F492686
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1295 | 537 | 1280 | 224 |
Family's Representative Sequence
| Representative Sequence | 3300053153|Ga0500616_0000001|Ga0500616_0000001_908860_909717 |
| Length | 275 |
| Sequence | VQCKNSKKCPAIAPGILFLRRRLQNGGRNNFAMTKQKSIWEEFEMSRVALVTGGTRGIGAAIAKALKTAGYKVAANYAGNDEAAQKFKAETGIPVFKWDVSSFEACEAGIKQVEAEVGPIDVLVNNAGITRDSQLHRMKPEQWSAVINTNLGSLFNMCRNVIEGMRTRKFGRIVNISSINYSAAKAGEIGFTKALAQESARSGITVNAICPGYINTEMVQAVPKDVLEKSILPLIPIGRLGEPEEIARCVVFLASDDAGLMTGSTLTANGGQYFT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 3 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 4 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 5 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 6 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 7 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 8 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 9 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 10 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 11 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 12 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 13 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 14 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 15 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 16 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 17 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 18 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 19 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 20 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 21 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 22 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 23 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 24 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 25 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 26 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 27 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 28 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 37 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 81 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 89 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 92 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 93 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 95 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 96 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 97 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 98 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 99 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 100 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 105 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 106 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 107 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 109 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 110 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 111 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 112 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 116 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 117 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 118 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 119 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 121 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 122 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 123 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 124 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 125 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 126 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 127 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 128 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 129 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 131 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 132 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 133 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 134 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 135 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 148 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 151 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 152 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 153 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 154 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 158 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 167 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 168 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 170 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 171 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 172 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 173 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 174 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 175 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 176 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 177 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 178 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 179 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 180 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 196 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 261 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 268 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 271 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 275 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 276 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 277 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 278 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 279 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 280 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 281 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 282 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 283 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 284 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 285 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 286 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 287 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 288 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 289 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 290 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 291 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 292 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 293 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 294 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 295 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 296 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 297 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 298 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 299 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 300 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 301 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 302 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 303 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 304 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 306 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 307 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 308 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 309 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 310 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 311 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 312 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 313 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 314 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 315 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 316 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 317 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 318 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 319 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 320 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 321 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 322 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 323 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 324 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 325 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 326 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 327 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 328 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 329 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 330 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 331 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 332 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 333 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 334 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 335 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 336 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 337 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 338 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 339 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 340 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 341 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 342 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 343 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 344 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 345 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 346 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 347 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 348 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 349 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 350 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 351 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 352 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 353 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 354 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 355 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 356 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 357 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 358 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 359 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 360 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 361 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 362 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 363 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 364 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 365 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 366 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 441 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 442 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 443 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 444 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 445 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 446 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 447 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 448 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 449 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 450 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 451 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 452 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 453 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 454 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 455 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 456 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 457 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 458 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 459 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 460 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 461 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 462 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 463 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 464 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 465 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 466 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 467 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 475 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 479 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 480 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 483 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 488 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 489 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 490 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 491 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 495 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 496 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 497 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 498 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 499 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 500 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 501 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 502 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 507 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 508 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 510 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 515 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 516 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 517 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 518 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 519 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 520 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 521 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 522 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 523 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 524 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 525 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 526 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 527 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 528 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 529 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 530 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 531 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 532 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 533 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 534 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 535 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 536 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 537 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.61 |
| Metatranscriptomes | 0.23 |
| Isolates | 1.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.19 |
| Nodule | 1.7 |
| Rhizoplane | 5.1 |
| Rhizosphere | 80.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c000003 | 3300000041 | Bacteria | 66110 |
| 2 | ARSoilYngRDRAFT_c00037 | 3300000042 | Bacteria | 21051 |
| 3 | ARcpr5yngRDRAFT_c000010 | 3300000043 | Bacteria | 36497 |
| 4 | ARSoilOldRDRAFT_c000114 | 3300000044 | Bacteria | 14136 |
| 5 | ARSoilOldRDRAFT_c002000 | 3300000044 | Bacteria | 1850 |
| 6 | ARCol0oldRDRAFT_c00094 | 3300000045 | Bacteria | 7532 |
| 7 | ARCol0yngRDRAFT_1000202 | 3300000652 | Bacteria | 10013 |
| 8 | JGI24749J21850_1004353 | 3300002076 | Bacteria | 1979 |
| 9 | JGI24034J26672_10034825 | 3300002239 | Bacteria | 831 |
| 10 | JGI25158J39367_1004631 | 3300002739 | Bacteria | 2057 |
| 11 | JGI25150J39212_1000171 | 3300002774 | Bacteria | 36637 |
| 12 | JGI25150J39212_1000433 | 3300002774 | Bacteria | 18809 |
| 13 | JGI25159J45721_1000017 | 3300002987 | Bacteria | 136127 |
| 14 | JGI25151J46595_10000034 | 3300003187 | Bacteria | 192271 |
| 15 | JGI25151J46595_10008877 | 3300003187 | Bacteria | 4801 |
| 16 | JGI25151J46595_10009621 | 3300003187 | Bacteria | 4560 |
| 17 | JGI25153J46596_10000673 | 3300003215 | Bacteria | 20907 |
| 18 | JGI25153J46596_10011382 | 3300003215 | Bacteria | 3935 |
| 19 | JGI25160J50197_1000027 | 3300003354 | Bacteria | 182809 |
| 20 | JGI25161J50226_1000160 | 3300003374 | Bacteria | 47045 |
| 21 | Ga0055524_1000782 | 3300003775 | Bacteria | 21292 |
| 22 | Ga0055536_1000711 | 3300003781 | Bacteria | 22317 |
| 23 | Ga0055530_10019826 | 3300003791 | Bacteria | 2027 |
| 24 | Ga0055531_10010747 | 3300003794 | Bacteria | 4506 |
| 25 | Ga0055543_1000030 | 3300004625 | Bacteria | 130849 |
| 26 | Ga0065165_1000122 | 3300005262 | Bacteria | 132524 |
| 27 | Ga0065704_10073674 | 3300005289 | Bacteria | 6900 |
| 28 | Ga0065712_10009067 | 3300005290 | Bacteria | 3377 |
| 29 | Ga0065712_10078443 | 3300005290 | Bacteria | 3347 |
| 30 | Ga0065707_10150122 | 3300005295 | Bacteria | 1668 |
| 31 | Ga0070658_10006314 | 3300005327 | Bacteria | 9600 |
| 32 | Ga0070658_10288976 | 3300005327 | Bacteria | 1397 |
| 33 | Ga0070676_10014503 | 3300005328 | Bacteria | 4333 |
| 34 | Ga0070683_100048470 | 3300005329 | Bacteria | 3928 |
| 35 | Ga0070683_100298148 | 3300005329 | Bacteria | 1533 |
| 36 | Ga0070690_100098133 | 3300005330 | Bacteria | 1939 |
| 37 | Ga0070690_100179140 | 3300005330 | Bacteria | 1463 |
| 38 | Ga0070670_100057539 | 3300005331 | Bacteria | 3337 |
| 39 | Ga0070677_10160182 | 3300005333 | Bacteria | 1055 |
| 40 | Ga0068869_100042291 | 3300005334 | Bacteria | 3266 |
| 41 | Ga0070666_10083329 | 3300005335 | Bacteria | 2187 |
| 42 | Ga0070680_100002836 | 3300005336 | Bacteria | 12877 |
| 43 | Ga0070680_100043291 | 3300005336 | Bacteria | 3657 |
| 44 | Ga0070680_100262573 | 3300005336 | Bacteria | 1461 |
| 45 | Ga0070680_100509879 | 3300005336 | Bacteria | 1029 |
| 46 | Ga0070660_100013941 | 3300005339 | Bacteria | 5783 |
| 47 | Ga0070660_100029666 | 3300005339 | Bacteria | 4101 |
| 48 | Ga0070660_100169739 | 3300005339 | Bacteria | 1761 |
| 49 | Ga0070687_100006984 | 3300005343 | Plasmid | 4671 |
| 50 | Ga0070687_100024918 | 3300005343 | Bacteria | 2864 |
| 51 | Ga0070687_100063265 | 3300005343 | Bacteria | 1962 |
| 52 | Ga0070661_100065654 | 3300005344 | Bacteria | 2666 |
| 53 | Ga0070661_100276399 | 3300005344 | Bacteria | 1302 |
| 54 | Ga0070668_100605437 | 3300005347 | Bacteria | 959 |
| 55 | Ga0070669_100143324 | 3300005353 | Bacteria | 1844 |
| 56 | Ga0070669_100350916 | 3300005353 | Bacteria | 1197 |
| 57 | Ga0070675_100106888 | 3300005354 | Bacteria | 2362 |
| 58 | Ga0070675_100118472 | 3300005354 | Bacteria | 2248 |
| 59 | Ga0070675_100167573 | 3300005354 | Bacteria | 1893 |
| 60 | Ga0070675_100299740 | 3300005354 | Bacteria | 1416 |
| 61 | Ga0070675_100526022 | 3300005354 | Bacteria | 1067 |
| 62 | Ga0070671_100027164 | 3300005355 | Bacteria | 4708 |
| 63 | Ga0070671_100039483 | 3300005355 | Bacteria | 3918 |
| 64 | Ga0070674_100013309 | 3300005356 | Bacteria | 5081 |
| 65 | Ga0070674_100097334 | 3300005356 | Bacteria | 2137 |
| 66 | Ga0070674_100135566 | 3300005356 | Bacteria | 1841 |
| 67 | Ga0070673_100016812 | 3300005364 | Bacteria | 5185 |
| 68 | Ga0070673_100046607 | 3300005364 | Bacteria | 3368 |
| 69 | Ga0070673_100067712 | 3300005364 | Bacteria | 2856 |
| 70 | Ga0070688_100007841 | 3300005365 | Bacteria | 5773 |
| 71 | Ga0070688_100022333 | 3300005365 | Bacteria | 3706 |
| 72 | Ga0070659_100054380 | 3300005366 | Bacteria | 3153 |
| 73 | Ga0070659_100236030 | 3300005366 | Bacteria | 1512 |
| 74 | Ga0070667_100014555 | 3300005367 | Bacteria | 6501 |
| 75 | Ga0070667_100275292 | 3300005367 | Bacteria | 1510 |
| 76 | Ga0070709_10013751 | 3300005434 | Bacteria | 4558 |
| 77 | Ga0070709_10251918 | 3300005434 | Bacteria | 1272 |
| 78 | Ga0070714_100081920 | 3300005435 | Bacteria | 2810 |
| 79 | Ga0070714_100122525 | 3300005435 | Bacteria | 2314 |
| 80 | Ga0070714_100681979 | 3300005435 | Bacteria | 991 |
| 81 | Ga0070713_100013740 | 3300005436 | Bacteria | 5987 |
| 82 | Ga0070713_100017477 | 3300005436 | Bacteria | 5425 |
| 83 | Ga0070713_100037681 | 3300005436 | Bacteria | 3910 |
| 84 | Ga0070713_100101051 | 3300005436 | Bacteria | 2498 |
| 85 | Ga0070713_100115215 | 3300005436 | Bacteria | 2349 |
| 86 | Ga0070713_100179817 | 3300005436 | Bacteria | 1900 |
| 87 | Ga0070713_100549168 | 3300005436 | Bacteria | 1094 |
| 88 | Ga0070710_10021576 | 3300005437 | Bacteria | 3358 |
| 89 | Ga0070710_10047902 | 3300005437 | Bacteria | 2386 |
| 90 | Ga0070710_10334790 | 3300005437 | Bacteria | 997 |
| 91 | Ga0070710_10409533 | 3300005437 | Bacteria | 911 |
| 92 | Ga0070701_10019213 | 3300005438 | Bacteria | 3225 |
| 93 | Ga0070701_10033348 | 3300005438 | Bacteria | 2572 |
| 94 | Ga0070711_100088519 | 3300005439 | Bacteria | 2225 |
| 95 | Ga0070711_100141673 | 3300005439 | Bacteria | 1803 |
| 96 | Ga0070711_100164775 | 3300005439 | Bacteria | 1684 |
| 97 | Ga0070711_100181748 | 3300005439 | Bacteria | 1610 |
| 98 | Ga0070705_100054445 | 3300005440 | Bacteria | 2347 |
| 99 | Ga0070705_100381993 | 3300005440 | Bacteria | 1037 |
| 100 | Ga0070700_100178583 | 3300005441 | Bacteria | 1475 |
| 101 | Ga0070708_100026124 | 3300005445 | Bacteria | 4995 |
| 102 | Ga0070663_100098827 | 3300005455 | Bacteria | 2175 |
| 103 | Ga0070663_100116276 | 3300005455 | Bacteria | 2015 |
| 104 | Ga0070678_100072545 | 3300005456 | Bacteria | 2581 |
| 105 | Ga0070678_100239338 | 3300005456 | Bacteria | 1517 |
| 106 | Ga0070662_100037740 | 3300005457 | Bacteria | 3427 |
| 107 | Ga0070662_100143904 | 3300005457 | Bacteria | 1850 |
| 108 | Ga0070662_100456839 | 3300005457 | Bacteria | 1061 |
| 109 | Ga0070681_10078648 | 3300005458 | Bacteria | 3254 |
| 110 | Ga0070681_10105326 | 3300005458 | Bacteria | 2762 |
| 111 | Ga0070681_10368448 | 3300005458 | Bacteria | 1347 |
| 112 | Ga0068867_100027781 | 3300005459 | Bacteria | 4070 |
| 113 | Ga0068867_100070345 | 3300005459 | Bacteria | 2616 |
| 114 | Ga0068867_100596314 | 3300005459 | Bacteria | 963 |
| 115 | Ga0070685_10003855 | 3300005466 | Bacteria | 7587 |
| 116 | Ga0070685_10006441 | 3300005466 | Bacteria | 5988 |
| 117 | Ga0070685_10105298 | 3300005466 | Bacteria | 1728 |
| 118 | Ga0070707_100217959 | 3300005468 | Bacteria | 1859 |
| 119 | Ga0070698_100138896 | 3300005471 | Bacteria | 2383 |
| 120 | Ga0070699_100106603 | 3300005518 | Bacteria | 2458 |
| 121 | Ga0070679_100042577 | 3300005530 | Bacteria | 4523 |
| 122 | Ga0070679_100112073 | 3300005530 | Bacteria | 2714 |
| 123 | Ga0070679_100221983 | 3300005530 | Bacteria | 1851 |
| 124 | Ga0070679_100545260 | 3300005530 | Bacteria | 1103 |
| 125 | Ga0070684_100044013 | 3300005535 | Bacteria | 3859 |
| 126 | Ga0070697_100202527 | 3300005536 | Bacteria | 1687 |
| 127 | Ga0068853_100502907 | 3300005539 | Bacteria | 1144 |
| 128 | Ga0070672_100798134 | 3300005543 | Bacteria | 830 |
| 129 | Ga0070686_100018983 | 3300005544 | Bacteria | 4046 |
| 130 | Ga0070695_100404566 | 3300005545 | Bacteria | 1036 |
| 131 | Ga0070696_100129398 | 3300005546 | Bacteria | 1835 |
| 132 | Ga0070696_100173830 | 3300005546 | Bacteria | 1594 |
| 133 | Ga0070693_100078684 | 3300005547 | Bacteria | 1960 |
| 134 | Ga0070693_100092445 | 3300005547 | Bacteria | 1827 |
| 135 | Ga0070665_100006101 | 3300005548 | Bacteria | 12320 |
| 136 | Ga0070665_100582611 | 3300005548 | Bacteria | 1132 |
| 137 | Ga0070665_100609835 | 3300005548 | Bacteria | 1104 |
| 138 | Ga0070704_100180226 | 3300005549 | Bacteria | 1689 |
| 139 | Ga0068855_100048582 | 3300005563 | Bacteria | 5007 |
| 140 | Ga0068855_100108304 | 3300005563 | Bacteria | 3191 |
| 141 | Ga0068855_100157729 | 3300005563 | Bacteria | 2577 |
| 142 | Ga0068855_100217262 | 3300005563 | Bacteria | 2145 |
| 143 | Ga0070664_100146232 | 3300005564 | Bacteria | 2085 |
| 144 | Ga0068857_100359504 | 3300005577 | Bacteria | 1349 |
| 145 | Ga0068854_100331354 | 3300005578 | Bacteria | 1240 |
| 146 | Ga0068856_100318837 | 3300005614 | Bacteria | 1572 |
| 147 | Ga0068856_100824585 | 3300005614 | Bacteria | 947 |
| 148 | Ga0070702_100483937 | 3300005615 | Bacteria | 905 |
| 149 | Ga0068852_100051991 | 3300005616 | Bacteria | 3519 |
| 150 | Ga0068852_100052192 | 3300005616 | Bacteria | 3513 |
| 151 | Ga0068852_100057208 | 3300005616 | Bacteria | 3373 |
| 152 | Ga0068852_100163143 | 3300005616 | Bacteria | 2082 |
| 153 | Ga0068859_100017208 | 3300005617 | Bacteria | 7259 |
| 154 | Ga0068859_100130968 | 3300005617 | Bacteria | 2580 |
| 155 | Ga0068859_100194167 | 3300005617 | Bacteria | 2114 |
| 156 | Ga0068859_100596542 | 3300005617 | Bacteria | 1198 |
| 157 | Ga0068864_100037945 | 3300005618 | Bacteria | 4112 |
| 158 | Ga0068864_100144389 | 3300005618 | Bacteria | 2150 |
| 159 | Ga0068866_10045382 | 3300005718 | Bacteria | 2204 |
| 160 | Ga0068861_100007388 | 3300005719 | Bacteria | 7528 |
| 161 | Ga0068861_100053737 | 3300005719 | Bacteria | 3066 |
| 162 | Ga0068851_10006192 | 3300005834 | Bacteria | 5462 |
| 163 | Ga0068851_10051665 | 3300005834 | Bacteria | 2089 |
| 164 | Ga0068851_10181466 | 3300005834 | Bacteria | 1166 |
| 165 | Ga0068870_10021003 | 3300005840 | Bacteria | 3188 |
| 166 | Ga0068863_100017793 | 3300005841 | Bacteria | 6802 |
| 167 | Ga0068858_100226731 | 3300005842 | Bacteria | 1771 |
| 168 | Ga0068858_100444807 | 3300005842 | Bacteria | 1248 |
| 169 | Ga0068860_100055931 | 3300005843 | Bacteria | 3751 |
| 170 | Ga0068860_100571721 | 3300005843 | Bacteria | 1134 |
| 171 | Ga0068860_100728360 | 3300005843 | Bacteria | 1002 |
| 172 | Ga0068862_100007073 | 3300005844 | Bacteria | 9318 |
| 173 | Ga0068862_100021405 | 3300005844 | Bacteria | 5402 |
| 174 | Ga0081455_10001108 | 3300005937 | Bacteria | 33842 |
| 175 | Ga0081540_1003343 | 3300005983 | Bacteria | 12715 |
| 176 | Ga0081540_1017391 | 3300005983 | Bacteria | 4453 |
| 177 | Ga0081540_1074291 | 3300005983 | Bacteria | 1558 |
| 178 | Ga0070717_10035744 | 3300006028 | Bacteria | 4025 |
| 179 | Ga0070717_10049830 | 3300006028 | Bacteria | 3439 |
| 180 | Ga0070717_10056608 | 3300006028 | Bacteria | 3240 |
| 181 | Ga0070717_10057481 | 3300006028 | Bacteria | 3215 |
| 182 | Ga0070717_10080726 | 3300006028 | Bacteria | 2729 |
| 183 | Ga0070717_10127131 | 3300006028 | Bacteria | 2189 |
| 184 | Ga0070717_10189664 | 3300006028 | Bacteria | 1796 |
| 185 | Ga0070717_10359769 | 3300006028 | Bacteria | 1302 |
| 186 | Ga0075365_10001359 | 3300006038 | Bacteria | 10973 |
| 187 | Ga0075365_10002417 | 3300006038 | Bacteria | 9150 |
| 188 | Ga0075365_10224602 | 3300006038 | Bacteria | 1318 |
| 189 | Ga0075368_10099462 | 3300006042 | Bacteria | 1193 |
| 190 | Ga0075363_100038942 | 3300006048 | Bacteria | 2501 |
| 191 | Ga0075363_100143393 | 3300006048 | Bacteria | 1346 |
| 192 | Ga0075363_100176382 | 3300006048 | Bacteria | 1215 |
| 193 | Ga0075364_10091048 | 3300006051 | Bacteria | 2023 |
| 194 | Ga0075364_10158611 | 3300006051 | Bacteria | 1527 |
| 195 | Ga0075364_10220641 | 3300006051 | Bacteria | 1287 |
| 196 | Ga0075364_10366452 | 3300006051 | Bacteria | 982 |
| 197 | Ga0070715_10004118 | 3300006163 | Bacteria | 4726 |
| 198 | Ga0070715_10113237 | 3300006163 | Bacteria | 1283 |
| 199 | Ga0070715_10138731 | 3300006163 | Bacteria | 1178 |
| 200 | Ga0070715_10331504 | 3300006163 | Bacteria | 825 |
| 201 | Ga0070716_100003919 | 3300006173 | Bacteria | 7070 |
| 202 | Ga0070716_100027329 | 3300006173 | Bacteria | 3064 |
| 203 | Ga0070712_100009184 | 3300006175 | Bacteria | 6227 |
| 204 | Ga0075362_10114499 | 3300006177 | Bacteria | 1272 |
| 205 | Ga0075367_10045574 | 3300006178 | Bacteria | 2573 |
| 206 | Ga0075367_10101821 | 3300006178 | Bacteria | 1756 |
| 207 | Ga0075367_10190180 | 3300006178 | Bacteria | 1281 |
| 208 | Ga0075367_10213346 | 3300006178 | Bacteria | 1207 |
| 209 | Ga0075369_10111023 | 3300006186 | Bacteria | 1236 |
| 210 | Ga0075366_10056646 | 3300006195 | Bacteria | 2328 |
| 211 | Ga0075366_10058954 | 3300006195 | Bacteria | 2280 |
| 212 | Ga0075366_10097265 | 3300006195 | Bacteria | 1765 |
| 213 | Ga0075366_10297632 | 3300006195 | Bacteria | 987 |
| 214 | Ga0097621_100027391 | 3300006237 | Bacteria | 4481 |
| 215 | Ga0097621_100309610 | 3300006237 | Bacteria | 1397 |
| 216 | Ga0097621_100463884 | 3300006237 | Bacteria | 1143 |
| 217 | Ga0075370_10110717 | 3300006353 | Bacteria | 1595 |
| 218 | Ga0075370_10246794 | 3300006353 | Bacteria | 1058 |
| 219 | Ga0075370_10325211 | 3300006353 | Bacteria | 916 |
| 220 | Ga0068871_100015006 | 3300006358 | Bacteria | 5793 |
| 221 | Ga0068871_100026947 | 3300006358 | Bacteria | 4490 |
| 222 | Ga0068871_100155111 | 3300006358 | Bacteria | 1955 |
| 223 | Ga0075428_100037884 | 3300006844 | Bacteria | 5306 |
| 224 | Ga0075430_100000387 | 3300006846 | Bacteria | 32406 |
| 225 | Ga0075430_100008653 | 3300006846 | Bacteria | 8585 |
| 226 | Ga0075431_100201902 | 3300006847 | Bacteria | 2034 |
| 227 | Ga0075431_100358218 | 3300006847 | Bacteria | 1466 |
| 228 | Ga0075433_10086392 | 3300006852 | Bacteria | 2769 |
| 229 | Ga0075434_100064484 | 3300006871 | Bacteria | 3647 |
| 230 | Ga0075434_100116001 | 3300006871 | Bacteria | 2691 |
| 231 | Ga0075434_100243841 | 3300006871 | Bacteria | 1817 |
| 232 | Ga0075434_100310082 | 3300006871 | Bacteria | 1598 |
| 233 | Ga0075434_100455406 | 3300006871 | Bacteria | 1301 |
| 234 | Ga0075434_100898291 | 3300006871 | Bacteria | 901 |
| 235 | Ga0068865_100079145 | 3300006881 | Bacteria | 2353 |
| 236 | Ga0068865_100203962 | 3300006881 | Bacteria | 1536 |
| 237 | Ga0068865_100240253 | 3300006881 | Bacteria | 1425 |
| 238 | Ga0075436_100002454 | 3300006914 | Bacteria | 12758 |
| 239 | Ga0075436_100202613 | 3300006914 | Bacteria | 1406 |
| 240 | Ga0097620_100017208 | 3300006931 | Bacteria | 7259 |
| 241 | Ga0097620_100130968 | 3300006931 | Bacteria | 2580 |
| 242 | Ga0097620_100194159 | 3300006931 | Bacteria | 2114 |
| 243 | Ga0097620_100596471 | 3300006931 | Bacteria | 1198 |
| 244 | Ga0079104_1009515 | 3300006946 | Bacteria | 3284 |
| 245 | Ga0079104_1010076 | 3300006946 | Bacteria | 3143 |
| 246 | Ga0099826_10107837 | 3300006948 | Bacteria | 1665 |
| 247 | Ga0075435_100029369 | 3300007076 | Bacteria | 4314 |
| 248 | Ga0075435_100143724 | 3300007076 | Bacteria | 2003 |
| 249 | Ga0075435_100171625 | 3300007076 | Bacteria | 1830 |
| 250 | Ga0075435_100296022 | 3300007076 | Bacteria | 1383 |
| 251 | Ga0099794_10007856 | 3300007265 | Bacteria | 4405 |
| 252 | Ga0099795_10042556 | 3300007788 | Bacteria | 1622 |
| 253 | Ga0105251_10036311 | 3300009011 | Bacteria | 2426 |
| 254 | Ga0105240_10304316 | 3300009093 | Bacteria | 1823 |
| 255 | Ga0111539_10001645 | 3300009094 | Bacteria | 29839 |
| 256 | Ga0111539_10109798 | 3300009094 | Bacteria | 3237 |
| 257 | Ga0111539_10130687 | 3300009094 | Bacteria | 2940 |
| 258 | Ga0111539_10336041 | 3300009094 | Bacteria | 1758 |
| 259 | Ga0111539_10503355 | 3300009094 | Bacteria | 1411 |
| 260 | Ga0105245_10007083 | 3300009098 | Bacteria | 9838 |
| 261 | Ga0105245_10046875 | 3300009098 | Bacteria | 3862 |
| 262 | Ga0114129_10016241 | 3300009147 | Bacteria | 10593 |
| 263 | Ga0114129_10040156 | 3300009147 | Bacteria | 6597 |
| 264 | Ga0114129_10479400 | 3300009147 | Bacteria | 1628 |
| 265 | Ga0114129_10586916 | 3300009147 | Bacteria | 1445 |
| 266 | Ga0105243_10010687 | 3300009148 | Bacteria | 6958 |
| 267 | Ga0105243_10019915 | 3300009148 | Bacteria | 5087 |
| 268 | Ga0105241_10007122 | 3300009174 | Bacteria | 8234 |
| 269 | Ga0105241_10325777 | 3300009174 | Bacteria | 1326 |
| 270 | Ga0105242_10028564 | 3300009176 | Bacteria | 4443 |
| 271 | Ga0105242_10859882 | 3300009176 | Bacteria | 903 |
| 272 | Ga0105242_11165972 | 3300009176 | Bacteria | 788 |
| 273 | Ga0105248_10024110 | 3300009177 | Bacteria | 6762 |
| 274 | Ga0105237_10051335 | 3300009545 | Bacteria | 4142 |
| 275 | Ga0105238_10027892 | 3300009551 | Bacteria | 5754 |
| 276 | Ga0105238_10103323 | 3300009551 | Bacteria | 2831 |
| 277 | Ga0105238_10105024 | 3300009551 | Bacteria | 2806 |
| 278 | Ga0105249_10049209 | 3300009553 | Bacteria | 3844 |
| 279 | Ga0105249_10212603 | 3300009553 | Bacteria | 1899 |
| 280 | Ga0099796_10000988 | 3300010159 | Bacteria | 5342 |
| 281 | Ga0105239_10058907 | 3300010375 | Bacteria | 4215 |
| 282 | Ga0105246_10491139 | 3300011119 | Bacteria | 1041 |
| 283 | Ga0157320_1000901 | 3300012481 | Bacteria | 1358 |
| 284 | Ga0157323_1001518 | 3300012495 | Bacteria | 1176 |
| 285 | Ga0157323_1005307 | 3300012495 | Bacteria | 858 |
| 286 | Ga0157342_1000875 | 3300012507 | Bacteria | 2046 |
| 287 | Ga0157326_1004618 | 3300012513 | Bacteria | 1451 |
| 288 | Ga0157371_10104933 | 3300013102 | Bacteria | 2005 |
| 289 | Ga0157371_10532723 | 3300013102 | Bacteria | 869 |
| 290 | Ga0157370_10126008 | 3300013104 | Bacteria | 2390 |
| 291 | Ga0157369_10222684 | 3300013105 | Bacteria | 1974 |
| 292 | Ga0157369_10380314 | 3300013105 | Bacteria | 1465 |
| 293 | Ga0171463_1004 | 3300013249 | Bacteria | 437207 |
| 294 | Ga0157378_10031786 | 3300013297 | Bacteria | 4662 |
| 295 | Ga0157378_10084666 | 3300013297 | Bacteria | 2871 |
| 296 | Ga0157378_10333822 | 3300013297 | Bacteria | 1476 |
| 297 | Ga0157378_10873672 | 3300013297 | Bacteria | 929 |
| 298 | Ga0163162_10178252 | 3300013306 | Bacteria | 2251 |
| 299 | Ga0163162_10437877 | 3300013306 | Bacteria | 1439 |
| 300 | Ga0163162_10451086 | 3300013306 | Bacteria | 1418 |
| 301 | Ga0157372_10111381 | 3300013307 | Bacteria | 3136 |
| 302 | Ga0157375_10138524 | 3300013308 | Bacteria | 2559 |
| 303 | Ga0157375_10580574 | 3300013308 | Bacteria | 1281 |
| 304 | Ga0157380_10040992 | 3300014326 | Bacteria | 3611 |
| 305 | Ga0157380_10323571 | 3300014326 | Bacteria | 1431 |
| 306 | Ga0157377_10093540 | 3300014745 | Bacteria | 1779 |
| 307 | Ga0157379_10572503 | 3300014968 | Bacteria | 1052 |
| 308 | Ga0157376_10222589 | 3300014969 | Bacteria | 1749 |
| 309 | Ga0182007_10035892 | 3300015262 | Bacteria | 1670 |
| 310 | Ga0183363_1290 | 3300015690 | Bacteria | 7203 |
| 311 | Ga0163161_10063750 | 3300017792 | Bacteria | 2687 |
| 312 | Ga0163161_10696976 | 3300017792 | Bacteria | 845 |
| 313 | Ga0214544_1000087 | 3300021320 | Bacteria | 119600 |
| 314 | Ga0214542_1000018 | 3300021321 | Bacteria | 202226 |
| 315 | Ga0214545_1000009 | 3300021324 | Bacteria | 202915 |
| 316 | Ga0214543_1000037 | 3300021327 | Bacteria | 182113 |
| 317 | Ga0213872_10000703 | 3300021361 | Bacteria | 25156 |
| 318 | Ga0213872_10106770 | 3300021361 | Bacteria | 1245 |
| 319 | Ga0213874_10057809 | 3300021377 | Bacteria | 1207 |
| 320 | Ga0213874_10068712 | 3300021377 | Bacteria | 1125 |
| 321 | Ga0213874_10076317 | 3300021377 | Bacteria | 1078 |
| 322 | Ga0213876_10006896 | 3300021384 | Bacteria | 6192 |
| 323 | Ga0213876_10101221 | 3300021384 | Bacteria | 1528 |
| 324 | Ga0224712_10059476 | 3300022467 | Bacteria | 1517 |
| 325 | Ga0228711_1000004 | 3300022739 | Bacteria | 250146 |
| 326 | Ga0228710_1000002 | 3300022740 | Bacteria | 287279 |
| 327 | Ga0228598_1000875 | 3300024227 | Bacteria | 6508 |
| 328 | Ga0209436_101378 | 3300025208 | Bacteria | 8579 |
| 329 | Ga0209437_111240 | 3300025233 | Bacteria | 1343 |
| 330 | Ga0207425_1000035 | 3300025245 | Bacteria | 225942 |
| 331 | Ga0209677_100265 | 3300025253 | Bacteria | 35526 |
| 332 | Ga0209148_1016880 | 3300025254 | Bacteria | 1249 |
| 333 | Ga0209129_1000029 | 3300025258 | Bacteria | 401149 |
| 334 | Ga0209233_1000255 | 3300025261 | Bacteria | 82230 |
| 335 | Ga0209233_1007650 | 3300025261 | Bacteria | 3405 |
| 336 | Ga0209233_1015962 | 3300025261 | Bacteria | 2078 |
| 337 | Ga0209455_1003697 | 3300025272 | Bacteria | 5294 |
| 338 | Ga0209673_1025959 | 3300025273 | Bacteria | 1936 |
| 339 | Ga0209130_1000027 | 3300025284 | Bacteria | 327700 |
| 340 | Ga0209676_1000956 | 3300025292 | Bacteria | 35128 |
| 341 | Ga0209025_1000042 | 3300025294 | Bacteria | 370577 |
| 342 | Ga0209025_1000132 | 3300025294 | Bacteria | 197432 |
| 343 | Ga0209025_1000591 | 3300025294 | Bacteria | 65471 |
| 344 | Ga0209564_1000193 | 3300025295 | Bacteria | 141731 |
| 345 | Ga0209758_1000255 | 3300025297 | Bacteria | 106892 |
| 346 | Ga0209758_1000430 | 3300025297 | Bacteria | 71132 |
| 347 | Ga0209758_1002586 | 3300025297 | Bacteria | 18151 |
| 348 | Ga0209758_1018161 | 3300025297 | Bacteria | 3464 |
| 349 | Ga0209050_1000572 | 3300025298 | Bacteria | 59716 |
| 350 | Ga0209256_1010178 | 3300025299 | Bacteria | 3982 |
| 351 | Ga0209256_1012263 | 3300025299 | Bacteria | 3309 |
| 352 | Ga0209256_1054962 | 3300025299 | Bacteria | 947 |
| 353 | Ga0207426_1000072 | 3300025302 | Bacteria | 327700 |
| 354 | Ga0207426_1027720 | 3300025302 | Bacteria | 1884 |
| 355 | Ga0207426_1065481 | 3300025302 | Bacteria | 1030 |
| 356 | Ga0209051_1020024 | 3300025303 | Bacteria | 2900 |
| 357 | Ga0209257_1001382 | 3300025304 | Bacteria | 29095 |
| 358 | Ga0207697_10070204 | 3300025315 | Bacteria | 1467 |
| 359 | Ga0207713_1034320 | 3300025735 | Bacteria | 2205 |
| 360 | Ga0207653_10022402 | 3300025885 | Bacteria | 2006 |
| 361 | Ga0207692_10004710 | 3300025898 | Bacteria | 5414 |
| 362 | Ga0207692_10022673 | 3300025898 | Bacteria | 2893 |
| 363 | Ga0207692_10092058 | 3300025898 | Bacteria | 1646 |
| 364 | Ga0207642_10007393 | 3300025899 | Bacteria | 3709 |
| 365 | Ga0207710_10001892 | 3300025900 | Bacteria | 10045 |
| 366 | Ga0207680_10031159 | 3300025903 | Bacteria | 3018 |
| 367 | Ga0207647_10065556 | 3300025904 | Bacteria | 2204 |
| 368 | Ga0207685_10001418 | 3300025905 | Bacteria | 5005 |
| 369 | Ga0207685_10004693 | 3300025905 | Bacteria | 3511 |
| 370 | Ga0207685_10227456 | 3300025905 | Bacteria | 890 |
| 371 | Ga0207699_10011151 | 3300025906 | Bacteria | 4529 |
| 372 | Ga0207699_10326631 | 3300025906 | Bacteria | 1078 |
| 373 | Ga0207699_10446266 | 3300025906 | Bacteria | 927 |
| 374 | Ga0207645_10010546 | 3300025907 | Bacteria | 6345 |
| 375 | Ga0207643_10000613 | 3300025908 | Bacteria | 22494 |
| 376 | Ga0207705_10048689 | 3300025909 | Bacteria | 3049 |
| 377 | Ga0207705_10180181 | 3300025909 | Bacteria | 1594 |
| 378 | Ga0207684_10033976 | 3300025910 | Bacteria | 4336 |
| 379 | Ga0207654_10037526 | 3300025911 | Bacteria | 2713 |
| 380 | Ga0207654_10320467 | 3300025911 | Bacteria | 1059 |
| 381 | Ga0207707_10060719 | 3300025912 | Bacteria | 3288 |
| 382 | Ga0207707_10363668 | 3300025912 | Bacteria | 1245 |
| 383 | Ga0207695_10000044 | 3300025913 | Bacteria | 440819 |
| 384 | Ga0207671_10000043 | 3300025914 | Bacteria | 206915 |
| 385 | Ga0207671_10057435 | 3300025914 | Bacteria | 2884 |
| 386 | Ga0207693_10022575 | 3300025915 | Bacteria | 5000 |
| 387 | Ga0207693_10083746 | 3300025915 | Bacteria | 2498 |
| 388 | Ga0207663_10019794 | 3300025916 | Bacteria | 3799 |
| 389 | Ga0207663_10089420 | 3300025916 | Bacteria | 2039 |
| 390 | Ga0207660_10011260 | 3300025917 | Bacteria | 5817 |
| 391 | Ga0207662_10093154 | 3300025918 | Bacteria | 1856 |
| 392 | Ga0207662_10096897 | 3300025918 | Bacteria | 1823 |
| 393 | Ga0207657_10015839 | 3300025919 | Bacteria | 7285 |
| 394 | Ga0207657_10025505 | 3300025919 | Bacteria | 5450 |
| 395 | Ga0207657_10092257 | 3300025919 | Bacteria | 2524 |
| 396 | Ga0207649_10152002 | 3300025920 | Bacteria | 1595 |
| 397 | Ga0207649_10307614 | 3300025920 | Bacteria | 1161 |
| 398 | Ga0207649_10373945 | 3300025920 | Bacteria | 1060 |
| 399 | Ga0207652_10253084 | 3300025921 | Bacteria | 1588 |
| 400 | Ga0207652_10308290 | 3300025921 | Bacteria | 1429 |
| 401 | Ga0207652_10562239 | 3300025921 | Bacteria | 1024 |
| 402 | Ga0207652_10689166 | 3300025921 | Bacteria | 912 |
| 403 | Ga0207646_10065889 | 3300025922 | Bacteria | 3233 |
| 404 | Ga0207681_10736860 | 3300025923 | Bacteria | 821 |
| 405 | Ga0207694_10024893 | 3300025924 | Bacteria | 4546 |
| 406 | Ga0207694_10487270 | 3300025924 | Bacteria | 1032 |
| 407 | Ga0207650_10002443 | 3300025925 | Bacteria | 12941 |
| 408 | Ga0207650_10037723 | 3300025925 | Bacteria | 3523 |
| 409 | Ga0207659_10157313 | 3300025926 | Bacteria | 1781 |
| 410 | Ga0207659_10661015 | 3300025926 | Bacteria | 893 |
| 411 | Ga0207687_10019823 | 3300025927 | Bacteria | 4460 |
| 412 | Ga0207687_10021525 | 3300025927 | Bacteria | 4285 |
| 413 | Ga0207700_10006313 | 3300025928 | Bacteria | 7151 |
| 414 | Ga0207700_10007976 | 3300025928 | Bacteria | 6520 |
| 415 | Ga0207700_10033806 | 3300025928 | Bacteria | 3662 |
| 416 | Ga0207700_10075251 | 3300025928 | Bacteria | 2616 |
| 417 | Ga0207700_10093294 | 3300025928 | Bacteria | 2382 |
| 418 | Ga0207700_10165505 | 3300025928 | Bacteria | 1840 |
| 419 | Ga0207700_10290320 | 3300025928 | Bacteria | 1409 |
| 420 | Ga0207700_10295244 | 3300025928 | Bacteria | 1398 |
| 421 | Ga0207700_10522858 | 3300025928 | Bacteria | 1051 |
| 422 | Ga0207664_10018710 | 3300025929 | Bacteria | 5107 |
| 423 | Ga0207664_10107314 | 3300025929 | Bacteria | 2316 |
| 424 | Ga0207664_10132028 | 3300025929 | Bacteria | 2103 |
| 425 | Ga0207664_10310075 | 3300025929 | Bacteria | 1390 |
| 426 | Ga0207664_10630357 | 3300025929 | Bacteria | 963 |
| 427 | Ga0207644_10017503 | 3300025931 | Bacteria | 4841 |
| 428 | Ga0207644_10183935 | 3300025931 | Bacteria | 1639 |
| 429 | Ga0207690_10091710 | 3300025932 | Bacteria | 2148 |
| 430 | Ga0207706_10008654 | 3300025933 | Bacteria | 9376 |
| 431 | Ga0207706_10095800 | 3300025933 | Bacteria | 2610 |
| 432 | Ga0207686_10010210 | 3300025934 | Bacteria | 5106 |
| 433 | Ga0207686_10181464 | 3300025934 | Bacteria | 1493 |
| 434 | Ga0207709_10016990 | 3300025935 | Bacteria | 4055 |
| 435 | Ga0207670_10076632 | 3300025936 | Bacteria | 2327 |
| 436 | Ga0207669_10003551 | 3300025937 | Bacteria | 6754 |
| 437 | Ga0207669_10247152 | 3300025937 | Bacteria | 1326 |
| 438 | Ga0207669_10317259 | 3300025937 | Bacteria | 1191 |
| 439 | Ga0207669_10580931 | 3300025937 | Bacteria | 908 |
| 440 | Ga0207704_10019430 | 3300025938 | Bacteria | 3568 |
| 441 | Ga0207704_10166503 | 3300025938 | Bacteria | 1575 |
| 442 | Ga0207704_10337409 | 3300025938 | Bacteria | 1169 |
| 443 | Ga0207665_10000117 | 3300025939 | Bacteria | 52204 |
| 444 | Ga0207665_10000210 | 3300025939 | Bacteria | 39483 |
| 445 | Ga0207665_10036842 | 3300025939 | Bacteria | 3254 |
| 446 | Ga0207665_10104873 | 3300025939 | Bacteria | 1979 |
| 447 | Ga0207691_10133928 | 3300025940 | Bacteria | 2187 |
| 448 | Ga0207711_10010865 | 3300025941 | Bacteria | 7567 |
| 449 | Ga0207711_10013853 | 3300025941 | Bacteria | 6697 |
| 450 | Ga0207689_10012163 | 3300025942 | Bacteria | 7365 |
| 451 | Ga0207689_10160808 | 3300025942 | Bacteria | 1850 |
| 452 | Ga0207661_10163247 | 3300025944 | Bacteria | 1934 |
| 453 | Ga0207661_10266857 | 3300025944 | Bacteria | 1526 |
| 454 | Ga0207679_10025554 | 3300025945 | Bacteria | 4063 |
| 455 | Ga0207679_10127977 | 3300025945 | Bacteria | 2033 |
| 456 | Ga0207679_10189976 | 3300025945 | Bacteria | 1707 |
| 457 | Ga0207667_10136980 | 3300025949 | Bacteria | 2521 |
| 458 | Ga0207667_10186932 | 3300025949 | Bacteria | 2126 |
| 459 | Ga0207667_10401627 | 3300025949 | Bacteria | 1395 |
| 460 | Ga0207651_10104736 | 3300025960 | Bacteria | 2108 |
| 461 | Ga0207651_10171172 | 3300025960 | Bacteria | 1713 |
| 462 | Ga0207651_10223690 | 3300025960 | Bacteria | 1523 |
| 463 | Ga0207712_10056760 | 3300025961 | Bacteria | 2759 |
| 464 | Ga0207712_10258379 | 3300025961 | Bacteria | 1411 |
| 465 | Ga0207712_10510485 | 3300025961 | Bacteria | 1029 |
| 466 | Ga0207658_10055410 | 3300025986 | Bacteria | 2938 |
| 467 | Ga0207658_10094692 | 3300025986 | Bacteria | 2325 |
| 468 | Ga0207658_10130185 | 3300025986 | Bacteria | 2020 |
| 469 | Ga0207658_10176656 | 3300025986 | Bacteria | 1764 |
| 470 | Ga0207658_10204159 | 3300025986 | Bacteria | 1652 |
| 471 | Ga0207658_10344464 | 3300025986 | Bacteria | 1296 |
| 472 | Ga0207703_10035397 | 3300026035 | Bacteria | 3968 |
| 473 | Ga0207703_10248110 | 3300026035 | Bacteria | 1603 |
| 474 | Ga0207678_10008960 | 3300026067 | Bacteria | 8806 |
| 475 | Ga0207678_10024906 | 3300026067 | Bacteria | 5225 |
| 476 | Ga0207708_10025996 | 3300026075 | Bacteria | 4429 |
| 477 | Ga0207641_10023568 | 3300026088 | Bacteria | 5069 |
| 478 | Ga0207641_10287063 | 3300026088 | Bacteria | 1550 |
| 479 | Ga0207648_10040324 | 3300026089 | Bacteria | 4104 |
| 480 | Ga0207648_10612286 | 3300026089 | Bacteria | 1004 |
| 481 | Ga0207676_10009273 | 3300026095 | Bacteria | 7001 |
| 482 | Ga0207676_10070676 | 3300026095 | Bacteria | 2800 |
| 483 | Ga0207674_10202399 | 3300026116 | Bacteria | 1935 |
| 484 | Ga0207674_10205934 | 3300026116 | Bacteria | 1916 |
| 485 | Ga0207675_100031108 | 3300026118 | Bacteria | 4970 |
| 486 | Ga0207675_100670225 | 3300026118 | Bacteria | 1044 |
| 487 | Ga0207683_10008834 | 3300026121 | Bacteria | 8594 |
| 488 | Ga0207698_10040894 | 3300026142 | Bacteria | 3450 |
| 489 | Ga0207698_10206211 | 3300026142 | Bacteria | 1765 |
| 490 | Ga0207698_10448262 | 3300026142 | Bacteria | 1245 |
| 491 | Ga0209281_1000030 | 3300027111 | Bacteria | 425931 |
| 492 | Ga0209281_1000144 | 3300027111 | Bacteria | 172471 |
| 493 | Ga0209371_1027003 | 3300027312 | Bacteria | 1298 |
| 494 | Ga0209981_1011464 | 3300027378 | Bacteria | 1222 |
| 495 | Ga0209179_1000861 | 3300027512 | Bacteria | 3376 |
| 496 | Ga0209999_1016117 | 3300027543 | Bacteria | 1360 |
| 497 | Ga0209982_1019550 | 3300027552 | Bacteria | 1038 |
| 498 | Ga0209983_1030478 | 3300027665 | Bacteria | 1148 |
| 499 | Ga0209282_1000004 | 3300027666 | Bacteria | 425931 |
| 500 | Ga0209971_1019044 | 3300027682 | Bacteria | 1630 |
| 501 | Ga0209966_1000738 | 3300027695 | Bacteria | 6827 |
| 502 | Ga0209966_1013935 | 3300027695 | Bacteria | 1495 |
| 503 | Ga0207428_10099113 | 3300027907 | Bacteria | 2253 |
| 504 | Ga0268266_10016289 | 3300028379 | Bacteria | 6354 |
| 505 | Ga0268266_10018885 | 3300028379 | Bacteria | 5873 |
| 506 | Ga0268265_10082764 | 3300028380 | Bacteria | 2539 |
| 507 | Ga0268265_10092590 | 3300028380 | Bacteria | 2420 |
| 508 | Ga0268264_10024794 | 3300028381 | Bacteria | 4898 |
| 509 | Ga0268264_10529318 | 3300028381 | Bacteria | 1153 |
| 510 | Ga0265337_1036207 | 3300028556 | Bacteria | 1442 |
| 511 | Ga0265318_10023551 | 3300028577 | Bacteria | 2453 |
| 512 | Ga0265338_10217329 | 3300028800 | Bacteria | 1430 |
| 513 | Ga0268256_1030724 | 3300030500 | Bacteria | 1298 |
| 514 | Ga0265330_10011684 | 3300031235 | Bacteria | 4115 |
| 515 | Ga0265332_10000616 | 3300031238 | Bacteria | 23188 |
| 516 | Ga0265332_10006156 | 3300031238 | Bacteria | 5474 |
| 517 | Ga0265320_10019560 | 3300031240 | Bacteria | 3698 |
| 518 | Ga0265325_10000162 | 3300031241 | Bacteria | 47234 |
| 519 | Ga0265325_10020612 | 3300031241 | Bacteria | 3632 |
| 520 | Ga0265325_10042414 | 3300031241 | Bacteria | 2379 |
| 521 | Ga0265329_10005375 | 3300031242 | Bacteria | 5182 |
| 522 | Ga0265340_10001157 | 3300031247 | Bacteria | 15092 |
| 523 | Ga0265340_10015097 | 3300031247 | Bacteria | 4019 |
| 524 | Ga0265340_10039855 | 3300031247 | Bacteria | 2315 |
| 525 | Ga0265339_10001689 | 3300031249 | Bacteria | 16287 |
| 526 | Ga0265339_10009337 | 3300031249 | Bacteria | 6170 |
| 527 | Ga0265339_10064128 | 3300031249 | Bacteria | 1972 |
| 528 | Ga0265331_10005352 | 3300031250 | Bacteria | 7760 |
| 529 | Ga0265331_10026552 | 3300031250 | Bacteria | 2909 |
| 530 | Ga0265331_10028156 | 3300031250 | Bacteria | 2811 |
| 531 | Ga0265331_10063039 | 3300031250 | Bacteria | 1747 |
| 532 | Ga0265327_10000496 | 3300031251 | Bacteria | 68506 |
| 533 | Ga0265316_10070623 | 3300031344 | Bacteria | 2693 |
| 534 | Ga0307509_10001262 | 3300031507 | Bacteria | 42913 |
| 535 | Ga0307408_100093069 | 3300031548 | Bacteria | 2280 |
| 536 | Ga0307408_100416972 | 3300031548 | Bacteria | 1157 |
| 537 | Ga0265313_10009102 | 3300031595 | Bacteria | 6494 |
| 538 | Ga0265313_10044247 | 3300031595 | Bacteria | 2174 |
| 539 | Ga0265313_10068633 | 3300031595 | Bacteria | 1638 |
| 540 | Ga0265313_10164797 | 3300031595 | Bacteria | 940 |
| 541 | Ga0316575_10029492 | 3300031665 | Bacteria | 2143 |
| 542 | Ga0316579_10048692 | 3300031691 | Bacteria | 1980 |
| 543 | Ga0265314_10001560 | 3300031711 | Bacteria | 25231 |
| 544 | Ga0265314_10007969 | 3300031711 | Bacteria | 9137 |
| 545 | Ga0265314_10025875 | 3300031711 | Bacteria | 4418 |
| 546 | Ga0265314_10036683 | 3300031711 | Bacteria | 3559 |
| 547 | Ga0265342_10000139 | 3300031712 | Bacteria | 81785 |
| 548 | Ga0265342_10000608 | 3300031712 | Bacteria | 37799 |
| 549 | Ga0265342_10006975 | 3300031712 | Bacteria | 8350 |
| 550 | Ga0265342_10103009 | 3300031712 | Bacteria | 1623 |
| 551 | Ga0316576_10016655 | 3300031727 | Bacteria | 4972 |
| 552 | Ga0307405_10000319 | 3300031731 | Bacteria | 17826 |
| 553 | Ga0307406_10038296 | 3300031901 | Bacteria | 2967 |
| 554 | Ga0315914_1000001 | 3300031967 | Bacteria | 416633 |
| 555 | Ga0307409_101167152 | 3300031995 | Bacteria | 793 |
| 556 | Ga0307414_10454691 | 3300032004 | Bacteria | 1124 |
| 557 | Ga0316583_10077037 | 3300032133 | Bacteria | 1166 |
| 558 | Ga0315913_1000004 | 3300033430 | Bacteria | 192741 |
| 559 | Ga0315915_1000002 | 3300033464 | Bacteria | 425854 |
| 560 | Ga0316596_1061347 | 3300033541 | Bacteria | 1003 |
| 561 | Ga0373959_0041399 | 3300034820 | Bacteria | 968 |
| 562 | Ga0373938_0019224 | 3300034957 | Bacteria | 1364 |
| 563 | Ga0373926_0013371 | 3300035083 | Bacteria | 2783 |
| 564 | Ga0373926_0018146 | 3300035083 | Bacteria | 2418 |
| 565 | Ga0373926_0031361 | 3300035083 | Bacteria | 1874 |
| 566 | Ga0373926_0042636 | 3300035083 | Bacteria | 1623 |
| 567 | Ga0373934_0019496 | 3300035086 | Bacteria | 2604 |
| 568 | Ga0373934_0079627 | 3300035086 | Bacteria | 1316 |
| 569 | Ga0373944_0001048 | 3300035089 | Bacteria | 6825 |
| 570 | Ga0373944_0002385 | 3300035089 | Bacteria | 4783 |
| 571 | Ga0373944_0043865 | 3300035089 | Bacteria | 1391 |
| 572 | Ga0373944_0077766 | 3300035089 | Bacteria | 1091 |
| 573 | Ga0373952_0041741 | 3300035092 | Bacteria | 1062 |
| 574 | Ga0373952_0044723 | 3300035092 | Bacteria | 1036 |
| 575 | Ga0373923_0001197 | 3300035111 | Bacteria | 7256 |
| 576 | Ga0373932_0115549 | 3300035112 | Bacteria | 889 |
| 577 | Ga0373936_0003776 | 3300035113 | Bacteria | 5697 |
| 578 | Ga0373936_0007303 | 3300035113 | Bacteria | 4158 |
| 579 | Ga0373939_0069833 | 3300035114 | Bacteria | 1141 |
| 580 | Ga0373939_0113468 | 3300035114 | Bacteria | 947 |
| 581 | Ga0373941_0003432 | 3300035115 | Bacteria | 3589 |
| 582 | Ga0373941_0159112 | 3300035115 | Bacteria | 834 |
| 583 | Ga0373945_0009707 | 3300035116 | Bacteria | 3157 |
| 584 | Ga0373945_0014620 | 3300035116 | Bacteria | 2633 |
| 585 | Ga0373945_0027358 | 3300035116 | Bacteria | 1992 |
| 586 | Ga0373945_0043837 | 3300035116 | Bacteria | 1624 |
| 587 | Ga0373953_0000163 | 3300035117 | Bacteria | 17387 |
| 588 | Ga0373953_0002594 | 3300035117 | Bacteria | 5470 |
| 589 | Ga0373953_0027416 | 3300035117 | Bacteria | 2190 |
| 590 | Ga0373954_0000145 | 3300035118 | Bacteria | 24877 |
| 591 | Ga0373954_0002810 | 3300035118 | Bacteria | 7327 |
| 592 | Ga0373954_0004821 | 3300035118 | Bacteria | 5815 |
| 593 | Ga0373954_0052525 | 3300035118 | Bacteria | 1915 |
| 594 | Ga0373954_0130741 | 3300035118 | Bacteria | 1222 |
| 595 | Ga0373956_0001494 | 3300035119 | Bacteria | 9666 |
| 596 | Ga0373956_0012834 | 3300035119 | Bacteria | 3479 |
| 597 | Ga0373956_0105178 | 3300035119 | Bacteria | 1311 |
| 598 | Ga0373957_0003169 | 3300035120 | Bacteria | 4817 |
| 599 | Ga0373960_0002152 | 3300035121 | Bacteria | 4438 |
| 600 | Ga0373943_0005333 | 3300035170 | Bacteria | 5780 |
| 601 | Ga0373943_0005356 | 3300035170 | Bacteria | 5771 |
| 602 | Ga0373943_0005440 | 3300035170 | Bacteria | 5730 |
| 603 | Ga0373943_0007037 | 3300035170 | Bacteria | 5046 |
| 604 | Ga0373943_0008557 | 3300035170 | Bacteria | 4587 |
| 605 | Ga0373943_0015761 | 3300035170 | Bacteria | 3437 |
| 606 | Ga0373943_0050796 | 3300035170 | Bacteria | 2039 |
| 607 | Ga0373943_0126950 | 3300035170 | Bacteria | 1361 |
| 608 | Ga0373943_0169117 | 3300035170 | Bacteria | 1195 |
| 609 | Ga0373946_0000831 | 3300035171 | Bacteria | 10553 |
| 610 | Ga0373946_0047849 | 3300035171 | Bacteria | 1777 |
| 611 | Ga0373946_0090582 | 3300035171 | Bacteria | 1355 |
| 612 | Ga0373946_0104233 | 3300035171 | Bacteria | 1275 |
| 613 | Ga0373955_0000129 | 3300035172 | Bacteria | 29850 |
| 614 | Ga0373955_0000245 | 3300035172 | Bacteria | 22476 |
| 615 | Ga0373955_0009700 | 3300035172 | Bacteria | 4521 |
| 616 | Ga0373955_0026576 | 3300035172 | Bacteria | 2983 |
| 617 | Ga0373955_0053551 | 3300035172 | Bacteria | 2203 |
| 618 | Ga0373955_0221682 | 3300035172 | Bacteria | 1130 |
| 619 | Ga0373961_0004207 | 3300035241 | Bacteria | 3493 |
| 620 | Ga0373962_0017573 | 3300035242 | Bacteria | 1854 |
| 621 | Ga0316574_0172630 | 3300035398 | Bacteria | 1392 |
| 622 | Ga0373924_0002728 | 3300035410 | Bacteria | 5963 |
| 623 | Ga0373924_0009624 | 3300035410 | Bacteria | 3547 |
| 624 | Ga0373931_0009777 | 3300035691 | Bacteria | 4592 |
| 625 | Ga0373931_0100454 | 3300035691 | Bacteria | 1626 |
| 626 | Ga0373931_0109768 | 3300035691 | Bacteria | 1563 |
| 627 | Ga0373931_0217475 | 3300035691 | Bacteria | 1149 |
| 628 | Ga0373935_0000514 | 3300035692 | Bacteria | 20101 |
| 629 | Ga0373935_0001583 | 3300035692 | Bacteria | 12687 |
| 630 | Ga0373935_0008943 | 3300035692 | Bacteria | 5995 |
| 631 | Ga0373935_0029303 | 3300035692 | Bacteria | 3406 |
| 632 | Ga0373935_0034563 | 3300035692 | Bacteria | 3151 |
| 633 | Ga0373935_0070266 | 3300035692 | Bacteria | 2256 |
| 634 | Ga0373927_0000243 | 3300035695 | Bacteria | 42834 |
| 635 | Ga0373927_0003594 | 3300035695 | Bacteria | 11057 |
| 636 | Ga0373927_0016658 | 3300035695 | Bacteria | 4848 |
| 637 | Ga0373927_0040324 | 3300035695 | Bacteria | 3029 |
| 638 | Ga0373927_0223252 | 3300035695 | Bacteria | 1237 |
| 639 | Ga0373933_0000999 | 3300035724 | Bacteria | 17254 |
| 640 | Ga0373933_0007091 | 3300035724 | Bacteria | 6106 |
| 641 | Ga0373933_0013404 | 3300035724 | Bacteria | 4542 |
| 642 | Ga0373933_0014674 | 3300035724 | Bacteria | 4362 |
| 643 | Ga0373933_0039115 | 3300035724 | Bacteria | 2789 |
| 644 | Ga0373933_0134085 | 3300035724 | Bacteria | 1559 |
| 645 | Ga0373947_0002558 | 3300035725 | Bacteria | 10927 |
| 646 | Ga0373947_0004234 | 3300035725 | Bacteria | 8413 |
| 647 | Ga0373947_0006288 | 3300035725 | Bacteria | 6904 |
| 648 | Ga0373947_0022019 | 3300035725 | Bacteria | 3693 |
| 649 | Ga0373947_0134997 | 3300035725 | Bacteria | 1578 |
| 650 | Ga0373947_0145550 | 3300035725 | Bacteria | 1523 |
| 651 | Ga0373947_0154857 | 3300035725 | Bacteria | 1478 |
| 652 | Ga0373947_0268394 | 3300035725 | Bacteria | 1132 |
| 653 | Ga0373937_0000005 | 3300036401 | Bacteria | 199965 |
| 654 | Ga0373937_0001770 | 3300036401 | Bacteria | 18155 |
| 655 | Ga0373937_0014589 | 3300036401 | Bacteria | 6940 |
| 656 | Ga0373937_0017483 | 3300036401 | Bacteria | 6390 |
| 657 | Ga0373937_0041928 | 3300036401 | Bacteria | 4176 |
| 658 | Ga0373937_0050791 | 3300036401 | Bacteria | 3799 |
| 659 | Ga0373937_0078240 | 3300036401 | Bacteria | 3056 |
| 660 | Ga0373937_0211788 | 3300036401 | Bacteria | 1824 |
| 661 | Ga0316584_0025549 | 3300036712 | Bacteria | 4334 |
| 662 | Ga0373925_0000007 | 3300037068 | Bacteria | 257023 |
| 663 | Ga0373925_0002474 | 3300037068 | Bacteria | 14766 |
| 664 | Ga0373925_0006021 | 3300037068 | Bacteria | 8976 |
| 665 | Ga0373925_0007690 | 3300037068 | Bacteria | 7849 |
| 666 | Ga0373925_0010149 | 3300037068 | Bacteria | 6837 |
| 667 | Ga0373925_0070975 | 3300037068 | Bacteria | 2633 |
| 668 | Ga0373925_0076180 | 3300037068 | Bacteria | 2543 |
| 669 | Ga0373925_0102445 | 3300037068 | Bacteria | 2202 |
| 670 | Ga0373925_0131664 | 3300037068 | Bacteria | 1950 |
| 671 | Ga0373925_0281437 | 3300037068 | Bacteria | 1340 |
| 672 | Ga0373925_0382068 | 3300037068 | Bacteria | 1147 |
| 673 | Ga0395899_0020603 | 3300037312 | Bacteria | 4999 |
| 674 | Ga0395899_0145037 | 3300037312 | Bacteria | 1686 |
| 675 | Ga0395899_0424030 | 3300037312 | Bacteria | 876 |
| 676 | Ga0395900_0038369 | 3300037418 | Bacteria | 4936 |
| 677 | Ga0395900_0075666 | 3300037418 | Bacteria | 3461 |
| 678 | Ga0395900_0087040 | 3300037418 | Bacteria | 3211 |
| 679 | Ga0395900_0253369 | 3300037418 | Bacteria | 1761 |
| 680 | Ga0395900_0293717 | 3300037418 | Bacteria | 1613 |
| 681 | Ga0395900_0560326 | 3300037418 | Bacteria | 1086 |
| 682 | Ga0395898_0002812 | 3300037466 | Bacteria | 19956 |
| 683 | Ga0395898_0040958 | 3300037466 | Bacteria | 4577 |
| 684 | Ga0395898_0041459 | 3300037466 | Bacteria | 4547 |
| 685 | Ga0395898_0070704 | 3300037466 | Bacteria | 3373 |
| 686 | Ga0395898_0081359 | 3300037466 | Bacteria | 3123 |
| 687 | Ga0395898_0440497 | 3300037466 | Bacteria | 1241 |
| 688 | Ga0395905_0053222 | 3300037471 | Bacteria | 3788 |
| 689 | Ga0395905_0134471 | 3300037471 | Bacteria | 2326 |
| 690 | Ga0436364_0143493 | 3300037853 | Bacteria | 871 |
| 691 | Ga0436364_1293698 | 3300037853 | Bacteria | 1978 |
| 692 | Ga0436364_1378623 | 3300037853 | Bacteria | 1005 |
| 693 | Ga0395901_0091577 | 3300038443 | Bacteria | 3183 |
| 694 | Ga0395901_0318189 | 3300038443 | Bacteria | 1610 |
| 695 | Ga0395901_0516912 | 3300038443 | Bacteria | 1213 |
| 696 | Ga0400483_057704 | 3300039062 | Bacteria | 2972 |
| 697 | Ga0400483_184981 | 3300039062 | Bacteria | 4448 |
| 698 | Ga0400483_185859 | 3300039062 | Bacteria | 13687 |
| 699 | Ga0400483_228929 | 3300039062 | Bacteria | 58877 |
| 700 | Ga0436365_0008071 | 3300039437 | Bacteria | 11634 |
| 701 | Ga0436365_0047534 | 3300039437 | Bacteria | 1873 |
| 702 | Ga0436365_0382338 | 3300039437 | Bacteria | 1181 |
| 703 | Ga0436365_0414414 | 3300039437 | Bacteria | 44510 |
| 704 | Ga0436365_0563707 | 3300039437 | Bacteria | 1664 |
| 705 | Ga0436365_0853635 | 3300039437 | Bacteria | 897 |
| 706 | Ga0436365_1561193 | 3300039437 | Bacteria | 1433 |
| 707 | Ga0436360_0205543 | 3300039438 | Bacteria | 1040 |
| 708 | Ga0436360_0224814 | 3300039438 | Bacteria | 1100 |
| 709 | Ga0436361_0092227 | 3300039447 | Bacteria | 2117 |
| 710 | Ga0436361_0492958 | 3300039447 | Bacteria | 54051 |
| 711 | Ga0436361_0494886 | 3300039447 | Bacteria | 1469 |
| 712 | Ga0436363_0382716 | 3300039450 | Bacteria | 1286 |
| 713 | Ga0436363_0639451 | 3300039450 | Bacteria | 3682 |
| 714 | Ga0436363_0780921 | 3300039450 | Bacteria | 9681 |
| 715 | Ga0436363_1418375 | 3300039450 | Bacteria | 2379 |
| 716 | Ga0439436_0047100 | 3300041404 | Bacteria | 1224 |
| 717 | Ga0439466_0061186 | 3300041411 | Bacteria | 1213 |
| 718 | Ga0439465_0013151 | 3300041413 | Bacteria | 2583 |
| 719 | Ga0439465_0090364 | 3300041413 | Bacteria | 1047 |
| 720 | Ga0451804_0220353 | 3300041463 | Bacteria | 996 |
| 721 | Ga0439441_002900 | 3300042001 | Bacteria | 2466 |
| 722 | Ga0439449_0006122 | 3300042007 | Bacteria | 4596 |
| 723 | Ga0439450_023665 | 3300042008 | Bacteria | 1334 |
| 724 | Ga0466966_0049822 | 3300044684 | Bacteria | 2666 |
| 725 | Ga0466966_0229552 | 3300044684 | Bacteria | 1120 |
| 726 | Ga0466961_0094591 | 3300044693 | Bacteria | 1885 |
| 727 | Ga0466964_0094272 | 3300044706 | Bacteria | 1308 |
| 728 | Ga0453684_0005046 | 3300044712 | Bacteria | 26754 |
| 729 | Ga0466971_0054028 | 3300044719 | Bacteria | 1810 |
| 730 | Ga0466968_0064700 | 3300044735 | Bacteria | 1582 |
| 731 | Ga0466957_0008064 | 3300044842 | Bacteria | 5975 |
| 732 | Ga0466959_0021717 | 3300045049 | Bacteria | 4737 |
| 733 | Ga0466959_0048305 | 3300045049 | Bacteria | 3127 |
| 734 | Ga0451576_0003376 | 3300045051 | Bacteria | 22069 |
| 735 | Ga0466958_0060091 | 3300045836 | Bacteria | 2313 |
| 736 | Ga0466958_0198665 | 3300045836 | Bacteria | 1276 |
| 737 | Ga0466967_0031475 | 3300045976 | Bacteria | 4466 |
| 738 | Ga0466967_0677786 | 3300045976 | Bacteria | 1020 |
| 739 | Ga0495592_0000165 | 3300046454 | Bacteria | 58936 |
| 740 | Ga0495592_0001415 | 3300046454 | Bacteria | 16650 |
| 741 | Ga0495592_0066586 | 3300046454 | Bacteria | 2635 |
| 742 | Ga0495592_0080782 | 3300046454 | Bacteria | 2351 |
| 743 | Ga0495592_0114599 | 3300046454 | Bacteria | 1903 |
| 744 | Ga0495592_0204443 | 3300046454 | Bacteria | 1331 |
| 745 | Ga0495592_0215119 | 3300046454 | Bacteria | 1288 |
| 746 | Ga0495603_0026000 | 3300046455 | Bacteria | 3539 |
| 747 | Ga0495603_0227915 | 3300046455 | Bacteria | 1074 |
| 748 | Ga0495591_038725 | 3300046458 | Bacteria | 1371 |
| 749 | Ga0495629_0000668 | 3300046459 | Bacteria | 27756 |
| 750 | Ga0495629_0001605 | 3300046459 | Bacteria | 17766 |
| 751 | Ga0495629_0047268 | 3300046459 | Bacteria | 3019 |
| 752 | Ga0495629_0102696 | 3300046459 | Bacteria | 1994 |
| 753 | Ga0495638_0163759 | 3300046460 | Bacteria | 1281 |
| 754 | Ga0495641_0007758 | 3300046461 | Bacteria | 6647 |
| 755 | Ga0495641_0019335 | 3300046461 | Bacteria | 3488 |
| 756 | Ga0495641_0042091 | 3300046461 | Bacteria | 2119 |
| 757 | Ga0495651_0000836 | 3300046462 | Bacteria | 23937 |
| 758 | Ga0495651_0021179 | 3300046462 | Bacteria | 5050 |
| 759 | Ga0495651_0144049 | 3300046462 | Bacteria | 1724 |
| 760 | Ga0495653_0000103 | 3300046463 | Bacteria | 69772 |
| 761 | Ga0495653_0000300 | 3300046463 | Bacteria | 40108 |
| 762 | Ga0495653_0027546 | 3300046463 | Bacteria | 4547 |
| 763 | Ga0495653_0096589 | 3300046463 | Bacteria | 2148 |
| 764 | Ga0495580_0018640 | 3300046472 | Bacteria | 5165 |
| 765 | Ga0495580_0031293 | 3300046472 | Bacteria | 3846 |
| 766 | Ga0495582_0002207 | 3300046473 | Bacteria | 10901 |
| 767 | Ga0495582_0028720 | 3300046473 | Bacteria | 3052 |
| 768 | Ga0495605_0219105 | 3300046474 | Bacteria | 823 |
| 769 | Ga0495639_0022873 | 3300046475 | Bacteria | 2744 |
| 770 | Ga0495639_0024480 | 3300046475 | Bacteria | 2658 |
| 771 | Ga0495639_0028611 | 3300046475 | Bacteria | 2470 |
| 772 | Ga0495662_0009429 | 3300046476 | Bacteria | 4785 |
| 773 | Ga0495662_0046886 | 3300046476 | Bacteria | 2086 |
| 774 | Ga0495664_0000003 | 3300046477 | Bacteria | 551602 |
| 775 | Ga0495664_0000877 | 3300046477 | Bacteria | 15497 |
| 776 | Ga0495664_0074144 | 3300046477 | Bacteria | 2035 |
| 777 | Ga0495664_0102269 | 3300046477 | Bacteria | 1727 |
| 778 | Ga0495584_0096965 | 3300046491 | Bacteria | 1489 |
| 779 | Ga0495585_0004225 | 3300046492 | Bacteria | 9369 |
| 780 | Ga0495594_0036748 | 3300046499 | Bacteria | 2672 |
| 781 | Ga0495594_0130699 | 3300046499 | Bacteria | 1422 |
| 782 | Ga0495607_0005594 | 3300046501 | Bacteria | 8963 |
| 783 | Ga0495608_0000072 | 3300046511 | Bacteria | 76887 |
| 784 | Ga0495608_0001863 | 3300046511 | Bacteria | 15064 |
| 785 | Ga0495608_0021002 | 3300046511 | Bacteria | 4485 |
| 786 | Ga0495608_0094658 | 3300046511 | Bacteria | 1930 |
| 787 | Ga0495610_0000530 | 3300046512 | Bacteria | 38418 |
| 788 | Ga0495618_0000019 | 3300046514 | Bacteria | 136770 |
| 789 | Ga0495618_0007932 | 3300046514 | Bacteria | 6427 |
| 790 | Ga0495618_0015011 | 3300046514 | Bacteria | 4724 |
| 791 | Ga0495628_0000080 | 3300046516 | Bacteria | 75108 |
| 792 | Ga0495628_0011369 | 3300046516 | Bacteria | 7529 |
| 793 | Ga0495628_0015340 | 3300046516 | Bacteria | 6398 |
| 794 | Ga0495628_0022925 | 3300046516 | Bacteria | 5125 |
| 795 | Ga0495628_0052125 | 3300046516 | Bacteria | 3233 |
| 796 | Ga0495628_0055939 | 3300046516 | Bacteria | 3107 |
| 797 | Ga0495630_0002294 | 3300046517 | Bacteria | 13300 |
| 798 | Ga0495630_0012446 | 3300046517 | Bacteria | 6177 |
| 799 | Ga0495630_0078757 | 3300046517 | Bacteria | 2485 |
| 800 | Ga0495632_0001108 | 3300046519 | Bacteria | 23100 |
| 801 | Ga0495637_0054046 | 3300046520 | Bacteria | 1670 |
| 802 | Ga0495643_0025174 | 3300046522 | Bacteria | 3370 |
| 803 | Ga0495644_0000306 | 3300046523 | Bacteria | 22634 |
| 804 | Ga0495648_0077361 | 3300046524 | Bacteria | 1907 |
| 805 | Ga0495666_0015401 | 3300046526 | Bacteria | 3807 |
| 806 | Ga0495666_0036055 | 3300046526 | Bacteria | 2409 |
| 807 | Ga0495642_0228251 | 3300046528 | Bacteria | 813 |
| 808 | Ga0495652_0000006 | 3300046529 | Bacteria | 459709 |
| 809 | Ga0495652_0002115 | 3300046529 | Bacteria | 20938 |
| 810 | Ga0495652_0002263 | 3300046529 | Bacteria | 20082 |
| 811 | Ga0495652_0013648 | 3300046529 | Bacteria | 7311 |
| 812 | Ga0495652_0305975 | 3300046529 | Bacteria | 1154 |
| 813 | Ga0495665_0062590 | 3300046531 | Bacteria | 1964 |
| 814 | Ga0495665_0226647 | 3300046531 | Bacteria | 966 |
| 815 | Ga0495640_0000002 | 3300046533 | Bacteria | 646434 |
| 816 | Ga0495640_0005373 | 3300046533 | Bacteria | 10190 |
| 817 | Ga0495640_0013146 | 3300046533 | Bacteria | 6299 |
| 818 | Ga0495640_0015102 | 3300046533 | Bacteria | 5817 |
| 819 | Ga0495640_0023878 | 3300046533 | Bacteria | 4448 |
| 820 | Ga0495640_0109377 | 3300046533 | Bacteria | 1807 |
| 821 | Ga0495640_0159277 | 3300046533 | Bacteria | 1447 |
| 822 | Ga0495586_0027068 | 3300046535 | Bacteria | 3068 |
| 823 | Ga0495586_0049358 | 3300046535 | Bacteria | 2275 |
| 824 | Ga0495586_0112940 | 3300046535 | Bacteria | 1513 |
| 825 | Ga0495587_0000001 | 3300046536 | Bacteria | 724132 |
| 826 | Ga0495587_0002255 | 3300046536 | Bacteria | 12888 |
| 827 | Ga0495587_0018878 | 3300046536 | Bacteria | 4274 |
| 828 | Ga0495587_0110028 | 3300046536 | Bacteria | 1583 |
| 829 | Ga0495587_0178859 | 3300046536 | Bacteria | 1203 |
| 830 | Ga0495598_0002277 | 3300046537 | Bacteria | 3952 |
| 831 | Ga0495621_0080055 | 3300046539 | Bacteria | 1217 |
| 832 | Ga0495645_0000284 | 3300046543 | Bacteria | 37169 |
| 833 | Ga0495645_0001277 | 3300046543 | Bacteria | 17149 |
| 834 | Ga0495645_0004817 | 3300046543 | Bacteria | 9220 |
| 835 | Ga0495645_0033438 | 3300046543 | Bacteria | 3751 |
| 836 | Ga0495645_0087084 | 3300046543 | Bacteria | 2234 |
| 837 | Ga0495645_0144812 | 3300046543 | Bacteria | 1655 |
| 838 | Ga0495645_0152759 | 3300046543 | Bacteria | 1602 |
| 839 | Ga0495622_0004842 | 3300046557 | Bacteria | 6235 |
| 840 | Ga0495633_0001183 | 3300046558 | Bacteria | 20947 |
| 841 | Ga0495633_0094773 | 3300046558 | Bacteria | 1387 |
| 842 | Ga0495667_0000021 | 3300046559 | Bacteria | 180625 |
| 843 | Ga0495667_0000121 | 3300046559 | Bacteria | 56223 |
| 844 | Ga0495667_0043767 | 3300046559 | Bacteria | 2966 |
| 845 | Ga0495667_0083496 | 3300046559 | Bacteria | 2074 |
| 846 | Ga0495656_0072048 | 3300046615 | Bacteria | 1537 |
| 847 | Ga0495634_0000396 | 3300046642 | Bacteria | 42784 |
| 848 | Ga0495634_0002835 | 3300046642 | Bacteria | 14233 |
| 849 | Ga0495634_0016888 | 3300046642 | Bacteria | 5214 |
| 850 | Ga0495634_0020441 | 3300046642 | Bacteria | 4694 |
| 851 | Ga0495634_0306465 | 3300046642 | Bacteria | 959 |
| 852 | Ga0495634_0353951 | 3300046642 | Bacteria | 879 |
| 853 | Ga0495611_0003332 | 3300046648 | Bacteria | 7096 |
| 854 | Ga0495635_0000001 | 3300046663 | Bacteria | 704901 |
| 855 | Ga0495635_0000072 | 3300046663 | Bacteria | 62736 |
| 856 | Ga0495635_0017419 | 3300046663 | Bacteria | 5018 |
| 857 | Ga0495635_0018165 | 3300046663 | Bacteria | 4910 |
| 858 | Ga0495635_0020590 | 3300046663 | Bacteria | 4593 |
| 859 | Ga0495635_0044207 | 3300046663 | Bacteria | 3073 |
| 860 | Ga0495635_0405216 | 3300046663 | Bacteria | 905 |
| 861 | Ga0495659_0000645 | 3300046664 | Bacteria | 12657 |
| 862 | Ga0495588_0003103 | 3300046674 | Bacteria | 7194 |
| 863 | Ga0495588_0113522 | 3300046674 | Bacteria | 1427 |
| 864 | Ga0495657_0000088 | 3300046675 | Bacteria | 81307 |
| 865 | Ga0495657_0001284 | 3300046675 | Bacteria | 21828 |
| 866 | Ga0495657_0034710 | 3300046675 | Bacteria | 3501 |
| 867 | Ga0495657_0107448 | 3300046675 | Bacteria | 1771 |
| 868 | Ga0495657_0306561 | 3300046675 | Bacteria | 946 |
| 869 | Ga0495599_0000025 | 3300046678 | Bacteria | 120337 |
| 870 | Ga0495599_0000695 | 3300046678 | Bacteria | 19040 |
| 871 | Ga0495599_0017266 | 3300046678 | Bacteria | 4486 |
| 872 | Ga0495599_0024129 | 3300046678 | Bacteria | 3803 |
| 873 | Ga0495623_0000058 | 3300046679 | Bacteria | 68197 |
| 874 | Ga0495623_0000291 | 3300046679 | Bacteria | 32839 |
| 875 | Ga0495623_0003236 | 3300046679 | Bacteria | 10761 |
| 876 | Ga0495623_0061099 | 3300046679 | Bacteria | 2363 |
| 877 | Ga0495646_0000003 | 3300046680 | Bacteria | 287773 |
| 878 | Ga0495646_0031506 | 3300046680 | Bacteria | 3304 |
| 879 | Ga0495646_0037206 | 3300046680 | Bacteria | 3012 |
| 880 | Ga0495646_0048349 | 3300046680 | Bacteria | 2584 |
| 881 | Ga0495646_0120946 | 3300046680 | Bacteria | 1482 |
| 882 | Ga0495647_0039384 | 3300046681 | Bacteria | 1791 |
| 883 | Ga0495647_0057825 | 3300046681 | Bacteria | 1523 |
| 884 | Ga0495647_0103155 | 3300046681 | Bacteria | 1183 |
| 885 | Ga0495647_0110990 | 3300046681 | Bacteria | 1144 |
| 886 | Ga0495658_0000229 | 3300046683 | Bacteria | 32147 |
| 887 | Ga0495658_0023036 | 3300046683 | Bacteria | 3302 |
| 888 | Ga0495658_0049426 | 3300046683 | Bacteria | 2375 |
| 889 | Ga0495658_0247448 | 3300046683 | Bacteria | 1121 |
| 890 | Ga0495613_0002758 | 3300046689 | Bacteria | 13197 |
| 891 | Ga0495613_0007587 | 3300046689 | Bacteria | 8066 |
| 892 | Ga0495613_0019425 | 3300046689 | Bacteria | 5063 |
| 893 | Ga0495613_0037004 | 3300046689 | Bacteria | 3618 |
| 894 | Ga0495613_0038838 | 3300046689 | Bacteria | 3529 |
| 895 | Ga0495613_0074812 | 3300046689 | Bacteria | 2466 |
| 896 | Ga0495624_0019928 | 3300046690 | Bacteria | 4469 |
| 897 | Ga0495624_0028910 | 3300046690 | Bacteria | 3617 |
| 898 | Ga0495624_0074972 | 3300046690 | Bacteria | 2101 |
| 899 | Ga0495624_0402183 | 3300046690 | Bacteria | 822 |
| 900 | Ga0495670_0004752 | 3300046691 | Bacteria | 6671 |
| 901 | Ga0495670_0062899 | 3300046691 | Bacteria | 1868 |
| 902 | Ga0495671_0039884 | 3300046692 | Bacteria | 2369 |
| 903 | Ga0495600_0000042 | 3300046809 | Bacteria | 74873 |
| 904 | Ga0495600_0000330 | 3300046809 | Bacteria | 25140 |
| 905 | Ga0495600_0045949 | 3300046809 | Bacteria | 2849 |
| 906 | Ga0495600_0049453 | 3300046809 | Bacteria | 2743 |
| 907 | Ga0495600_0281681 | 3300046809 | Bacteria | 1052 |
| 908 | Ga0495581_0006942 | 3300047315 | Bacteria | 6561 |
| 909 | Ga0495581_0008088 | 3300047315 | Bacteria | 6088 |
| 910 | Ga0495581_0008513 | 3300047315 | Bacteria | 5948 |
| 911 | Ga0495604_0000008 | 3300047317 | Bacteria | 341160 |
| 912 | Ga0495604_0003872 | 3300047317 | Bacteria | 11918 |
| 913 | Ga0495604_0005468 | 3300047317 | Bacteria | 10075 |
| 914 | Ga0495604_0024793 | 3300047317 | Bacteria | 4785 |
| 915 | Ga0495604_0077274 | 3300047317 | Bacteria | 2502 |
| 916 | Ga0495674_0000028 | 3300047319 | Bacteria | 124722 |
| 917 | Ga0495674_0002065 | 3300047319 | Bacteria | 19693 |
| 918 | Ga0495674_0017187 | 3300047319 | Bacteria | 6734 |
| 919 | Ga0495674_0018921 | 3300047319 | Bacteria | 6405 |
| 920 | Ga0495674_0019117 | 3300047319 | Bacteria | 6366 |
| 921 | Ga0495674_0098730 | 3300047319 | Bacteria | 2486 |
| 922 | Ga0495674_0102023 | 3300047319 | Bacteria | 2440 |
| 923 | Ga0495674_0308239 | 3300047319 | Bacteria | 1292 |
| 924 | Ga0495674_0672778 | 3300047319 | Bacteria | 814 |
| 925 | Ga0495672_0046593 | 3300047320 | Bacteria | 2585 |
| 926 | Ga0495676_0012443 | 3300047321 | Bacteria | 7666 |
| 927 | Ga0495676_0114954 | 3300047321 | Bacteria | 1968 |
| 928 | Ga0495676_0152323 | 3300047321 | Bacteria | 1644 |
| 929 | Ga0495676_0231937 | 3300047321 | Bacteria | 1267 |
| 930 | Ga0495680_0000711 | 3300047322 | Bacteria | 37349 |
| 931 | Ga0495680_0009139 | 3300047322 | Bacteria | 8943 |
| 932 | Ga0495680_0016511 | 3300047322 | Bacteria | 6338 |
| 933 | Ga0495680_0036945 | 3300047322 | Bacteria | 3915 |
| 934 | Ga0495680_0080264 | 3300047322 | Bacteria | 2465 |
| 935 | Ga0495680_0081464 | 3300047322 | Bacteria | 2443 |
| 936 | Ga0495680_0142257 | 3300047322 | Bacteria | 1754 |
| 937 | Ga0495680_0350950 | 3300047322 | Bacteria | 1027 |
| 938 | Ga0495680_0401106 | 3300047322 | Bacteria | 947 |
| 939 | Ga0495675_0000796 | 3300047444 | Bacteria | 19452 |
| 940 | Ga0495675_0001942 | 3300047444 | Bacteria | 12331 |
| 941 | Ga0495675_0243369 | 3300047444 | Bacteria | 1082 |
| 942 | Ga0495675_0377683 | 3300047444 | Bacteria | 829 |
| 943 | Ga0495677_0184934 | 3300047445 | Bacteria | 808 |
| 944 | Ga0495679_034322 | 3300047446 | Bacteria | 1615 |
| 945 | Ga0495681_0003767 | 3300047470 | Bacteria | 10514 |
| 946 | Ga0495681_0090686 | 3300047470 | Bacteria | 1350 |
| 947 | Ga0495684_0000002 | 3300047471 | Bacteria | 341216 |
| 948 | Ga0495684_0000594 | 3300047471 | Bacteria | 29100 |
| 949 | Ga0495684_0014934 | 3300047471 | Bacteria | 5981 |
| 950 | Ga0495684_0059336 | 3300047471 | Bacteria | 2914 |
| 951 | Ga0495684_0091239 | 3300047471 | Bacteria | 2308 |
| 952 | Ga0495684_0248620 | 3300047471 | Bacteria | 1294 |
| 953 | Ga0495686_0000269 | 3300047472 | Bacteria | 92647 |
| 954 | Ga0495686_0003611 | 3300047472 | Bacteria | 13269 |
| 955 | Ga0495593_0000641 | 3300047673 | Bacteria | 20075 |
| 956 | Ga0495593_0003093 | 3300047673 | Bacteria | 10010 |
| 957 | Ga0495593_0015025 | 3300047673 | Bacteria | 4397 |
| 958 | Ga0495593_0024445 | 3300047673 | Bacteria | 3348 |
| 959 | Ga0495593_0040039 | 3300047673 | Bacteria | 2524 |
| 960 | Ga0495593_0154447 | 3300047673 | Bacteria | 1160 |
| 961 | Ga0495602_0000468 | 3300048088 | Bacteria | 37400 |
| 962 | Ga0495602_0004847 | 3300048088 | Bacteria | 14082 |
| 963 | Ga0495602_0014643 | 3300048088 | Bacteria | 7956 |
| 964 | Ga0495602_0024310 | 3300048088 | Bacteria | 5879 |
| 965 | Ga0495602_0057882 | 3300048088 | Bacteria | 3397 |
| 966 | Ga0495614_0005547 | 3300048089 | Bacteria | 5691 |
| 967 | Ga0495614_0147956 | 3300048089 | Bacteria | 1047 |
| 968 | Ga0495615_0055265 | 3300048090 | Bacteria | 1033 |
| 969 | Ga0496100_0001589 | 3300048903 | Bacteria | 11190 |
| 970 | Ga0496100_0010967 | 3300048903 | Bacteria | 5142 |
| 971 | Ga0496100_0169109 | 3300048903 | Bacteria | 1572 |
| 972 | Ga0496100_0270443 | 3300048903 | Bacteria | 1263 |
| 973 | Ga0496101_0009861 | 3300048904 | Bacteria | 6292 |
| 974 | Ga0496101_0057632 | 3300048904 | Bacteria | 2810 |
| 975 | Ga0496101_0241609 | 3300048904 | Bacteria | 1405 |
| 976 | Ga0496101_0363146 | 3300048904 | Bacteria | 1138 |
| 977 | Ga0496101_0365362 | 3300048904 | Bacteria | 1135 |
| 978 | Ga0496102_0038711 | 3300048905 | Bacteria | 4305 |
| 979 | Ga0496102_0058140 | 3300048905 | Bacteria | 3532 |
| 980 | Ga0496102_0294986 | 3300048905 | Bacteria | 1528 |
| 981 | Ga0496102_0343096 | 3300048905 | Bacteria | 1406 |
| 982 | Ga0496102_0381817 | 3300048905 | Bacteria | 1326 |
| 983 | Ga0496103_0044117 | 3300048906 | Bacteria | 2746 |
| 984 | Ga0496103_0112598 | 3300048906 | Bacteria | 1729 |
| 985 | Ga0496103_0194201 | 3300048906 | Bacteria | 1305 |
| 986 | Ga0496104_0000311 | 3300048907 | Bacteria | 43387 |
| 987 | Ga0496104_0009349 | 3300048907 | Bacteria | 8718 |
| 988 | Ga0496104_0013664 | 3300048907 | Bacteria | 7320 |
| 989 | Ga0496104_0033322 | 3300048907 | Bacteria | 4798 |
| 990 | Ga0496104_0129894 | 3300048907 | Bacteria | 2420 |
| 991 | Ga0496104_0406085 | 3300048907 | Bacteria | 1274 |
| 992 | Ga0496105_0006002 | 3300048908 | Bacteria | 9278 |
| 993 | Ga0496105_0014977 | 3300048908 | Bacteria | 6171 |
| 994 | Ga0496105_0080525 | 3300048908 | Bacteria | 2690 |
| 995 | Ga0496105_0091271 | 3300048908 | Bacteria | 2515 |
| 996 | Ga0496105_0382335 | 3300048908 | Bacteria | 1120 |
| 997 | Ga0496106_0003164 | 3300048909 | Bacteria | 12292 |
| 998 | Ga0496106_0022817 | 3300048909 | Bacteria | 4649 |
| 999 | Ga0496106_0032219 | 3300048909 | Bacteria | 3907 |
| 1000 | Ga0496106_0335659 | 3300048909 | Bacteria | 1214 |
| 1001 | Ga0496107_0005584 | 3300048910 | Bacteria | 8616 |
| 1002 | Ga0496107_0043194 | 3300048910 | Bacteria | 3238 |
| 1003 | Ga0496107_0053037 | 3300048910 | Bacteria | 2925 |
| 1004 | Ga0496107_0147874 | 3300048910 | Bacteria | 1737 |
| 1005 | Ga0496107_0159415 | 3300048910 | Bacteria | 1672 |
| 1006 | Ga0496108_0010630 | 3300048911 | Bacteria | 7466 |
| 1007 | Ga0496108_0044300 | 3300048911 | Bacteria | 3715 |
| 1008 | Ga0496108_0086659 | 3300048911 | Bacteria | 2658 |
| 1009 | Ga0496109_0091484 | 3300048912 | Bacteria | 2813 |
| 1010 | Ga0496109_0505388 | 3300048912 | Bacteria | 1141 |
| 1011 | Ga0496109_0921889 | 3300048912 | Bacteria | 811 |
| 1012 | Ga0496110_0006378 | 3300048913 | Bacteria | 9328 |
| 1013 | Ga0496110_0007488 | 3300048913 | Bacteria | 8722 |
| 1014 | Ga0496110_0014478 | 3300048913 | Bacteria | 6552 |
| 1015 | Ga0496110_0140581 | 3300048913 | Bacteria | 2182 |
| 1016 | Ga0496110_0175536 | 3300048913 | Bacteria | 1945 |
| 1017 | Ga0496111_0066041 | 3300048914 | Bacteria | 2626 |
| 1018 | Ga0496112_0007190 | 3300048915 | Bacteria | 9862 |
| 1019 | Ga0496112_0028322 | 3300048915 | Bacteria | 5406 |
| 1020 | Ga0496112_0060353 | 3300048915 | Bacteria | 3737 |
| 1021 | Ga0496112_0062681 | 3300048915 | Bacteria | 3668 |
| 1022 | Ga0496112_0073057 | 3300048915 | Bacteria | 3391 |
| 1023 | Ga0496112_0152444 | 3300048915 | Bacteria | 2278 |
| 1024 | Ga0496112_0443252 | 3300048915 | Bacteria | 1236 |
| 1025 | Ga0496113_0047215 | 3300048916 | Bacteria | 3199 |
| 1026 | Ga0496113_0417097 | 3300048916 | Bacteria | 1078 |
| 1027 | Ga0496114_0034874 | 3300048917 | Bacteria | 4153 |
| 1028 | Ga0496114_0090001 | 3300048917 | Bacteria | 2605 |
| 1029 | Ga0496115_0015333 | 3300048918 | Bacteria | 5811 |
| 1030 | Ga0496115_0029287 | 3300048918 | Bacteria | 4323 |
| 1031 | Ga0496115_0050532 | 3300048918 | Bacteria | 3331 |
| 1032 | Ga0496115_0116250 | 3300048918 | Bacteria | 2200 |
| 1033 | Ga0496116_0001796 | 3300048919 | Bacteria | 23307 |
| 1034 | Ga0496116_0006429 | 3300048919 | Bacteria | 10651 |
| 1035 | Ga0496116_0010738 | 3300048919 | Bacteria | 7643 |
| 1036 | Ga0496116_0025017 | 3300048919 | Bacteria | 4399 |
| 1037 | Ga0496117_0012169 | 3300048920 | Bacteria | 7620 |
| 1038 | Ga0496117_0040813 | 3300048920 | Bacteria | 3408 |
| 1039 | Ga0496118_0037860 | 3300048921 | Bacteria | 3874 |
| 1040 | Ga0496118_0071833 | 3300048921 | Bacteria | 2489 |
| 1041 | Ga0496119_0120375 | 3300048922 | Bacteria | 1444 |
| 1042 | Ga0496119_0154257 | 3300048922 | Bacteria | 1228 |
| 1043 | Ga0496120_0248603 | 3300048923 | Bacteria | 836 |
| 1044 | Ga0496121_0017255 | 3300048924 | Bacteria | 7387 |
| 1045 | Ga0496121_0046016 | 3300048924 | Bacteria | 3740 |
| 1046 | Ga0496121_0099426 | 3300048924 | Bacteria | 2248 |
| 1047 | Ga0496122_0011409 | 3300048925 | Bacteria | 8999 |
| 1048 | Ga0496122_0042101 | 3300048925 | Bacteria | 3598 |
| 1049 | Ga0496122_0072861 | 3300048925 | Bacteria | 2439 |
| 1050 | Ga0496122_0079885 | 3300048925 | Bacteria | 2283 |
| 1051 | Ga0496123_0003477 | 3300048926 | Bacteria | 17605 |
| 1052 | Ga0496123_0014908 | 3300048926 | Bacteria | 6408 |
| 1053 | Ga0496123_0031554 | 3300048926 | Bacteria | 3853 |
| 1054 | Ga0496124_0006309 | 3300048927 | Bacteria | 12948 |
| 1055 | Ga0496124_0008251 | 3300048927 | Bacteria | 10923 |
| 1056 | Ga0496124_0022918 | 3300048927 | Bacteria | 5714 |
| 1057 | Ga0496124_0040338 | 3300048927 | Bacteria | 4039 |
| 1058 | Ga0496124_0303193 | 3300048927 | Bacteria | 1152 |
| 1059 | Ga0496125_0002335 | 3300048928 | Bacteria | 24935 |
| 1060 | Ga0496126_0089178 | 3300048929 | Bacteria | 2715 |
| 1061 | Ga0501031_0002030 | 3300049568 | Bacteria | 12744 |
| 1062 | Ga0501031_0167306 | 3300049568 | Bacteria | 1436 |
| 1063 | Ga0501031_0412925 | 3300049568 | Bacteria | 873 |
| 1064 | Ga0501032_0000074 | 3300049569 | Bacteria | 84694 |
| 1065 | Ga0501032_0108696 | 3300049569 | Bacteria | 1836 |
| 1066 | Ga0501033_0000796 | 3300049570 | Bacteria | 28911 |
| 1067 | Ga0501033_0129652 | 3300049570 | Bacteria | 1827 |
| 1068 | Ga0501034_0000249 | 3300049571 | Bacteria | 99562 |
| 1069 | Ga0501034_0000436 | 3300049571 | Bacteria | 69142 |
| 1070 | Ga0501034_0003203 | 3300049571 | Bacteria | 18778 |
| 1071 | Ga0501034_0041027 | 3300049571 | Bacteria | 4682 |
| 1072 | Ga0501034_0049808 | 3300049571 | Bacteria | 4226 |
| 1073 | Ga0501034_0127319 | 3300049571 | Bacteria | 2531 |
| 1074 | Ga0501034_0170870 | 3300049571 | Bacteria | 2141 |
| 1075 | Ga0501034_0267148 | 3300049571 | Bacteria | 1652 |
| 1076 | Ga0501036_0000472 | 3300049572 | Bacteria | 28732 |
| 1077 | Ga0501036_0002786 | 3300049572 | Bacteria | 13844 |
| 1078 | Ga0501036_0020355 | 3300049572 | Bacteria | 5573 |
| 1079 | Ga0501036_0020904 | 3300049572 | Bacteria | 5496 |
| 1080 | Ga0501036_0030645 | 3300049572 | Bacteria | 4543 |
| 1081 | Ga0501036_0052535 | 3300049572 | Bacteria | 3451 |
| 1082 | Ga0501037_0000129 | 3300049573 | Bacteria | 70557 |
| 1083 | Ga0501037_0003344 | 3300049573 | Bacteria | 11656 |
| 1084 | Ga0501037_0003548 | 3300049573 | Bacteria | 11318 |
| 1085 | Ga0501037_0041626 | 3300049573 | Bacteria | 3378 |
| 1086 | Ga0501038_0000202 | 3300049574 | Bacteria | 50972 |
| 1087 | Ga0501038_0001565 | 3300049574 | Bacteria | 21184 |
| 1088 | Ga0501038_0009422 | 3300049574 | Bacteria | 8961 |
| 1089 | Ga0501038_0049417 | 3300049574 | Bacteria | 3636 |
| 1090 | Ga0501038_0056984 | 3300049574 | Bacteria | 3356 |
| 1091 | Ga0501038_0059157 | 3300049574 | Bacteria | 3283 |
| 1092 | Ga0501038_0142330 | 3300049574 | Bacteria | 1961 |
| 1093 | Ga0501039_0000027 | 3300049575 | Bacteria | 150215 |
| 1094 | Ga0501039_0004448 | 3300049575 | Bacteria | 10579 |
| 1095 | Ga0501039_0009471 | 3300049575 | Bacteria | 7425 |
| 1096 | Ga0501039_0292085 | 3300049575 | Bacteria | 1281 |
| 1097 | Ga0501039_0522172 | 3300049575 | Bacteria | 932 |
| 1098 | Ga0501041_0076719 | 3300049577 | Bacteria | 2056 |
| 1099 | Ga0501041_0341204 | 3300049577 | Bacteria | 946 |
| 1100 | Ga0501043_0000047 | 3300049579 | Bacteria | 110659 |
| 1101 | Ga0501043_0050717 | 3300049579 | Bacteria | 3261 |
| 1102 | Ga0501046_0003231 | 3300049580 | Bacteria | 14971 |
| 1103 | Ga0501046_0038661 | 3300049580 | Bacteria | 3827 |
| 1104 | Ga0501047_0000384 | 3300049581 | Bacteria | 49644 |
| 1105 | Ga0501047_0026320 | 3300049581 | Bacteria | 5597 |
| 1106 | Ga0501047_0040982 | 3300049581 | Bacteria | 4477 |
| 1107 | Ga0501047_0043963 | 3300049581 | Bacteria | 4314 |
| 1108 | Ga0501047_0050031 | 3300049581 | Bacteria | 4035 |
| 1109 | Ga0501047_0081713 | 3300049581 | Bacteria | 3106 |
| 1110 | Ga0501047_0234621 | 3300049581 | Bacteria | 1686 |
| 1111 | Ga0501048_0000074 | 3300049582 | Bacteria | 51762 |
| 1112 | Ga0501048_0000302 | 3300049582 | Bacteria | 33455 |
| 1113 | Ga0501048_0004383 | 3300049582 | Bacteria | 10748 |
| 1114 | Ga0501048_0419858 | 3300049582 | Bacteria | 957 |
| 1115 | Ga0501067_0002609 | 3300049583 | Bacteria | 9976 |
| 1116 | Ga0501067_0049133 | 3300049583 | Bacteria | 2338 |
| 1117 | Ga0501068_0030914 | 3300049584 | Bacteria | 3178 |
| 1118 | Ga0501068_0034189 | 3300049584 | Bacteria | 3031 |
| 1119 | Ga0501068_0062769 | 3300049584 | Bacteria | 2260 |
| 1120 | Ga0501069_0258577 | 3300049585 | Bacteria | 1016 |
| 1121 | Ga0501070_0006228 | 3300049586 | Bacteria | 10156 |
| 1122 | Ga0501070_0022527 | 3300049586 | Bacteria | 5277 |
| 1123 | Ga0501070_0058997 | 3300049586 | Bacteria | 3181 |
| 1124 | Ga0501070_0117429 | 3300049586 | Bacteria | 2197 |
| 1125 | Ga0501070_0201742 | 3300049586 | Bacteria | 1633 |
| 1126 | Ga0501071_0027148 | 3300049587 | Bacteria | 4025 |
| 1127 | Ga0501071_0114814 | 3300049587 | Bacteria | 1992 |
| 1128 | Ga0501072_0390934 | 3300049588 | Bacteria | 1103 |
| 1129 | Ga0501073_0002212 | 3300049589 | Bacteria | 14534 |
| 1130 | Ga0501073_0010194 | 3300049589 | Bacteria | 6903 |
| 1131 | Ga0501073_0027419 | 3300049589 | Bacteria | 4073 |
| 1132 | Ga0501073_0047630 | 3300049589 | Bacteria | 3012 |
| 1133 | Ga0501073_0089648 | 3300049589 | Bacteria | 2138 |
| 1134 | Ga0501073_0536421 | 3300049589 | Bacteria | 809 |
| 1135 | Ga0501074_0038453 | 3300049590 | Bacteria | 3467 |
| 1136 | Ga0501075_0116511 | 3300049591 | Bacteria | 2031 |
| 1137 | Ga0501075_0118558 | 3300049591 | Bacteria | 2013 |
| 1138 | Ga0501076_0154071 | 3300049592 | Bacteria | 1870 |
| 1139 | Ga0501076_0630322 | 3300049592 | Bacteria | 885 |
| 1140 | Ga0501077_0010467 | 3300049593 | Bacteria | 5774 |
| 1141 | Ga0501077_0120998 | 3300049593 | Bacteria | 1659 |
| 1142 | Ga0501077_0300785 | 3300049593 | Bacteria | 1022 |
| 1143 | Ga0501079_0026337 | 3300049741 | Bacteria | 4459 |
| 1144 | Ga0501079_0087366 | 3300049741 | Bacteria | 2414 |
| 1145 | Ga0501079_0091637 | 3300049741 | Bacteria | 2355 |
| 1146 | Ga0501079_0279845 | 3300049741 | Bacteria | 1305 |
| 1147 | Ga0501079_0330179 | 3300049741 | Bacteria | 1194 |
| 1148 | Ga0501080_0001148 | 3300049742 | Bacteria | 21848 |
| 1149 | Ga0501080_0026165 | 3300049742 | Bacteria | 5420 |
| 1150 | Ga0501080_0099024 | 3300049742 | Bacteria | 2705 |
| 1151 | Ga0501080_0126654 | 3300049742 | Bacteria | 2365 |
| 1152 | Ga0501083_0003658 | 3300049744 | Bacteria | 10791 |
| 1153 | Ga0501083_0009432 | 3300049744 | Bacteria | 6895 |
| 1154 | Ga0501083_0101265 | 3300049744 | Bacteria | 1899 |
| 1155 | Ga0501035_0000132 | 3300049822 | Bacteria | 90625 |
| 1156 | Ga0501035_0141034 | 3300049822 | Bacteria | 2095 |
| 1157 | Ga0501035_0175644 | 3300049822 | Bacteria | 1848 |
| 1158 | Ga0501044_0000509 | 3300049823 | Bacteria | 47320 |
| 1159 | Ga0501044_0010183 | 3300049823 | Bacteria | 10213 |
| 1160 | Ga0501044_0017087 | 3300049823 | Bacteria | 7785 |
| 1161 | Ga0501044_0023168 | 3300049823 | Bacteria | 6608 |
| 1162 | Ga0501044_0099694 | 3300049823 | Bacteria | 2923 |
| 1163 | Ga0501044_0121115 | 3300049823 | Bacteria | 2617 |
| 1164 | Ga0501044_0124359 | 3300049823 | Bacteria | 2577 |
| 1165 | Ga0501044_0140143 | 3300049823 | Bacteria | 2407 |
| 1166 | Ga0501044_0155855 | 3300049823 | Bacteria | 2263 |
| 1167 | Ga0501044_0243680 | 3300049823 | Bacteria | 1740 |
| 1168 | Ga0501044_0267882 | 3300049823 | Bacteria | 1645 |
| 1169 | Ga0501044_0268553 | 3300049823 | Bacteria | 1642 |
| 1170 | Ga0501045_0008006 | 3300049824 | Bacteria | 7361 |
| 1171 | Ga0501045_0165728 | 3300049824 | Bacteria | 1646 |
| 1172 | Ga0501045_0263972 | 3300049824 | Bacteria | 1282 |
| 1173 | Ga0501045_0495086 | 3300049824 | Bacteria | 908 |
| 1174 | nmdc:mga00v17_357368_c1 | 3300050491 | Bacteria | 949 |
| 1175 | nmdc:mga0yw44_1172_c1 | 3300050492 | Bacteria | 10204 |
| 1176 | nmdc:mga0yw44_29500_c1 | 3300050492 | Bacteria | 3167 |
| 1177 | nmdc:mga0yw44_6325_c1 | 3300050492 | Bacteria | 5713 |
| 1178 | nmdc:mga0k408_10105_c1 | 3300050493 | Bacteria | 5099 |
| 1179 | nmdc:mga0k408_11707_c1 | 3300050493 | Bacteria | 4783 |
| 1180 | nmdc:mga0k408_245651_c1 | 3300050493 | Bacteria | 1069 |
| 1181 | nmdc:mga06z11_161499_c1 | 3300050494 | Bacteria | 1281 |
| 1182 | nmdc:mga06z11_200658_c1 | 3300050494 | Bacteria | 1158 |
| 1183 | nmdc:mga07m45_167326_c1 | 3300050496 | Bacteria | 1277 |
| 1184 | nmdc:mga07m45_325344_c1 | 3300050496 | Bacteria | 894 |
| 1185 | nmdc:mga07m45_33236_c1 | 3300050496 | Bacteria | 2863 |
| 1186 | nmdc:mga07m45_69540_c1 | 3300050496 | Bacteria | 2001 |
| 1187 | nmdc:mga05p37_10714_c1 | 3300050507 | Bacteria | 10882 |
| 1188 | nmdc:mga05p37_17777_c1 | 3300050507 | Bacteria | 8272 |
| 1189 | nmdc:mga05p37_448459_c1 | 3300050507 | Bacteria | 1494 |
| 1190 | nmdc:mga05p37_561174_c1 | 3300050507 | Bacteria | 1297 |
| 1191 | nmdc:mga05p37_960127_c1 | 3300050507 | Bacteria | 913 |
| 1192 | nmdc:mga0qj67_128_c1 | 3300050509 | Bacteria | 50095 |
| 1193 | nmdc:mga0qj67_295557_c1 | 3300050509 | Bacteria | 1312 |
| 1194 | nmdc:mga0qj67_452593_c1 | 3300050509 | Bacteria | 1034 |
| 1195 | nmdc:mga06r32_92563_c1 | 3300050510 | Bacteria | 2956 |
| 1196 | nmdc:mga08y16_173974_c1 | 3300050511 | Bacteria | 2235 |
| 1197 | nmdc:mga08y16_184340_c1 | 3300050511 | Bacteria | 2166 |
| 1198 | nmdc:mga08y16_220666_c1 | 3300050511 | Bacteria | 1963 |
| 1199 | nmdc:mga08y16_313456_c1 | 3300050511 | Bacteria | 1616 |
| 1200 | nmdc:mga08y16_361824_c1 | 3300050511 | Bacteria | 1489 |
| 1201 | nmdc:mga0n895_147647_c1 | 3300050512 | Bacteria | 2381 |
| 1202 | nmdc:mga0n895_173354_c1 | 3300050512 | Bacteria | 2189 |
| 1203 | nmdc:mga0n895_58450_c1 | 3300050512 | Bacteria | 3802 |
| 1204 | nmdc:mga0n895_61493_c1 | 3300050512 | Bacteria | 3708 |
| 1205 | nmdc:mga0n895_773241_c1 | 3300050512 | Bacteria | 952 |
| 1206 | nmdc:mga0rr50_132364_c1 | 3300050513 | Bacteria | 1998 |
| 1207 | nmdc:mga0rr50_452107_c1 | 3300050513 | Bacteria | 1089 |
| 1208 | nmdc:mga0rr50_659953_c1 | 3300050513 | Bacteria | 892 |
| 1209 | nmdc:mga08x19_1357_c1 | 3300050514 | Bacteria | 15172 |
| 1210 | nmdc:mga08x19_80332_c1 | 3300050514 | Bacteria | 2140 |
| 1211 | nmdc:mga0a205_26885_c1 | 3300050515 | Bacteria | 3025 |
| 1212 | nmdc:mga0a205_27393_c1 | 3300050515 | Bacteria | 5443 |
| 1213 | nmdc:mga0a205_323455_c1 | 3300050515 | Bacteria | 1413 |
| 1214 | Ga0495601_0000001 | 3300053077 | Bacteria | 549454 |
| 1215 | Ga0495601_0000436 | 3300053077 | Bacteria | 21835 |
| 1216 | Ga0495601_0000441 | 3300053077 | Bacteria | 21726 |
| 1217 | Ga0495601_0001526 | 3300053077 | Bacteria | 12769 |
| 1218 | Ga0495601_0001594 | 3300053077 | Bacteria | 12527 |
| 1219 | Ga0495601_0095959 | 3300053077 | Bacteria | 1912 |
| 1220 | Ga0495601_0295023 | 3300053077 | Bacteria | 1056 |
| 1221 | Ga0495612_0000003 | 3300053078 | Bacteria | 303629 |
| 1222 | Ga0495612_0000238 | 3300053078 | Bacteria | 23053 |
| 1223 | Ga0495612_0001337 | 3300053078 | Bacteria | 10155 |
| 1224 | Ga0495612_0007090 | 3300053078 | Bacteria | 4586 |
| 1225 | Ga0495612_0008988 | 3300053078 | Bacteria | 4050 |
| 1226 | Ga0495612_0022460 | 3300053078 | Bacteria | 2528 |
| 1227 | Ga0495595_0000569 | 3300053084 | Bacteria | 14156 |
| 1228 | Ga0495595_0002985 | 3300053084 | Bacteria | 6683 |
| 1229 | Ga0495595_0005043 | 3300053084 | Bacteria | 5333 |
| 1230 | Ga0495595_0016582 | 3300053084 | Bacteria | 3155 |
| 1231 | Ga0495595_0037977 | 3300053084 | Bacteria | 2192 |
| 1232 | Ga0495595_0068618 | 3300053084 | Bacteria | 1672 |
| 1233 | Ga0495619_0000004 | 3300053085 | Bacteria | 500068 |
| 1234 | Ga0495619_0000063 | 3300053085 | Bacteria | 84834 |
| 1235 | Ga0495619_0001864 | 3300053085 | Bacteria | 14043 |
| 1236 | Ga0495619_0002658 | 3300053085 | Bacteria | 11687 |
| 1237 | Ga0495619_0004091 | 3300053085 | Bacteria | 9333 |
| 1238 | Ga0495619_0005185 | 3300053085 | Bacteria | 8260 |
| 1239 | Ga0495619_0029031 | 3300053085 | Bacteria | 3571 |
| 1240 | Ga0495619_0072135 | 3300053085 | Bacteria | 2312 |
| 1241 | Ga0495619_0137769 | 3300053085 | Bacteria | 1679 |
| 1242 | Ga0500643_010715 | 3300053087 | Bacteria | 3393 |
| 1243 | Ga0500651_0006750 | 3300053093 | Bacteria | 6645 |
| 1244 | Ga0500566_0043210 | 3300053094 | Bacteria | 2597 |
| 1245 | Ga0500641_0003892 | 3300053096 | Bacteria | 5279 |
| 1246 | Ga0500641_0004747 | 3300053096 | Bacteria | 4808 |
| 1247 | Ga0500555_001006 | 3300053103 | Bacteria | 9625 |
| 1248 | Ga0500562_069493 | 3300053108 | Bacteria | 950 |
| 1249 | Ga0500593_018097 | 3300053117 | Bacteria | 3067 |
| 1250 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 1251 | Ga0500595_011782 | 3300053119 | Bacteria | 3405 |
| 1252 | Ga0500642_0069863 | 3300053130 | Bacteria | 1596 |
| 1253 | Ga0500652_000056 | 3300053131 | Bacteria | 51871 |
| 1254 | Ga0500658_0037202 | 3300053134 | Bacteria | 1935 |
| 1255 | Ga0500559_0005651 | 3300053136 | Bacteria | 5723 |
| 1256 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1257 | Ga0500616_0000441 | 3300053153 | Bacteria | 54819 |
| 1258 | Ga0500616_0056025 | 3300053153 | Bacteria | 2059 |
| 1259 | Ga0500616_0077655 | 3300053153 | Bacteria | 1676 |
| 1260 | Ga0500636_0012034 | 3300053177 | Bacteria | 5068 |
| 1261 | Ga0500645_000592 | 3300053730 | Bacteria | 23396 |
| 1262 | Ga0500601_000399 | 3300053737 | Bacteria | 7445 |
| 1263 | Ga0501084_0139445 | 3300054114 | Bacteria | 2041 |
| 1264 | Ga0501084_0361279 | 3300054114 | Bacteria | 1227 |
| 1265 | Ga0501084_0813697 | 3300054114 | Bacteria | 787 |
| 1266 | Ga0500661_014610 | 3300055283 | Bacteria | 1413 |
| 1267 | Ga0587077_037182 | 3300059493 | Bacteria | 959 |
| 1268 | Ga0501082_0000510 | 3300060353 | Bacteria | 34491 |
| 1269 | Ga0501082_0030808 | 3300060353 | Bacteria | 4624 |
| 1270 | Ga0501082_0061318 | 3300060353 | Bacteria | 3238 |
| 1271 | Ga0501082_0076938 | 3300060353 | Bacteria | 2877 |
| 1272 | Ga0501082_0184800 | 3300060353 | Bacteria | 1814 |
| 1273 | Ga0501082_0202907 | 3300060353 | Bacteria | 1725 |
| 1274 | Ga0501082_0226635 | 3300060353 | Bacteria | 1626 |
| 1275 | Ga0501082_0617968 | 3300060353 | Bacteria | 948 |
| 1276 | Ga0466962_0169587 | 3300061719 | Bacteria | 1062 |
| 1277 | Ga0530510_0083357 | 3300061734 | Bacteria | 2328 |
| 1278 | Ga0530510_0112341 | 3300061734 | Bacteria | 1996 |
| 1279 | Ga0530510_0258438 | 3300061734 | Bacteria | 1298 |
| 1280 | Ga0530510_0584078 | 3300061734 | Bacteria | 849 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2958041894 | 2958049248 | 186 |
| 2 | 3300060353 | Ga0501082_0076938 | Ga0501082_0076938_579_1283 | 201 |
| 3 | 3300037068 | Ga0373925_0281437 | Ga0373925_0281437_470_1189 | 205 |
| 4 | 3300053096 | Ga0500641_0003892 | Ga0500641_0003892_297_1022 | 209 |
| 5 | 3300049571 | Ga0501034_0170870 | Ga0501034_0170870_725_1435 | 210 |
| 6 | 3300039437 | Ga0436365_0853635 | Ga0436365_0853635_17_724 | 211 |
| 7 | 3300005617 | Ga0068859_100596542 | Ga0068859_1005965422 | 212 |
| 8 | 3300005842 | Ga0068858_100226731 | Ga0068858_1002267312 | 212 |
| 9 | 3300006237 | Ga0097621_100309610 | Ga0097621_1003096102 | 212 |
| 10 | 3300006358 | Ga0068871_100015006 | Ga0068871_1000150062 | 212 |
| 11 | 3300006931 | Ga0097620_100596471 | Ga0097620_1005964711 | 212 |
| 12 | 3300009098 | Ga0105245_10007083 | Ga0105245_100070836 | 212 |
| 13 | 3300009551 | Ga0105238_10105024 | Ga0105238_101050244 | 212 |
| 14 | 3300011119 | Ga0105246_10491139 | Ga0105246_104911392 | 212 |
| 15 | 3300014968 | Ga0157379_10572503 | Ga0157379_105725032 | 212 |
| 16 | 3300025899 | Ga0207642_10007393 | Ga0207642_100073933 | 212 |
| 17 | 3300025911 | Ga0207654_10320467 | Ga0207654_103204672 | 212 |
| 18 | 3300025924 | Ga0207694_10487270 | Ga0207694_104872701 | 212 |
| 19 | 3300025927 | Ga0207687_10021525 | Ga0207687_100215252 | 212 |
| 20 | 3300025960 | Ga0207651_10223690 | Ga0207651_102236901 | 212 |
| 21 | 3300025986 | Ga0207658_10176656 | Ga0207658_101766562 | 212 |
| 22 | 3300026035 | Ga0207703_10035397 | Ga0207703_100353971 | 212 |
| 23 | 3300046454 | Ga0495592_0215119 | Ga0495592_0215119_74_781 | 212 |
| 24 | 3300047319 | Ga0495674_0672778 | Ga0495674_0672778_11_718 | 212 |
| 25 | 3300053077 | Ga0495601_0295023 | Ga0495601_0295023_321_1028 | 212 |
| 26 | 3300053108 | Ga0500562_069493 | Ga0500562_069493_161_871 | 212 |
| 27 | 3300050491 | nmdc:mga00v17_357368_c1 | nmdc:mga00v17_357368_c1_32_739 | 213 |
| 28 | 3300013249 | Ga0171463_1004 | Ga0171463_1004240 | 214 |
| 29 | 3300035083 | Ga0373926_0042636 | Ga0373926_0042636_239_949 | 214 |
| 30 | 3300035111 | Ga0373923_0001197 | Ga0373923_0001197_1002_1712 | 214 |
| 31 | 3300035113 | Ga0373936_0003776 | Ga0373936_0003776_136_846 | 214 |
| 32 | 3300035116 | Ga0373945_0014620 | Ga0373945_0014620_194_904 | 214 |
| 33 | 3300035117 | Ga0373953_0002594 | Ga0373953_0002594_3043_3753 | 214 |
| 34 | 3300035118 | Ga0373954_0002810 | Ga0373954_0002810_1369_2079 | 214 |
| 35 | 3300035170 | Ga0373943_0005356 | Ga0373943_0005356_410_1120 | 214 |
| 36 | 3300035171 | Ga0373946_0000831 | Ga0373946_0000831_4152_4862 | 214 |
| 37 | 3300035172 | Ga0373955_0000245 | Ga0373955_0000245_13896_14606 | 214 |
| 38 | 3300035692 | Ga0373935_0000514 | Ga0373935_0000514_13655_14365 | 214 |
| 39 | 3300035695 | Ga0373927_0003594 | Ga0373927_0003594_173_883 | 214 |
| 40 | 3300035724 | Ga0373933_0013404 | Ga0373933_0013404_1961_2671 | 214 |
| 41 | 3300035725 | Ga0373947_0002558 | Ga0373947_0002558_5842_6552 | 214 |
| 42 | 3300036401 | Ga0373937_0000005 | Ga0373937_0000005_112375_113085 | 214 |
| 43 | 3300037068 | Ga0373925_0000007 | Ga0373925_0000007_87108_87818 | 214 |
| 44 | 3300039450 | Ga0436363_0382716 | Ga0436363_0382716_133_924 | 214 |
| 45 | 3300046454 | Ga0495592_0000165 | Ga0495592_0000165_30978_31688 | 214 |
| 46 | 3300046462 | Ga0495651_0000836 | Ga0495651_0000836_21701_22411 | 214 |
| 47 | 3300046463 | Ga0495653_0000103 | Ga0495653_0000103_38089_38799 | 214 |
| 48 | 3300046476 | Ga0495662_0009429 | Ga0495662_0009429_2016_2726 | 214 |
| 49 | 3300046477 | Ga0495664_0000003 | Ga0495664_0000003_471743_472453 | 214 |
| 50 | 3300046511 | Ga0495608_0000072 | Ga0495608_0000072_70472_71182 | 214 |
| 51 | 3300046514 | Ga0495618_0000019 | Ga0495618_0000019_36910_37620 | 214 |
| 52 | 3300046516 | Ga0495628_0000080 | Ga0495628_0000080_30870_31580 | 214 |
| 53 | 3300046517 | Ga0495630_0002294 | Ga0495630_0002294_5726_6436 | 214 |
| 54 | 3300046529 | Ga0495652_0000006 | Ga0495652_0000006_229216_229926 | 214 |
| 55 | 3300046533 | Ga0495640_0000002 | Ga0495640_0000002_415957_416667 | 214 |
| 56 | 3300046535 | Ga0495586_0049358 | Ga0495586_0049358_743_1453 | 214 |
| 57 | 3300046536 | Ga0495587_0000001 | Ga0495587_0000001_488413_489123 | 214 |
| 58 | 3300046543 | Ga0495645_0000284 | Ga0495645_0000284_30724_31434 | 214 |
| 59 | 3300046559 | Ga0495667_0000021 | Ga0495667_0000021_92890_93600 | 214 |
| 60 | 3300046642 | Ga0495634_0000396 | Ga0495634_0000396_11531_12241 | 214 |
| 61 | 3300046663 | Ga0495635_0000001 | Ga0495635_0000001_474224_474934 | 214 |
| 62 | 3300046675 | Ga0495657_0000088 | Ga0495657_0000088_28292_29002 | 214 |
| 63 | 3300046678 | Ga0495599_0000025 | Ga0495599_0000025_88691_89401 | 214 |
| 64 | 3300046679 | Ga0495623_0000058 | Ga0495623_0000058_51346_52056 | 214 |
| 65 | 3300046680 | Ga0495646_0000003 | Ga0495646_0000003_52212_52922 | 214 |
| 66 | 3300046683 | Ga0495658_0247448 | Ga0495658_0247448_113_823 | 214 |
| 67 | 3300046689 | Ga0495613_0019425 | Ga0495613_0019425_1760_2470 | 214 |
| 68 | 3300046690 | Ga0495624_0019928 | Ga0495624_0019928_2637_3347 | 214 |
| 69 | 3300046690 | Ga0495624_0402183 | Ga0495624_0402183_101_811 | 214 |
| 70 | 3300046809 | Ga0495600_0000042 | Ga0495600_0000042_68453_69163 | 214 |
| 71 | 3300047315 | Ga0495581_0008088 | Ga0495581_0008088_1011_1721 | 214 |
| 72 | 3300047317 | Ga0495604_0000008 | Ga0495604_0000008_30911_31621 | 214 |
| 73 | 3300047319 | Ga0495674_0000028 | Ga0495674_0000028_93018_93728 | 214 |
| 74 | 3300047322 | Ga0495680_0000711 | Ga0495680_0000711_5712_6422 | 214 |
| 75 | 3300047444 | Ga0495675_0001942 | Ga0495675_0001942_5908_6618 | 214 |
| 76 | 3300047471 | Ga0495684_0000002 | Ga0495684_0000002_30969_31679 | 214 |
| 77 | 3300047673 | Ga0495593_0003093 | Ga0495593_0003093_5339_6049 | 214 |
| 78 | 3300048088 | Ga0495602_0000468 | Ga0495602_0000468_30976_31686 | 214 |
| 79 | 3300049568 | Ga0501031_0167306 | Ga0501031_0167306_612_1322 | 214 |
| 80 | 3300049574 | Ga0501038_0049417 | Ga0501038_0049417_2745_3455 | 214 |
| 81 | 3300053077 | Ga0495601_0000001 | Ga0495601_0000001_70469_71179 | 214 |
| 82 | 3300053078 | Ga0495612_0000003 | Ga0495612_0000003_271926_272636 | 214 |
| 83 | 3300053084 | Ga0495595_0000569 | Ga0495595_0000569_5656_6366 | 214 |
| 84 | 3300053085 | Ga0495619_0000004 | Ga0495619_0000004_70500_71210 | 214 |
| 85 | iso_pu_bacteria | 8054563764 | 8054568546 | 214 |
| 86 | 3300035121 | Ga0373960_0002152 | Ga0373960_0002152_68_781 | 215 |
| 87 | 3300049570 | Ga0501033_0129652 | Ga0501033_0129652_846_1571 | 215 |
| 88 | 3300049571 | Ga0501034_0267148 | Ga0501034_0267148_207_932 | 215 |
| 89 | 3300049572 | Ga0501036_0020904 | Ga0501036_0020904_4157_4882 | 215 |
| 90 | 3300049573 | Ga0501037_0003548 | Ga0501037_0003548_7912_8637 | 215 |
| 91 | 3300049574 | Ga0501038_0001565 | Ga0501038_0001565_6992_7717 | 215 |
| 92 | 3300049575 | Ga0501039_0004448 | Ga0501039_0004448_9624_10349 | 215 |
| 93 | 3300049580 | Ga0501046_0003231 | Ga0501046_0003231_6156_6881 | 215 |
| 94 | 3300049582 | Ga0501048_0004383 | Ga0501048_0004383_9439_10164 | 215 |
| 95 | 3300049583 | Ga0501067_0002609 | Ga0501067_0002609_4293_5018 | 215 |
| 96 | 3300049584 | Ga0501068_0034189 | Ga0501068_0034189_89_814 | 215 |
| 97 | 3300049586 | Ga0501070_0117429 | Ga0501070_0117429_499_1224 | 215 |
| 98 | 3300049587 | Ga0501071_0027148 | Ga0501071_0027148_1391_2116 | 215 |
| 99 | 3300049589 | Ga0501073_0002212 | Ga0501073_0002212_257_982 | 215 |
| 100 | 3300049741 | Ga0501079_0091637 | Ga0501079_0091637_814_1539 | 215 |
| 101 | 3300049742 | Ga0501080_0126654 | Ga0501080_0126654_615_1340 | 215 |
| 102 | 3300049823 | Ga0501044_0243680 | Ga0501044_0243680_809_1534 | 215 |
| 103 | 3300049824 | Ga0501045_0008006 | Ga0501045_0008006_73_798 | 215 |
| 104 | 3300060353 | Ga0501082_0030808 | Ga0501082_0030808_2151_2876 | 215 |
| 105 | 3300061734 | Ga0530510_0584078 | Ga0530510_0584078_61_786 | 215 |
| 106 | iso_pu_bacteria | 2508501122 | 2509109615 | 215 |
| 107 | iso_pu_bacteria | 2510065057 | 2510306747 | 215 |
| 108 | iso_pu_bacteria | 2510917026 | 2511175729 | 215 |
| 109 | iso_pu_bacteria | 2511231052 | 2511498517 | 215 |
| 110 | iso_pu_bacteria | 2558860983 | 2561467160 | 215 |
| 111 | iso_pu_bacteria | 2585427633 | 2585997833 | 215 |
| 112 | iso_pu_bacteria | 2585427634 | 2586002419 | 215 |
| 113 | iso_pu_bacteria | 2791355092 | 2792628868 | 215 |
| 114 | iso_pu_bacteria | 2854896431 | 2854901676 | 215 |
| 115 | iso_pu_bacteria | 2919171160 | 2919175731 | 215 |
| 116 | iso_pu_bacteria | 2941499720 | 2941501399 | 215 |
| 117 | iso_pu_bacteria | 8018150411 | 8018153423 | 215 |
| 118 | 3300005333 | Ga0070677_10160182 | Ga0070677_101601822 | 216 |
| 119 | 3300005336 | Ga0070680_100509879 | Ga0070680_1005098791 | 216 |
| 120 | 3300005343 | Ga0070687_100024918 | Ga0070687_1000249182 | 216 |
| 121 | 3300005353 | Ga0070669_100350916 | Ga0070669_1003509162 | 216 |
| 122 | 3300005356 | Ga0070674_100135566 | Ga0070674_1001355662 | 216 |
| 123 | 3300005365 | Ga0070688_100022333 | Ga0070688_1000223334 | 216 |
| 124 | 3300005434 | Ga0070709_10251918 | Ga0070709_102519182 | 216 |
| 125 | 3300005436 | Ga0070713_100013740 | Ga0070713_1000137402 | 216 |
| 126 | 3300005436 | Ga0070713_100549168 | Ga0070713_1005491682 | 216 |
| 127 | 3300005439 | Ga0070711_100141673 | Ga0070711_1001416731 | 216 |
| 128 | 3300005439 | Ga0070711_100164775 | Ga0070711_1001647752 | 216 |
| 129 | 3300005455 | Ga0070663_100116276 | Ga0070663_1001162762 | 216 |
| 130 | 3300005458 | Ga0070681_10105326 | Ga0070681_101053263 | 216 |
| 131 | 3300005458 | Ga0070681_10368448 | Ga0070681_103684482 | 216 |
| 132 | 3300005459 | Ga0068867_100027781 | Ga0068867_1000277814 | 216 |
| 133 | 3300005530 | Ga0070679_100112073 | Ga0070679_1001120733 | 216 |
| 134 | 3300005548 | Ga0070665_100582611 | Ga0070665_1005826112 | 216 |
| 135 | 3300005617 | Ga0068859_100130968 | Ga0068859_1001309682 | 216 |
| 136 | 3300005618 | Ga0068864_100144389 | Ga0068864_1001443892 | 216 |
| 137 | 3300005983 | Ga0081540_1003343 | Ga0081540_10033433 | 216 |
| 138 | 3300006028 | Ga0070717_10189664 | Ga0070717_101896642 | 216 |
| 139 | 3300006038 | Ga0075365_10001359 | Ga0075365_1000135912 | 216 |
| 140 | 3300006163 | Ga0070715_10113237 | Ga0070715_101132372 | 216 |
| 141 | 3300006195 | Ga0075366_10056646 | Ga0075366_100566462 | 216 |
| 142 | 3300006237 | Ga0097621_100463884 | Ga0097621_1004638841 | 216 |
| 143 | 3300006852 | Ga0075433_10086392 | Ga0075433_100863923 | 216 |
| 144 | 3300006871 | Ga0075434_100116001 | Ga0075434_1001160013 | 216 |
| 145 | 3300006881 | Ga0068865_100203962 | Ga0068865_1002039621 | 216 |
| 146 | 3300006914 | Ga0075436_100202613 | Ga0075436_1002026132 | 216 |
| 147 | 3300006931 | Ga0097620_100130968 | Ga0097620_1001309682 | 216 |
| 148 | 3300007076 | Ga0075435_100171625 | Ga0075435_1001716252 | 216 |
| 149 | 3300009094 | Ga0111539_10130687 | Ga0111539_101306873 | 216 |
| 150 | 3300009174 | Ga0105241_10325777 | Ga0105241_103257772 | 216 |
| 151 | 3300009177 | Ga0105248_10024110 | Ga0105248_100241106 | 216 |
| 152 | 3300013104 | Ga0157370_10126008 | Ga0157370_101260082 | 216 |
| 153 | 3300013297 | Ga0157378_10084666 | Ga0157378_100846663 | 216 |
| 154 | 3300013306 | Ga0163162_10437877 | Ga0163162_104378772 | 216 |
| 155 | 3300025906 | Ga0207699_10326631 | Ga0207699_103266311 | 216 |
| 156 | 3300025906 | Ga0207699_10446266 | Ga0207699_104462661 | 216 |
| 157 | 3300025912 | Ga0207707_10060719 | Ga0207707_100607192 | 216 |
| 158 | 3300025912 | Ga0207707_10363668 | Ga0207707_103636681 | 216 |
| 159 | 3300025915 | Ga0207693_10083746 | Ga0207693_100837463 | 216 |
| 160 | 3300025916 | Ga0207663_10089420 | Ga0207663_100894202 | 216 |
| 161 | 3300025921 | Ga0207652_10308290 | Ga0207652_103082902 | 216 |
| 162 | 3300025921 | Ga0207652_10562239 | Ga0207652_105622392 | 216 |
| 163 | 3300025928 | Ga0207700_10033806 | Ga0207700_100338064 | 216 |
| 164 | 3300025934 | Ga0207686_10181464 | Ga0207686_101814642 | 216 |
| 165 | 3300025937 | Ga0207669_10247152 | Ga0207669_102471521 | 216 |
| 166 | 3300025938 | Ga0207704_10166503 | Ga0207704_101665031 | 216 |
| 167 | 3300025939 | Ga0207665_10104873 | Ga0207665_101048732 | 216 |
| 168 | 3300025941 | Ga0207711_10013853 | Ga0207711_100138536 | 216 |
| 169 | 3300025949 | Ga0207667_10401627 | Ga0207667_104016272 | 216 |
| 170 | 3300025961 | Ga0207712_10258379 | Ga0207712_102583792 | 216 |
| 171 | 3300025986 | Ga0207658_10204159 | Ga0207658_102041591 | 216 |
| 172 | 3300026067 | Ga0207678_10024906 | Ga0207678_100249066 | 216 |
| 173 | 3300026089 | Ga0207648_10040324 | Ga0207648_100403242 | 216 |
| 174 | 3300026095 | Ga0207676_10070676 | Ga0207676_100706762 | 216 |
| 175 | 3300028381 | Ga0268264_10529318 | Ga0268264_105293182 | 216 |
| 176 | 3300028800 | Ga0265338_10217329 | Ga0265338_102173291 | 216 |
| 177 | 3300031241 | Ga0265325_10000162 | Ga0265325_1000016240 | 216 |
| 178 | 3300031249 | Ga0265339_10064128 | Ga0265339_100641283 | 216 |
| 179 | 3300031548 | Ga0307408_100416972 | Ga0307408_1004169722 | 216 |
| 180 | 3300031595 | Ga0265313_10044247 | Ga0265313_100442471 | 216 |
| 181 | 3300032004 | Ga0307414_10454691 | Ga0307414_104546912 | 216 |
| 182 | 3300035083 | Ga0373926_0013371 | Ga0373926_0013371_1698_2423 | 216 |
| 183 | 3300035089 | Ga0373944_0077766 | Ga0373944_0077766_147_872 | 216 |
| 184 | 3300035092 | Ga0373952_0044723 | Ga0373952_0044723_85_810 | 216 |
| 185 | 3300035112 | Ga0373932_0115549 | Ga0373932_0115549_101_826 | 216 |
| 186 | 3300035114 | Ga0373939_0069833 | Ga0373939_0069833_276_1001 | 216 |
| 187 | 3300035116 | Ga0373945_0043837 | Ga0373945_0043837_820_1545 | 216 |
| 188 | 3300035118 | Ga0373954_0130741 | Ga0373954_0130741_168_893 | 216 |
| 189 | 3300035119 | Ga0373956_0012834 | Ga0373956_0012834_2318_3043 | 216 |
| 190 | 3300035170 | Ga0373943_0169117 | Ga0373943_0169117_31_756 | 216 |
| 191 | 3300035171 | Ga0373946_0047849 | Ga0373946_0047849_791_1516 | 216 |
| 192 | 3300035172 | Ga0373955_0026576 | Ga0373955_0026576_298_1023 | 216 |
| 193 | 3300035172 | Ga0373955_0053551 | Ga0373955_0053551_793_1518 | 216 |
| 194 | 3300035241 | Ga0373961_0004207 | Ga0373961_0004207_187_912 | 216 |
| 195 | 3300035691 | Ga0373931_0009777 | Ga0373931_0009777_2003_2728 | 216 |
| 196 | 3300035691 | Ga0373931_0109768 | Ga0373931_0109768_274_999 | 216 |
| 197 | 3300035691 | Ga0373931_0217475 | Ga0373931_0217475_332_1057 | 216 |
| 198 | 3300035724 | Ga0373933_0007091 | Ga0373933_0007091_5327_6052 | 216 |
| 199 | 3300035724 | Ga0373933_0134085 | Ga0373933_0134085_558_1283 | 216 |
| 200 | 3300035725 | Ga0373947_0134997 | Ga0373947_0134997_248_973 | 216 |
| 201 | 3300036401 | Ga0373937_0017483 | Ga0373937_0017483_1993_2718 | 216 |
| 202 | 3300036401 | Ga0373937_0041928 | Ga0373937_0041928_1774_2499 | 216 |
| 203 | 3300036401 | Ga0373937_0078240 | Ga0373937_0078240_1751_2476 | 216 |
| 204 | 3300037068 | Ga0373925_0076180 | Ga0373925_0076180_656_1381 | 216 |
| 205 | 3300039062 | Ga0400483_057704 | Ga0400483_057704_820_1545 | 216 |
| 206 | 3300039062 | Ga0400483_185859 | Ga0400483_185859_1364_2089 | 216 |
| 207 | 3300039062 | Ga0400483_228929 | Ga0400483_228929_21793_22518 | 216 |
| 208 | 3300039437 | Ga0436365_0563707 | Ga0436365_0563707_213_950 | 216 |
| 209 | 3300046454 | Ga0495592_0114599 | Ga0495592_0114599_858_1583 | 216 |
| 210 | 3300046454 | Ga0495592_0204443 | Ga0495592_0204443_248_973 | 216 |
| 211 | 3300046455 | Ga0495603_0227915 | Ga0495603_0227915_321_1046 | 216 |
| 212 | 3300046459 | Ga0495629_0102696 | Ga0495629_0102696_996_1721 | 216 |
| 213 | 3300046461 | Ga0495641_0042091 | Ga0495641_0042091_1382_2107 | 216 |
| 214 | 3300046462 | Ga0495651_0144049 | Ga0495651_0144049_113_838 | 216 |
| 215 | 3300046474 | Ga0495605_0219105 | Ga0495605_0219105_11_736 | 216 |
| 216 | 3300046475 | Ga0495639_0024480 | Ga0495639_0024480_1462_2187 | 216 |
| 217 | 3300046477 | Ga0495664_0102269 | Ga0495664_0102269_135_860 | 216 |
| 218 | 3300046516 | Ga0495628_0011369 | Ga0495628_0011369_2017_2742 | 216 |
| 219 | 3300046516 | Ga0495628_0052125 | Ga0495628_0052125_1062_1787 | 216 |
| 220 | 3300046526 | Ga0495666_0036055 | Ga0495666_0036055_261_986 | 216 |
| 221 | 3300046529 | Ga0495652_0002263 | Ga0495652_0002263_10098_10823 | 216 |
| 222 | 3300046531 | Ga0495665_0226647 | Ga0495665_0226647_182_907 | 216 |
| 223 | 3300046533 | Ga0495640_0023878 | Ga0495640_0023878_2296_3021 | 216 |
| 224 | 3300046533 | Ga0495640_0109377 | Ga0495640_0109377_184_909 | 216 |
| 225 | 3300046536 | Ga0495587_0110028 | Ga0495587_0110028_807_1532 | 216 |
| 226 | 3300046543 | Ga0495645_0004817 | Ga0495645_0004817_7269_7994 | 216 |
| 227 | 3300046543 | Ga0495645_0087084 | Ga0495645_0087084_921_1646 | 216 |
| 228 | 3300046559 | Ga0495667_0083496 | Ga0495667_0083496_673_1398 | 216 |
| 229 | 3300046642 | Ga0495634_0353951 | Ga0495634_0353951_128_853 | 216 |
| 230 | 3300046663 | Ga0495635_0018165 | Ga0495635_0018165_2787_3512 | 216 |
| 231 | 3300046663 | Ga0495635_0020590 | Ga0495635_0020590_2886_3611 | 216 |
| 232 | 3300046663 | Ga0495635_0405216 | Ga0495635_0405216_125_850 | 216 |
| 233 | 3300046675 | Ga0495657_0034710 | Ga0495657_0034710_2475_3200 | 216 |
| 234 | 3300046675 | Ga0495657_0306561 | Ga0495657_0306561_193_918 | 216 |
| 235 | 3300046678 | Ga0495599_0024129 | Ga0495599_0024129_1163_1888 | 216 |
| 236 | 3300046679 | Ga0495623_0003236 | Ga0495623_0003236_182_907 | 216 |
| 237 | 3300046681 | Ga0495647_0039384 | Ga0495647_0039384_1018_1743 | 216 |
| 238 | 3300046681 | Ga0495647_0103155 | Ga0495647_0103155_133_858 | 216 |
| 239 | 3300046809 | Ga0495600_0049453 | Ga0495600_0049453_772_1497 | 216 |
| 240 | 3300046809 | Ga0495600_0281681 | Ga0495600_0281681_192_917 | 216 |
| 241 | 3300047317 | Ga0495604_0005468 | Ga0495604_0005468_2601_3326 | 216 |
| 242 | 3300047317 | Ga0495604_0077274 | Ga0495604_0077274_1753_2478 | 216 |
| 243 | 3300047319 | Ga0495674_0018921 | Ga0495674_0018921_4532_5257 | 216 |
| 244 | 3300047319 | Ga0495674_0102023 | Ga0495674_0102023_140_865 | 216 |
| 245 | 3300047319 | Ga0495674_0308239 | Ga0495674_0308239_184_909 | 216 |
| 246 | 3300047321 | Ga0495676_0114954 | Ga0495676_0114954_1100_1825 | 216 |
| 247 | 3300047322 | Ga0495680_0016511 | Ga0495680_0016511_3526_4251 | 216 |
| 248 | 3300047322 | Ga0495680_0142257 | Ga0495680_0142257_469_1194 | 216 |
| 249 | 3300047322 | Ga0495680_0350950 | Ga0495680_0350950_167_892 | 216 |
| 250 | 3300047471 | Ga0495684_0059336 | Ga0495684_0059336_865_1590 | 216 |
| 251 | 3300047673 | Ga0495593_0154447 | Ga0495593_0154447_290_1015 | 216 |
| 252 | 3300048088 | Ga0495602_0014643 | Ga0495602_0014643_4757_5482 | 216 |
| 253 | 3300048089 | Ga0495614_0147956 | Ga0495614_0147956_67_792 | 216 |
| 254 | 3300048903 | Ga0496100_0001589 | Ga0496100_0001589_9252_9977 | 216 |
| 255 | 3300048904 | Ga0496101_0009861 | Ga0496101_0009861_555_1280 | 216 |
| 256 | 3300048904 | Ga0496101_0057632 | Ga0496101_0057632_1463_2188 | 216 |
| 257 | 3300048904 | Ga0496101_0363146 | Ga0496101_0363146_260_985 | 216 |
| 258 | 3300048905 | Ga0496102_0294986 | Ga0496102_0294986_725_1450 | 216 |
| 259 | 3300048905 | Ga0496102_0343096 | Ga0496102_0343096_97_822 | 216 |
| 260 | 3300048906 | Ga0496103_0112598 | Ga0496103_0112598_175_900 | 216 |
| 261 | 3300048907 | Ga0496104_0000311 | Ga0496104_0000311_17361_18086 | 216 |
| 262 | 3300048907 | Ga0496104_0129894 | Ga0496104_0129894_941_1666 | 216 |
| 263 | 3300048907 | Ga0496104_0406085 | Ga0496104_0406085_487_1212 | 216 |
| 264 | 3300048908 | Ga0496105_0014977 | Ga0496105_0014977_1341_2066 | 216 |
| 265 | 3300048908 | Ga0496105_0080525 | Ga0496105_0080525_662_1387 | 216 |
| 266 | 3300048908 | Ga0496105_0091271 | Ga0496105_0091271_1463_2188 | 216 |
| 267 | 3300048910 | Ga0496107_0043194 | Ga0496107_0043194_719_1444 | 216 |
| 268 | 3300048910 | Ga0496107_0147874 | Ga0496107_0147874_507_1232 | 216 |
| 269 | 3300048911 | Ga0496108_0044300 | Ga0496108_0044300_546_1271 | 216 |
| 270 | 3300048913 | Ga0496110_0014478 | Ga0496110_0014478_2593_3318 | 216 |
| 271 | 3300048914 | Ga0496111_0066041 | Ga0496111_0066041_425_1150 | 216 |
| 272 | 3300048915 | Ga0496112_0007190 | Ga0496112_0007190_7072_7797 | 216 |
| 273 | 3300048915 | Ga0496112_0062681 | Ga0496112_0062681_1799_2524 | 216 |
| 274 | 3300048917 | Ga0496114_0090001 | Ga0496114_0090001_140_865 | 216 |
| 275 | 3300048918 | Ga0496115_0029287 | Ga0496115_0029287_3552_4277 | 216 |
| 276 | 3300048918 | Ga0496115_0050532 | Ga0496115_0050532_1539_2264 | 216 |
| 277 | 3300049571 | Ga0501034_0049808 | Ga0501034_0049808_2567_3283 | 216 |
| 278 | 3300049575 | Ga0501039_0292085 | Ga0501039_0292085_237_962 | 216 |
| 279 | 3300049577 | Ga0501041_0341204 | Ga0501041_0341204_123_848 | 216 |
| 280 | 3300049582 | Ga0501048_0419858 | Ga0501048_0419858_76_801 | 216 |
| 281 | 3300049587 | Ga0501071_0114814 | Ga0501071_0114814_943_1668 | 216 |
| 282 | 3300049588 | Ga0501072_0390934 | Ga0501072_0390934_155_880 | 216 |
| 283 | 3300049589 | Ga0501073_0089648 | Ga0501073_0089648_1308_2024 | 216 |
| 284 | 3300049591 | Ga0501075_0116511 | Ga0501075_0116511_704_1429 | 216 |
| 285 | 3300049591 | Ga0501075_0118558 | Ga0501075_0118558_284_1009 | 216 |
| 286 | 3300049592 | Ga0501076_0154071 | Ga0501076_0154071_304_1029 | 216 |
| 287 | 3300049741 | Ga0501079_0087366 | Ga0501079_0087366_1316_2041 | 216 |
| 288 | 3300049741 | Ga0501079_0279845 | Ga0501079_0279845_109_834 | 216 |
| 289 | 3300049824 | Ga0501045_0495086 | Ga0501045_0495086_152_877 | 216 |
| 290 | 3300050492 | nmdc:mga0yw44_6325_c1 | nmdc:mga0yw44_6325_c1_149_874 | 216 |
| 291 | 3300050493 | nmdc:mga0k408_10105_c1 | nmdc:mga0k408_10105_c1_3135_3860 | 216 |
| 292 | 3300050493 | nmdc:mga0k408_11707_c1 | nmdc:mga0k408_11707_c1_430_1155 | 216 |
| 293 | 3300050494 | nmdc:mga06z11_200658_c1 | nmdc:mga06z11_200658_c1_338_1063 | 216 |
| 294 | 3300050496 | nmdc:mga07m45_33236_c1 | nmdc:mga07m45_33236_c1_1934_2659 | 216 |
| 295 | 3300050512 | nmdc:mga0n895_173354_c1 | nmdc:mga0n895_173354_c1_390_1115 | 216 |
| 296 | 3300050513 | nmdc:mga0rr50_132364_c1 | nmdc:mga0rr50_132364_c1_466_1191 | 216 |
| 297 | 3300050515 | nmdc:mga0a205_27393_c1 | nmdc:mga0a205_27393_c1_1172_1897 | 216 |
| 298 | 3300053077 | Ga0495601_0000436 | Ga0495601_0000436_8466_9191 | 216 |
| 299 | 3300053077 | Ga0495601_0000441 | Ga0495601_0000441_645_1370 | 216 |
| 300 | 3300053077 | Ga0495601_0001594 | Ga0495601_0001594_7542_8267 | 216 |
| 301 | 3300053078 | Ga0495612_0000238 | Ga0495612_0000238_13301_14026 | 216 |
| 302 | 3300053078 | Ga0495612_0007090 | Ga0495612_0007090_74_799 | 216 |
| 303 | 3300053078 | Ga0495612_0022460 | Ga0495612_0022460_1252_1977 | 216 |
| 304 | 3300053084 | Ga0495595_0005043 | Ga0495595_0005043_1169_1894 | 216 |
| 305 | 3300053084 | Ga0495595_0016582 | Ga0495595_0016582_558_1283 | 216 |
| 306 | 3300053084 | Ga0495595_0037977 | Ga0495595_0037977_107_832 | 216 |
| 307 | 3300053085 | Ga0495619_0000063 | Ga0495619_0000063_11835_12560 | 216 |
| 308 | 3300053085 | Ga0495619_0004091 | Ga0495619_0004091_6780_7505 | 216 |
| 309 | 3300053085 | Ga0495619_0029031 | Ga0495619_0029031_1221_1946 | 216 |
| 310 | 3300053085 | Ga0495619_0072135 | Ga0495619_0072135_769_1494 | 216 |
| 311 | 3300053117 | Ga0500593_018097 | Ga0500593_018097_37_762 | 216 |
| 312 | 3300054114 | Ga0501084_0361279 | Ga0501084_0361279_305_1030 | 216 |
| 313 | 3300054114 | Ga0501084_0813697 | Ga0501084_0813697_25_750 | 216 |
| 314 | 3300060353 | Ga0501082_0226635 | Ga0501082_0226635_32_757 | 216 |
| 315 | 3300061734 | Ga0530510_0083357 | Ga0530510_0083357_1145_1870 | 216 |
| 316 | 3300061734 | Ga0530510_0112341 | Ga0530510_0112341_1106_1831 | 216 |
| 317 | 3300061734 | Ga0530510_0258438 | Ga0530510_0258438_336_1061 | 216 |
| 318 | iso_pu_bacteria | 2829745981 | 2829746079 | 216 |
| 319 | 3300002239 | JGI24034J26672_10034825 | JGI24034J26672_100348251 | 217 |
| 320 | 3300005327 | Ga0070658_10006314 | Ga0070658_100063146 | 217 |
| 321 | 3300005328 | Ga0070676_10014503 | Ga0070676_100145035 | 217 |
| 322 | 3300005329 | Ga0070683_100048470 | Ga0070683_1000484702 | 217 |
| 323 | 3300005329 | Ga0070683_100298148 | Ga0070683_1002981483 | 217 |
| 324 | 3300005330 | Ga0070690_100098133 | Ga0070690_1000981334 | 217 |
| 325 | 3300005334 | Ga0068869_100042291 | Ga0068869_1000422913 | 217 |
| 326 | 3300005335 | Ga0070666_10083329 | Ga0070666_100833292 | 217 |
| 327 | 3300005336 | Ga0070680_100002836 | Ga0070680_10000283611 | 217 |
| 328 | 3300005339 | Ga0070660_100029666 | Ga0070660_1000296662 | 217 |
| 329 | 3300005339 | Ga0070660_100169739 | Ga0070660_1001697392 | 217 |
| 330 | 3300005344 | Ga0070661_100065654 | Ga0070661_1000656542 | 217 |
| 331 | 3300005354 | Ga0070675_100106888 | Ga0070675_1001068882 | 217 |
| 332 | 3300005355 | Ga0070671_100027164 | Ga0070671_1000271643 | 217 |
| 333 | 3300005364 | Ga0070673_100046607 | Ga0070673_1000466072 | 217 |
| 334 | 3300005365 | Ga0070688_100007841 | Ga0070688_1000078414 | 217 |
| 335 | 3300005367 | Ga0070667_100014555 | Ga0070667_1000145551 | 217 |
| 336 | 3300005434 | Ga0070709_10013751 | Ga0070709_100137513 | 217 |
| 337 | 3300005435 | Ga0070714_100122525 | Ga0070714_1001225252 | 217 |
| 338 | 3300005436 | Ga0070713_100017477 | Ga0070713_1000174775 | 217 |
| 339 | 3300005436 | Ga0070713_100179817 | Ga0070713_1001798172 | 217 |
| 340 | 3300005437 | Ga0070710_10047902 | Ga0070710_100479023 | 217 |
| 341 | 3300005438 | Ga0070701_10033348 | Ga0070701_100333483 | 217 |
| 342 | 3300005439 | Ga0070711_100181748 | Ga0070711_1001817481 | 217 |
| 343 | 3300005456 | Ga0070678_100072545 | Ga0070678_1000725454 | 217 |
| 344 | 3300005457 | Ga0070662_100456839 | Ga0070662_1004568391 | 217 |
| 345 | 3300005458 | Ga0070681_10078648 | Ga0070681_100786481 | 217 |
| 346 | 3300005466 | Ga0070685_10006441 | Ga0070685_100064415 | 217 |
| 347 | 3300005530 | Ga0070679_100042577 | Ga0070679_1000425776 | 217 |
| 348 | 3300005530 | Ga0070679_100545260 | Ga0070679_1005452602 | 217 |
| 349 | 3300005539 | Ga0068853_100502907 | Ga0068853_1005029072 | 217 |
| 350 | 3300005543 | Ga0070672_100798134 | Ga0070672_1007981341 | 217 |
| 351 | 3300005544 | Ga0070686_100018983 | Ga0070686_1000189832 | 217 |
| 352 | 3300005547 | Ga0070693_100078684 | Ga0070693_1000786842 | 217 |
| 353 | 3300005548 | Ga0070665_100609835 | Ga0070665_1006098351 | 217 |
| 354 | 3300005563 | Ga0068855_100048582 | Ga0068855_1000485825 | 217 |
| 355 | 3300005563 | Ga0068855_100108304 | Ga0068855_1001083044 | 217 |
| 356 | 3300005563 | Ga0068855_100157729 | Ga0068855_1001577292 | 217 |
| 357 | 3300005564 | Ga0070664_100146232 | Ga0070664_1001462323 | 217 |
| 358 | 3300005577 | Ga0068857_100359504 | Ga0068857_1003595042 | 217 |
| 359 | 3300005614 | Ga0068856_100318837 | Ga0068856_1003188372 | 217 |
| 360 | 3300005614 | Ga0068856_100824585 | Ga0068856_1008245852 | 217 |
| 361 | 3300005616 | Ga0068852_100051991 | Ga0068852_1000519912 | 217 |
| 362 | 3300005616 | Ga0068852_100052192 | Ga0068852_1000521922 | 217 |
| 363 | 3300005616 | Ga0068852_100163143 | Ga0068852_1001631432 | 217 |
| 364 | 3300005617 | Ga0068859_100017208 | Ga0068859_1000172089 | 217 |
| 365 | 3300005618 | Ga0068864_100037945 | Ga0068864_1000379451 | 217 |
| 366 | 3300005718 | Ga0068866_10045382 | Ga0068866_100453822 | 217 |
| 367 | 3300005719 | Ga0068861_100053737 | Ga0068861_1000537373 | 217 |
| 368 | 3300005834 | Ga0068851_10051665 | Ga0068851_100516652 | 217 |
| 369 | 3300005841 | Ga0068863_100017793 | Ga0068863_1000177934 | 217 |
| 370 | 3300005842 | Ga0068858_100444807 | Ga0068858_1004448071 | 217 |
| 371 | 3300005843 | Ga0068860_100571721 | Ga0068860_1005717212 | 217 |
| 372 | 3300005843 | Ga0068860_100728360 | Ga0068860_1007283602 | 217 |
| 373 | 3300005844 | Ga0068862_100021405 | Ga0068862_1000214055 | 217 |
| 374 | 3300006028 | Ga0070717_10035744 | Ga0070717_100357445 | 217 |
| 375 | 3300006028 | Ga0070717_10127131 | Ga0070717_101271314 | 217 |
| 376 | 3300006038 | Ga0075365_10002417 | Ga0075365_1000241710 | 217 |
| 377 | 3300006038 | Ga0075365_10224602 | Ga0075365_102246021 | 217 |
| 378 | 3300006042 | Ga0075368_10099462 | Ga0075368_100994622 | 217 |
| 379 | 3300006051 | Ga0075364_10091048 | Ga0075364_100910482 | 217 |
| 380 | 3300006163 | Ga0070715_10004118 | Ga0070715_100041183 | 217 |
| 381 | 3300006173 | Ga0070716_100003919 | Ga0070716_1000039195 | 217 |
| 382 | 3300006177 | Ga0075362_10114499 | Ga0075362_101144992 | 217 |
| 383 | 3300006178 | Ga0075367_10213346 | Ga0075367_102133462 | 217 |
| 384 | 3300006195 | Ga0075366_10097265 | Ga0075366_100972652 | 217 |
| 385 | 3300006237 | Ga0097621_100027391 | Ga0097621_1000273912 | 217 |
| 386 | 3300006353 | Ga0075370_10325211 | Ga0075370_103252111 | 217 |
| 387 | 3300006358 | Ga0068871_100026947 | Ga0068871_1000269475 | 217 |
| 388 | 3300006881 | Ga0068865_100079145 | Ga0068865_1000791453 | 217 |
| 389 | 3300006914 | Ga0075436_100002454 | Ga0075436_1000024545 | 217 |
| 390 | 3300006931 | Ga0097620_100017208 | Ga0097620_1000172082 | 217 |
| 391 | 3300007076 | Ga0075435_100143724 | Ga0075435_1001437242 | 217 |
| 392 | 3300009011 | Ga0105251_10036311 | Ga0105251_100363112 | 217 |
| 393 | 3300009098 | Ga0105245_10046875 | Ga0105245_100468751 | 217 |
| 394 | 3300009147 | Ga0114129_10016241 | Ga0114129_100162415 | 217 |
| 395 | 3300009147 | Ga0114129_10586916 | Ga0114129_105869162 | 217 |
| 396 | 3300009148 | Ga0105243_10010687 | Ga0105243_100106875 | 217 |
| 397 | 3300009174 | Ga0105241_10007122 | Ga0105241_100071226 | 217 |
| 398 | 3300009551 | Ga0105238_10027892 | Ga0105238_100278925 | 217 |
| 399 | 3300009551 | Ga0105238_10103323 | Ga0105238_101033232 | 217 |
| 400 | 3300012481 | Ga0157320_1000901 | Ga0157320_10009013 | 217 |
| 401 | 3300012513 | Ga0157326_1004618 | Ga0157326_10046182 | 217 |
| 402 | 3300013102 | Ga0157371_10104933 | Ga0157371_101049333 | 217 |
| 403 | 3300013102 | Ga0157371_10532723 | Ga0157371_105327231 | 217 |
| 404 | 3300013297 | Ga0157378_10031786 | Ga0157378_100317863 | 217 |
| 405 | 3300014745 | Ga0157377_10093540 | Ga0157377_100935401 | 217 |
| 406 | 3300017792 | Ga0163161_10063750 | Ga0163161_100637502 | 217 |
| 407 | 3300017792 | Ga0163161_10696976 | Ga0163161_106969761 | 217 |
| 408 | 3300025297 | Ga0209758_1018161 | Ga0209758_10181612 | 217 |
| 409 | 3300025299 | Ga0209256_1054962 | Ga0209256_10549621 | 217 |
| 410 | 3300025735 | Ga0207713_1034320 | Ga0207713_10343202 | 217 |
| 411 | 3300025898 | Ga0207692_10004710 | Ga0207692_100047103 | 217 |
| 412 | 3300025900 | Ga0207710_10001892 | Ga0207710_100018922 | 217 |
| 413 | 3300025903 | Ga0207680_10031159 | Ga0207680_100311593 | 217 |
| 414 | 3300025904 | Ga0207647_10065556 | Ga0207647_100655561 | 217 |
| 415 | 3300025905 | Ga0207685_10001418 | Ga0207685_100014185 | 217 |
| 416 | 3300025906 | Ga0207699_10011151 | Ga0207699_100111515 | 217 |
| 417 | 3300025907 | Ga0207645_10010546 | Ga0207645_100105463 | 217 |
| 418 | 3300025911 | Ga0207654_10037526 | Ga0207654_100375262 | 217 |
| 419 | 3300025914 | Ga0207671_10057435 | Ga0207671_100574351 | 217 |
| 420 | 3300025915 | Ga0207693_10022575 | Ga0207693_100225756 | 217 |
| 421 | 3300025917 | Ga0207660_10011260 | Ga0207660_100112602 | 217 |
| 422 | 3300025919 | Ga0207657_10015839 | Ga0207657_100158396 | 217 |
| 423 | 3300025919 | Ga0207657_10092257 | Ga0207657_100922572 | 217 |
| 424 | 3300025920 | Ga0207649_10152002 | Ga0207649_101520022 | 217 |
| 425 | 3300025920 | Ga0207649_10307614 | Ga0207649_103076141 | 217 |
| 426 | 3300025921 | Ga0207652_10253084 | Ga0207652_102530841 | 217 |
| 427 | 3300025921 | Ga0207652_10689166 | Ga0207652_106891661 | 217 |
| 428 | 3300025924 | Ga0207694_10024893 | Ga0207694_100248935 | 217 |
| 429 | 3300025925 | Ga0207650_10037723 | Ga0207650_100377232 | 217 |
| 430 | 3300025926 | Ga0207659_10157313 | Ga0207659_101573132 | 217 |
| 431 | 3300025927 | Ga0207687_10019823 | Ga0207687_100198235 | 217 |
| 432 | 3300025928 | Ga0207700_10006313 | Ga0207700_100063135 | 217 |
| 433 | 3300025928 | Ga0207700_10165505 | Ga0207700_101655052 | 217 |
| 434 | 3300025929 | Ga0207664_10018710 | Ga0207664_100187103 | 217 |
| 435 | 3300025929 | Ga0207664_10132028 | Ga0207664_101320282 | 217 |
| 436 | 3300025931 | Ga0207644_10017503 | Ga0207644_100175036 | 217 |
| 437 | 3300025932 | Ga0207690_10091710 | Ga0207690_100917102 | 217 |
| 438 | 3300025934 | Ga0207686_10010210 | Ga0207686_100102104 | 217 |
| 439 | 3300025935 | Ga0207709_10016990 | Ga0207709_100169905 | 217 |
| 440 | 3300025936 | Ga0207670_10076632 | Ga0207670_100766324 | 217 |
| 441 | 3300025937 | Ga0207669_10317259 | Ga0207669_103172592 | 217 |
| 442 | 3300025938 | Ga0207704_10019430 | Ga0207704_100194305 | 217 |
| 443 | 3300025939 | Ga0207665_10000210 | Ga0207665_100002109 | 217 |
| 444 | 3300025940 | Ga0207691_10133928 | Ga0207691_101339281 | 217 |
| 445 | 3300025941 | Ga0207711_10010865 | Ga0207711_100108657 | 217 |
| 446 | 3300025942 | Ga0207689_10012163 | Ga0207689_100121635 | 217 |
| 447 | 3300025942 | Ga0207689_10160808 | Ga0207689_101608082 | 217 |
| 448 | 3300025944 | Ga0207661_10163247 | Ga0207661_101632472 | 217 |
| 449 | 3300025944 | Ga0207661_10266857 | Ga0207661_102668572 | 217 |
| 450 | 3300025945 | Ga0207679_10025554 | Ga0207679_100255543 | 217 |
| 451 | 3300025945 | Ga0207679_10189976 | Ga0207679_101899763 | 217 |
| 452 | 3300025949 | Ga0207667_10186932 | Ga0207667_101869322 | 217 |
| 453 | 3300025960 | Ga0207651_10104736 | Ga0207651_101047362 | 217 |
| 454 | 3300025986 | Ga0207658_10130185 | Ga0207658_101301852 | 217 |
| 455 | 3300026035 | Ga0207703_10248110 | Ga0207703_102481103 | 217 |
| 456 | 3300026067 | Ga0207678_10008960 | Ga0207678_100089608 | 217 |
| 457 | 3300026088 | Ga0207641_10023568 | Ga0207641_100235685 | 217 |
| 458 | 3300026095 | Ga0207676_10009273 | Ga0207676_100092733 | 217 |
| 459 | 3300026116 | Ga0207674_10202399 | Ga0207674_102023992 | 217 |
| 460 | 3300026116 | Ga0207674_10205934 | Ga0207674_102059342 | 217 |
| 461 | 3300026121 | Ga0207683_10008834 | Ga0207683_100088345 | 217 |
| 462 | 3300026142 | Ga0207698_10206211 | Ga0207698_102062112 | 217 |
| 463 | 3300026142 | Ga0207698_10448262 | Ga0207698_104482622 | 217 |
| 464 | 3300028379 | Ga0268266_10016289 | Ga0268266_100162896 | 217 |
| 465 | 3300028380 | Ga0268265_10082764 | Ga0268265_100827642 | 217 |
| 466 | 3300028381 | Ga0268264_10024794 | Ga0268264_100247944 | 217 |
| 467 | 3300031595 | Ga0265313_10009102 | Ga0265313_100091023 | 217 |
| 468 | 3300031595 | Ga0265313_10068633 | Ga0265313_100686332 | 217 |
| 469 | 3300031711 | Ga0265314_10001560 | Ga0265314_100015607 | 217 |
| 470 | 3300031712 | Ga0265342_10000608 | Ga0265342_1000060829 | 217 |
| 471 | 3300035115 | Ga0373941_0159112 | Ga0373941_0159112_42_767 | 217 |
| 472 | 3300037312 | Ga0395899_0145037 | Ga0395899_0145037_353_1078 | 217 |
| 473 | 3300037418 | Ga0395900_0038369 | Ga0395900_0038369_772_1497 | 217 |
| 474 | 3300037418 | Ga0395900_0253369 | Ga0395900_0253369_61_786 | 217 |
| 475 | 3300037466 | Ga0395898_0002812 | Ga0395898_0002812_16975_17700 | 217 |
| 476 | 3300037466 | Ga0395898_0070704 | Ga0395898_0070704_12_737 | 217 |
| 477 | 3300038443 | Ga0395901_0318189 | Ga0395901_0318189_746_1471 | 217 |
| 478 | 3300044684 | Ga0466966_0049822 | Ga0466966_0049822_1605_2330 | 217 |
| 479 | 3300044693 | Ga0466961_0094591 | Ga0466961_0094591_235_960 | 217 |
| 480 | 3300044719 | Ga0466971_0054028 | Ga0466971_0054028_305_1030 | 217 |
| 481 | 3300044842 | Ga0466957_0008064 | Ga0466957_0008064_4770_5495 | 217 |
| 482 | 3300045049 | Ga0466959_0021717 | Ga0466959_0021717_3222_3947 | 217 |
| 483 | 3300045836 | Ga0466958_0060091 | Ga0466958_0060091_582_1307 | 217 |
| 484 | 3300046475 | Ga0495639_0028611 | Ga0495639_0028611_160_879 | 217 |
| 485 | 3300046516 | Ga0495628_0022925 | Ga0495628_0022925_3754_4530 | 217 |
| 486 | 3300048903 | Ga0496100_0169109 | Ga0496100_0169109_33_758 | 217 |
| 487 | 3300048904 | Ga0496101_0241609 | Ga0496101_0241609_192_917 | 217 |
| 488 | 3300048905 | Ga0496102_0058140 | Ga0496102_0058140_1830_2555 | 217 |
| 489 | 3300048906 | Ga0496103_0044117 | Ga0496103_0044117_192_917 | 217 |
| 490 | 3300048909 | Ga0496106_0032219 | Ga0496106_0032219_1821_2546 | 217 |
| 491 | 3300048910 | Ga0496107_0053037 | Ga0496107_0053037_1362_2087 | 217 |
| 492 | 3300048911 | Ga0496108_0086659 | Ga0496108_0086659_1279_2004 | 217 |
| 493 | 3300048913 | Ga0496110_0140581 | Ga0496110_0140581_645_1370 | 217 |
| 494 | 3300048915 | Ga0496112_0152444 | Ga0496112_0152444_539_1264 | 217 |
| 495 | 3300048916 | Ga0496113_0047215 | Ga0496113_0047215_645_1370 | 217 |
| 496 | 3300048917 | Ga0496114_0034874 | Ga0496114_0034874_1599_2324 | 217 |
| 497 | 3300048918 | Ga0496115_0015333 | Ga0496115_0015333_1005_1730 | 217 |
| 498 | 3300048922 | Ga0496119_0120375 | Ga0496119_0120375_54_779 | 217 |
| 499 | 3300048923 | Ga0496120_0248603 | Ga0496120_0248603_92_817 | 217 |
| 500 | 3300048929 | Ga0496126_0089178 | Ga0496126_0089178_1072_1800 | 217 |
| 501 | 3300049581 | Ga0501047_0040982 | Ga0501047_0040982_1704_2429 | 217 |
| 502 | 3300049586 | Ga0501070_0058997 | Ga0501070_0058997_812_1537 | 217 |
| 503 | 3300049822 | Ga0501035_0175644 | Ga0501035_0175644_1033_1758 | 217 |
| 504 | 3300049823 | Ga0501044_0140143 | Ga0501044_0140143_1661_2386 | 217 |
| 505 | 3300049823 | Ga0501044_0267882 | Ga0501044_0267882_843_1568 | 217 |
| 506 | 3300050492 | nmdc:mga0yw44_1172_c1 | nmdc:mga0yw44_1172_c1_2985_3713 | 217 |
| 507 | 3300050496 | nmdc:mga07m45_325344_c1 | nmdc:mga07m45_325344_c1_11_736 | 217 |
| 508 | 3300050507 | nmdc:mga05p37_448459_c1 | nmdc:mga05p37_448459_c1_512_1237 | 217 |
| 509 | 3300050511 | nmdc:mga08y16_184340_c1 | nmdc:mga08y16_184340_c1_368_1093 | 217 |
| 510 | 3300050514 | nmdc:mga08x19_1357_c1 | nmdc:mga08x19_1357_c1_8307_9032 | 217 |
| 511 | 3300053096 | Ga0500641_0004747 | Ga0500641_0004747_3844_4569 | 217 |
| 512 | 3300053153 | Ga0500616_0056025 | Ga0500616_0056025_1133_1858 | 217 |
| 513 | 3300053153 | Ga0500616_0077655 | Ga0500616_0077655_106_933 | 217 |
| 514 | 3300061719 | Ga0466962_0169587 | Ga0466962_0169587_220_945 | 217 |
| 515 | 3300005343 | Ga0070687_100006984 | Ga0070687_1000069847 | 218 |
| 516 | 3300005366 | Ga0070659_100054380 | Ga0070659_1000543802 | 218 |
| 517 | 3300005436 | Ga0070713_100101051 | Ga0070713_1001010512 | 218 |
| 518 | 3300005466 | Ga0070685_10003855 | Ga0070685_100038558 | 218 |
| 519 | 3300005471 | Ga0070698_100138896 | Ga0070698_1001388963 | 218 |
| 520 | 3300005546 | Ga0070696_100129398 | Ga0070696_1001293981 | 218 |
| 521 | 3300005615 | Ga0070702_100483937 | Ga0070702_1004839371 | 218 |
| 522 | 3300005937 | Ga0081455_10001108 | Ga0081455_1000110811 | 218 |
| 523 | 3300006028 | Ga0070717_10080726 | Ga0070717_100807261 | 218 |
| 524 | 3300006051 | Ga0075364_10158611 | Ga0075364_101586111 | 218 |
| 525 | 3300006163 | Ga0070715_10331504 | Ga0070715_103315041 | 218 |
| 526 | 3300006844 | Ga0075428_100037884 | Ga0075428_1000378842 | 218 |
| 527 | 3300006847 | Ga0075431_100358218 | Ga0075431_1003582182 | 218 |
| 528 | 3300006871 | Ga0075434_100064484 | Ga0075434_1000644843 | 218 |
| 529 | 3300009094 | Ga0111539_10336041 | Ga0111539_103360413 | 218 |
| 530 | 3300009147 | Ga0114129_10040156 | Ga0114129_100401564 | 218 |
| 531 | 3300021361 | Ga0213872_10000703 | Ga0213872_100007035 | 218 |
| 532 | 3300021384 | Ga0213876_10006896 | Ga0213876_100068968 | 218 |
| 533 | 3300024227 | Ga0228598_1000875 | Ga0228598_10008756 | 218 |
| 534 | 3300025302 | Ga0207426_1065481 | Ga0207426_10654811 | 218 |
| 535 | 3300026118 | Ga0207675_100031108 | Ga0207675_1000311086 | 218 |
| 536 | 3300027695 | Ga0209966_1000738 | Ga0209966_10007383 | 218 |
| 537 | 3300027907 | Ga0207428_10099113 | Ga0207428_100991133 | 218 |
| 538 | 3300031247 | Ga0265340_10039855 | Ga0265340_100398553 | 218 |
| 539 | 3300031251 | Ga0265327_10000496 | Ga0265327_1000049640 | 218 |
| 540 | 3300031507 | Ga0307509_10001262 | Ga0307509_1000126224 | 218 |
| 541 | 3300035086 | Ga0373934_0079627 | Ga0373934_0079627_270_995 | 218 |
| 542 | 3300035118 | Ga0373954_0052525 | Ga0373954_0052525_506_1231 | 218 |
| 543 | 3300035172 | Ga0373955_0221682 | Ga0373955_0221682_199_924 | 218 |
| 544 | 3300035724 | Ga0373933_0039115 | Ga0373933_0039115_334_1059 | 218 |
| 545 | 3300036401 | Ga0373937_0014589 | Ga0373937_0014589_1590_2315 | 218 |
| 546 | 3300037312 | Ga0395899_0424030 | Ga0395899_0424030_79_804 | 218 |
| 547 | 3300037418 | Ga0395900_0075666 | Ga0395900_0075666_991_1713 | 218 |
| 548 | 3300037418 | Ga0395900_0087040 | Ga0395900_0087040_1352_2077 | 218 |
| 549 | 3300037466 | Ga0395898_0440497 | Ga0395898_0440497_445_1167 | 218 |
| 550 | 3300037471 | Ga0395905_0053222 | Ga0395905_0053222_460_1182 | 218 |
| 551 | 3300037853 | Ga0436364_0143493 | Ga0436364_0143493_14_736 | 218 |
| 552 | 3300038443 | Ga0395901_0091577 | Ga0395901_0091577_2108_2830 | 218 |
| 553 | 3300039437 | Ga0436365_0382338 | Ga0436365_0382338_104_889 | 218 |
| 554 | 3300039437 | Ga0436365_0414414 | Ga0436365_0414414_22846_23571 | 218 |
| 555 | 3300039447 | Ga0436361_0492958 | Ga0436361_0492958_3450_4172 | 218 |
| 556 | 3300041411 | Ga0439466_0061186 | Ga0439466_0061186_361_1083 | 218 |
| 557 | 3300041413 | Ga0439465_0013151 | Ga0439465_0013151_1087_1809 | 218 |
| 558 | 3300041413 | Ga0439465_0090364 | Ga0439465_0090364_276_998 | 218 |
| 559 | 3300044706 | Ga0466964_0094272 | Ga0466964_0094272_241_972 | 218 |
| 560 | 3300044712 | Ga0453684_0005046 | Ga0453684_0005046_7963_8706 | 218 |
| 561 | 3300045976 | Ga0466967_0031475 | Ga0466967_0031475_1801_2526 | 218 |
| 562 | 3300046454 | Ga0495592_0080782 | Ga0495592_0080782_1084_1809 | 218 |
| 563 | 3300046463 | Ga0495653_0096589 | Ga0495653_0096589_456_1181 | 218 |
| 564 | 3300046511 | Ga0495608_0094658 | Ga0495608_0094658_184_909 | 218 |
| 565 | 3300046536 | Ga0495587_0018878 | Ga0495587_0018878_846_1571 | 218 |
| 566 | 3300046543 | Ga0495645_0152759 | Ga0495645_0152759_169_894 | 218 |
| 567 | 3300046642 | Ga0495634_0306465 | Ga0495634_0306465_94_819 | 218 |
| 568 | 3300046679 | Ga0495623_0061099 | Ga0495623_0061099_548_1273 | 218 |
| 569 | 3300046680 | Ga0495646_0120946 | Ga0495646_0120946_374_1099 | 218 |
| 570 | 3300047317 | Ga0495604_0024793 | Ga0495604_0024793_3602_4327 | 218 |
| 571 | 3300047320 | Ga0495672_0046593 | Ga0495672_0046593_541_1266 | 218 |
| 572 | 3300047322 | Ga0495680_0081464 | Ga0495680_0081464_34_759 | 218 |
| 573 | 3300047444 | Ga0495675_0377683 | Ga0495675_0377683_53_778 | 218 |
| 574 | 3300048088 | Ga0495602_0024310 | Ga0495602_0024310_3212_3937 | 218 |
| 575 | 3300048903 | Ga0496100_0010967 | Ga0496100_0010967_1956_2681 | 218 |
| 576 | 3300048905 | Ga0496102_0038711 | Ga0496102_0038711_2826_3551 | 218 |
| 577 | 3300048906 | Ga0496103_0194201 | Ga0496103_0194201_285_1010 | 218 |
| 578 | 3300048907 | Ga0496104_0009349 | Ga0496104_0009349_317_1042 | 218 |
| 579 | 3300048907 | Ga0496104_0013664 | Ga0496104_0013664_711_1472 | 218 |
| 580 | 3300048908 | Ga0496105_0006002 | Ga0496105_0006002_6154_6915 | 218 |
| 581 | 3300048909 | Ga0496106_0003164 | Ga0496106_0003164_6279_7004 | 218 |
| 582 | 3300048910 | Ga0496107_0005584 | Ga0496107_0005584_4752_5477 | 218 |
| 583 | 3300048911 | Ga0496108_0010630 | Ga0496108_0010630_4924_5649 | 218 |
| 584 | 3300048912 | Ga0496109_0505388 | Ga0496109_0505388_216_977 | 218 |
| 585 | 3300048912 | Ga0496109_0921889 | Ga0496109_0921889_18_743 | 218 |
| 586 | 3300048913 | Ga0496110_0007488 | Ga0496110_0007488_2576_3301 | 218 |
| 587 | 3300048913 | Ga0496110_0175536 | Ga0496110_0175536_723_1448 | 218 |
| 588 | 3300048915 | Ga0496112_0060353 | Ga0496112_0060353_2978_3703 | 218 |
| 589 | 3300048915 | Ga0496112_0443252 | Ga0496112_0443252_383_1108 | 218 |
| 590 | 3300049568 | Ga0501031_0002030 | Ga0501031_0002030_7834_8556 | 218 |
| 591 | 3300049569 | Ga0501032_0000074 | Ga0501032_0000074_27845_28567 | 218 |
| 592 | 3300049569 | Ga0501032_0108696 | Ga0501032_0108696_1057_1782 | 218 |
| 593 | 3300049570 | Ga0501033_0000796 | Ga0501033_0000796_22653_23375 | 218 |
| 594 | 3300049571 | Ga0501034_0000249 | Ga0501034_0000249_41646_42368 | 218 |
| 595 | 3300049571 | Ga0501034_0000436 | Ga0501034_0000436_7183_7908 | 218 |
| 596 | 3300049571 | Ga0501034_0003203 | Ga0501034_0003203_9527_10252 | 218 |
| 597 | 3300049572 | Ga0501036_0000472 | Ga0501036_0000472_22704_23426 | 218 |
| 598 | 3300049572 | Ga0501036_0002786 | Ga0501036_0002786_6353_7078 | 218 |
| 599 | 3300049572 | Ga0501036_0052535 | Ga0501036_0052535_1452_2177 | 218 |
| 600 | 3300049573 | Ga0501037_0000129 | Ga0501037_0000129_12982_13704 | 218 |
| 601 | 3300049573 | Ga0501037_0003344 | Ga0501037_0003344_1450_2175 | 218 |
| 602 | 3300049573 | Ga0501037_0041626 | Ga0501037_0041626_607_1332 | 218 |
| 603 | 3300049574 | Ga0501038_0000202 | Ga0501038_0000202_22535_23257 | 218 |
| 604 | 3300049574 | Ga0501038_0009422 | Ga0501038_0009422_3505_4230 | 218 |
| 605 | 3300049575 | Ga0501039_0000027 | Ga0501039_0000027_126943_127665 | 218 |
| 606 | 3300049577 | Ga0501041_0076719 | Ga0501041_0076719_1026_1748 | 218 |
| 607 | 3300049579 | Ga0501043_0000047 | Ga0501043_0000047_53255_53977 | 218 |
| 608 | 3300049580 | Ga0501046_0038661 | Ga0501046_0038661_2740_3462 | 218 |
| 609 | 3300049581 | Ga0501047_0000384 | Ga0501047_0000384_14783_15508 | 218 |
| 610 | 3300049581 | Ga0501047_0050031 | Ga0501047_0050031_1716_2441 | 218 |
| 611 | 3300049581 | Ga0501047_0081713 | Ga0501047_0081713_2122_2847 | 218 |
| 612 | 3300049582 | Ga0501048_0000074 | Ga0501048_0000074_35019_35744 | 218 |
| 613 | 3300049586 | Ga0501070_0006228 | Ga0501070_0006228_3235_3960 | 218 |
| 614 | 3300049589 | Ga0501073_0010194 | Ga0501073_0010194_4264_4989 | 218 |
| 615 | 3300049589 | Ga0501073_0047630 | Ga0501073_0047630_1113_1838 | 218 |
| 616 | 3300049742 | Ga0501080_0001148 | Ga0501080_0001148_6246_6971 | 218 |
| 617 | 3300049742 | Ga0501080_0026165 | Ga0501080_0026165_159_884 | 218 |
| 618 | 3300049744 | Ga0501083_0003658 | Ga0501083_0003658_4789_5544 | 218 |
| 619 | 3300049822 | Ga0501035_0000132 | Ga0501035_0000132_22543_23265 | 218 |
| 620 | 3300049823 | Ga0501044_0010183 | Ga0501044_0010183_7686_8408 | 218 |
| 621 | 3300049823 | Ga0501044_0017087 | Ga0501044_0017087_1862_2587 | 218 |
| 622 | 3300049824 | Ga0501045_0165728 | Ga0501045_0165728_849_1604 | 218 |
| 623 | 3300050507 | nmdc:mga05p37_10714_c1 | nmdc:mga05p37_10714_c1_1981_2706 | 218 |
| 624 | 3300050507 | nmdc:mga05p37_17777_c1 | nmdc:mga05p37_17777_c1_4711_5436 | 218 |
| 625 | 3300050507 | nmdc:mga05p37_561174_c1 | nmdc:mga05p37_561174_c1_288_1013 | 218 |
| 626 | 3300050510 | nmdc:mga06r32_92563_c1 | nmdc:mga06r32_92563_c1_303_1028 | 218 |
| 627 | 3300050511 | nmdc:mga08y16_313456_c1 | nmdc:mga08y16_313456_c1_336_1061 | 218 |
| 628 | 3300050512 | nmdc:mga0n895_61493_c1 | nmdc:mga0n895_61493_c1_1243_1968 | 218 |
| 629 | 3300050513 | nmdc:mga0rr50_452107_c1 | nmdc:mga0rr50_452107_c1_341_1066 | 218 |
| 630 | 3300050515 | nmdc:mga0a205_26885_c1 | nmdc:mga0a205_26885_c1_2254_2979 | 218 |
| 631 | 3300053087 | Ga0500643_010715 | Ga0500643_010715_530_1252 | 218 |
| 632 | 3300053130 | Ga0500642_0069863 | Ga0500642_0069863_214_936 | 218 |
| 633 | 3300053730 | Ga0500645_000592 | Ga0500645_000592_17723_18448 | 218 |
| 634 | 3300060353 | Ga0501082_0000510 | Ga0501082_0000510_1026_1751 | 218 |
| 635 | 3300060353 | Ga0501082_0617968 | Ga0501082_0617968_16_741 | 218 |
| 636 | 3300000041 | ARcpr5oldR_c000003 | ARcpr5oldR_00000344 | 219 |
| 637 | 3300000042 | ARSoilYngRDRAFT_c00037 | ARSoilYngRDRAFT_0003721 | 219 |
| 638 | 3300000043 | ARcpr5yngRDRAFT_c000010 | ARcpr5yngRDRAFT_00001025 | 219 |
| 639 | 3300000044 | ARSoilOldRDRAFT_c000114 | ARSoilOldRDRAFT_0001146 | 219 |
| 640 | 3300000044 | ARSoilOldRDRAFT_c002000 | ARSoilOldRDRAFT_0020002 | 219 |
| 641 | 3300000045 | ARCol0oldRDRAFT_c00094 | ARCol0oldRDRAFT_000946 | 219 |
| 642 | 3300000652 | ARCol0yngRDRAFT_1000202 | ARCol0yngRDRAFT_10002025 | 219 |
| 643 | 3300002076 | JGI24749J21850_1004353 | JGI24749J21850_10043533 | 219 |
| 644 | 3300002739 | JGI25158J39367_1004631 | JGI25158J39367_10046312 | 219 |
| 645 | 3300002774 | JGI25150J39212_1000171 | JGI25150J39212_100017125 | 219 |
| 646 | 3300002774 | JGI25150J39212_1000433 | JGI25150J39212_100043312 | 219 |
| 647 | 3300002987 | JGI25159J45721_1000017 | JGI25159J45721_100001751 | 219 |
| 648 | 3300003187 | JGI25151J46595_10000034 | JGI25151J46595_1000003425 | 219 |
| 649 | 3300003187 | JGI25151J46595_10008877 | JGI25151J46595_100088775 | 219 |
| 650 | 3300003187 | JGI25151J46595_10009621 | JGI25151J46595_100096215 | 219 |
| 651 | 3300003215 | JGI25153J46596_10000673 | JGI25153J46596_100006734 | 219 |
| 652 | 3300003215 | JGI25153J46596_10011382 | JGI25153J46596_100113826 | 219 |
| 653 | 3300003354 | JGI25160J50197_1000027 | JGI25160J50197_1000027131 | 219 |
| 654 | 3300003374 | JGI25161J50226_1000160 | JGI25161J50226_10001608 | 219 |
| 655 | 3300003775 | Ga0055524_1000782 | Ga0055524_10007822 | 219 |
| 656 | 3300003781 | Ga0055536_1000711 | Ga0055536_100071118 | 219 |
| 657 | 3300003791 | Ga0055530_10019826 | Ga0055530_100198261 | 219 |
| 658 | 3300003794 | Ga0055531_10010747 | Ga0055531_100107471 | 219 |
| 659 | 3300004625 | Ga0055543_1000030 | Ga0055543_1000030139 | 219 |
| 660 | 3300005262 | Ga0065165_1000122 | Ga0065165_100012251 | 219 |
| 661 | 3300005289 | Ga0065704_10073674 | Ga0065704_100736745 | 219 |
| 662 | 3300005290 | Ga0065712_10009067 | Ga0065712_100090674 | 219 |
| 663 | 3300005290 | Ga0065712_10078443 | Ga0065712_100784431 | 219 |
| 664 | 3300005295 | Ga0065707_10150122 | Ga0065707_101501222 | 219 |
| 665 | 3300005327 | Ga0070658_10288976 | Ga0070658_102889761 | 219 |
| 666 | 3300005330 | Ga0070690_100179140 | Ga0070690_1001791403 | 219 |
| 667 | 3300005331 | Ga0070670_100057539 | Ga0070670_1000575395 | 219 |
| 668 | 3300005336 | Ga0070680_100043291 | Ga0070680_1000432916 | 219 |
| 669 | 3300005336 | Ga0070680_100262573 | Ga0070680_1002625732 | 219 |
| 670 | 3300005339 | Ga0070660_100013941 | Ga0070660_1000139414 | 219 |
| 671 | 3300005343 | Ga0070687_100063265 | Ga0070687_1000632652 | 219 |
| 672 | 3300005344 | Ga0070661_100276399 | Ga0070661_1002763992 | 219 |
| 673 | 3300005347 | Ga0070668_100605437 | Ga0070668_1006054371 | 219 |
| 674 | 3300005353 | Ga0070669_100143324 | Ga0070669_1001433243 | 219 |
| 675 | 3300005354 | Ga0070675_100118472 | Ga0070675_1001184723 | 219 |
| 676 | 3300005354 | Ga0070675_100167573 | Ga0070675_1001675731 | 219 |
| 677 | 3300005354 | Ga0070675_100299740 | Ga0070675_1002997402 | 219 |
| 678 | 3300005354 | Ga0070675_100526022 | Ga0070675_1005260221 | 219 |
| 679 | 3300005355 | Ga0070671_100039483 | Ga0070671_1000394834 | 219 |
| 680 | 3300005356 | Ga0070674_100013309 | Ga0070674_1000133092 | 219 |
| 681 | 3300005356 | Ga0070674_100097334 | Ga0070674_1000973343 | 219 |
| 682 | 3300005364 | Ga0070673_100016812 | Ga0070673_1000168126 | 219 |
| 683 | 3300005364 | Ga0070673_100067712 | Ga0070673_1000677122 | 219 |
| 684 | 3300005366 | Ga0070659_100236030 | Ga0070659_1002360302 | 219 |
| 685 | 3300005367 | Ga0070667_100275292 | Ga0070667_1002752923 | 219 |
| 686 | 3300005435 | Ga0070714_100081920 | Ga0070714_1000819203 | 219 |
| 687 | 3300005435 | Ga0070714_100681979 | Ga0070714_1006819791 | 219 |
| 688 | 3300005436 | Ga0070713_100037681 | Ga0070713_1000376814 | 219 |
| 689 | 3300005436 | Ga0070713_100115215 | Ga0070713_1001152153 | 219 |
| 690 | 3300005437 | Ga0070710_10021576 | Ga0070710_100215762 | 219 |
| 691 | 3300005437 | Ga0070710_10334790 | Ga0070710_103347901 | 219 |
| 692 | 3300005437 | Ga0070710_10409533 | Ga0070710_104095331 | 219 |
| 693 | 3300005438 | Ga0070701_10019213 | Ga0070701_100192135 | 219 |
| 694 | 3300005439 | Ga0070711_100088519 | Ga0070711_1000885192 | 219 |
| 695 | 3300005440 | Ga0070705_100054445 | Ga0070705_1000544452 | 219 |
| 696 | 3300005440 | Ga0070705_100381993 | Ga0070705_1003819932 | 219 |
| 697 | 3300005441 | Ga0070700_100178583 | Ga0070700_1001785832 | 219 |
| 698 | 3300005445 | Ga0070708_100026124 | Ga0070708_1000261244 | 219 |
| 699 | 3300005455 | Ga0070663_100098827 | Ga0070663_1000988272 | 219 |
| 700 | 3300005456 | Ga0070678_100239338 | Ga0070678_1002393381 | 219 |
| 701 | 3300005457 | Ga0070662_100037740 | Ga0070662_1000377403 | 219 |
| 702 | 3300005457 | Ga0070662_100143904 | Ga0070662_1001439043 | 219 |
| 703 | 3300005459 | Ga0068867_100070345 | Ga0068867_1000703455 | 219 |
| 704 | 3300005459 | Ga0068867_100596314 | Ga0068867_1005963141 | 219 |
| 705 | 3300005466 | Ga0070685_10105298 | Ga0070685_101052982 | 219 |
| 706 | 3300005468 | Ga0070707_100217959 | Ga0070707_1002179593 | 219 |
| 707 | 3300005518 | Ga0070699_100106603 | Ga0070699_1001066032 | 219 |
| 708 | 3300005530 | Ga0070679_100221983 | Ga0070679_1002219832 | 219 |
| 709 | 3300005535 | Ga0070684_100044013 | Ga0070684_1000440133 | 219 |
| 710 | 3300005536 | Ga0070697_100202527 | Ga0070697_1002025272 | 219 |
| 711 | 3300005545 | Ga0070695_100404566 | Ga0070695_1004045662 | 219 |
| 712 | 3300005546 | Ga0070696_100173830 | Ga0070696_1001738302 | 219 |
| 713 | 3300005547 | Ga0070693_100092445 | Ga0070693_1000924452 | 219 |
| 714 | 3300005548 | Ga0070665_100006101 | Ga0070665_10000610111 | 219 |
| 715 | 3300005549 | Ga0070704_100180226 | Ga0070704_1001802262 | 219 |
| 716 | 3300005563 | Ga0068855_100217262 | Ga0068855_1002172621 | 219 |
| 717 | 3300005578 | Ga0068854_100331354 | Ga0068854_1003313542 | 219 |
| 718 | 3300005616 | Ga0068852_100057208 | Ga0068852_1000572087 | 219 |
| 719 | 3300005617 | Ga0068859_100194167 | Ga0068859_1001941674 | 219 |
| 720 | 3300005719 | Ga0068861_100007388 | Ga0068861_1000073888 | 219 |
| 721 | 3300005834 | Ga0068851_10006192 | Ga0068851_100061926 | 219 |
| 722 | 3300005834 | Ga0068851_10181466 | Ga0068851_101814662 | 219 |
| 723 | 3300005840 | Ga0068870_10021003 | Ga0068870_100210033 | 219 |
| 724 | 3300005843 | Ga0068860_100055931 | Ga0068860_1000559311 | 219 |
| 725 | 3300005844 | Ga0068862_100007073 | Ga0068862_1000070739 | 219 |
| 726 | 3300005983 | Ga0081540_1017391 | Ga0081540_10173913 | 219 |
| 727 | 3300005983 | Ga0081540_1074291 | Ga0081540_10742912 | 219 |
| 728 | 3300006028 | Ga0070717_10049830 | Ga0070717_100498301 | 219 |
| 729 | 3300006028 | Ga0070717_10056608 | Ga0070717_100566082 | 219 |
| 730 | 3300006028 | Ga0070717_10057481 | Ga0070717_100574812 | 219 |
| 731 | 3300006028 | Ga0070717_10359769 | Ga0070717_103597692 | 219 |
| 732 | 3300006048 | Ga0075363_100038942 | Ga0075363_1000389421 | 219 |
| 733 | 3300006048 | Ga0075363_100143393 | Ga0075363_1001433933 | 219 |
| 734 | 3300006048 | Ga0075363_100176382 | Ga0075363_1001763821 | 219 |
| 735 | 3300006051 | Ga0075364_10220641 | Ga0075364_102206411 | 219 |
| 736 | 3300006051 | Ga0075364_10366452 | Ga0075364_103664521 | 219 |
| 737 | 3300006163 | Ga0070715_10138731 | Ga0070715_101387312 | 219 |
| 738 | 3300006173 | Ga0070716_100027329 | Ga0070716_1000273291 | 219 |
| 739 | 3300006175 | Ga0070712_100009184 | Ga0070712_1000091842 | 219 |
| 740 | 3300006178 | Ga0075367_10045574 | Ga0075367_100455741 | 219 |
| 741 | 3300006178 | Ga0075367_10101821 | Ga0075367_101018212 | 219 |
| 742 | 3300006178 | Ga0075367_10190180 | Ga0075367_101901802 | 219 |
| 743 | 3300006186 | Ga0075369_10111023 | Ga0075369_101110232 | 219 |
| 744 | 3300006195 | Ga0075366_10058954 | Ga0075366_100589542 | 219 |
| 745 | 3300006195 | Ga0075366_10297632 | Ga0075366_102976321 | 219 |
| 746 | 3300006353 | Ga0075370_10110717 | Ga0075370_101107174 | 219 |
| 747 | 3300006353 | Ga0075370_10246794 | Ga0075370_102467941 | 219 |
| 748 | 3300006358 | Ga0068871_100155111 | Ga0068871_1001551113 | 219 |
| 749 | 3300006846 | Ga0075430_100000387 | Ga0075430_10000038728 | 219 |
| 750 | 3300006846 | Ga0075430_100008653 | Ga0075430_1000086534 | 219 |
| 751 | 3300006847 | Ga0075431_100201902 | Ga0075431_1002019022 | 219 |
| 752 | 3300006871 | Ga0075434_100243841 | Ga0075434_1002438412 | 219 |
| 753 | 3300006871 | Ga0075434_100310082 | Ga0075434_1003100821 | 219 |
| 754 | 3300006871 | Ga0075434_100455406 | Ga0075434_1004554061 | 219 |
| 755 | 3300006871 | Ga0075434_100898291 | Ga0075434_1008982912 | 219 |
| 756 | 3300006881 | Ga0068865_100240253 | Ga0068865_1002402533 | 219 |
| 757 | 3300006931 | Ga0097620_100194159 | Ga0097620_1001941594 | 219 |
| 758 | 3300006946 | Ga0079104_1009515 | Ga0079104_10095154 | 219 |
| 759 | 3300006946 | Ga0079104_1010076 | Ga0079104_10100764 | 219 |
| 760 | 3300006948 | Ga0099826_10107837 | Ga0099826_101078372 | 219 |
| 761 | 3300007076 | Ga0075435_100029369 | Ga0075435_1000293691 | 219 |
| 762 | 3300007076 | Ga0075435_100296022 | Ga0075435_1002960222 | 219 |
| 763 | 3300007265 | Ga0099794_10007856 | Ga0099794_100078562 | 219 |
| 764 | 3300007788 | Ga0099795_10042556 | Ga0099795_100425562 | 219 |
| 765 | 3300009093 | Ga0105240_10304316 | Ga0105240_103043163 | 219 |
| 766 | 3300009094 | Ga0111539_10001645 | Ga0111539_1000164527 | 219 |
| 767 | 3300009094 | Ga0111539_10109798 | Ga0111539_101097984 | 219 |
| 768 | 3300009094 | Ga0111539_10503355 | Ga0111539_105033552 | 219 |
| 769 | 3300009147 | Ga0114129_10479400 | Ga0114129_104794002 | 219 |
| 770 | 3300009148 | Ga0105243_10019915 | Ga0105243_100199153 | 219 |
| 771 | 3300009176 | Ga0105242_10028564 | Ga0105242_100285642 | 219 |
| 772 | 3300009176 | Ga0105242_10859882 | Ga0105242_108598821 | 219 |
| 773 | 3300009176 | Ga0105242_11165972 | Ga0105242_111659721 | 219 |
| 774 | 3300009545 | Ga0105237_10051335 | Ga0105237_100513356 | 219 |
| 775 | 3300009553 | Ga0105249_10049209 | Ga0105249_100492094 | 219 |
| 776 | 3300009553 | Ga0105249_10212603 | Ga0105249_102126033 | 219 |
| 777 | 3300010159 | Ga0099796_10000988 | Ga0099796_100009886 | 219 |
| 778 | 3300010375 | Ga0105239_10058907 | Ga0105239_100589073 | 219 |
| 779 | 3300012495 | Ga0157323_1001518 | Ga0157323_10015182 | 219 |
| 780 | 3300012495 | Ga0157323_1005307 | Ga0157323_10053072 | 219 |
| 781 | 3300012507 | Ga0157342_1000875 | Ga0157342_10008752 | 219 |
| 782 | 3300013105 | Ga0157369_10222684 | Ga0157369_102226842 | 219 |
| 783 | 3300013105 | Ga0157369_10380314 | Ga0157369_103803142 | 219 |
| 784 | 3300013297 | Ga0157378_10333822 | Ga0157378_103338222 | 219 |
| 785 | 3300013297 | Ga0157378_10873672 | Ga0157378_108736721 | 219 |
| 786 | 3300013306 | Ga0163162_10178252 | Ga0163162_101782524 | 219 |
| 787 | 3300013306 | Ga0163162_10451086 | Ga0163162_104510862 | 219 |
| 788 | 3300013307 | Ga0157372_10111381 | Ga0157372_101113814 | 219 |
| 789 | 3300013308 | Ga0157375_10138524 | Ga0157375_101385243 | 219 |
| 790 | 3300013308 | Ga0157375_10580574 | Ga0157375_105805742 | 219 |
| 791 | 3300014326 | Ga0157380_10040992 | Ga0157380_100409925 | 219 |
| 792 | 3300014326 | Ga0157380_10323571 | Ga0157380_103235712 | 219 |
| 793 | 3300014969 | Ga0157376_10222589 | Ga0157376_102225893 | 219 |
| 794 | 3300015262 | Ga0182007_10035892 | Ga0182007_100358922 | 219 |
| 795 | 3300015690 | Ga0183363_1290 | Ga0183363_12909 | 219 |
| 796 | 3300021320 | Ga0214544_1000087 | Ga0214544_100008734 | 219 |
| 797 | 3300021321 | Ga0214542_1000018 | Ga0214542_1000018105 | 219 |
| 798 | 3300021324 | Ga0214545_1000009 | Ga0214545_100000977 | 219 |
| 799 | 3300021327 | Ga0214543_1000037 | Ga0214543_100003796 | 219 |
| 800 | 3300021361 | Ga0213872_10106770 | Ga0213872_101067702 | 219 |
| 801 | 3300021377 | Ga0213874_10057809 | Ga0213874_100578091 | 219 |
| 802 | 3300021377 | Ga0213874_10068712 | Ga0213874_100687121 | 219 |
| 803 | 3300021377 | Ga0213874_10076317 | Ga0213874_100763172 | 219 |
| 804 | 3300021384 | Ga0213876_10101221 | Ga0213876_101012211 | 219 |
| 805 | 3300022467 | Ga0224712_10059476 | Ga0224712_100594762 | 219 |
| 806 | 3300022739 | Ga0228711_1000004 | Ga0228711_1000004147 | 219 |
| 807 | 3300022740 | Ga0228710_1000002 | Ga0228710_100000296 | 219 |
| 808 | 3300025208 | Ga0209436_101378 | Ga0209436_1013782 | 219 |
| 809 | 3300025233 | Ga0209437_111240 | Ga0209437_1112402 | 219 |
| 810 | 3300025245 | Ga0207425_1000035 | Ga0207425_100003548 | 219 |
| 811 | 3300025253 | Ga0209677_100265 | Ga0209677_1002657 | 219 |
| 812 | 3300025254 | Ga0209148_1016880 | Ga0209148_10168802 | 219 |
| 813 | 3300025258 | Ga0209129_1000029 | Ga0209129_100002948 | 219 |
| 814 | 3300025261 | Ga0209233_1000255 | Ga0209233_100025566 | 219 |
| 815 | 3300025261 | Ga0209233_1007650 | Ga0209233_10076501 | 219 |
| 816 | 3300025261 | Ga0209233_1015962 | Ga0209233_10159622 | 219 |
| 817 | 3300025272 | Ga0209455_1003697 | Ga0209455_10036973 | 219 |
| 818 | 3300025273 | Ga0209673_1025959 | Ga0209673_10259592 | 219 |
| 819 | 3300025284 | Ga0209130_1000027 | Ga0209130_1000027266 | 219 |
| 820 | 3300025292 | Ga0209676_1000956 | Ga0209676_100095625 | 219 |
| 821 | 3300025294 | Ga0209025_1000042 | Ga0209025_1000042245 | 219 |
| 822 | 3300025294 | Ga0209025_1000132 | Ga0209025_1000132158 | 219 |
| 823 | 3300025294 | Ga0209025_1000591 | Ga0209025_100059152 | 219 |
| 824 | 3300025295 | Ga0209564_1000193 | Ga0209564_10001932 | 219 |
| 825 | 3300025297 | Ga0209758_1000255 | Ga0209758_100025555 | 219 |
| 826 | 3300025297 | Ga0209758_1000430 | Ga0209758_100043063 | 219 |
| 827 | 3300025297 | Ga0209758_1002586 | Ga0209758_100258612 | 219 |
| 828 | 3300025298 | Ga0209050_1000572 | Ga0209050_100057257 | 219 |
| 829 | 3300025299 | Ga0209256_1010178 | Ga0209256_10101783 | 219 |
| 830 | 3300025299 | Ga0209256_1012263 | Ga0209256_10122632 | 219 |
| 831 | 3300025302 | Ga0207426_1000072 | Ga0207426_100007250 | 219 |
| 832 | 3300025302 | Ga0207426_1027720 | Ga0207426_10277202 | 219 |
| 833 | 3300025303 | Ga0209051_1020024 | Ga0209051_10200243 | 219 |
| 834 | 3300025304 | Ga0209257_1001382 | Ga0209257_100138218 | 219 |
| 835 | 3300025315 | Ga0207697_10070204 | Ga0207697_100702042 | 219 |
| 836 | 3300025885 | Ga0207653_10022402 | Ga0207653_100224022 | 219 |
| 837 | 3300025898 | Ga0207692_10022673 | Ga0207692_100226731 | 219 |
| 838 | 3300025898 | Ga0207692_10092058 | Ga0207692_100920581 | 219 |
| 839 | 3300025905 | Ga0207685_10004693 | Ga0207685_100046933 | 219 |
| 840 | 3300025905 | Ga0207685_10227456 | Ga0207685_102274561 | 219 |
| 841 | 3300025908 | Ga0207643_10000613 | Ga0207643_1000061312 | 219 |
| 842 | 3300025909 | Ga0207705_10048689 | Ga0207705_100486892 | 219 |
| 843 | 3300025909 | Ga0207705_10180181 | Ga0207705_101801811 | 219 |
| 844 | 3300025910 | Ga0207684_10033976 | Ga0207684_100339763 | 219 |
| 845 | 3300025913 | Ga0207695_10000044 | Ga0207695_10000044360 | 219 |
| 846 | 3300025914 | Ga0207671_10000043 | Ga0207671_10000043128 | 219 |
| 847 | 3300025916 | Ga0207663_10019794 | Ga0207663_100197944 | 219 |
| 848 | 3300025918 | Ga0207662_10093154 | Ga0207662_100931543 | 219 |
| 849 | 3300025918 | Ga0207662_10096897 | Ga0207662_100968971 | 219 |
| 850 | 3300025919 | Ga0207657_10025505 | Ga0207657_100255053 | 219 |
| 851 | 3300025920 | Ga0207649_10373945 | Ga0207649_103739451 | 219 |
| 852 | 3300025922 | Ga0207646_10065889 | Ga0207646_100658892 | 219 |
| 853 | 3300025923 | Ga0207681_10736860 | Ga0207681_107368601 | 219 |
| 854 | 3300025925 | Ga0207650_10002443 | Ga0207650_100024439 | 219 |
| 855 | 3300025926 | Ga0207659_10661015 | Ga0207659_106610151 | 219 |
| 856 | 3300025928 | Ga0207700_10007976 | Ga0207700_100079766 | 219 |
| 857 | 3300025928 | Ga0207700_10075251 | Ga0207700_100752513 | 219 |
| 858 | 3300025928 | Ga0207700_10093294 | Ga0207700_100932943 | 219 |
| 859 | 3300025928 | Ga0207700_10290320 | Ga0207700_102903202 | 219 |
| 860 | 3300025928 | Ga0207700_10295244 | Ga0207700_102952442 | 219 |
| 861 | 3300025928 | Ga0207700_10522858 | Ga0207700_105228581 | 219 |
| 862 | 3300025929 | Ga0207664_10107314 | Ga0207664_101073142 | 219 |
| 863 | 3300025929 | Ga0207664_10310075 | Ga0207664_103100752 | 219 |
| 864 | 3300025929 | Ga0207664_10630357 | Ga0207664_106303571 | 219 |
| 865 | 3300025931 | Ga0207644_10183935 | Ga0207644_101839352 | 219 |
| 866 | 3300025933 | Ga0207706_10008654 | Ga0207706_100086549 | 219 |
| 867 | 3300025933 | Ga0207706_10095800 | Ga0207706_100958002 | 219 |
| 868 | 3300025937 | Ga0207669_10003551 | Ga0207669_100035512 | 219 |
| 869 | 3300025937 | Ga0207669_10580931 | Ga0207669_105809311 | 219 |
| 870 | 3300025938 | Ga0207704_10337409 | Ga0207704_103374092 | 219 |
| 871 | 3300025939 | Ga0207665_10000117 | Ga0207665_1000011746 | 219 |
| 872 | 3300025939 | Ga0207665_10036842 | Ga0207665_100368421 | 219 |
| 873 | 3300025945 | Ga0207679_10127977 | Ga0207679_101279771 | 219 |
| 874 | 3300025949 | Ga0207667_10136980 | Ga0207667_101369804 | 219 |
| 875 | 3300025960 | Ga0207651_10171172 | Ga0207651_101711722 | 219 |
| 876 | 3300025961 | Ga0207712_10056760 | Ga0207712_100567602 | 219 |
| 877 | 3300025961 | Ga0207712_10510485 | Ga0207712_105104851 | 219 |
| 878 | 3300025986 | Ga0207658_10055410 | Ga0207658_100554102 | 219 |
| 879 | 3300025986 | Ga0207658_10094692 | Ga0207658_100946922 | 219 |
| 880 | 3300025986 | Ga0207658_10344464 | Ga0207658_103444641 | 219 |
| 881 | 3300026075 | Ga0207708_10025996 | Ga0207708_100259965 | 219 |
| 882 | 3300026088 | Ga0207641_10287063 | Ga0207641_102870633 | 219 |
| 883 | 3300026089 | Ga0207648_10612286 | Ga0207648_106122862 | 219 |
| 884 | 3300026118 | Ga0207675_100670225 | Ga0207675_1006702252 | 219 |
| 885 | 3300026142 | Ga0207698_10040894 | Ga0207698_100408942 | 219 |
| 886 | 3300027111 | Ga0209281_1000030 | Ga0209281_1000030164 | 219 |
| 887 | 3300027111 | Ga0209281_1000144 | Ga0209281_1000144107 | 219 |
| 888 | 3300027312 | Ga0209371_1027003 | Ga0209371_10270031 | 219 |
| 889 | 3300027378 | Ga0209981_1011464 | Ga0209981_10114642 | 219 |
| 890 | 3300027512 | Ga0209179_1000861 | Ga0209179_10008613 | 219 |
| 891 | 3300027543 | Ga0209999_1016117 | Ga0209999_10161172 | 219 |
| 892 | 3300027552 | Ga0209982_1019550 | Ga0209982_10195502 | 219 |
| 893 | 3300027665 | Ga0209983_1030478 | Ga0209983_10304782 | 219 |
| 894 | 3300027666 | Ga0209282_1000004 | Ga0209282_1000004164 | 219 |
| 895 | 3300027682 | Ga0209971_1019044 | Ga0209971_10190442 | 219 |
| 896 | 3300027695 | Ga0209966_1013935 | Ga0209966_10139352 | 219 |
| 897 | 3300028379 | Ga0268266_10018885 | Ga0268266_100188856 | 219 |
| 898 | 3300028380 | Ga0268265_10092590 | Ga0268265_100925902 | 219 |
| 899 | 3300028556 | Ga0265337_1036207 | Ga0265337_10362072 | 219 |
| 900 | 3300028577 | Ga0265318_10023551 | Ga0265318_100235512 | 219 |
| 901 | 3300030500 | Ga0268256_1030724 | Ga0268256_10307241 | 219 |
| 902 | 3300031235 | Ga0265330_10011684 | Ga0265330_100116842 | 219 |
| 903 | 3300031238 | Ga0265332_10000616 | Ga0265332_1000061614 | 219 |
| 904 | 3300031238 | Ga0265332_10006156 | Ga0265332_100061566 | 219 |
| 905 | 3300031240 | Ga0265320_10019560 | Ga0265320_100195602 | 219 |
| 906 | 3300031241 | Ga0265325_10020612 | Ga0265325_100206124 | 219 |
| 907 | 3300031241 | Ga0265325_10042414 | Ga0265325_100424142 | 219 |
| 908 | 3300031242 | Ga0265329_10005375 | Ga0265329_100053752 | 219 |
| 909 | 3300031247 | Ga0265340_10001157 | Ga0265340_100011573 | 219 |
| 910 | 3300031247 | Ga0265340_10015097 | Ga0265340_100150971 | 219 |
| 911 | 3300031249 | Ga0265339_10001689 | Ga0265339_100016898 | 219 |
| 912 | 3300031249 | Ga0265339_10009337 | Ga0265339_100093375 | 219 |
| 913 | 3300031250 | Ga0265331_10005352 | Ga0265331_100053526 | 219 |
| 914 | 3300031250 | Ga0265331_10026552 | Ga0265331_100265522 | 219 |
| 915 | 3300031250 | Ga0265331_10028156 | Ga0265331_100281562 | 219 |
| 916 | 3300031250 | Ga0265331_10063039 | Ga0265331_100630391 | 219 |
| 917 | 3300031344 | Ga0265316_10070623 | Ga0265316_100706231 | 219 |
| 918 | 3300031548 | Ga0307408_100093069 | Ga0307408_1000930692 | 219 |
| 919 | 3300031595 | Ga0265313_10164797 | Ga0265313_101647972 | 219 |
| 920 | 3300031665 | Ga0316575_10029492 | Ga0316575_100294923 | 219 |
| 921 | 3300031691 | Ga0316579_10048692 | Ga0316579_100486923 | 219 |
| 922 | 3300031711 | Ga0265314_10007969 | Ga0265314_100079699 | 219 |
| 923 | 3300031711 | Ga0265314_10025875 | Ga0265314_100258752 | 219 |
| 924 | 3300031711 | Ga0265314_10036683 | Ga0265314_100366834 | 219 |
| 925 | 3300031712 | Ga0265342_10000139 | Ga0265342_1000013964 | 219 |
| 926 | 3300031712 | Ga0265342_10006975 | Ga0265342_100069756 | 219 |
| 927 | 3300031712 | Ga0265342_10103009 | Ga0265342_101030092 | 219 |
| 928 | 3300031727 | Ga0316576_10016655 | Ga0316576_100166553 | 219 |
| 929 | 3300031731 | Ga0307405_10000319 | Ga0307405_100003195 | 219 |
| 930 | 3300031901 | Ga0307406_10038296 | Ga0307406_100382964 | 219 |
| 931 | 3300031967 | Ga0315914_1000001 | Ga0315914_1000001219 | 219 |
| 932 | 3300031995 | Ga0307409_101167152 | Ga0307409_1011671521 | 219 |
| 933 | 3300032133 | Ga0316583_10077037 | Ga0316583_100770372 | 219 |
| 934 | 3300033430 | Ga0315913_1000004 | Ga0315913_100000481 | 219 |
| 935 | 3300033464 | Ga0315915_1000002 | Ga0315915_1000002165 | 219 |
| 936 | 3300033541 | Ga0316596_1061347 | Ga0316596_10613471 | 219 |
| 937 | 3300034820 | Ga0373959_0041399 | Ga0373959_0041399_138_863 | 219 |
| 938 | 3300034957 | Ga0373938_0019224 | Ga0373938_0019224_195_920 | 219 |
| 939 | 3300035083 | Ga0373926_0018146 | Ga0373926_0018146_506_1231 | 219 |
| 940 | 3300035083 | Ga0373926_0031361 | Ga0373926_0031361_167_892 | 219 |
| 941 | 3300035086 | Ga0373934_0019496 | Ga0373934_0019496_338_1063 | 219 |
| 942 | 3300035089 | Ga0373944_0001048 | Ga0373944_0001048_5595_6320 | 219 |
| 943 | 3300035089 | Ga0373944_0002385 | Ga0373944_0002385_327_1052 | 219 |
| 944 | 3300035089 | Ga0373944_0043865 | Ga0373944_0043865_115_873 | 219 |
| 945 | 3300035092 | Ga0373952_0041741 | Ga0373952_0041741_77_802 | 219 |
| 946 | 3300035113 | Ga0373936_0007303 | Ga0373936_0007303_2785_3510 | 219 |
| 947 | 3300035114 | Ga0373939_0113468 | Ga0373939_0113468_123_848 | 219 |
| 948 | 3300035115 | Ga0373941_0003432 | Ga0373941_0003432_915_1640 | 219 |
| 949 | 3300035116 | Ga0373945_0009707 | Ga0373945_0009707_1927_2652 | 219 |
| 950 | 3300035116 | Ga0373945_0027358 | Ga0373945_0027358_330_1088 | 219 |
| 951 | 3300035117 | Ga0373953_0000163 | Ga0373953_0000163_12876_13601 | 219 |
| 952 | 3300035117 | Ga0373953_0027416 | Ga0373953_0027416_605_1330 | 219 |
| 953 | 3300035118 | Ga0373954_0000145 | Ga0373954_0000145_13570_14295 | 219 |
| 954 | 3300035118 | Ga0373954_0004821 | Ga0373954_0004821_2425_3150 | 219 |
| 955 | 3300035119 | Ga0373956_0001494 | Ga0373956_0001494_149_874 | 219 |
| 956 | 3300035119 | Ga0373956_0105178 | Ga0373956_0105178_416_1141 | 219 |
| 957 | 3300035120 | Ga0373957_0003169 | Ga0373957_0003169_3819_4544 | 219 |
| 958 | 3300035170 | Ga0373943_0005333 | Ga0373943_0005333_1463_2188 | 219 |
| 959 | 3300035170 | Ga0373943_0005440 | Ga0373943_0005440_4366_5091 | 219 |
| 960 | 3300035170 | Ga0373943_0007037 | Ga0373943_0007037_2135_2860 | 219 |
| 961 | 3300035170 | Ga0373943_0008557 | Ga0373943_0008557_3086_3817 | 219 |
| 962 | 3300035170 | Ga0373943_0015761 | Ga0373943_0015761_506_1231 | 219 |
| 963 | 3300035170 | Ga0373943_0050796 | Ga0373943_0050796_737_1462 | 219 |
| 964 | 3300035170 | Ga0373943_0126950 | Ga0373943_0126950_25_783 | 219 |
| 965 | 3300035171 | Ga0373946_0090582 | Ga0373946_0090582_373_1131 | 219 |
| 966 | 3300035171 | Ga0373946_0104233 | Ga0373946_0104233_454_1179 | 219 |
| 967 | 3300035172 | Ga0373955_0000129 | Ga0373955_0000129_13280_14005 | 219 |
| 968 | 3300035172 | Ga0373955_0009700 | Ga0373955_0009700_2071_2796 | 219 |
| 969 | 3300035242 | Ga0373962_0017573 | Ga0373962_0017573_762_1487 | 219 |
| 970 | 3300035398 | Ga0316574_0172630 | Ga0316574_0172630_42_767 | 219 |
| 971 | 3300035410 | Ga0373924_0002728 | Ga0373924_0002728_2013_2738 | 219 |
| 972 | 3300035410 | Ga0373924_0009624 | Ga0373924_0009624_2065_2790 | 219 |
| 973 | 3300035691 | Ga0373931_0100454 | Ga0373931_0100454_342_1067 | 219 |
| 974 | 3300035692 | Ga0373935_0001583 | Ga0373935_0001583_673_1398 | 219 |
| 975 | 3300035692 | Ga0373935_0008943 | Ga0373935_0008943_1608_2333 | 219 |
| 976 | 3300035692 | Ga0373935_0029303 | Ga0373935_0029303_1295_2026 | 219 |
| 977 | 3300035692 | Ga0373935_0034563 | Ga0373935_0034563_17_775 | 219 |
| 978 | 3300035692 | Ga0373935_0070266 | Ga0373935_0070266_1236_1961 | 219 |
| 979 | 3300035695 | Ga0373927_0000243 | Ga0373927_0000243_9920_10645 | 219 |
| 980 | 3300035695 | Ga0373927_0016658 | Ga0373927_0016658_2611_3336 | 219 |
| 981 | 3300035695 | Ga0373927_0040324 | Ga0373927_0040324_1465_2190 | 219 |
| 982 | 3300035695 | Ga0373927_0223252 | Ga0373927_0223252_215_940 | 219 |
| 983 | 3300035724 | Ga0373933_0000999 | Ga0373933_0000999_5439_6164 | 219 |
| 984 | 3300035724 | Ga0373933_0014674 | Ga0373933_0014674_1189_1914 | 219 |
| 985 | 3300035725 | Ga0373947_0004234 | Ga0373947_0004234_2548_3306 | 219 |
| 986 | 3300035725 | Ga0373947_0006288 | Ga0373947_0006288_4069_4794 | 219 |
| 987 | 3300035725 | Ga0373947_0022019 | Ga0373947_0022019_2922_3647 | 219 |
| 988 | 3300035725 | Ga0373947_0145550 | Ga0373947_0145550_424_1149 | 219 |
| 989 | 3300035725 | Ga0373947_0154857 | Ga0373947_0154857_565_1296 | 219 |
| 990 | 3300035725 | Ga0373947_0268394 | Ga0373947_0268394_10_735 | 219 |
| 991 | 3300036401 | Ga0373937_0001770 | Ga0373937_0001770_14920_15645 | 219 |
| 992 | 3300036401 | Ga0373937_0050791 | Ga0373937_0050791_2780_3505 | 219 |
| 993 | 3300036401 | Ga0373937_0211788 | Ga0373937_0211788_793_1518 | 219 |
| 994 | 3300036712 | Ga0316584_0025549 | Ga0316584_0025549_76_801 | 219 |
| 995 | 3300037068 | Ga0373925_0002474 | Ga0373925_0002474_10567_11292 | 219 |
| 996 | 3300037068 | Ga0373925_0006021 | Ga0373925_0006021_7239_7997 | 219 |
| 997 | 3300037068 | Ga0373925_0007690 | Ga0373925_0007690_720_1445 | 219 |
| 998 | 3300037068 | Ga0373925_0010149 | Ga0373925_0010149_57_782 | 219 |
| 999 | 3300037068 | Ga0373925_0070975 | Ga0373925_0070975_1049_1780 | 219 |
| 1000 | 3300037068 | Ga0373925_0102445 | Ga0373925_0102445_1351_2076 | 219 |
| 1001 | 3300037068 | Ga0373925_0131664 | Ga0373925_0131664_731_1456 | 219 |
| 1002 | 3300037068 | Ga0373925_0382068 | Ga0373925_0382068_174_899 | 219 |
| 1003 | 3300037312 | Ga0395899_0020603 | Ga0395899_0020603_2661_3386 | 219 |
| 1004 | 3300037418 | Ga0395900_0293717 | Ga0395900_0293717_411_1136 | 219 |
| 1005 | 3300037418 | Ga0395900_0560326 | Ga0395900_0560326_280_1005 | 219 |
| 1006 | 3300037466 | Ga0395898_0040958 | Ga0395898_0040958_3761_4489 | 219 |
| 1007 | 3300037466 | Ga0395898_0041459 | Ga0395898_0041459_1351_2076 | 219 |
| 1008 | 3300037466 | Ga0395898_0081359 | Ga0395898_0081359_2326_3051 | 219 |
| 1009 | 3300037471 | Ga0395905_0134471 | Ga0395905_0134471_873_1598 | 219 |
| 1010 | 3300037853 | Ga0436364_1293698 | Ga0436364_1293698_177_902 | 219 |
| 1011 | 3300037853 | Ga0436364_1378623 | Ga0436364_1378623_218_943 | 219 |
| 1012 | 3300038443 | Ga0395901_0516912 | Ga0395901_0516912_461_1186 | 219 |
| 1013 | 3300039062 | Ga0400483_184981 | Ga0400483_184981_24_767 | 219 |
| 1014 | 3300039437 | Ga0436365_0008071 | Ga0436365_0008071_5893_6618 | 219 |
| 1015 | 3300039437 | Ga0436365_0047534 | Ga0436365_0047534_480_1205 | 219 |
| 1016 | 3300039437 | Ga0436365_1561193 | Ga0436365_1561193_249_974 | 219 |
| 1017 | 3300039438 | Ga0436360_0205543 | Ga0436360_0205543_291_1016 | 219 |
| 1018 | 3300039438 | Ga0436360_0224814 | Ga0436360_0224814_93_818 | 219 |
| 1019 | 3300039447 | Ga0436361_0092227 | Ga0436361_0092227_1049_1774 | 219 |
| 1020 | 3300039447 | Ga0436361_0494886 | Ga0436361_0494886_361_1086 | 219 |
| 1021 | 3300039450 | Ga0436363_0639451 | Ga0436363_0639451_33_770 | 219 |
| 1022 | 3300039450 | Ga0436363_0780921 | Ga0436363_0780921_1987_2712 | 219 |
| 1023 | 3300039450 | Ga0436363_1418375 | Ga0436363_1418375_538_1263 | 219 |
| 1024 | 3300041404 | Ga0439436_0047100 | Ga0439436_0047100_484_1209 | 219 |
| 1025 | 3300041463 | Ga0451804_0220353 | Ga0451804_0220353_16_741 | 219 |
| 1026 | 3300042001 | Ga0439441_002900 | Ga0439441_002900_1466_2191 | 219 |
| 1027 | 3300042007 | Ga0439449_0006122 | Ga0439449_0006122_182_907 | 219 |
| 1028 | 3300042008 | Ga0439450_023665 | Ga0439450_023665_112_837 | 219 |
| 1029 | 3300044684 | Ga0466966_0229552 | Ga0466966_0229552_342_1070 | 219 |
| 1030 | 3300044735 | Ga0466968_0064700 | Ga0466968_0064700_184_918 | 219 |
| 1031 | 3300045049 | Ga0466959_0048305 | Ga0466959_0048305_2128_2853 | 219 |
| 1032 | 3300045051 | Ga0451576_0003376 | Ga0451576_0003376_6762_7487 | 219 |
| 1033 | 3300045836 | Ga0466958_0198665 | Ga0466958_0198665_97_873 | 219 |
| 1034 | 3300045976 | Ga0466967_0677786 | Ga0466967_0677786_83_808 | 219 |
| 1035 | 3300046454 | Ga0495592_0001415 | Ga0495592_0001415_8654_9379 | 219 |
| 1036 | 3300046454 | Ga0495592_0066586 | Ga0495592_0066586_37_762 | 219 |
| 1037 | 3300046455 | Ga0495603_0026000 | Ga0495603_0026000_1505_2230 | 219 |
| 1038 | 3300046458 | Ga0495591_038725 | Ga0495591_038725_259_984 | 219 |
| 1039 | 3300046459 | Ga0495629_0000668 | Ga0495629_0000668_16991_17716 | 219 |
| 1040 | 3300046459 | Ga0495629_0001605 | Ga0495629_0001605_2753_3478 | 219 |
| 1041 | 3300046459 | Ga0495629_0047268 | Ga0495629_0047268_961_1686 | 219 |
| 1042 | 3300046460 | Ga0495638_0163759 | Ga0495638_0163759_181_906 | 219 |
| 1043 | 3300046461 | Ga0495641_0007758 | Ga0495641_0007758_4432_5157 | 219 |
| 1044 | 3300046461 | Ga0495641_0019335 | Ga0495641_0019335_1654_2385 | 219 |
| 1045 | 3300046462 | Ga0495651_0021179 | Ga0495651_0021179_2103_2828 | 219 |
| 1046 | 3300046463 | Ga0495653_0000300 | Ga0495653_0000300_14842_15567 | 219 |
| 1047 | 3300046463 | Ga0495653_0027546 | Ga0495653_0027546_2504_3229 | 219 |
| 1048 | 3300046472 | Ga0495580_0018640 | Ga0495580_0018640_3014_3745 | 219 |
| 1049 | 3300046472 | Ga0495580_0031293 | Ga0495580_0031293_378_1103 | 219 |
| 1050 | 3300046473 | Ga0495582_0002207 | Ga0495582_0002207_7255_7980 | 219 |
| 1051 | 3300046473 | Ga0495582_0028720 | Ga0495582_0028720_1923_2654 | 219 |
| 1052 | 3300046475 | Ga0495639_0022873 | Ga0495639_0022873_2004_2729 | 219 |
| 1053 | 3300046476 | Ga0495662_0046886 | Ga0495662_0046886_764_1489 | 219 |
| 1054 | 3300046477 | Ga0495664_0000877 | Ga0495664_0000877_14489_15214 | 219 |
| 1055 | 3300046477 | Ga0495664_0074144 | Ga0495664_0074144_16_741 | 219 |
| 1056 | 3300046491 | Ga0495584_0096965 | Ga0495584_0096965_732_1457 | 219 |
| 1057 | 3300046492 | Ga0495585_0004225 | Ga0495585_0004225_7625_8350 | 219 |
| 1058 | 3300046499 | Ga0495594_0036748 | Ga0495594_0036748_1391_2116 | 219 |
| 1059 | 3300046499 | Ga0495594_0130699 | Ga0495594_0130699_336_1067 | 219 |
| 1060 | 3300046501 | Ga0495607_0005594 | Ga0495607_0005594_2024_2749 | 219 |
| 1061 | 3300046511 | Ga0495608_0001863 | Ga0495608_0001863_14190_14915 | 219 |
| 1062 | 3300046511 | Ga0495608_0021002 | Ga0495608_0021002_1372_2097 | 219 |
| 1063 | 3300046512 | Ga0495610_0000530 | Ga0495610_0000530_11600_12325 | 219 |
| 1064 | 3300046514 | Ga0495618_0007932 | Ga0495618_0007932_2426_3151 | 219 |
| 1065 | 3300046514 | Ga0495618_0015011 | Ga0495618_0015011_465_1190 | 219 |
| 1066 | 3300046516 | Ga0495628_0015340 | Ga0495628_0015340_3797_4522 | 219 |
| 1067 | 3300046516 | Ga0495628_0055939 | Ga0495628_0055939_255_980 | 219 |
| 1068 | 3300046517 | Ga0495630_0012446 | Ga0495630_0012446_4494_5219 | 219 |
| 1069 | 3300046517 | Ga0495630_0078757 | Ga0495630_0078757_1011_1736 | 219 |
| 1070 | 3300046519 | Ga0495632_0001108 | Ga0495632_0001108_1558_2283 | 219 |
| 1071 | 3300046520 | Ga0495637_0054046 | Ga0495637_0054046_801_1526 | 219 |
| 1072 | 3300046522 | Ga0495643_0025174 | Ga0495643_0025174_1632_2357 | 219 |
| 1073 | 3300046523 | Ga0495644_0000306 | Ga0495644_0000306_9968_10693 | 219 |
| 1074 | 3300046524 | Ga0495648_0077361 | Ga0495648_0077361_826_1584 | 219 |
| 1075 | 3300046526 | Ga0495666_0015401 | Ga0495666_0015401_1548_2279 | 219 |
| 1076 | 3300046528 | Ga0495642_0228251 | Ga0495642_0228251_73_798 | 219 |
| 1077 | 3300046529 | Ga0495652_0002115 | Ga0495652_0002115_6168_6893 | 219 |
| 1078 | 3300046529 | Ga0495652_0013648 | Ga0495652_0013648_1726_2451 | 219 |
| 1079 | 3300046529 | Ga0495652_0305975 | Ga0495652_0305975_95_820 | 219 |
| 1080 | 3300046531 | Ga0495665_0062590 | Ga0495665_0062590_223_948 | 219 |
| 1081 | 3300046533 | Ga0495640_0005373 | Ga0495640_0005373_9348_10073 | 219 |
| 1082 | 3300046533 | Ga0495640_0013146 | Ga0495640_0013146_3643_4401 | 219 |
| 1083 | 3300046533 | Ga0495640_0015102 | Ga0495640_0015102_1087_1812 | 219 |
| 1084 | 3300046533 | Ga0495640_0159277 | Ga0495640_0159277_582_1307 | 219 |
| 1085 | 3300046535 | Ga0495586_0027068 | Ga0495586_0027068_2273_2998 | 219 |
| 1086 | 3300046535 | Ga0495586_0112940 | Ga0495586_0112940_659_1417 | 219 |
| 1087 | 3300046536 | Ga0495587_0002255 | Ga0495587_0002255_898_1623 | 219 |
| 1088 | 3300046536 | Ga0495587_0178859 | Ga0495587_0178859_295_1020 | 219 |
| 1089 | 3300046537 | Ga0495598_0002277 | Ga0495598_0002277_228_953 | 219 |
| 1090 | 3300046539 | Ga0495621_0080055 | Ga0495621_0080055_85_810 | 219 |
| 1091 | 3300046543 | Ga0495645_0001277 | Ga0495645_0001277_14177_14902 | 219 |
| 1092 | 3300046543 | Ga0495645_0033438 | Ga0495645_0033438_2411_3136 | 219 |
| 1093 | 3300046543 | Ga0495645_0144812 | Ga0495645_0144812_591_1316 | 219 |
| 1094 | 3300046557 | Ga0495622_0004842 | Ga0495622_0004842_4216_4941 | 219 |
| 1095 | 3300046558 | Ga0495633_0001183 | Ga0495633_0001183_10326_11051 | 219 |
| 1096 | 3300046558 | Ga0495633_0094773 | Ga0495633_0094773_82_807 | 219 |
| 1097 | 3300046559 | Ga0495667_0000121 | Ga0495667_0000121_48781_49506 | 219 |
| 1098 | 3300046559 | Ga0495667_0043767 | Ga0495667_0043767_239_964 | 219 |
| 1099 | 3300046615 | Ga0495656_0072048 | Ga0495656_0072048_562_1287 | 219 |
| 1100 | 3300046642 | Ga0495634_0002835 | Ga0495634_0002835_12510_13235 | 219 |
| 1101 | 3300046642 | Ga0495634_0016888 | Ga0495634_0016888_3194_3952 | 219 |
| 1102 | 3300046642 | Ga0495634_0020441 | Ga0495634_0020441_3464_4189 | 219 |
| 1103 | 3300046648 | Ga0495611_0003332 | Ga0495611_0003332_1011_1736 | 219 |
| 1104 | 3300046663 | Ga0495635_0000072 | Ga0495635_0000072_49803_50528 | 219 |
| 1105 | 3300046663 | Ga0495635_0017419 | Ga0495635_0017419_3295_4020 | 219 |
| 1106 | 3300046663 | Ga0495635_0044207 | Ga0495635_0044207_1135_1860 | 219 |
| 1107 | 3300046664 | Ga0495659_0000645 | Ga0495659_0000645_9964_10689 | 219 |
| 1108 | 3300046674 | Ga0495588_0003103 | Ga0495588_0003103_4038_4763 | 219 |
| 1109 | 3300046674 | Ga0495588_0113522 | Ga0495588_0113522_638_1369 | 219 |
| 1110 | 3300046675 | Ga0495657_0001284 | Ga0495657_0001284_11048_11773 | 219 |
| 1111 | 3300046675 | Ga0495657_0107448 | Ga0495657_0107448_165_890 | 219 |
| 1112 | 3300046678 | Ga0495599_0000695 | Ga0495599_0000695_11641_12366 | 219 |
| 1113 | 3300046678 | Ga0495599_0017266 | Ga0495599_0017266_2104_2829 | 219 |
| 1114 | 3300046679 | Ga0495623_0000291 | Ga0495623_0000291_11091_11816 | 219 |
| 1115 | 3300046680 | Ga0495646_0031506 | Ga0495646_0031506_1679_2404 | 219 |
| 1116 | 3300046680 | Ga0495646_0037206 | Ga0495646_0037206_2276_3001 | 219 |
| 1117 | 3300046680 | Ga0495646_0048349 | Ga0495646_0048349_1711_2436 | 219 |
| 1118 | 3300046681 | Ga0495647_0057825 | Ga0495647_0057825_45_770 | 219 |
| 1119 | 3300046681 | Ga0495647_0110990 | Ga0495647_0110990_42_767 | 219 |
| 1120 | 3300046683 | Ga0495658_0000229 | Ga0495658_0000229_16182_16907 | 219 |
| 1121 | 3300046683 | Ga0495658_0023036 | Ga0495658_0023036_1613_2344 | 219 |
| 1122 | 3300046683 | Ga0495658_0049426 | Ga0495658_0049426_1013_1738 | 219 |
| 1123 | 3300046689 | Ga0495613_0002758 | Ga0495613_0002758_10284_11009 | 219 |
| 1124 | 3300046689 | Ga0495613_0007587 | Ga0495613_0007587_1329_2054 | 219 |
| 1125 | 3300046689 | Ga0495613_0037004 | Ga0495613_0037004_472_1197 | 219 |
| 1126 | 3300046689 | Ga0495613_0038838 | Ga0495613_0038838_1307_2038 | 219 |
| 1127 | 3300046689 | Ga0495613_0074812 | Ga0495613_0074812_16_741 | 219 |
| 1128 | 3300046690 | Ga0495624_0028910 | Ga0495624_0028910_2769_3494 | 219 |
| 1129 | 3300046690 | Ga0495624_0074972 | Ga0495624_0074972_699_1424 | 219 |
| 1130 | 3300046691 | Ga0495670_0004752 | Ga0495670_0004752_2163_2888 | 219 |
| 1131 | 3300046691 | Ga0495670_0062899 | Ga0495670_0062899_961_1692 | 219 |
| 1132 | 3300046692 | Ga0495671_0039884 | Ga0495671_0039884_413_1150 | 219 |
| 1133 | 3300046809 | Ga0495600_0000330 | Ga0495600_0000330_10710_11435 | 219 |
| 1134 | 3300046809 | Ga0495600_0045949 | Ga0495600_0045949_16_741 | 219 |
| 1135 | 3300047315 | Ga0495581_0006942 | Ga0495581_0006942_1736_2461 | 219 |
| 1136 | 3300047315 | Ga0495581_0008513 | Ga0495581_0008513_610_1335 | 219 |
| 1137 | 3300047317 | Ga0495604_0003872 | Ga0495604_0003872_3926_4651 | 219 |
| 1138 | 3300047319 | Ga0495674_0002065 | Ga0495674_0002065_14968_15693 | 219 |
| 1139 | 3300047319 | Ga0495674_0017187 | Ga0495674_0017187_495_1253 | 219 |
| 1140 | 3300047319 | Ga0495674_0019117 | Ga0495674_0019117_3833_4558 | 219 |
| 1141 | 3300047319 | Ga0495674_0098730 | Ga0495674_0098730_296_1021 | 219 |
| 1142 | 3300047321 | Ga0495676_0012443 | Ga0495676_0012443_3672_4397 | 219 |
| 1143 | 3300047321 | Ga0495676_0152323 | Ga0495676_0152323_747_1472 | 219 |
| 1144 | 3300047321 | Ga0495676_0231937 | Ga0495676_0231937_37_762 | 219 |
| 1145 | 3300047322 | Ga0495680_0009139 | Ga0495680_0009139_2405_3130 | 219 |
| 1146 | 3300047322 | Ga0495680_0036945 | Ga0495680_0036945_2004_2729 | 219 |
| 1147 | 3300047322 | Ga0495680_0080264 | Ga0495680_0080264_506_1231 | 219 |
| 1148 | 3300047322 | Ga0495680_0401106 | Ga0495680_0401106_65_790 | 219 |
| 1149 | 3300047444 | Ga0495675_0000796 | Ga0495675_0000796_16505_17230 | 219 |
| 1150 | 3300047444 | Ga0495675_0243369 | Ga0495675_0243369_335_1060 | 219 |
| 1151 | 3300047445 | Ga0495677_0184934 | Ga0495677_0184934_25_750 | 219 |
| 1152 | 3300047446 | Ga0495679_034322 | Ga0495679_034322_537_1262 | 219 |
| 1153 | 3300047470 | Ga0495681_0003767 | Ga0495681_0003767_9297_10034 | 219 |
| 1154 | 3300047470 | Ga0495681_0090686 | Ga0495681_0090686_40_765 | 219 |
| 1155 | 3300047471 | Ga0495684_0000594 | Ga0495684_0000594_2530_3255 | 219 |
| 1156 | 3300047471 | Ga0495684_0014934 | Ga0495684_0014934_762_1487 | 219 |
| 1157 | 3300047471 | Ga0495684_0091239 | Ga0495684_0091239_132_857 | 219 |
| 1158 | 3300047471 | Ga0495684_0248620 | Ga0495684_0248620_417_1142 | 219 |
| 1159 | 3300047472 | Ga0495686_0000269 | Ga0495686_0000269_87336_88061 | 219 |
| 1160 | 3300047472 | Ga0495686_0003611 | Ga0495686_0003611_1803_2528 | 219 |
| 1161 | 3300047673 | Ga0495593_0000641 | Ga0495593_0000641_8273_8998 | 219 |
| 1162 | 3300047673 | Ga0495593_0015025 | Ga0495593_0015025_2629_3354 | 219 |
| 1163 | 3300047673 | Ga0495593_0024445 | Ga0495593_0024445_2474_3199 | 219 |
| 1164 | 3300047673 | Ga0495593_0040039 | Ga0495593_0040039_435_1160 | 219 |
| 1165 | 3300048088 | Ga0495602_0004847 | Ga0495602_0004847_3589_4314 | 219 |
| 1166 | 3300048088 | Ga0495602_0057882 | Ga0495602_0057882_1164_1889 | 219 |
| 1167 | 3300048089 | Ga0495614_0005547 | Ga0495614_0005547_4230_4955 | 219 |
| 1168 | 3300048090 | Ga0495615_0055265 | Ga0495615_0055265_20_745 | 219 |
| 1169 | 3300048903 | Ga0496100_0270443 | Ga0496100_0270443_248_973 | 219 |
| 1170 | 3300048904 | Ga0496101_0365362 | Ga0496101_0365362_343_1068 | 219 |
| 1171 | 3300048905 | Ga0496102_0381817 | Ga0496102_0381817_148_873 | 219 |
| 1172 | 3300048907 | Ga0496104_0033322 | Ga0496104_0033322_2990_3715 | 219 |
| 1173 | 3300048908 | Ga0496105_0382335 | Ga0496105_0382335_300_1025 | 219 |
| 1174 | 3300048909 | Ga0496106_0022817 | Ga0496106_0022817_2343_3068 | 219 |
| 1175 | 3300048909 | Ga0496106_0335659 | Ga0496106_0335659_242_967 | 219 |
| 1176 | 3300048910 | Ga0496107_0159415 | Ga0496107_0159415_632_1357 | 219 |
| 1177 | 3300048912 | Ga0496109_0091484 | Ga0496109_0091484_352_1077 | 219 |
| 1178 | 3300048913 | Ga0496110_0006378 | Ga0496110_0006378_6771_7496 | 219 |
| 1179 | 3300048915 | Ga0496112_0028322 | Ga0496112_0028322_3411_4136 | 219 |
| 1180 | 3300048915 | Ga0496112_0073057 | Ga0496112_0073057_21_746 | 219 |
| 1181 | 3300048916 | Ga0496113_0417097 | Ga0496113_0417097_106_831 | 219 |
| 1182 | 3300048918 | Ga0496115_0116250 | Ga0496115_0116250_632_1357 | 219 |
| 1183 | 3300048919 | Ga0496116_0001796 | Ga0496116_0001796_21129_21854 | 219 |
| 1184 | 3300048919 | Ga0496116_0006429 | Ga0496116_0006429_8473_9198 | 219 |
| 1185 | 3300048919 | Ga0496116_0010738 | Ga0496116_0010738_1539_2264 | 219 |
| 1186 | 3300048919 | Ga0496116_0025017 | Ga0496116_0025017_1290_2015 | 219 |
| 1187 | 3300048920 | Ga0496117_0012169 | Ga0496117_0012169_3999_4724 | 219 |
| 1188 | 3300048920 | Ga0496117_0040813 | Ga0496117_0040813_2403_3128 | 219 |
| 1189 | 3300048921 | Ga0496118_0037860 | Ga0496118_0037860_2286_3011 | 219 |
| 1190 | 3300048921 | Ga0496118_0071833 | Ga0496118_0071833_1548_2273 | 219 |
| 1191 | 3300048922 | Ga0496119_0154257 | Ga0496119_0154257_429_1157 | 219 |
| 1192 | 3300048924 | Ga0496121_0017255 | Ga0496121_0017255_1329_2054 | 219 |
| 1193 | 3300048924 | Ga0496121_0046016 | Ga0496121_0046016_2659_3384 | 219 |
| 1194 | 3300048924 | Ga0496121_0099426 | Ga0496121_0099426_1328_2053 | 219 |
| 1195 | 3300048925 | Ga0496122_0011409 | Ga0496122_0011409_6041_6766 | 219 |
| 1196 | 3300048925 | Ga0496122_0042101 | Ga0496122_0042101_2774_3499 | 219 |
| 1197 | 3300048925 | Ga0496122_0072861 | Ga0496122_0072861_1307_2032 | 219 |
| 1198 | 3300048925 | Ga0496122_0079885 | Ga0496122_0079885_599_1324 | 219 |
| 1199 | 3300048926 | Ga0496123_0003477 | Ga0496123_0003477_5763_6488 | 219 |
| 1200 | 3300048926 | Ga0496123_0014908 | Ga0496123_0014908_5206_5931 | 219 |
| 1201 | 3300048926 | Ga0496123_0031554 | Ga0496123_0031554_2318_3043 | 219 |
| 1202 | 3300048927 | Ga0496124_0006309 | Ga0496124_0006309_5496_6221 | 219 |
| 1203 | 3300048927 | Ga0496124_0008251 | Ga0496124_0008251_5511_6236 | 219 |
| 1204 | 3300048927 | Ga0496124_0022918 | Ga0496124_0022918_886_1611 | 219 |
| 1205 | 3300048927 | Ga0496124_0040338 | Ga0496124_0040338_2909_3634 | 219 |
| 1206 | 3300048927 | Ga0496124_0303193 | Ga0496124_0303193_137_862 | 219 |
| 1207 | 3300048928 | Ga0496125_0002335 | Ga0496125_0002335_1514_2239 | 219 |
| 1208 | 3300049568 | Ga0501031_0412925 | Ga0501031_0412925_132_857 | 219 |
| 1209 | 3300049571 | Ga0501034_0041027 | Ga0501034_0041027_1956_2681 | 219 |
| 1210 | 3300049571 | Ga0501034_0127319 | Ga0501034_0127319_191_916 | 219 |
| 1211 | 3300049572 | Ga0501036_0020355 | Ga0501036_0020355_2613_3338 | 219 |
| 1212 | 3300049572 | Ga0501036_0030645 | Ga0501036_0030645_1731_2456 | 219 |
| 1213 | 3300049574 | Ga0501038_0056984 | Ga0501038_0056984_151_876 | 219 |
| 1214 | 3300049574 | Ga0501038_0059157 | Ga0501038_0059157_491_1216 | 219 |
| 1215 | 3300049574 | Ga0501038_0142330 | Ga0501038_0142330_495_1220 | 219 |
| 1216 | 3300049575 | Ga0501039_0009471 | Ga0501039_0009471_504_1229 | 219 |
| 1217 | 3300049575 | Ga0501039_0522172 | Ga0501039_0522172_39_764 | 219 |
| 1218 | 3300049579 | Ga0501043_0050717 | Ga0501043_0050717_378_1103 | 219 |
| 1219 | 3300049581 | Ga0501047_0026320 | Ga0501047_0026320_1792_2517 | 219 |
| 1220 | 3300049581 | Ga0501047_0043963 | Ga0501047_0043963_3314_4039 | 219 |
| 1221 | 3300049581 | Ga0501047_0234621 | Ga0501047_0234621_750_1475 | 219 |
| 1222 | 3300049582 | Ga0501048_0000302 | Ga0501048_0000302_31045_31773 | 219 |
| 1223 | 3300049583 | Ga0501067_0049133 | Ga0501067_0049133_1149_1874 | 219 |
| 1224 | 3300049584 | Ga0501068_0030914 | Ga0501068_0030914_1531_2256 | 219 |
| 1225 | 3300049584 | Ga0501068_0062769 | Ga0501068_0062769_351_1076 | 219 |
| 1226 | 3300049585 | Ga0501069_0258577 | Ga0501069_0258577_252_977 | 219 |
| 1227 | 3300049586 | Ga0501070_0022527 | Ga0501070_0022527_3142_3867 | 219 |
| 1228 | 3300049586 | Ga0501070_0201742 | Ga0501070_0201742_336_1061 | 219 |
| 1229 | 3300049589 | Ga0501073_0027419 | Ga0501073_0027419_372_1187 | 219 |
| 1230 | 3300049589 | Ga0501073_0536421 | Ga0501073_0536421_17_745 | 219 |
| 1231 | 3300049590 | Ga0501074_0038453 | Ga0501074_0038453_1113_1838 | 219 |
| 1232 | 3300049592 | Ga0501076_0630322 | Ga0501076_0630322_84_809 | 219 |
| 1233 | 3300049593 | Ga0501077_0010467 | Ga0501077_0010467_421_1146 | 219 |
| 1234 | 3300049593 | Ga0501077_0120998 | Ga0501077_0120998_797_1522 | 219 |
| 1235 | 3300049593 | Ga0501077_0300785 | Ga0501077_0300785_65_790 | 219 |
| 1236 | 3300049741 | Ga0501079_0026337 | Ga0501079_0026337_1356_2081 | 219 |
| 1237 | 3300049741 | Ga0501079_0330179 | Ga0501079_0330179_16_741 | 219 |
| 1238 | 3300049742 | Ga0501080_0099024 | Ga0501080_0099024_1367_2092 | 219 |
| 1239 | 3300049744 | Ga0501083_0009432 | Ga0501083_0009432_1558_2283 | 219 |
| 1240 | 3300049744 | Ga0501083_0101265 | Ga0501083_0101265_1098_1823 | 219 |
| 1241 | 3300049822 | Ga0501035_0141034 | Ga0501035_0141034_17_742 | 219 |
| 1242 | 3300049823 | Ga0501044_0000509 | Ga0501044_0000509_11874_12599 | 219 |
| 1243 | 3300049823 | Ga0501044_0023168 | Ga0501044_0023168_5027_5752 | 219 |
| 1244 | 3300049823 | Ga0501044_0099694 | Ga0501044_0099694_1536_2261 | 219 |
| 1245 | 3300049823 | Ga0501044_0121115 | Ga0501044_0121115_264_989 | 219 |
| 1246 | 3300049823 | Ga0501044_0124359 | Ga0501044_0124359_1709_2434 | 219 |
| 1247 | 3300049823 | Ga0501044_0155855 | Ga0501044_0155855_1479_2204 | 219 |
| 1248 | 3300049823 | Ga0501044_0268553 | Ga0501044_0268553_704_1429 | 219 |
| 1249 | 3300049824 | Ga0501045_0263972 | Ga0501045_0263972_161_886 | 219 |
| 1250 | 3300050492 | nmdc:mga0yw44_29500_c1 | nmdc:mga0yw44_29500_c1_690_1415 | 219 |
| 1251 | 3300050493 | nmdc:mga0k408_245651_c1 | nmdc:mga0k408_245651_c1_177_902 | 219 |
| 1252 | 3300050494 | nmdc:mga06z11_161499_c1 | nmdc:mga06z11_161499_c1_126_914 | 219 |
| 1253 | 3300050496 | nmdc:mga07m45_167326_c1 | nmdc:mga07m45_167326_c1_201_932 | 219 |
| 1254 | 3300050496 | nmdc:mga07m45_69540_c1 | nmdc:mga07m45_69540_c1_957_1682 | 219 |
| 1255 | 3300050507 | nmdc:mga05p37_960127_c1 | nmdc:mga05p37_960127_c1_178_903 | 219 |
| 1256 | 3300050509 | nmdc:mga0qj67_128_c1 | nmdc:mga0qj67_128_c1_24815_25549 | 219 |
| 1257 | 3300050509 | nmdc:mga0qj67_295557_c1 | nmdc:mga0qj67_295557_c1_315_1040 | 219 |
| 1258 | 3300050509 | nmdc:mga0qj67_452593_c1 | nmdc:mga0qj67_452593_c1_145_870 | 219 |
| 1259 | 3300050511 | nmdc:mga08y16_173974_c1 | nmdc:mga08y16_173974_c1_944_1669 | 219 |
| 1260 | 3300050511 | nmdc:mga08y16_220666_c1 | nmdc:mga08y16_220666_c1_1146_1871 | 219 |
| 1261 | 3300050511 | nmdc:mga08y16_361824_c1 | nmdc:mga08y16_361824_c1_611_1387 | 219 |
| 1262 | 3300050512 | nmdc:mga0n895_147647_c1 | nmdc:mga0n895_147647_c1_1559_2284 | 219 |
| 1263 | 3300050512 | nmdc:mga0n895_58450_c1 | nmdc:mga0n895_58450_c1_1998_2723 | 219 |
| 1264 | 3300050512 | nmdc:mga0n895_773241_c1 | nmdc:mga0n895_773241_c1_170_895 | 219 |
| 1265 | 3300050513 | nmdc:mga0rr50_659953_c1 | nmdc:mga0rr50_659953_c1_128_853 | 219 |
| 1266 | 3300050514 | nmdc:mga08x19_80332_c1 | nmdc:mga08x19_80332_c1_35_760 | 219 |
| 1267 | 3300050515 | nmdc:mga0a205_323455_c1 | nmdc:mga0a205_323455_c1_292_1017 | 219 |
| 1268 | 3300053077 | Ga0495601_0001526 | Ga0495601_0001526_5963_6688 | 219 |
| 1269 | 3300053077 | Ga0495601_0095959 | Ga0495601_0095959_1068_1826 | 219 |
| 1270 | 3300053078 | Ga0495612_0001337 | Ga0495612_0001337_1403_2128 | 219 |
| 1271 | 3300053078 | Ga0495612_0008988 | Ga0495612_0008988_1235_1960 | 219 |
| 1272 | 3300053084 | Ga0495595_0002985 | Ga0495595_0002985_1646_2371 | 219 |
| 1273 | 3300053084 | Ga0495595_0068618 | Ga0495595_0068618_297_1022 | 219 |
| 1274 | 3300053085 | Ga0495619_0001864 | Ga0495619_0001864_9521_10246 | 219 |
| 1275 | 3300053085 | Ga0495619_0002658 | Ga0495619_0002658_147_872 | 219 |
| 1276 | 3300053085 | Ga0495619_0005185 | Ga0495619_0005185_5574_6299 | 219 |
| 1277 | 3300053085 | Ga0495619_0137769 | Ga0495619_0137769_578_1303 | 219 |
| 1278 | 3300053093 | Ga0500651_0006750 | Ga0500651_0006750_2887_3612 | 219 |
| 1279 | 3300053094 | Ga0500566_0043210 | Ga0500566_0043210_1615_2361 | 219 |
| 1280 | 3300053103 | Ga0500555_001006 | Ga0500555_001006_7538_8263 | 219 |
| 1281 | 3300053119 | Ga0500595_000001 | Ga0500595_000001_1081335_1082081 | 219 |
| 1282 | 3300053119 | Ga0500595_011782 | Ga0500595_011782_1537_2262 | 219 |
| 1283 | 3300053131 | Ga0500652_000056 | Ga0500652_000056_27069_27794 | 219 |
| 1284 | 3300053134 | Ga0500658_0037202 | Ga0500658_0037202_543_1268 | 219 |
| 1285 | 3300053136 | Ga0500559_0005651 | Ga0500559_0005651_2372_3097 | 219 |
| 1286 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_908860_909717 | 219 |
| 1287 | 3300053153 | Ga0500616_0000441 | Ga0500616_0000441_41366_42094 | 219 |
| 1288 | 3300053177 | Ga0500636_0012034 | Ga0500636_0012034_852_1577 | 219 |
| 1289 | 3300053737 | Ga0500601_000399 | Ga0500601_000399_135_860 | 219 |
| 1290 | 3300054114 | Ga0501084_0139445 | Ga0501084_0139445_716_1441 | 219 |
| 1291 | 3300055283 | Ga0500661_014610 | Ga0500661_014610_66_791 | 219 |
| 1292 | 3300059493 | Ga0587077_037182 | Ga0587077_037182_13_828 | 219 |
| 1293 | 3300060353 | Ga0501082_0061318 | Ga0501082_0061318_2350_3075 | 219 |
| 1294 | 3300060353 | Ga0501082_0184800 | Ga0501082_0184800_23_748 | 219 |
| 1295 | 3300060353 | Ga0501082_0202907 | Ga0501082_0202907_189_914 | 219 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5vt6-assembly1.cif.gz_A | crystal structure of acetoacetyl-coa reductase from burkholderia pseudomallei 1710b complexed with nadp | 0.9626 | 2 | 219 |
| 4k6c-assembly1.cif.gz_A | x-ray crystal structure of a putative acetoacyl-coa reductase from burkholderia cenocepacia | 0.9576 | 2 | 219 |
| 5vt6-assembly1.cif.gz_A | crystal structure of acetoacetyl-coa reductase from burkholderia pseudomallei 1710b complexed with nadp | 0.954 | 2 | 219 |
| 4nbu-assembly1.cif.gz_D | crystal structure of fabg from bacillus sp | 0.9527 | 1 | 215 |
| 5vml-assembly1.cif.gz_A | crystal structure of acetoacetyl-coa reductase from burkholderia pseudomallei 1710b with bound nadp | 0.951 | 1 | 219 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0JDU3_1_168_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9462 | 74 | 218 | 3.40.50.720 |
| 2cfcD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.945 | 1 | 214 | 3.40.50.720 |
| 3awdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9422 | 1 | 214 | 3.40.50.720 |
| af_B7FAC8_69_312_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9374 | 2 | 218 | 3.40.50.720 |
| af_A0A1D6J5I0_53_326_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9359 | 1 | 218 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529PGN1-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9906 | 1 | 129 |
|
| AF-A0A529IRX2-F1-model_v4 | deleted | 0.9894 | 1 | 187 |
|
| AF-A0A529LSD5-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9875 | 1 | 111 |
GO:0008667
GO:0019290 |
| AF-A0A529ZRP8-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9866 | 1 | 105 |
|
| AF-A0A526RE03-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.985 | 1 | 152 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar