F492686

General Info

Members Datasets Scaffolds Average Seq Length
1295 537 1280 224

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0000001|Ga0500616_0000001_908860_909717
Length 275
Sequence VQCKNSKKCPAIAPGILFLRRRLQNGGRNNFAMTKQKSIWEEFEMSRVALVTGGTRGIGAAIAKALKTAGYKVAANYAGNDEAAQKFKAETGIPVFKWDVSSFEACEAGIKQVEAEVGPIDVLVNNAGITRDSQLHRMKPEQWSAVINTNLGSLFNMCRNVIEGMRTRKFGRIVNISSINYSAAKAGEIGFTKALAQESARSGITVNAICPGYINTEMVQAVPKDVLEKSILPLIPIGRLGEPEEIARCVVFLASDDAGLMTGSTLTANGGQYFT

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
3 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
4 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
5 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
6 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
7 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
8 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
9 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
10 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
11 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
12 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
13 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
14 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
15 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
16 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
17 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
18 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
19 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
20 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
21 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
22 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
23 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
24 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
25 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
28 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
37 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
60 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
61 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
62 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
63 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
64 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
65 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
66 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
67 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
74 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
75 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
76 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
79 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
82 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
83 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
100 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
106 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
107 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
108 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
109 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
110 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
111 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
112 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
113 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
114 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
115 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
116 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
117 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
118 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
119 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
121 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
122 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
123 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
124 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
125 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
126 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
127 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
128 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
129 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
131 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
132 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
133 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
134 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
135 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
139 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
141 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
142 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
143 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
147 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
148 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
149 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
150 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
151 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
152 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
153 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
154 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
155 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
158 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
159 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
160 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
161 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
162 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
163 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
164 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
165 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
166 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
167 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
168 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
169 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
170 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
171 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
172 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
173 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
174 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
175 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
176 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
178 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
179 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
180 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
181 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
182 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
183 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
186 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
187 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
190 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
192 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
194 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
197 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
261 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
268 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
271 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
275 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
276 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
277 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
278 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
279 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
280 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
281 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
282 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
283 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
284 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
285 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
286 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
287 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
288 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
289 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
290 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
291 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
292 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
293 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
294 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
295 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
296 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
297 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
298 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
299 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
300 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
301 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
302 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
303 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
304 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
306 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
307 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
308 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
309 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
310 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
311 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
312 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
313 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
314 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
315 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
316 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
317 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
318 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
319 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
320 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
321 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
322 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
323 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
324 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
325 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
326 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
327 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
328 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
329 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
330 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
331 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
332 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
333 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
334 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
335 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
336 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
337 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
338 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
339 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
340 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
341 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
342 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
343 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
344 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
345 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
346 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
347 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
348 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
349 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
350 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
351 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
352 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
353 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
354 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
355 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
356 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
357 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
358 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
359 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
360 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
361 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
362 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
363 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
364 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
365 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
366 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
367 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
368 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
369 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
370 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
371 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
372 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
373 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
374 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
375 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
376 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
377 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
378 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
379 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
380 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
381 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
382 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
383 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
384 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
385 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
386 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
387 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
388 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
389 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
390 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
391 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
392 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
393 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
394 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
395 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
396 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
397 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
398 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
399 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
400 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
401 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
402 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
403 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
404 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
405 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
406 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
407 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
408 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
409 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
410 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
411 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
412 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
413 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
414 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
415 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
416 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
417 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
418 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
419 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
420 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
421 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
422 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
423 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
424 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
425 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
426 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
427 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
428 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
429 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
430 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
431 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
432 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
433 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
434 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
435 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
436 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
437 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
438 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
439 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
440 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
441 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
442 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
443 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
444 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
445 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
446 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
447 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
448 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
449 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
450 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
451 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
452 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
453 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
454 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
455 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
456 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
457 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
458 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
459 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
460 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
461 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
462 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
463 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
464 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
465 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
466 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
467 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
472 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
473 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
474 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
475 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
476 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
477 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
478 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
479 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
480 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
481 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
482 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
483 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
484 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
485 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
486 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
487 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
488 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
489 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
490 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
491 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
492 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
493 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
494 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
495 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
496 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
497 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
498 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
499 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
500 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
501 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
502 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
503 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
504 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
505 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
506 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
507 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
508 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
509 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
510 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
511 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
512 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
513 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
514 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
515 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
516 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
517 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
518 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
519 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
520 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
521 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
522 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
523 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
524 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
525 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
526 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
527 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
528 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
529 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
530 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
531 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
532 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
534 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
535 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
536 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
537 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.61
Metatranscriptomes 0.23
Isolates 1.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.19
Nodule 1.7
Rhizoplane 5.1
Rhizosphere 80.77
Stem 0
Stem Tuber 0
Unclassified 4.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c000003 3300000041 Bacteria 66110
2 ARSoilYngRDRAFT_c00037 3300000042 Bacteria 21051
3 ARcpr5yngRDRAFT_c000010 3300000043 Bacteria 36497
4 ARSoilOldRDRAFT_c000114 3300000044 Bacteria 14136
5 ARSoilOldRDRAFT_c002000 3300000044 Bacteria 1850
6 ARCol0oldRDRAFT_c00094 3300000045 Bacteria 7532
7 ARCol0yngRDRAFT_1000202 3300000652 Bacteria 10013
8 JGI24749J21850_1004353 3300002076 Bacteria 1979
9 JGI24034J26672_10034825 3300002239 Bacteria 831
10 JGI25158J39367_1004631 3300002739 Bacteria 2057
11 JGI25150J39212_1000171 3300002774 Bacteria 36637
12 JGI25150J39212_1000433 3300002774 Bacteria 18809
13 JGI25159J45721_1000017 3300002987 Bacteria 136127
14 JGI25151J46595_10000034 3300003187 Bacteria 192271
15 JGI25151J46595_10008877 3300003187 Bacteria 4801
16 JGI25151J46595_10009621 3300003187 Bacteria 4560
17 JGI25153J46596_10000673 3300003215 Bacteria 20907
18 JGI25153J46596_10011382 3300003215 Bacteria 3935
19 JGI25160J50197_1000027 3300003354 Bacteria 182809
20 JGI25161J50226_1000160 3300003374 Bacteria 47045
21 Ga0055524_1000782 3300003775 Bacteria 21292
22 Ga0055536_1000711 3300003781 Bacteria 22317
23 Ga0055530_10019826 3300003791 Bacteria 2027
24 Ga0055531_10010747 3300003794 Bacteria 4506
25 Ga0055543_1000030 3300004625 Bacteria 130849
26 Ga0065165_1000122 3300005262 Bacteria 132524
27 Ga0065704_10073674 3300005289 Bacteria 6900
28 Ga0065712_10009067 3300005290 Bacteria 3377
29 Ga0065712_10078443 3300005290 Bacteria 3347
30 Ga0065707_10150122 3300005295 Bacteria 1668
31 Ga0070658_10006314 3300005327 Bacteria 9600
32 Ga0070658_10288976 3300005327 Bacteria 1397
33 Ga0070676_10014503 3300005328 Bacteria 4333
34 Ga0070683_100048470 3300005329 Bacteria 3928
35 Ga0070683_100298148 3300005329 Bacteria 1533
36 Ga0070690_100098133 3300005330 Bacteria 1939
37 Ga0070690_100179140 3300005330 Bacteria 1463
38 Ga0070670_100057539 3300005331 Bacteria 3337
39 Ga0070677_10160182 3300005333 Bacteria 1055
40 Ga0068869_100042291 3300005334 Bacteria 3266
41 Ga0070666_10083329 3300005335 Bacteria 2187
42 Ga0070680_100002836 3300005336 Bacteria 12877
43 Ga0070680_100043291 3300005336 Bacteria 3657
44 Ga0070680_100262573 3300005336 Bacteria 1461
45 Ga0070680_100509879 3300005336 Bacteria 1029
46 Ga0070660_100013941 3300005339 Bacteria 5783
47 Ga0070660_100029666 3300005339 Bacteria 4101
48 Ga0070660_100169739 3300005339 Bacteria 1761
49 Ga0070687_100006984 3300005343 Plasmid 4671
50 Ga0070687_100024918 3300005343 Bacteria 2864
51 Ga0070687_100063265 3300005343 Bacteria 1962
52 Ga0070661_100065654 3300005344 Bacteria 2666
53 Ga0070661_100276399 3300005344 Bacteria 1302
54 Ga0070668_100605437 3300005347 Bacteria 959
55 Ga0070669_100143324 3300005353 Bacteria 1844
56 Ga0070669_100350916 3300005353 Bacteria 1197
57 Ga0070675_100106888 3300005354 Bacteria 2362
58 Ga0070675_100118472 3300005354 Bacteria 2248
59 Ga0070675_100167573 3300005354 Bacteria 1893
60 Ga0070675_100299740 3300005354 Bacteria 1416
61 Ga0070675_100526022 3300005354 Bacteria 1067
62 Ga0070671_100027164 3300005355 Bacteria 4708
63 Ga0070671_100039483 3300005355 Bacteria 3918
64 Ga0070674_100013309 3300005356 Bacteria 5081
65 Ga0070674_100097334 3300005356 Bacteria 2137
66 Ga0070674_100135566 3300005356 Bacteria 1841
67 Ga0070673_100016812 3300005364 Bacteria 5185
68 Ga0070673_100046607 3300005364 Bacteria 3368
69 Ga0070673_100067712 3300005364 Bacteria 2856
70 Ga0070688_100007841 3300005365 Bacteria 5773
71 Ga0070688_100022333 3300005365 Bacteria 3706
72 Ga0070659_100054380 3300005366 Bacteria 3153
73 Ga0070659_100236030 3300005366 Bacteria 1512
74 Ga0070667_100014555 3300005367 Bacteria 6501
75 Ga0070667_100275292 3300005367 Bacteria 1510
76 Ga0070709_10013751 3300005434 Bacteria 4558
77 Ga0070709_10251918 3300005434 Bacteria 1272
78 Ga0070714_100081920 3300005435 Bacteria 2810
79 Ga0070714_100122525 3300005435 Bacteria 2314
80 Ga0070714_100681979 3300005435 Bacteria 991
81 Ga0070713_100013740 3300005436 Bacteria 5987
82 Ga0070713_100017477 3300005436 Bacteria 5425
83 Ga0070713_100037681 3300005436 Bacteria 3910
84 Ga0070713_100101051 3300005436 Bacteria 2498
85 Ga0070713_100115215 3300005436 Bacteria 2349
86 Ga0070713_100179817 3300005436 Bacteria 1900
87 Ga0070713_100549168 3300005436 Bacteria 1094
88 Ga0070710_10021576 3300005437 Bacteria 3358
89 Ga0070710_10047902 3300005437 Bacteria 2386
90 Ga0070710_10334790 3300005437 Bacteria 997
91 Ga0070710_10409533 3300005437 Bacteria 911
92 Ga0070701_10019213 3300005438 Bacteria 3225
93 Ga0070701_10033348 3300005438 Bacteria 2572
94 Ga0070711_100088519 3300005439 Bacteria 2225
95 Ga0070711_100141673 3300005439 Bacteria 1803
96 Ga0070711_100164775 3300005439 Bacteria 1684
97 Ga0070711_100181748 3300005439 Bacteria 1610
98 Ga0070705_100054445 3300005440 Bacteria 2347
99 Ga0070705_100381993 3300005440 Bacteria 1037
100 Ga0070700_100178583 3300005441 Bacteria 1475
101 Ga0070708_100026124 3300005445 Bacteria 4995
102 Ga0070663_100098827 3300005455 Bacteria 2175
103 Ga0070663_100116276 3300005455 Bacteria 2015
104 Ga0070678_100072545 3300005456 Bacteria 2581
105 Ga0070678_100239338 3300005456 Bacteria 1517
106 Ga0070662_100037740 3300005457 Bacteria 3427
107 Ga0070662_100143904 3300005457 Bacteria 1850
108 Ga0070662_100456839 3300005457 Bacteria 1061
109 Ga0070681_10078648 3300005458 Bacteria 3254
110 Ga0070681_10105326 3300005458 Bacteria 2762
111 Ga0070681_10368448 3300005458 Bacteria 1347
112 Ga0068867_100027781 3300005459 Bacteria 4070
113 Ga0068867_100070345 3300005459 Bacteria 2616
114 Ga0068867_100596314 3300005459 Bacteria 963
115 Ga0070685_10003855 3300005466 Bacteria 7587
116 Ga0070685_10006441 3300005466 Bacteria 5988
117 Ga0070685_10105298 3300005466 Bacteria 1728
118 Ga0070707_100217959 3300005468 Bacteria 1859
119 Ga0070698_100138896 3300005471 Bacteria 2383
120 Ga0070699_100106603 3300005518 Bacteria 2458
121 Ga0070679_100042577 3300005530 Bacteria 4523
122 Ga0070679_100112073 3300005530 Bacteria 2714
123 Ga0070679_100221983 3300005530 Bacteria 1851
124 Ga0070679_100545260 3300005530 Bacteria 1103
125 Ga0070684_100044013 3300005535 Bacteria 3859
126 Ga0070697_100202527 3300005536 Bacteria 1687
127 Ga0068853_100502907 3300005539 Bacteria 1144
128 Ga0070672_100798134 3300005543 Bacteria 830
129 Ga0070686_100018983 3300005544 Bacteria 4046
130 Ga0070695_100404566 3300005545 Bacteria 1036
131 Ga0070696_100129398 3300005546 Bacteria 1835
132 Ga0070696_100173830 3300005546 Bacteria 1594
133 Ga0070693_100078684 3300005547 Bacteria 1960
134 Ga0070693_100092445 3300005547 Bacteria 1827
135 Ga0070665_100006101 3300005548 Bacteria 12320
136 Ga0070665_100582611 3300005548 Bacteria 1132
137 Ga0070665_100609835 3300005548 Bacteria 1104
138 Ga0070704_100180226 3300005549 Bacteria 1689
139 Ga0068855_100048582 3300005563 Bacteria 5007
140 Ga0068855_100108304 3300005563 Bacteria 3191
141 Ga0068855_100157729 3300005563 Bacteria 2577
142 Ga0068855_100217262 3300005563 Bacteria 2145
143 Ga0070664_100146232 3300005564 Bacteria 2085
144 Ga0068857_100359504 3300005577 Bacteria 1349
145 Ga0068854_100331354 3300005578 Bacteria 1240
146 Ga0068856_100318837 3300005614 Bacteria 1572
147 Ga0068856_100824585 3300005614 Bacteria 947
148 Ga0070702_100483937 3300005615 Bacteria 905
149 Ga0068852_100051991 3300005616 Bacteria 3519
150 Ga0068852_100052192 3300005616 Bacteria 3513
151 Ga0068852_100057208 3300005616 Bacteria 3373
152 Ga0068852_100163143 3300005616 Bacteria 2082
153 Ga0068859_100017208 3300005617 Bacteria 7259
154 Ga0068859_100130968 3300005617 Bacteria 2580
155 Ga0068859_100194167 3300005617 Bacteria 2114
156 Ga0068859_100596542 3300005617 Bacteria 1198
157 Ga0068864_100037945 3300005618 Bacteria 4112
158 Ga0068864_100144389 3300005618 Bacteria 2150
159 Ga0068866_10045382 3300005718 Bacteria 2204
160 Ga0068861_100007388 3300005719 Bacteria 7528
161 Ga0068861_100053737 3300005719 Bacteria 3066
162 Ga0068851_10006192 3300005834 Bacteria 5462
163 Ga0068851_10051665 3300005834 Bacteria 2089
164 Ga0068851_10181466 3300005834 Bacteria 1166
165 Ga0068870_10021003 3300005840 Bacteria 3188
166 Ga0068863_100017793 3300005841 Bacteria 6802
167 Ga0068858_100226731 3300005842 Bacteria 1771
168 Ga0068858_100444807 3300005842 Bacteria 1248
169 Ga0068860_100055931 3300005843 Bacteria 3751
170 Ga0068860_100571721 3300005843 Bacteria 1134
171 Ga0068860_100728360 3300005843 Bacteria 1002
172 Ga0068862_100007073 3300005844 Bacteria 9318
173 Ga0068862_100021405 3300005844 Bacteria 5402
174 Ga0081455_10001108 3300005937 Bacteria 33842
175 Ga0081540_1003343 3300005983 Bacteria 12715
176 Ga0081540_1017391 3300005983 Bacteria 4453
177 Ga0081540_1074291 3300005983 Bacteria 1558
178 Ga0070717_10035744 3300006028 Bacteria 4025
179 Ga0070717_10049830 3300006028 Bacteria 3439
180 Ga0070717_10056608 3300006028 Bacteria 3240
181 Ga0070717_10057481 3300006028 Bacteria 3215
182 Ga0070717_10080726 3300006028 Bacteria 2729
183 Ga0070717_10127131 3300006028 Bacteria 2189
184 Ga0070717_10189664 3300006028 Bacteria 1796
185 Ga0070717_10359769 3300006028 Bacteria 1302
186 Ga0075365_10001359 3300006038 Bacteria 10973
187 Ga0075365_10002417 3300006038 Bacteria 9150
188 Ga0075365_10224602 3300006038 Bacteria 1318
189 Ga0075368_10099462 3300006042 Bacteria 1193
190 Ga0075363_100038942 3300006048 Bacteria 2501
191 Ga0075363_100143393 3300006048 Bacteria 1346
192 Ga0075363_100176382 3300006048 Bacteria 1215
193 Ga0075364_10091048 3300006051 Bacteria 2023
194 Ga0075364_10158611 3300006051 Bacteria 1527
195 Ga0075364_10220641 3300006051 Bacteria 1287
196 Ga0075364_10366452 3300006051 Bacteria 982
197 Ga0070715_10004118 3300006163 Bacteria 4726
198 Ga0070715_10113237 3300006163 Bacteria 1283
199 Ga0070715_10138731 3300006163 Bacteria 1178
200 Ga0070715_10331504 3300006163 Bacteria 825
201 Ga0070716_100003919 3300006173 Bacteria 7070
202 Ga0070716_100027329 3300006173 Bacteria 3064
203 Ga0070712_100009184 3300006175 Bacteria 6227
204 Ga0075362_10114499 3300006177 Bacteria 1272
205 Ga0075367_10045574 3300006178 Bacteria 2573
206 Ga0075367_10101821 3300006178 Bacteria 1756
207 Ga0075367_10190180 3300006178 Bacteria 1281
208 Ga0075367_10213346 3300006178 Bacteria 1207
209 Ga0075369_10111023 3300006186 Bacteria 1236
210 Ga0075366_10056646 3300006195 Bacteria 2328
211 Ga0075366_10058954 3300006195 Bacteria 2280
212 Ga0075366_10097265 3300006195 Bacteria 1765
213 Ga0075366_10297632 3300006195 Bacteria 987
214 Ga0097621_100027391 3300006237 Bacteria 4481
215 Ga0097621_100309610 3300006237 Bacteria 1397
216 Ga0097621_100463884 3300006237 Bacteria 1143
217 Ga0075370_10110717 3300006353 Bacteria 1595
218 Ga0075370_10246794 3300006353 Bacteria 1058
219 Ga0075370_10325211 3300006353 Bacteria 916
220 Ga0068871_100015006 3300006358 Bacteria 5793
221 Ga0068871_100026947 3300006358 Bacteria 4490
222 Ga0068871_100155111 3300006358 Bacteria 1955
223 Ga0075428_100037884 3300006844 Bacteria 5306
224 Ga0075430_100000387 3300006846 Bacteria 32406
225 Ga0075430_100008653 3300006846 Bacteria 8585
226 Ga0075431_100201902 3300006847 Bacteria 2034
227 Ga0075431_100358218 3300006847 Bacteria 1466
228 Ga0075433_10086392 3300006852 Bacteria 2769
229 Ga0075434_100064484 3300006871 Bacteria 3647
230 Ga0075434_100116001 3300006871 Bacteria 2691
231 Ga0075434_100243841 3300006871 Bacteria 1817
232 Ga0075434_100310082 3300006871 Bacteria 1598
233 Ga0075434_100455406 3300006871 Bacteria 1301
234 Ga0075434_100898291 3300006871 Bacteria 901
235 Ga0068865_100079145 3300006881 Bacteria 2353
236 Ga0068865_100203962 3300006881 Bacteria 1536
237 Ga0068865_100240253 3300006881 Bacteria 1425
238 Ga0075436_100002454 3300006914 Bacteria 12758
239 Ga0075436_100202613 3300006914 Bacteria 1406
240 Ga0097620_100017208 3300006931 Bacteria 7259
241 Ga0097620_100130968 3300006931 Bacteria 2580
242 Ga0097620_100194159 3300006931 Bacteria 2114
243 Ga0097620_100596471 3300006931 Bacteria 1198
244 Ga0079104_1009515 3300006946 Bacteria 3284
245 Ga0079104_1010076 3300006946 Bacteria 3143
246 Ga0099826_10107837 3300006948 Bacteria 1665
247 Ga0075435_100029369 3300007076 Bacteria 4314
248 Ga0075435_100143724 3300007076 Bacteria 2003
249 Ga0075435_100171625 3300007076 Bacteria 1830
250 Ga0075435_100296022 3300007076 Bacteria 1383
251 Ga0099794_10007856 3300007265 Bacteria 4405
252 Ga0099795_10042556 3300007788 Bacteria 1622
253 Ga0105251_10036311 3300009011 Bacteria 2426
254 Ga0105240_10304316 3300009093 Bacteria 1823
255 Ga0111539_10001645 3300009094 Bacteria 29839
256 Ga0111539_10109798 3300009094 Bacteria 3237
257 Ga0111539_10130687 3300009094 Bacteria 2940
258 Ga0111539_10336041 3300009094 Bacteria 1758
259 Ga0111539_10503355 3300009094 Bacteria 1411
260 Ga0105245_10007083 3300009098 Bacteria 9838
261 Ga0105245_10046875 3300009098 Bacteria 3862
262 Ga0114129_10016241 3300009147 Bacteria 10593
263 Ga0114129_10040156 3300009147 Bacteria 6597
264 Ga0114129_10479400 3300009147 Bacteria 1628
265 Ga0114129_10586916 3300009147 Bacteria 1445
266 Ga0105243_10010687 3300009148 Bacteria 6958
267 Ga0105243_10019915 3300009148 Bacteria 5087
268 Ga0105241_10007122 3300009174 Bacteria 8234
269 Ga0105241_10325777 3300009174 Bacteria 1326
270 Ga0105242_10028564 3300009176 Bacteria 4443
271 Ga0105242_10859882 3300009176 Bacteria 903
272 Ga0105242_11165972 3300009176 Bacteria 788
273 Ga0105248_10024110 3300009177 Bacteria 6762
274 Ga0105237_10051335 3300009545 Bacteria 4142
275 Ga0105238_10027892 3300009551 Bacteria 5754
276 Ga0105238_10103323 3300009551 Bacteria 2831
277 Ga0105238_10105024 3300009551 Bacteria 2806
278 Ga0105249_10049209 3300009553 Bacteria 3844
279 Ga0105249_10212603 3300009553 Bacteria 1899
280 Ga0099796_10000988 3300010159 Bacteria 5342
281 Ga0105239_10058907 3300010375 Bacteria 4215
282 Ga0105246_10491139 3300011119 Bacteria 1041
283 Ga0157320_1000901 3300012481 Bacteria 1358
284 Ga0157323_1001518 3300012495 Bacteria 1176
285 Ga0157323_1005307 3300012495 Bacteria 858
286 Ga0157342_1000875 3300012507 Bacteria 2046
287 Ga0157326_1004618 3300012513 Bacteria 1451
288 Ga0157371_10104933 3300013102 Bacteria 2005
289 Ga0157371_10532723 3300013102 Bacteria 869
290 Ga0157370_10126008 3300013104 Bacteria 2390
291 Ga0157369_10222684 3300013105 Bacteria 1974
292 Ga0157369_10380314 3300013105 Bacteria 1465
293 Ga0171463_1004 3300013249 Bacteria 437207
294 Ga0157378_10031786 3300013297 Bacteria 4662
295 Ga0157378_10084666 3300013297 Bacteria 2871
296 Ga0157378_10333822 3300013297 Bacteria 1476
297 Ga0157378_10873672 3300013297 Bacteria 929
298 Ga0163162_10178252 3300013306 Bacteria 2251
299 Ga0163162_10437877 3300013306 Bacteria 1439
300 Ga0163162_10451086 3300013306 Bacteria 1418
301 Ga0157372_10111381 3300013307 Bacteria 3136
302 Ga0157375_10138524 3300013308 Bacteria 2559
303 Ga0157375_10580574 3300013308 Bacteria 1281
304 Ga0157380_10040992 3300014326 Bacteria 3611
305 Ga0157380_10323571 3300014326 Bacteria 1431
306 Ga0157377_10093540 3300014745 Bacteria 1779
307 Ga0157379_10572503 3300014968 Bacteria 1052
308 Ga0157376_10222589 3300014969 Bacteria 1749
309 Ga0182007_10035892 3300015262 Bacteria 1670
310 Ga0183363_1290 3300015690 Bacteria 7203
311 Ga0163161_10063750 3300017792 Bacteria 2687
312 Ga0163161_10696976 3300017792 Bacteria 845
313 Ga0214544_1000087 3300021320 Bacteria 119600
314 Ga0214542_1000018 3300021321 Bacteria 202226
315 Ga0214545_1000009 3300021324 Bacteria 202915
316 Ga0214543_1000037 3300021327 Bacteria 182113
317 Ga0213872_10000703 3300021361 Bacteria 25156
318 Ga0213872_10106770 3300021361 Bacteria 1245
319 Ga0213874_10057809 3300021377 Bacteria 1207
320 Ga0213874_10068712 3300021377 Bacteria 1125
321 Ga0213874_10076317 3300021377 Bacteria 1078
322 Ga0213876_10006896 3300021384 Bacteria 6192
323 Ga0213876_10101221 3300021384 Bacteria 1528
324 Ga0224712_10059476 3300022467 Bacteria 1517
325 Ga0228711_1000004 3300022739 Bacteria 250146
326 Ga0228710_1000002 3300022740 Bacteria 287279
327 Ga0228598_1000875 3300024227 Bacteria 6508
328 Ga0209436_101378 3300025208 Bacteria 8579
329 Ga0209437_111240 3300025233 Bacteria 1343
330 Ga0207425_1000035 3300025245 Bacteria 225942
331 Ga0209677_100265 3300025253 Bacteria 35526
332 Ga0209148_1016880 3300025254 Bacteria 1249
333 Ga0209129_1000029 3300025258 Bacteria 401149
334 Ga0209233_1000255 3300025261 Bacteria 82230
335 Ga0209233_1007650 3300025261 Bacteria 3405
336 Ga0209233_1015962 3300025261 Bacteria 2078
337 Ga0209455_1003697 3300025272 Bacteria 5294
338 Ga0209673_1025959 3300025273 Bacteria 1936
339 Ga0209130_1000027 3300025284 Bacteria 327700
340 Ga0209676_1000956 3300025292 Bacteria 35128
341 Ga0209025_1000042 3300025294 Bacteria 370577
342 Ga0209025_1000132 3300025294 Bacteria 197432
343 Ga0209025_1000591 3300025294 Bacteria 65471
344 Ga0209564_1000193 3300025295 Bacteria 141731
345 Ga0209758_1000255 3300025297 Bacteria 106892
346 Ga0209758_1000430 3300025297 Bacteria 71132
347 Ga0209758_1002586 3300025297 Bacteria 18151
348 Ga0209758_1018161 3300025297 Bacteria 3464
349 Ga0209050_1000572 3300025298 Bacteria 59716
350 Ga0209256_1010178 3300025299 Bacteria 3982
351 Ga0209256_1012263 3300025299 Bacteria 3309
352 Ga0209256_1054962 3300025299 Bacteria 947
353 Ga0207426_1000072 3300025302 Bacteria 327700
354 Ga0207426_1027720 3300025302 Bacteria 1884
355 Ga0207426_1065481 3300025302 Bacteria 1030
356 Ga0209051_1020024 3300025303 Bacteria 2900
357 Ga0209257_1001382 3300025304 Bacteria 29095
358 Ga0207697_10070204 3300025315 Bacteria 1467
359 Ga0207713_1034320 3300025735 Bacteria 2205
360 Ga0207653_10022402 3300025885 Bacteria 2006
361 Ga0207692_10004710 3300025898 Bacteria 5414
362 Ga0207692_10022673 3300025898 Bacteria 2893
363 Ga0207692_10092058 3300025898 Bacteria 1646
364 Ga0207642_10007393 3300025899 Bacteria 3709
365 Ga0207710_10001892 3300025900 Bacteria 10045
366 Ga0207680_10031159 3300025903 Bacteria 3018
367 Ga0207647_10065556 3300025904 Bacteria 2204
368 Ga0207685_10001418 3300025905 Bacteria 5005
369 Ga0207685_10004693 3300025905 Bacteria 3511
370 Ga0207685_10227456 3300025905 Bacteria 890
371 Ga0207699_10011151 3300025906 Bacteria 4529
372 Ga0207699_10326631 3300025906 Bacteria 1078
373 Ga0207699_10446266 3300025906 Bacteria 927
374 Ga0207645_10010546 3300025907 Bacteria 6345
375 Ga0207643_10000613 3300025908 Bacteria 22494
376 Ga0207705_10048689 3300025909 Bacteria 3049
377 Ga0207705_10180181 3300025909 Bacteria 1594
378 Ga0207684_10033976 3300025910 Bacteria 4336
379 Ga0207654_10037526 3300025911 Bacteria 2713
380 Ga0207654_10320467 3300025911 Bacteria 1059
381 Ga0207707_10060719 3300025912 Bacteria 3288
382 Ga0207707_10363668 3300025912 Bacteria 1245
383 Ga0207695_10000044 3300025913 Bacteria 440819
384 Ga0207671_10000043 3300025914 Bacteria 206915
385 Ga0207671_10057435 3300025914 Bacteria 2884
386 Ga0207693_10022575 3300025915 Bacteria 5000
387 Ga0207693_10083746 3300025915 Bacteria 2498
388 Ga0207663_10019794 3300025916 Bacteria 3799
389 Ga0207663_10089420 3300025916 Bacteria 2039
390 Ga0207660_10011260 3300025917 Bacteria 5817
391 Ga0207662_10093154 3300025918 Bacteria 1856
392 Ga0207662_10096897 3300025918 Bacteria 1823
393 Ga0207657_10015839 3300025919 Bacteria 7285
394 Ga0207657_10025505 3300025919 Bacteria 5450
395 Ga0207657_10092257 3300025919 Bacteria 2524
396 Ga0207649_10152002 3300025920 Bacteria 1595
397 Ga0207649_10307614 3300025920 Bacteria 1161
398 Ga0207649_10373945 3300025920 Bacteria 1060
399 Ga0207652_10253084 3300025921 Bacteria 1588
400 Ga0207652_10308290 3300025921 Bacteria 1429
401 Ga0207652_10562239 3300025921 Bacteria 1024
402 Ga0207652_10689166 3300025921 Bacteria 912
403 Ga0207646_10065889 3300025922 Bacteria 3233
404 Ga0207681_10736860 3300025923 Bacteria 821
405 Ga0207694_10024893 3300025924 Bacteria 4546
406 Ga0207694_10487270 3300025924 Bacteria 1032
407 Ga0207650_10002443 3300025925 Bacteria 12941
408 Ga0207650_10037723 3300025925 Bacteria 3523
409 Ga0207659_10157313 3300025926 Bacteria 1781
410 Ga0207659_10661015 3300025926 Bacteria 893
411 Ga0207687_10019823 3300025927 Bacteria 4460
412 Ga0207687_10021525 3300025927 Bacteria 4285
413 Ga0207700_10006313 3300025928 Bacteria 7151
414 Ga0207700_10007976 3300025928 Bacteria 6520
415 Ga0207700_10033806 3300025928 Bacteria 3662
416 Ga0207700_10075251 3300025928 Bacteria 2616
417 Ga0207700_10093294 3300025928 Bacteria 2382
418 Ga0207700_10165505 3300025928 Bacteria 1840
419 Ga0207700_10290320 3300025928 Bacteria 1409
420 Ga0207700_10295244 3300025928 Bacteria 1398
421 Ga0207700_10522858 3300025928 Bacteria 1051
422 Ga0207664_10018710 3300025929 Bacteria 5107
423 Ga0207664_10107314 3300025929 Bacteria 2316
424 Ga0207664_10132028 3300025929 Bacteria 2103
425 Ga0207664_10310075 3300025929 Bacteria 1390
426 Ga0207664_10630357 3300025929 Bacteria 963
427 Ga0207644_10017503 3300025931 Bacteria 4841
428 Ga0207644_10183935 3300025931 Bacteria 1639
429 Ga0207690_10091710 3300025932 Bacteria 2148
430 Ga0207706_10008654 3300025933 Bacteria 9376
431 Ga0207706_10095800 3300025933 Bacteria 2610
432 Ga0207686_10010210 3300025934 Bacteria 5106
433 Ga0207686_10181464 3300025934 Bacteria 1493
434 Ga0207709_10016990 3300025935 Bacteria 4055
435 Ga0207670_10076632 3300025936 Bacteria 2327
436 Ga0207669_10003551 3300025937 Bacteria 6754
437 Ga0207669_10247152 3300025937 Bacteria 1326
438 Ga0207669_10317259 3300025937 Bacteria 1191
439 Ga0207669_10580931 3300025937 Bacteria 908
440 Ga0207704_10019430 3300025938 Bacteria 3568
441 Ga0207704_10166503 3300025938 Bacteria 1575
442 Ga0207704_10337409 3300025938 Bacteria 1169
443 Ga0207665_10000117 3300025939 Bacteria 52204
444 Ga0207665_10000210 3300025939 Bacteria 39483
445 Ga0207665_10036842 3300025939 Bacteria 3254
446 Ga0207665_10104873 3300025939 Bacteria 1979
447 Ga0207691_10133928 3300025940 Bacteria 2187
448 Ga0207711_10010865 3300025941 Bacteria 7567
449 Ga0207711_10013853 3300025941 Bacteria 6697
450 Ga0207689_10012163 3300025942 Bacteria 7365
451 Ga0207689_10160808 3300025942 Bacteria 1850
452 Ga0207661_10163247 3300025944 Bacteria 1934
453 Ga0207661_10266857 3300025944 Bacteria 1526
454 Ga0207679_10025554 3300025945 Bacteria 4063
455 Ga0207679_10127977 3300025945 Bacteria 2033
456 Ga0207679_10189976 3300025945 Bacteria 1707
457 Ga0207667_10136980 3300025949 Bacteria 2521
458 Ga0207667_10186932 3300025949 Bacteria 2126
459 Ga0207667_10401627 3300025949 Bacteria 1395
460 Ga0207651_10104736 3300025960 Bacteria 2108
461 Ga0207651_10171172 3300025960 Bacteria 1713
462 Ga0207651_10223690 3300025960 Bacteria 1523
463 Ga0207712_10056760 3300025961 Bacteria 2759
464 Ga0207712_10258379 3300025961 Bacteria 1411
465 Ga0207712_10510485 3300025961 Bacteria 1029
466 Ga0207658_10055410 3300025986 Bacteria 2938
467 Ga0207658_10094692 3300025986 Bacteria 2325
468 Ga0207658_10130185 3300025986 Bacteria 2020
469 Ga0207658_10176656 3300025986 Bacteria 1764
470 Ga0207658_10204159 3300025986 Bacteria 1652
471 Ga0207658_10344464 3300025986 Bacteria 1296
472 Ga0207703_10035397 3300026035 Bacteria 3968
473 Ga0207703_10248110 3300026035 Bacteria 1603
474 Ga0207678_10008960 3300026067 Bacteria 8806
475 Ga0207678_10024906 3300026067 Bacteria 5225
476 Ga0207708_10025996 3300026075 Bacteria 4429
477 Ga0207641_10023568 3300026088 Bacteria 5069
478 Ga0207641_10287063 3300026088 Bacteria 1550
479 Ga0207648_10040324 3300026089 Bacteria 4104
480 Ga0207648_10612286 3300026089 Bacteria 1004
481 Ga0207676_10009273 3300026095 Bacteria 7001
482 Ga0207676_10070676 3300026095 Bacteria 2800
483 Ga0207674_10202399 3300026116 Bacteria 1935
484 Ga0207674_10205934 3300026116 Bacteria 1916
485 Ga0207675_100031108 3300026118 Bacteria 4970
486 Ga0207675_100670225 3300026118 Bacteria 1044
487 Ga0207683_10008834 3300026121 Bacteria 8594
488 Ga0207698_10040894 3300026142 Bacteria 3450
489 Ga0207698_10206211 3300026142 Bacteria 1765
490 Ga0207698_10448262 3300026142 Bacteria 1245
491 Ga0209281_1000030 3300027111 Bacteria 425931
492 Ga0209281_1000144 3300027111 Bacteria 172471
493 Ga0209371_1027003 3300027312 Bacteria 1298
494 Ga0209981_1011464 3300027378 Bacteria 1222
495 Ga0209179_1000861 3300027512 Bacteria 3376
496 Ga0209999_1016117 3300027543 Bacteria 1360
497 Ga0209982_1019550 3300027552 Bacteria 1038
498 Ga0209983_1030478 3300027665 Bacteria 1148
499 Ga0209282_1000004 3300027666 Bacteria 425931
500 Ga0209971_1019044 3300027682 Bacteria 1630
501 Ga0209966_1000738 3300027695 Bacteria 6827
502 Ga0209966_1013935 3300027695 Bacteria 1495
503 Ga0207428_10099113 3300027907 Bacteria 2253
504 Ga0268266_10016289 3300028379 Bacteria 6354
505 Ga0268266_10018885 3300028379 Bacteria 5873
506 Ga0268265_10082764 3300028380 Bacteria 2539
507 Ga0268265_10092590 3300028380 Bacteria 2420
508 Ga0268264_10024794 3300028381 Bacteria 4898
509 Ga0268264_10529318 3300028381 Bacteria 1153
510 Ga0265337_1036207 3300028556 Bacteria 1442
511 Ga0265318_10023551 3300028577 Bacteria 2453
512 Ga0265338_10217329 3300028800 Bacteria 1430
513 Ga0268256_1030724 3300030500 Bacteria 1298
514 Ga0265330_10011684 3300031235 Bacteria 4115
515 Ga0265332_10000616 3300031238 Bacteria 23188
516 Ga0265332_10006156 3300031238 Bacteria 5474
517 Ga0265320_10019560 3300031240 Bacteria 3698
518 Ga0265325_10000162 3300031241 Bacteria 47234
519 Ga0265325_10020612 3300031241 Bacteria 3632
520 Ga0265325_10042414 3300031241 Bacteria 2379
521 Ga0265329_10005375 3300031242 Bacteria 5182
522 Ga0265340_10001157 3300031247 Bacteria 15092
523 Ga0265340_10015097 3300031247 Bacteria 4019
524 Ga0265340_10039855 3300031247 Bacteria 2315
525 Ga0265339_10001689 3300031249 Bacteria 16287
526 Ga0265339_10009337 3300031249 Bacteria 6170
527 Ga0265339_10064128 3300031249 Bacteria 1972
528 Ga0265331_10005352 3300031250 Bacteria 7760
529 Ga0265331_10026552 3300031250 Bacteria 2909
530 Ga0265331_10028156 3300031250 Bacteria 2811
531 Ga0265331_10063039 3300031250 Bacteria 1747
532 Ga0265327_10000496 3300031251 Bacteria 68506
533 Ga0265316_10070623 3300031344 Bacteria 2693
534 Ga0307509_10001262 3300031507 Bacteria 42913
535 Ga0307408_100093069 3300031548 Bacteria 2280
536 Ga0307408_100416972 3300031548 Bacteria 1157
537 Ga0265313_10009102 3300031595 Bacteria 6494
538 Ga0265313_10044247 3300031595 Bacteria 2174
539 Ga0265313_10068633 3300031595 Bacteria 1638
540 Ga0265313_10164797 3300031595 Bacteria 940
541 Ga0316575_10029492 3300031665 Bacteria 2143
542 Ga0316579_10048692 3300031691 Bacteria 1980
543 Ga0265314_10001560 3300031711 Bacteria 25231
544 Ga0265314_10007969 3300031711 Bacteria 9137
545 Ga0265314_10025875 3300031711 Bacteria 4418
546 Ga0265314_10036683 3300031711 Bacteria 3559
547 Ga0265342_10000139 3300031712 Bacteria 81785
548 Ga0265342_10000608 3300031712 Bacteria 37799
549 Ga0265342_10006975 3300031712 Bacteria 8350
550 Ga0265342_10103009 3300031712 Bacteria 1623
551 Ga0316576_10016655 3300031727 Bacteria 4972
552 Ga0307405_10000319 3300031731 Bacteria 17826
553 Ga0307406_10038296 3300031901 Bacteria 2967
554 Ga0315914_1000001 3300031967 Bacteria 416633
555 Ga0307409_101167152 3300031995 Bacteria 793
556 Ga0307414_10454691 3300032004 Bacteria 1124
557 Ga0316583_10077037 3300032133 Bacteria 1166
558 Ga0315913_1000004 3300033430 Bacteria 192741
559 Ga0315915_1000002 3300033464 Bacteria 425854
560 Ga0316596_1061347 3300033541 Bacteria 1003
561 Ga0373959_0041399 3300034820 Bacteria 968
562 Ga0373938_0019224 3300034957 Bacteria 1364
563 Ga0373926_0013371 3300035083 Bacteria 2783
564 Ga0373926_0018146 3300035083 Bacteria 2418
565 Ga0373926_0031361 3300035083 Bacteria 1874
566 Ga0373926_0042636 3300035083 Bacteria 1623
567 Ga0373934_0019496 3300035086 Bacteria 2604
568 Ga0373934_0079627 3300035086 Bacteria 1316
569 Ga0373944_0001048 3300035089 Bacteria 6825
570 Ga0373944_0002385 3300035089 Bacteria 4783
571 Ga0373944_0043865 3300035089 Bacteria 1391
572 Ga0373944_0077766 3300035089 Bacteria 1091
573 Ga0373952_0041741 3300035092 Bacteria 1062
574 Ga0373952_0044723 3300035092 Bacteria 1036
575 Ga0373923_0001197 3300035111 Bacteria 7256
576 Ga0373932_0115549 3300035112 Bacteria 889
577 Ga0373936_0003776 3300035113 Bacteria 5697
578 Ga0373936_0007303 3300035113 Bacteria 4158
579 Ga0373939_0069833 3300035114 Bacteria 1141
580 Ga0373939_0113468 3300035114 Bacteria 947
581 Ga0373941_0003432 3300035115 Bacteria 3589
582 Ga0373941_0159112 3300035115 Bacteria 834
583 Ga0373945_0009707 3300035116 Bacteria 3157
584 Ga0373945_0014620 3300035116 Bacteria 2633
585 Ga0373945_0027358 3300035116 Bacteria 1992
586 Ga0373945_0043837 3300035116 Bacteria 1624
587 Ga0373953_0000163 3300035117 Bacteria 17387
588 Ga0373953_0002594 3300035117 Bacteria 5470
589 Ga0373953_0027416 3300035117 Bacteria 2190
590 Ga0373954_0000145 3300035118 Bacteria 24877
591 Ga0373954_0002810 3300035118 Bacteria 7327
592 Ga0373954_0004821 3300035118 Bacteria 5815
593 Ga0373954_0052525 3300035118 Bacteria 1915
594 Ga0373954_0130741 3300035118 Bacteria 1222
595 Ga0373956_0001494 3300035119 Bacteria 9666
596 Ga0373956_0012834 3300035119 Bacteria 3479
597 Ga0373956_0105178 3300035119 Bacteria 1311
598 Ga0373957_0003169 3300035120 Bacteria 4817
599 Ga0373960_0002152 3300035121 Bacteria 4438
600 Ga0373943_0005333 3300035170 Bacteria 5780
601 Ga0373943_0005356 3300035170 Bacteria 5771
602 Ga0373943_0005440 3300035170 Bacteria 5730
603 Ga0373943_0007037 3300035170 Bacteria 5046
604 Ga0373943_0008557 3300035170 Bacteria 4587
605 Ga0373943_0015761 3300035170 Bacteria 3437
606 Ga0373943_0050796 3300035170 Bacteria 2039
607 Ga0373943_0126950 3300035170 Bacteria 1361
608 Ga0373943_0169117 3300035170 Bacteria 1195
609 Ga0373946_0000831 3300035171 Bacteria 10553
610 Ga0373946_0047849 3300035171 Bacteria 1777
611 Ga0373946_0090582 3300035171 Bacteria 1355
612 Ga0373946_0104233 3300035171 Bacteria 1275
613 Ga0373955_0000129 3300035172 Bacteria 29850
614 Ga0373955_0000245 3300035172 Bacteria 22476
615 Ga0373955_0009700 3300035172 Bacteria 4521
616 Ga0373955_0026576 3300035172 Bacteria 2983
617 Ga0373955_0053551 3300035172 Bacteria 2203
618 Ga0373955_0221682 3300035172 Bacteria 1130
619 Ga0373961_0004207 3300035241 Bacteria 3493
620 Ga0373962_0017573 3300035242 Bacteria 1854
621 Ga0316574_0172630 3300035398 Bacteria 1392
622 Ga0373924_0002728 3300035410 Bacteria 5963
623 Ga0373924_0009624 3300035410 Bacteria 3547
624 Ga0373931_0009777 3300035691 Bacteria 4592
625 Ga0373931_0100454 3300035691 Bacteria 1626
626 Ga0373931_0109768 3300035691 Bacteria 1563
627 Ga0373931_0217475 3300035691 Bacteria 1149
628 Ga0373935_0000514 3300035692 Bacteria 20101
629 Ga0373935_0001583 3300035692 Bacteria 12687
630 Ga0373935_0008943 3300035692 Bacteria 5995
631 Ga0373935_0029303 3300035692 Bacteria 3406
632 Ga0373935_0034563 3300035692 Bacteria 3151
633 Ga0373935_0070266 3300035692 Bacteria 2256
634 Ga0373927_0000243 3300035695 Bacteria 42834
635 Ga0373927_0003594 3300035695 Bacteria 11057
636 Ga0373927_0016658 3300035695 Bacteria 4848
637 Ga0373927_0040324 3300035695 Bacteria 3029
638 Ga0373927_0223252 3300035695 Bacteria 1237
639 Ga0373933_0000999 3300035724 Bacteria 17254
640 Ga0373933_0007091 3300035724 Bacteria 6106
641 Ga0373933_0013404 3300035724 Bacteria 4542
642 Ga0373933_0014674 3300035724 Bacteria 4362
643 Ga0373933_0039115 3300035724 Bacteria 2789
644 Ga0373933_0134085 3300035724 Bacteria 1559
645 Ga0373947_0002558 3300035725 Bacteria 10927
646 Ga0373947_0004234 3300035725 Bacteria 8413
647 Ga0373947_0006288 3300035725 Bacteria 6904
648 Ga0373947_0022019 3300035725 Bacteria 3693
649 Ga0373947_0134997 3300035725 Bacteria 1578
650 Ga0373947_0145550 3300035725 Bacteria 1523
651 Ga0373947_0154857 3300035725 Bacteria 1478
652 Ga0373947_0268394 3300035725 Bacteria 1132
653 Ga0373937_0000005 3300036401 Bacteria 199965
654 Ga0373937_0001770 3300036401 Bacteria 18155
655 Ga0373937_0014589 3300036401 Bacteria 6940
656 Ga0373937_0017483 3300036401 Bacteria 6390
657 Ga0373937_0041928 3300036401 Bacteria 4176
658 Ga0373937_0050791 3300036401 Bacteria 3799
659 Ga0373937_0078240 3300036401 Bacteria 3056
660 Ga0373937_0211788 3300036401 Bacteria 1824
661 Ga0316584_0025549 3300036712 Bacteria 4334
662 Ga0373925_0000007 3300037068 Bacteria 257023
663 Ga0373925_0002474 3300037068 Bacteria 14766
664 Ga0373925_0006021 3300037068 Bacteria 8976
665 Ga0373925_0007690 3300037068 Bacteria 7849
666 Ga0373925_0010149 3300037068 Bacteria 6837
667 Ga0373925_0070975 3300037068 Bacteria 2633
668 Ga0373925_0076180 3300037068 Bacteria 2543
669 Ga0373925_0102445 3300037068 Bacteria 2202
670 Ga0373925_0131664 3300037068 Bacteria 1950
671 Ga0373925_0281437 3300037068 Bacteria 1340
672 Ga0373925_0382068 3300037068 Bacteria 1147
673 Ga0395899_0020603 3300037312 Bacteria 4999
674 Ga0395899_0145037 3300037312 Bacteria 1686
675 Ga0395899_0424030 3300037312 Bacteria 876
676 Ga0395900_0038369 3300037418 Bacteria 4936
677 Ga0395900_0075666 3300037418 Bacteria 3461
678 Ga0395900_0087040 3300037418 Bacteria 3211
679 Ga0395900_0253369 3300037418 Bacteria 1761
680 Ga0395900_0293717 3300037418 Bacteria 1613
681 Ga0395900_0560326 3300037418 Bacteria 1086
682 Ga0395898_0002812 3300037466 Bacteria 19956
683 Ga0395898_0040958 3300037466 Bacteria 4577
684 Ga0395898_0041459 3300037466 Bacteria 4547
685 Ga0395898_0070704 3300037466 Bacteria 3373
686 Ga0395898_0081359 3300037466 Bacteria 3123
687 Ga0395898_0440497 3300037466 Bacteria 1241
688 Ga0395905_0053222 3300037471 Bacteria 3788
689 Ga0395905_0134471 3300037471 Bacteria 2326
690 Ga0436364_0143493 3300037853 Bacteria 871
691 Ga0436364_1293698 3300037853 Bacteria 1978
692 Ga0436364_1378623 3300037853 Bacteria 1005
693 Ga0395901_0091577 3300038443 Bacteria 3183
694 Ga0395901_0318189 3300038443 Bacteria 1610
695 Ga0395901_0516912 3300038443 Bacteria 1213
696 Ga0400483_057704 3300039062 Bacteria 2972
697 Ga0400483_184981 3300039062 Bacteria 4448
698 Ga0400483_185859 3300039062 Bacteria 13687
699 Ga0400483_228929 3300039062 Bacteria 58877
700 Ga0436365_0008071 3300039437 Bacteria 11634
701 Ga0436365_0047534 3300039437 Bacteria 1873
702 Ga0436365_0382338 3300039437 Bacteria 1181
703 Ga0436365_0414414 3300039437 Bacteria 44510
704 Ga0436365_0563707 3300039437 Bacteria 1664
705 Ga0436365_0853635 3300039437 Bacteria 897
706 Ga0436365_1561193 3300039437 Bacteria 1433
707 Ga0436360_0205543 3300039438 Bacteria 1040
708 Ga0436360_0224814 3300039438 Bacteria 1100
709 Ga0436361_0092227 3300039447 Bacteria 2117
710 Ga0436361_0492958 3300039447 Bacteria 54051
711 Ga0436361_0494886 3300039447 Bacteria 1469
712 Ga0436363_0382716 3300039450 Bacteria 1286
713 Ga0436363_0639451 3300039450 Bacteria 3682
714 Ga0436363_0780921 3300039450 Bacteria 9681
715 Ga0436363_1418375 3300039450 Bacteria 2379
716 Ga0439436_0047100 3300041404 Bacteria 1224
717 Ga0439466_0061186 3300041411 Bacteria 1213
718 Ga0439465_0013151 3300041413 Bacteria 2583
719 Ga0439465_0090364 3300041413 Bacteria 1047
720 Ga0451804_0220353 3300041463 Bacteria 996
721 Ga0439441_002900 3300042001 Bacteria 2466
722 Ga0439449_0006122 3300042007 Bacteria 4596
723 Ga0439450_023665 3300042008 Bacteria 1334
724 Ga0466966_0049822 3300044684 Bacteria 2666
725 Ga0466966_0229552 3300044684 Bacteria 1120
726 Ga0466961_0094591 3300044693 Bacteria 1885
727 Ga0466964_0094272 3300044706 Bacteria 1308
728 Ga0453684_0005046 3300044712 Bacteria 26754
729 Ga0466971_0054028 3300044719 Bacteria 1810
730 Ga0466968_0064700 3300044735 Bacteria 1582
731 Ga0466957_0008064 3300044842 Bacteria 5975
732 Ga0466959_0021717 3300045049 Bacteria 4737
733 Ga0466959_0048305 3300045049 Bacteria 3127
734 Ga0451576_0003376 3300045051 Bacteria 22069
735 Ga0466958_0060091 3300045836 Bacteria 2313
736 Ga0466958_0198665 3300045836 Bacteria 1276
737 Ga0466967_0031475 3300045976 Bacteria 4466
738 Ga0466967_0677786 3300045976 Bacteria 1020
739 Ga0495592_0000165 3300046454 Bacteria 58936
740 Ga0495592_0001415 3300046454 Bacteria 16650
741 Ga0495592_0066586 3300046454 Bacteria 2635
742 Ga0495592_0080782 3300046454 Bacteria 2351
743 Ga0495592_0114599 3300046454 Bacteria 1903
744 Ga0495592_0204443 3300046454 Bacteria 1331
745 Ga0495592_0215119 3300046454 Bacteria 1288
746 Ga0495603_0026000 3300046455 Bacteria 3539
747 Ga0495603_0227915 3300046455 Bacteria 1074
748 Ga0495591_038725 3300046458 Bacteria 1371
749 Ga0495629_0000668 3300046459 Bacteria 27756
750 Ga0495629_0001605 3300046459 Bacteria 17766
751 Ga0495629_0047268 3300046459 Bacteria 3019
752 Ga0495629_0102696 3300046459 Bacteria 1994
753 Ga0495638_0163759 3300046460 Bacteria 1281
754 Ga0495641_0007758 3300046461 Bacteria 6647
755 Ga0495641_0019335 3300046461 Bacteria 3488
756 Ga0495641_0042091 3300046461 Bacteria 2119
757 Ga0495651_0000836 3300046462 Bacteria 23937
758 Ga0495651_0021179 3300046462 Bacteria 5050
759 Ga0495651_0144049 3300046462 Bacteria 1724
760 Ga0495653_0000103 3300046463 Bacteria 69772
761 Ga0495653_0000300 3300046463 Bacteria 40108
762 Ga0495653_0027546 3300046463 Bacteria 4547
763 Ga0495653_0096589 3300046463 Bacteria 2148
764 Ga0495580_0018640 3300046472 Bacteria 5165
765 Ga0495580_0031293 3300046472 Bacteria 3846
766 Ga0495582_0002207 3300046473 Bacteria 10901
767 Ga0495582_0028720 3300046473 Bacteria 3052
768 Ga0495605_0219105 3300046474 Bacteria 823
769 Ga0495639_0022873 3300046475 Bacteria 2744
770 Ga0495639_0024480 3300046475 Bacteria 2658
771 Ga0495639_0028611 3300046475 Bacteria 2470
772 Ga0495662_0009429 3300046476 Bacteria 4785
773 Ga0495662_0046886 3300046476 Bacteria 2086
774 Ga0495664_0000003 3300046477 Bacteria 551602
775 Ga0495664_0000877 3300046477 Bacteria 15497
776 Ga0495664_0074144 3300046477 Bacteria 2035
777 Ga0495664_0102269 3300046477 Bacteria 1727
778 Ga0495584_0096965 3300046491 Bacteria 1489
779 Ga0495585_0004225 3300046492 Bacteria 9369
780 Ga0495594_0036748 3300046499 Bacteria 2672
781 Ga0495594_0130699 3300046499 Bacteria 1422
782 Ga0495607_0005594 3300046501 Bacteria 8963
783 Ga0495608_0000072 3300046511 Bacteria 76887
784 Ga0495608_0001863 3300046511 Bacteria 15064
785 Ga0495608_0021002 3300046511 Bacteria 4485
786 Ga0495608_0094658 3300046511 Bacteria 1930
787 Ga0495610_0000530 3300046512 Bacteria 38418
788 Ga0495618_0000019 3300046514 Bacteria 136770
789 Ga0495618_0007932 3300046514 Bacteria 6427
790 Ga0495618_0015011 3300046514 Bacteria 4724
791 Ga0495628_0000080 3300046516 Bacteria 75108
792 Ga0495628_0011369 3300046516 Bacteria 7529
793 Ga0495628_0015340 3300046516 Bacteria 6398
794 Ga0495628_0022925 3300046516 Bacteria 5125
795 Ga0495628_0052125 3300046516 Bacteria 3233
796 Ga0495628_0055939 3300046516 Bacteria 3107
797 Ga0495630_0002294 3300046517 Bacteria 13300
798 Ga0495630_0012446 3300046517 Bacteria 6177
799 Ga0495630_0078757 3300046517 Bacteria 2485
800 Ga0495632_0001108 3300046519 Bacteria 23100
801 Ga0495637_0054046 3300046520 Bacteria 1670
802 Ga0495643_0025174 3300046522 Bacteria 3370
803 Ga0495644_0000306 3300046523 Bacteria 22634
804 Ga0495648_0077361 3300046524 Bacteria 1907
805 Ga0495666_0015401 3300046526 Bacteria 3807
806 Ga0495666_0036055 3300046526 Bacteria 2409
807 Ga0495642_0228251 3300046528 Bacteria 813
808 Ga0495652_0000006 3300046529 Bacteria 459709
809 Ga0495652_0002115 3300046529 Bacteria 20938
810 Ga0495652_0002263 3300046529 Bacteria 20082
811 Ga0495652_0013648 3300046529 Bacteria 7311
812 Ga0495652_0305975 3300046529 Bacteria 1154
813 Ga0495665_0062590 3300046531 Bacteria 1964
814 Ga0495665_0226647 3300046531 Bacteria 966
815 Ga0495640_0000002 3300046533 Bacteria 646434
816 Ga0495640_0005373 3300046533 Bacteria 10190
817 Ga0495640_0013146 3300046533 Bacteria 6299
818 Ga0495640_0015102 3300046533 Bacteria 5817
819 Ga0495640_0023878 3300046533 Bacteria 4448
820 Ga0495640_0109377 3300046533 Bacteria 1807
821 Ga0495640_0159277 3300046533 Bacteria 1447
822 Ga0495586_0027068 3300046535 Bacteria 3068
823 Ga0495586_0049358 3300046535 Bacteria 2275
824 Ga0495586_0112940 3300046535 Bacteria 1513
825 Ga0495587_0000001 3300046536 Bacteria 724132
826 Ga0495587_0002255 3300046536 Bacteria 12888
827 Ga0495587_0018878 3300046536 Bacteria 4274
828 Ga0495587_0110028 3300046536 Bacteria 1583
829 Ga0495587_0178859 3300046536 Bacteria 1203
830 Ga0495598_0002277 3300046537 Bacteria 3952
831 Ga0495621_0080055 3300046539 Bacteria 1217
832 Ga0495645_0000284 3300046543 Bacteria 37169
833 Ga0495645_0001277 3300046543 Bacteria 17149
834 Ga0495645_0004817 3300046543 Bacteria 9220
835 Ga0495645_0033438 3300046543 Bacteria 3751
836 Ga0495645_0087084 3300046543 Bacteria 2234
837 Ga0495645_0144812 3300046543 Bacteria 1655
838 Ga0495645_0152759 3300046543 Bacteria 1602
839 Ga0495622_0004842 3300046557 Bacteria 6235
840 Ga0495633_0001183 3300046558 Bacteria 20947
841 Ga0495633_0094773 3300046558 Bacteria 1387
842 Ga0495667_0000021 3300046559 Bacteria 180625
843 Ga0495667_0000121 3300046559 Bacteria 56223
844 Ga0495667_0043767 3300046559 Bacteria 2966
845 Ga0495667_0083496 3300046559 Bacteria 2074
846 Ga0495656_0072048 3300046615 Bacteria 1537
847 Ga0495634_0000396 3300046642 Bacteria 42784
848 Ga0495634_0002835 3300046642 Bacteria 14233
849 Ga0495634_0016888 3300046642 Bacteria 5214
850 Ga0495634_0020441 3300046642 Bacteria 4694
851 Ga0495634_0306465 3300046642 Bacteria 959
852 Ga0495634_0353951 3300046642 Bacteria 879
853 Ga0495611_0003332 3300046648 Bacteria 7096
854 Ga0495635_0000001 3300046663 Bacteria 704901
855 Ga0495635_0000072 3300046663 Bacteria 62736
856 Ga0495635_0017419 3300046663 Bacteria 5018
857 Ga0495635_0018165 3300046663 Bacteria 4910
858 Ga0495635_0020590 3300046663 Bacteria 4593
859 Ga0495635_0044207 3300046663 Bacteria 3073
860 Ga0495635_0405216 3300046663 Bacteria 905
861 Ga0495659_0000645 3300046664 Bacteria 12657
862 Ga0495588_0003103 3300046674 Bacteria 7194
863 Ga0495588_0113522 3300046674 Bacteria 1427
864 Ga0495657_0000088 3300046675 Bacteria 81307
865 Ga0495657_0001284 3300046675 Bacteria 21828
866 Ga0495657_0034710 3300046675 Bacteria 3501
867 Ga0495657_0107448 3300046675 Bacteria 1771
868 Ga0495657_0306561 3300046675 Bacteria 946
869 Ga0495599_0000025 3300046678 Bacteria 120337
870 Ga0495599_0000695 3300046678 Bacteria 19040
871 Ga0495599_0017266 3300046678 Bacteria 4486
872 Ga0495599_0024129 3300046678 Bacteria 3803
873 Ga0495623_0000058 3300046679 Bacteria 68197
874 Ga0495623_0000291 3300046679 Bacteria 32839
875 Ga0495623_0003236 3300046679 Bacteria 10761
876 Ga0495623_0061099 3300046679 Bacteria 2363
877 Ga0495646_0000003 3300046680 Bacteria 287773
878 Ga0495646_0031506 3300046680 Bacteria 3304
879 Ga0495646_0037206 3300046680 Bacteria 3012
880 Ga0495646_0048349 3300046680 Bacteria 2584
881 Ga0495646_0120946 3300046680 Bacteria 1482
882 Ga0495647_0039384 3300046681 Bacteria 1791
883 Ga0495647_0057825 3300046681 Bacteria 1523
884 Ga0495647_0103155 3300046681 Bacteria 1183
885 Ga0495647_0110990 3300046681 Bacteria 1144
886 Ga0495658_0000229 3300046683 Bacteria 32147
887 Ga0495658_0023036 3300046683 Bacteria 3302
888 Ga0495658_0049426 3300046683 Bacteria 2375
889 Ga0495658_0247448 3300046683 Bacteria 1121
890 Ga0495613_0002758 3300046689 Bacteria 13197
891 Ga0495613_0007587 3300046689 Bacteria 8066
892 Ga0495613_0019425 3300046689 Bacteria 5063
893 Ga0495613_0037004 3300046689 Bacteria 3618
894 Ga0495613_0038838 3300046689 Bacteria 3529
895 Ga0495613_0074812 3300046689 Bacteria 2466
896 Ga0495624_0019928 3300046690 Bacteria 4469
897 Ga0495624_0028910 3300046690 Bacteria 3617
898 Ga0495624_0074972 3300046690 Bacteria 2101
899 Ga0495624_0402183 3300046690 Bacteria 822
900 Ga0495670_0004752 3300046691 Bacteria 6671
901 Ga0495670_0062899 3300046691 Bacteria 1868
902 Ga0495671_0039884 3300046692 Bacteria 2369
903 Ga0495600_0000042 3300046809 Bacteria 74873
904 Ga0495600_0000330 3300046809 Bacteria 25140
905 Ga0495600_0045949 3300046809 Bacteria 2849
906 Ga0495600_0049453 3300046809 Bacteria 2743
907 Ga0495600_0281681 3300046809 Bacteria 1052
908 Ga0495581_0006942 3300047315 Bacteria 6561
909 Ga0495581_0008088 3300047315 Bacteria 6088
910 Ga0495581_0008513 3300047315 Bacteria 5948
911 Ga0495604_0000008 3300047317 Bacteria 341160
912 Ga0495604_0003872 3300047317 Bacteria 11918
913 Ga0495604_0005468 3300047317 Bacteria 10075
914 Ga0495604_0024793 3300047317 Bacteria 4785
915 Ga0495604_0077274 3300047317 Bacteria 2502
916 Ga0495674_0000028 3300047319 Bacteria 124722
917 Ga0495674_0002065 3300047319 Bacteria 19693
918 Ga0495674_0017187 3300047319 Bacteria 6734
919 Ga0495674_0018921 3300047319 Bacteria 6405
920 Ga0495674_0019117 3300047319 Bacteria 6366
921 Ga0495674_0098730 3300047319 Bacteria 2486
922 Ga0495674_0102023 3300047319 Bacteria 2440
923 Ga0495674_0308239 3300047319 Bacteria 1292
924 Ga0495674_0672778 3300047319 Bacteria 814
925 Ga0495672_0046593 3300047320 Bacteria 2585
926 Ga0495676_0012443 3300047321 Bacteria 7666
927 Ga0495676_0114954 3300047321 Bacteria 1968
928 Ga0495676_0152323 3300047321 Bacteria 1644
929 Ga0495676_0231937 3300047321 Bacteria 1267
930 Ga0495680_0000711 3300047322 Bacteria 37349
931 Ga0495680_0009139 3300047322 Bacteria 8943
932 Ga0495680_0016511 3300047322 Bacteria 6338
933 Ga0495680_0036945 3300047322 Bacteria 3915
934 Ga0495680_0080264 3300047322 Bacteria 2465
935 Ga0495680_0081464 3300047322 Bacteria 2443
936 Ga0495680_0142257 3300047322 Bacteria 1754
937 Ga0495680_0350950 3300047322 Bacteria 1027
938 Ga0495680_0401106 3300047322 Bacteria 947
939 Ga0495675_0000796 3300047444 Bacteria 19452
940 Ga0495675_0001942 3300047444 Bacteria 12331
941 Ga0495675_0243369 3300047444 Bacteria 1082
942 Ga0495675_0377683 3300047444 Bacteria 829
943 Ga0495677_0184934 3300047445 Bacteria 808
944 Ga0495679_034322 3300047446 Bacteria 1615
945 Ga0495681_0003767 3300047470 Bacteria 10514
946 Ga0495681_0090686 3300047470 Bacteria 1350
947 Ga0495684_0000002 3300047471 Bacteria 341216
948 Ga0495684_0000594 3300047471 Bacteria 29100
949 Ga0495684_0014934 3300047471 Bacteria 5981
950 Ga0495684_0059336 3300047471 Bacteria 2914
951 Ga0495684_0091239 3300047471 Bacteria 2308
952 Ga0495684_0248620 3300047471 Bacteria 1294
953 Ga0495686_0000269 3300047472 Bacteria 92647
954 Ga0495686_0003611 3300047472 Bacteria 13269
955 Ga0495593_0000641 3300047673 Bacteria 20075
956 Ga0495593_0003093 3300047673 Bacteria 10010
957 Ga0495593_0015025 3300047673 Bacteria 4397
958 Ga0495593_0024445 3300047673 Bacteria 3348
959 Ga0495593_0040039 3300047673 Bacteria 2524
960 Ga0495593_0154447 3300047673 Bacteria 1160
961 Ga0495602_0000468 3300048088 Bacteria 37400
962 Ga0495602_0004847 3300048088 Bacteria 14082
963 Ga0495602_0014643 3300048088 Bacteria 7956
964 Ga0495602_0024310 3300048088 Bacteria 5879
965 Ga0495602_0057882 3300048088 Bacteria 3397
966 Ga0495614_0005547 3300048089 Bacteria 5691
967 Ga0495614_0147956 3300048089 Bacteria 1047
968 Ga0495615_0055265 3300048090 Bacteria 1033
969 Ga0496100_0001589 3300048903 Bacteria 11190
970 Ga0496100_0010967 3300048903 Bacteria 5142
971 Ga0496100_0169109 3300048903 Bacteria 1572
972 Ga0496100_0270443 3300048903 Bacteria 1263
973 Ga0496101_0009861 3300048904 Bacteria 6292
974 Ga0496101_0057632 3300048904 Bacteria 2810
975 Ga0496101_0241609 3300048904 Bacteria 1405
976 Ga0496101_0363146 3300048904 Bacteria 1138
977 Ga0496101_0365362 3300048904 Bacteria 1135
978 Ga0496102_0038711 3300048905 Bacteria 4305
979 Ga0496102_0058140 3300048905 Bacteria 3532
980 Ga0496102_0294986 3300048905 Bacteria 1528
981 Ga0496102_0343096 3300048905 Bacteria 1406
982 Ga0496102_0381817 3300048905 Bacteria 1326
983 Ga0496103_0044117 3300048906 Bacteria 2746
984 Ga0496103_0112598 3300048906 Bacteria 1729
985 Ga0496103_0194201 3300048906 Bacteria 1305
986 Ga0496104_0000311 3300048907 Bacteria 43387
987 Ga0496104_0009349 3300048907 Bacteria 8718
988 Ga0496104_0013664 3300048907 Bacteria 7320
989 Ga0496104_0033322 3300048907 Bacteria 4798
990 Ga0496104_0129894 3300048907 Bacteria 2420
991 Ga0496104_0406085 3300048907 Bacteria 1274
992 Ga0496105_0006002 3300048908 Bacteria 9278
993 Ga0496105_0014977 3300048908 Bacteria 6171
994 Ga0496105_0080525 3300048908 Bacteria 2690
995 Ga0496105_0091271 3300048908 Bacteria 2515
996 Ga0496105_0382335 3300048908 Bacteria 1120
997 Ga0496106_0003164 3300048909 Bacteria 12292
998 Ga0496106_0022817 3300048909 Bacteria 4649
999 Ga0496106_0032219 3300048909 Bacteria 3907
1000 Ga0496106_0335659 3300048909 Bacteria 1214
1001 Ga0496107_0005584 3300048910 Bacteria 8616
1002 Ga0496107_0043194 3300048910 Bacteria 3238
1003 Ga0496107_0053037 3300048910 Bacteria 2925
1004 Ga0496107_0147874 3300048910 Bacteria 1737
1005 Ga0496107_0159415 3300048910 Bacteria 1672
1006 Ga0496108_0010630 3300048911 Bacteria 7466
1007 Ga0496108_0044300 3300048911 Bacteria 3715
1008 Ga0496108_0086659 3300048911 Bacteria 2658
1009 Ga0496109_0091484 3300048912 Bacteria 2813
1010 Ga0496109_0505388 3300048912 Bacteria 1141
1011 Ga0496109_0921889 3300048912 Bacteria 811
1012 Ga0496110_0006378 3300048913 Bacteria 9328
1013 Ga0496110_0007488 3300048913 Bacteria 8722
1014 Ga0496110_0014478 3300048913 Bacteria 6552
1015 Ga0496110_0140581 3300048913 Bacteria 2182
1016 Ga0496110_0175536 3300048913 Bacteria 1945
1017 Ga0496111_0066041 3300048914 Bacteria 2626
1018 Ga0496112_0007190 3300048915 Bacteria 9862
1019 Ga0496112_0028322 3300048915 Bacteria 5406
1020 Ga0496112_0060353 3300048915 Bacteria 3737
1021 Ga0496112_0062681 3300048915 Bacteria 3668
1022 Ga0496112_0073057 3300048915 Bacteria 3391
1023 Ga0496112_0152444 3300048915 Bacteria 2278
1024 Ga0496112_0443252 3300048915 Bacteria 1236
1025 Ga0496113_0047215 3300048916 Bacteria 3199
1026 Ga0496113_0417097 3300048916 Bacteria 1078
1027 Ga0496114_0034874 3300048917 Bacteria 4153
1028 Ga0496114_0090001 3300048917 Bacteria 2605
1029 Ga0496115_0015333 3300048918 Bacteria 5811
1030 Ga0496115_0029287 3300048918 Bacteria 4323
1031 Ga0496115_0050532 3300048918 Bacteria 3331
1032 Ga0496115_0116250 3300048918 Bacteria 2200
1033 Ga0496116_0001796 3300048919 Bacteria 23307
1034 Ga0496116_0006429 3300048919 Bacteria 10651
1035 Ga0496116_0010738 3300048919 Bacteria 7643
1036 Ga0496116_0025017 3300048919 Bacteria 4399
1037 Ga0496117_0012169 3300048920 Bacteria 7620
1038 Ga0496117_0040813 3300048920 Bacteria 3408
1039 Ga0496118_0037860 3300048921 Bacteria 3874
1040 Ga0496118_0071833 3300048921 Bacteria 2489
1041 Ga0496119_0120375 3300048922 Bacteria 1444
1042 Ga0496119_0154257 3300048922 Bacteria 1228
1043 Ga0496120_0248603 3300048923 Bacteria 836
1044 Ga0496121_0017255 3300048924 Bacteria 7387
1045 Ga0496121_0046016 3300048924 Bacteria 3740
1046 Ga0496121_0099426 3300048924 Bacteria 2248
1047 Ga0496122_0011409 3300048925 Bacteria 8999
1048 Ga0496122_0042101 3300048925 Bacteria 3598
1049 Ga0496122_0072861 3300048925 Bacteria 2439
1050 Ga0496122_0079885 3300048925 Bacteria 2283
1051 Ga0496123_0003477 3300048926 Bacteria 17605
1052 Ga0496123_0014908 3300048926 Bacteria 6408
1053 Ga0496123_0031554 3300048926 Bacteria 3853
1054 Ga0496124_0006309 3300048927 Bacteria 12948
1055 Ga0496124_0008251 3300048927 Bacteria 10923
1056 Ga0496124_0022918 3300048927 Bacteria 5714
1057 Ga0496124_0040338 3300048927 Bacteria 4039
1058 Ga0496124_0303193 3300048927 Bacteria 1152
1059 Ga0496125_0002335 3300048928 Bacteria 24935
1060 Ga0496126_0089178 3300048929 Bacteria 2715
1061 Ga0501031_0002030 3300049568 Bacteria 12744
1062 Ga0501031_0167306 3300049568 Bacteria 1436
1063 Ga0501031_0412925 3300049568 Bacteria 873
1064 Ga0501032_0000074 3300049569 Bacteria 84694
1065 Ga0501032_0108696 3300049569 Bacteria 1836
1066 Ga0501033_0000796 3300049570 Bacteria 28911
1067 Ga0501033_0129652 3300049570 Bacteria 1827
1068 Ga0501034_0000249 3300049571 Bacteria 99562
1069 Ga0501034_0000436 3300049571 Bacteria 69142
1070 Ga0501034_0003203 3300049571 Bacteria 18778
1071 Ga0501034_0041027 3300049571 Bacteria 4682
1072 Ga0501034_0049808 3300049571 Bacteria 4226
1073 Ga0501034_0127319 3300049571 Bacteria 2531
1074 Ga0501034_0170870 3300049571 Bacteria 2141
1075 Ga0501034_0267148 3300049571 Bacteria 1652
1076 Ga0501036_0000472 3300049572 Bacteria 28732
1077 Ga0501036_0002786 3300049572 Bacteria 13844
1078 Ga0501036_0020355 3300049572 Bacteria 5573
1079 Ga0501036_0020904 3300049572 Bacteria 5496
1080 Ga0501036_0030645 3300049572 Bacteria 4543
1081 Ga0501036_0052535 3300049572 Bacteria 3451
1082 Ga0501037_0000129 3300049573 Bacteria 70557
1083 Ga0501037_0003344 3300049573 Bacteria 11656
1084 Ga0501037_0003548 3300049573 Bacteria 11318
1085 Ga0501037_0041626 3300049573 Bacteria 3378
1086 Ga0501038_0000202 3300049574 Bacteria 50972
1087 Ga0501038_0001565 3300049574 Bacteria 21184
1088 Ga0501038_0009422 3300049574 Bacteria 8961
1089 Ga0501038_0049417 3300049574 Bacteria 3636
1090 Ga0501038_0056984 3300049574 Bacteria 3356
1091 Ga0501038_0059157 3300049574 Bacteria 3283
1092 Ga0501038_0142330 3300049574 Bacteria 1961
1093 Ga0501039_0000027 3300049575 Bacteria 150215
1094 Ga0501039_0004448 3300049575 Bacteria 10579
1095 Ga0501039_0009471 3300049575 Bacteria 7425
1096 Ga0501039_0292085 3300049575 Bacteria 1281
1097 Ga0501039_0522172 3300049575 Bacteria 932
1098 Ga0501041_0076719 3300049577 Bacteria 2056
1099 Ga0501041_0341204 3300049577 Bacteria 946
1100 Ga0501043_0000047 3300049579 Bacteria 110659
1101 Ga0501043_0050717 3300049579 Bacteria 3261
1102 Ga0501046_0003231 3300049580 Bacteria 14971
1103 Ga0501046_0038661 3300049580 Bacteria 3827
1104 Ga0501047_0000384 3300049581 Bacteria 49644
1105 Ga0501047_0026320 3300049581 Bacteria 5597
1106 Ga0501047_0040982 3300049581 Bacteria 4477
1107 Ga0501047_0043963 3300049581 Bacteria 4314
1108 Ga0501047_0050031 3300049581 Bacteria 4035
1109 Ga0501047_0081713 3300049581 Bacteria 3106
1110 Ga0501047_0234621 3300049581 Bacteria 1686
1111 Ga0501048_0000074 3300049582 Bacteria 51762
1112 Ga0501048_0000302 3300049582 Bacteria 33455
1113 Ga0501048_0004383 3300049582 Bacteria 10748
1114 Ga0501048_0419858 3300049582 Bacteria 957
1115 Ga0501067_0002609 3300049583 Bacteria 9976
1116 Ga0501067_0049133 3300049583 Bacteria 2338
1117 Ga0501068_0030914 3300049584 Bacteria 3178
1118 Ga0501068_0034189 3300049584 Bacteria 3031
1119 Ga0501068_0062769 3300049584 Bacteria 2260
1120 Ga0501069_0258577 3300049585 Bacteria 1016
1121 Ga0501070_0006228 3300049586 Bacteria 10156
1122 Ga0501070_0022527 3300049586 Bacteria 5277
1123 Ga0501070_0058997 3300049586 Bacteria 3181
1124 Ga0501070_0117429 3300049586 Bacteria 2197
1125 Ga0501070_0201742 3300049586 Bacteria 1633
1126 Ga0501071_0027148 3300049587 Bacteria 4025
1127 Ga0501071_0114814 3300049587 Bacteria 1992
1128 Ga0501072_0390934 3300049588 Bacteria 1103
1129 Ga0501073_0002212 3300049589 Bacteria 14534
1130 Ga0501073_0010194 3300049589 Bacteria 6903
1131 Ga0501073_0027419 3300049589 Bacteria 4073
1132 Ga0501073_0047630 3300049589 Bacteria 3012
1133 Ga0501073_0089648 3300049589 Bacteria 2138
1134 Ga0501073_0536421 3300049589 Bacteria 809
1135 Ga0501074_0038453 3300049590 Bacteria 3467
1136 Ga0501075_0116511 3300049591 Bacteria 2031
1137 Ga0501075_0118558 3300049591 Bacteria 2013
1138 Ga0501076_0154071 3300049592 Bacteria 1870
1139 Ga0501076_0630322 3300049592 Bacteria 885
1140 Ga0501077_0010467 3300049593 Bacteria 5774
1141 Ga0501077_0120998 3300049593 Bacteria 1659
1142 Ga0501077_0300785 3300049593 Bacteria 1022
1143 Ga0501079_0026337 3300049741 Bacteria 4459
1144 Ga0501079_0087366 3300049741 Bacteria 2414
1145 Ga0501079_0091637 3300049741 Bacteria 2355
1146 Ga0501079_0279845 3300049741 Bacteria 1305
1147 Ga0501079_0330179 3300049741 Bacteria 1194
1148 Ga0501080_0001148 3300049742 Bacteria 21848
1149 Ga0501080_0026165 3300049742 Bacteria 5420
1150 Ga0501080_0099024 3300049742 Bacteria 2705
1151 Ga0501080_0126654 3300049742 Bacteria 2365
1152 Ga0501083_0003658 3300049744 Bacteria 10791
1153 Ga0501083_0009432 3300049744 Bacteria 6895
1154 Ga0501083_0101265 3300049744 Bacteria 1899
1155 Ga0501035_0000132 3300049822 Bacteria 90625
1156 Ga0501035_0141034 3300049822 Bacteria 2095
1157 Ga0501035_0175644 3300049822 Bacteria 1848
1158 Ga0501044_0000509 3300049823 Bacteria 47320
1159 Ga0501044_0010183 3300049823 Bacteria 10213
1160 Ga0501044_0017087 3300049823 Bacteria 7785
1161 Ga0501044_0023168 3300049823 Bacteria 6608
1162 Ga0501044_0099694 3300049823 Bacteria 2923
1163 Ga0501044_0121115 3300049823 Bacteria 2617
1164 Ga0501044_0124359 3300049823 Bacteria 2577
1165 Ga0501044_0140143 3300049823 Bacteria 2407
1166 Ga0501044_0155855 3300049823 Bacteria 2263
1167 Ga0501044_0243680 3300049823 Bacteria 1740
1168 Ga0501044_0267882 3300049823 Bacteria 1645
1169 Ga0501044_0268553 3300049823 Bacteria 1642
1170 Ga0501045_0008006 3300049824 Bacteria 7361
1171 Ga0501045_0165728 3300049824 Bacteria 1646
1172 Ga0501045_0263972 3300049824 Bacteria 1282
1173 Ga0501045_0495086 3300049824 Bacteria 908
1174 nmdc:mga00v17_357368_c1 3300050491 Bacteria 949
1175 nmdc:mga0yw44_1172_c1 3300050492 Bacteria 10204
1176 nmdc:mga0yw44_29500_c1 3300050492 Bacteria 3167
1177 nmdc:mga0yw44_6325_c1 3300050492 Bacteria 5713
1178 nmdc:mga0k408_10105_c1 3300050493 Bacteria 5099
1179 nmdc:mga0k408_11707_c1 3300050493 Bacteria 4783
1180 nmdc:mga0k408_245651_c1 3300050493 Bacteria 1069
1181 nmdc:mga06z11_161499_c1 3300050494 Bacteria 1281
1182 nmdc:mga06z11_200658_c1 3300050494 Bacteria 1158
1183 nmdc:mga07m45_167326_c1 3300050496 Bacteria 1277
1184 nmdc:mga07m45_325344_c1 3300050496 Bacteria 894
1185 nmdc:mga07m45_33236_c1 3300050496 Bacteria 2863
1186 nmdc:mga07m45_69540_c1 3300050496 Bacteria 2001
1187 nmdc:mga05p37_10714_c1 3300050507 Bacteria 10882
1188 nmdc:mga05p37_17777_c1 3300050507 Bacteria 8272
1189 nmdc:mga05p37_448459_c1 3300050507 Bacteria 1494
1190 nmdc:mga05p37_561174_c1 3300050507 Bacteria 1297
1191 nmdc:mga05p37_960127_c1 3300050507 Bacteria 913
1192 nmdc:mga0qj67_128_c1 3300050509 Bacteria 50095
1193 nmdc:mga0qj67_295557_c1 3300050509 Bacteria 1312
1194 nmdc:mga0qj67_452593_c1 3300050509 Bacteria 1034
1195 nmdc:mga06r32_92563_c1 3300050510 Bacteria 2956
1196 nmdc:mga08y16_173974_c1 3300050511 Bacteria 2235
1197 nmdc:mga08y16_184340_c1 3300050511 Bacteria 2166
1198 nmdc:mga08y16_220666_c1 3300050511 Bacteria 1963
1199 nmdc:mga08y16_313456_c1 3300050511 Bacteria 1616
1200 nmdc:mga08y16_361824_c1 3300050511 Bacteria 1489
1201 nmdc:mga0n895_147647_c1 3300050512 Bacteria 2381
1202 nmdc:mga0n895_173354_c1 3300050512 Bacteria 2189
1203 nmdc:mga0n895_58450_c1 3300050512 Bacteria 3802
1204 nmdc:mga0n895_61493_c1 3300050512 Bacteria 3708
1205 nmdc:mga0n895_773241_c1 3300050512 Bacteria 952
1206 nmdc:mga0rr50_132364_c1 3300050513 Bacteria 1998
1207 nmdc:mga0rr50_452107_c1 3300050513 Bacteria 1089
1208 nmdc:mga0rr50_659953_c1 3300050513 Bacteria 892
1209 nmdc:mga08x19_1357_c1 3300050514 Bacteria 15172
1210 nmdc:mga08x19_80332_c1 3300050514 Bacteria 2140
1211 nmdc:mga0a205_26885_c1 3300050515 Bacteria 3025
1212 nmdc:mga0a205_27393_c1 3300050515 Bacteria 5443
1213 nmdc:mga0a205_323455_c1 3300050515 Bacteria 1413
1214 Ga0495601_0000001 3300053077 Bacteria 549454
1215 Ga0495601_0000436 3300053077 Bacteria 21835
1216 Ga0495601_0000441 3300053077 Bacteria 21726
1217 Ga0495601_0001526 3300053077 Bacteria 12769
1218 Ga0495601_0001594 3300053077 Bacteria 12527
1219 Ga0495601_0095959 3300053077 Bacteria 1912
1220 Ga0495601_0295023 3300053077 Bacteria 1056
1221 Ga0495612_0000003 3300053078 Bacteria 303629
1222 Ga0495612_0000238 3300053078 Bacteria 23053
1223 Ga0495612_0001337 3300053078 Bacteria 10155
1224 Ga0495612_0007090 3300053078 Bacteria 4586
1225 Ga0495612_0008988 3300053078 Bacteria 4050
1226 Ga0495612_0022460 3300053078 Bacteria 2528
1227 Ga0495595_0000569 3300053084 Bacteria 14156
1228 Ga0495595_0002985 3300053084 Bacteria 6683
1229 Ga0495595_0005043 3300053084 Bacteria 5333
1230 Ga0495595_0016582 3300053084 Bacteria 3155
1231 Ga0495595_0037977 3300053084 Bacteria 2192
1232 Ga0495595_0068618 3300053084 Bacteria 1672
1233 Ga0495619_0000004 3300053085 Bacteria 500068
1234 Ga0495619_0000063 3300053085 Bacteria 84834
1235 Ga0495619_0001864 3300053085 Bacteria 14043
1236 Ga0495619_0002658 3300053085 Bacteria 11687
1237 Ga0495619_0004091 3300053085 Bacteria 9333
1238 Ga0495619_0005185 3300053085 Bacteria 8260
1239 Ga0495619_0029031 3300053085 Bacteria 3571
1240 Ga0495619_0072135 3300053085 Bacteria 2312
1241 Ga0495619_0137769 3300053085 Bacteria 1679
1242 Ga0500643_010715 3300053087 Bacteria 3393
1243 Ga0500651_0006750 3300053093 Bacteria 6645
1244 Ga0500566_0043210 3300053094 Bacteria 2597
1245 Ga0500641_0003892 3300053096 Bacteria 5279
1246 Ga0500641_0004747 3300053096 Bacteria 4808
1247 Ga0500555_001006 3300053103 Bacteria 9625
1248 Ga0500562_069493 3300053108 Bacteria 950
1249 Ga0500593_018097 3300053117 Bacteria 3067
1250 Ga0500595_000001 3300053119 Bacteria 1088438
1251 Ga0500595_011782 3300053119 Bacteria 3405
1252 Ga0500642_0069863 3300053130 Bacteria 1596
1253 Ga0500652_000056 3300053131 Bacteria 51871
1254 Ga0500658_0037202 3300053134 Bacteria 1935
1255 Ga0500559_0005651 3300053136 Bacteria 5723
1256 Ga0500616_0000001 3300053153 Bacteria 1986011
1257 Ga0500616_0000441 3300053153 Bacteria 54819
1258 Ga0500616_0056025 3300053153 Bacteria 2059
1259 Ga0500616_0077655 3300053153 Bacteria 1676
1260 Ga0500636_0012034 3300053177 Bacteria 5068
1261 Ga0500645_000592 3300053730 Bacteria 23396
1262 Ga0500601_000399 3300053737 Bacteria 7445
1263 Ga0501084_0139445 3300054114 Bacteria 2041
1264 Ga0501084_0361279 3300054114 Bacteria 1227
1265 Ga0501084_0813697 3300054114 Bacteria 787
1266 Ga0500661_014610 3300055283 Bacteria 1413
1267 Ga0587077_037182 3300059493 Bacteria 959
1268 Ga0501082_0000510 3300060353 Bacteria 34491
1269 Ga0501082_0030808 3300060353 Bacteria 4624
1270 Ga0501082_0061318 3300060353 Bacteria 3238
1271 Ga0501082_0076938 3300060353 Bacteria 2877
1272 Ga0501082_0184800 3300060353 Bacteria 1814
1273 Ga0501082_0202907 3300060353 Bacteria 1725
1274 Ga0501082_0226635 3300060353 Bacteria 1626
1275 Ga0501082_0617968 3300060353 Bacteria 948
1276 Ga0466962_0169587 3300061719 Bacteria 1062
1277 Ga0530510_0083357 3300061734 Bacteria 2328
1278 Ga0530510_0112341 3300061734 Bacteria 1996
1279 Ga0530510_0258438 3300061734 Bacteria 1298
1280 Ga0530510_0584078 3300061734 Bacteria 849

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2958041894 2958049248 186
2 3300060353 Ga0501082_0076938 Ga0501082_0076938_579_1283 201
3 3300037068 Ga0373925_0281437 Ga0373925_0281437_470_1189 205
4 3300053096 Ga0500641_0003892 Ga0500641_0003892_297_1022 209
5 3300049571 Ga0501034_0170870 Ga0501034_0170870_725_1435 210
6 3300039437 Ga0436365_0853635 Ga0436365_0853635_17_724 211
7 3300005617 Ga0068859_100596542 Ga0068859_1005965422 212
8 3300005842 Ga0068858_100226731 Ga0068858_1002267312 212
9 3300006237 Ga0097621_100309610 Ga0097621_1003096102 212
10 3300006358 Ga0068871_100015006 Ga0068871_1000150062 212
11 3300006931 Ga0097620_100596471 Ga0097620_1005964711 212
12 3300009098 Ga0105245_10007083 Ga0105245_100070836 212
13 3300009551 Ga0105238_10105024 Ga0105238_101050244 212
14 3300011119 Ga0105246_10491139 Ga0105246_104911392 212
15 3300014968 Ga0157379_10572503 Ga0157379_105725032 212
16 3300025899 Ga0207642_10007393 Ga0207642_100073933 212
17 3300025911 Ga0207654_10320467 Ga0207654_103204672 212
18 3300025924 Ga0207694_10487270 Ga0207694_104872701 212
19 3300025927 Ga0207687_10021525 Ga0207687_100215252 212
20 3300025960 Ga0207651_10223690 Ga0207651_102236901 212
21 3300025986 Ga0207658_10176656 Ga0207658_101766562 212
22 3300026035 Ga0207703_10035397 Ga0207703_100353971 212
23 3300046454 Ga0495592_0215119 Ga0495592_0215119_74_781 212
24 3300047319 Ga0495674_0672778 Ga0495674_0672778_11_718 212
25 3300053077 Ga0495601_0295023 Ga0495601_0295023_321_1028 212
26 3300053108 Ga0500562_069493 Ga0500562_069493_161_871 212
27 3300050491 nmdc:mga00v17_357368_c1 nmdc:mga00v17_357368_c1_32_739 213
28 3300013249 Ga0171463_1004 Ga0171463_1004240 214
29 3300035083 Ga0373926_0042636 Ga0373926_0042636_239_949 214
30 3300035111 Ga0373923_0001197 Ga0373923_0001197_1002_1712 214
31 3300035113 Ga0373936_0003776 Ga0373936_0003776_136_846 214
32 3300035116 Ga0373945_0014620 Ga0373945_0014620_194_904 214
33 3300035117 Ga0373953_0002594 Ga0373953_0002594_3043_3753 214
34 3300035118 Ga0373954_0002810 Ga0373954_0002810_1369_2079 214
35 3300035170 Ga0373943_0005356 Ga0373943_0005356_410_1120 214
36 3300035171 Ga0373946_0000831 Ga0373946_0000831_4152_4862 214
37 3300035172 Ga0373955_0000245 Ga0373955_0000245_13896_14606 214
38 3300035692 Ga0373935_0000514 Ga0373935_0000514_13655_14365 214
39 3300035695 Ga0373927_0003594 Ga0373927_0003594_173_883 214
40 3300035724 Ga0373933_0013404 Ga0373933_0013404_1961_2671 214
41 3300035725 Ga0373947_0002558 Ga0373947_0002558_5842_6552 214
42 3300036401 Ga0373937_0000005 Ga0373937_0000005_112375_113085 214
43 3300037068 Ga0373925_0000007 Ga0373925_0000007_87108_87818 214
44 3300039450 Ga0436363_0382716 Ga0436363_0382716_133_924 214
45 3300046454 Ga0495592_0000165 Ga0495592_0000165_30978_31688 214
46 3300046462 Ga0495651_0000836 Ga0495651_0000836_21701_22411 214
47 3300046463 Ga0495653_0000103 Ga0495653_0000103_38089_38799 214
48 3300046476 Ga0495662_0009429 Ga0495662_0009429_2016_2726 214
49 3300046477 Ga0495664_0000003 Ga0495664_0000003_471743_472453 214
50 3300046511 Ga0495608_0000072 Ga0495608_0000072_70472_71182 214
51 3300046514 Ga0495618_0000019 Ga0495618_0000019_36910_37620 214
52 3300046516 Ga0495628_0000080 Ga0495628_0000080_30870_31580 214
53 3300046517 Ga0495630_0002294 Ga0495630_0002294_5726_6436 214
54 3300046529 Ga0495652_0000006 Ga0495652_0000006_229216_229926 214
55 3300046533 Ga0495640_0000002 Ga0495640_0000002_415957_416667 214
56 3300046535 Ga0495586_0049358 Ga0495586_0049358_743_1453 214
57 3300046536 Ga0495587_0000001 Ga0495587_0000001_488413_489123 214
58 3300046543 Ga0495645_0000284 Ga0495645_0000284_30724_31434 214
59 3300046559 Ga0495667_0000021 Ga0495667_0000021_92890_93600 214
60 3300046642 Ga0495634_0000396 Ga0495634_0000396_11531_12241 214
61 3300046663 Ga0495635_0000001 Ga0495635_0000001_474224_474934 214
62 3300046675 Ga0495657_0000088 Ga0495657_0000088_28292_29002 214
63 3300046678 Ga0495599_0000025 Ga0495599_0000025_88691_89401 214
64 3300046679 Ga0495623_0000058 Ga0495623_0000058_51346_52056 214
65 3300046680 Ga0495646_0000003 Ga0495646_0000003_52212_52922 214
66 3300046683 Ga0495658_0247448 Ga0495658_0247448_113_823 214
67 3300046689 Ga0495613_0019425 Ga0495613_0019425_1760_2470 214
68 3300046690 Ga0495624_0019928 Ga0495624_0019928_2637_3347 214
69 3300046690 Ga0495624_0402183 Ga0495624_0402183_101_811 214
70 3300046809 Ga0495600_0000042 Ga0495600_0000042_68453_69163 214
71 3300047315 Ga0495581_0008088 Ga0495581_0008088_1011_1721 214
72 3300047317 Ga0495604_0000008 Ga0495604_0000008_30911_31621 214
73 3300047319 Ga0495674_0000028 Ga0495674_0000028_93018_93728 214
74 3300047322 Ga0495680_0000711 Ga0495680_0000711_5712_6422 214
75 3300047444 Ga0495675_0001942 Ga0495675_0001942_5908_6618 214
76 3300047471 Ga0495684_0000002 Ga0495684_0000002_30969_31679 214
77 3300047673 Ga0495593_0003093 Ga0495593_0003093_5339_6049 214
78 3300048088 Ga0495602_0000468 Ga0495602_0000468_30976_31686 214
79 3300049568 Ga0501031_0167306 Ga0501031_0167306_612_1322 214
80 3300049574 Ga0501038_0049417 Ga0501038_0049417_2745_3455 214
81 3300053077 Ga0495601_0000001 Ga0495601_0000001_70469_71179 214
82 3300053078 Ga0495612_0000003 Ga0495612_0000003_271926_272636 214
83 3300053084 Ga0495595_0000569 Ga0495595_0000569_5656_6366 214
84 3300053085 Ga0495619_0000004 Ga0495619_0000004_70500_71210 214
85 iso_pu_bacteria 8054563764 8054568546 214
86 3300035121 Ga0373960_0002152 Ga0373960_0002152_68_781 215
87 3300049570 Ga0501033_0129652 Ga0501033_0129652_846_1571 215
88 3300049571 Ga0501034_0267148 Ga0501034_0267148_207_932 215
89 3300049572 Ga0501036_0020904 Ga0501036_0020904_4157_4882 215
90 3300049573 Ga0501037_0003548 Ga0501037_0003548_7912_8637 215
91 3300049574 Ga0501038_0001565 Ga0501038_0001565_6992_7717 215
92 3300049575 Ga0501039_0004448 Ga0501039_0004448_9624_10349 215
93 3300049580 Ga0501046_0003231 Ga0501046_0003231_6156_6881 215
94 3300049582 Ga0501048_0004383 Ga0501048_0004383_9439_10164 215
95 3300049583 Ga0501067_0002609 Ga0501067_0002609_4293_5018 215
96 3300049584 Ga0501068_0034189 Ga0501068_0034189_89_814 215
97 3300049586 Ga0501070_0117429 Ga0501070_0117429_499_1224 215
98 3300049587 Ga0501071_0027148 Ga0501071_0027148_1391_2116 215
99 3300049589 Ga0501073_0002212 Ga0501073_0002212_257_982 215
100 3300049741 Ga0501079_0091637 Ga0501079_0091637_814_1539 215
101 3300049742 Ga0501080_0126654 Ga0501080_0126654_615_1340 215
102 3300049823 Ga0501044_0243680 Ga0501044_0243680_809_1534 215
103 3300049824 Ga0501045_0008006 Ga0501045_0008006_73_798 215
104 3300060353 Ga0501082_0030808 Ga0501082_0030808_2151_2876 215
105 3300061734 Ga0530510_0584078 Ga0530510_0584078_61_786 215
106 iso_pu_bacteria 2508501122 2509109615 215
107 iso_pu_bacteria 2510065057 2510306747 215
108 iso_pu_bacteria 2510917026 2511175729 215
109 iso_pu_bacteria 2511231052 2511498517 215
110 iso_pu_bacteria 2558860983 2561467160 215
111 iso_pu_bacteria 2585427633 2585997833 215
112 iso_pu_bacteria 2585427634 2586002419 215
113 iso_pu_bacteria 2791355092 2792628868 215
114 iso_pu_bacteria 2854896431 2854901676 215
115 iso_pu_bacteria 2919171160 2919175731 215
116 iso_pu_bacteria 2941499720 2941501399 215
117 iso_pu_bacteria 8018150411 8018153423 215
118 3300005333 Ga0070677_10160182 Ga0070677_101601822 216
119 3300005336 Ga0070680_100509879 Ga0070680_1005098791 216
120 3300005343 Ga0070687_100024918 Ga0070687_1000249182 216
121 3300005353 Ga0070669_100350916 Ga0070669_1003509162 216
122 3300005356 Ga0070674_100135566 Ga0070674_1001355662 216
123 3300005365 Ga0070688_100022333 Ga0070688_1000223334 216
124 3300005434 Ga0070709_10251918 Ga0070709_102519182 216
125 3300005436 Ga0070713_100013740 Ga0070713_1000137402 216
126 3300005436 Ga0070713_100549168 Ga0070713_1005491682 216
127 3300005439 Ga0070711_100141673 Ga0070711_1001416731 216
128 3300005439 Ga0070711_100164775 Ga0070711_1001647752 216
129 3300005455 Ga0070663_100116276 Ga0070663_1001162762 216
130 3300005458 Ga0070681_10105326 Ga0070681_101053263 216
131 3300005458 Ga0070681_10368448 Ga0070681_103684482 216
132 3300005459 Ga0068867_100027781 Ga0068867_1000277814 216
133 3300005530 Ga0070679_100112073 Ga0070679_1001120733 216
134 3300005548 Ga0070665_100582611 Ga0070665_1005826112 216
135 3300005617 Ga0068859_100130968 Ga0068859_1001309682 216
136 3300005618 Ga0068864_100144389 Ga0068864_1001443892 216
137 3300005983 Ga0081540_1003343 Ga0081540_10033433 216
138 3300006028 Ga0070717_10189664 Ga0070717_101896642 216
139 3300006038 Ga0075365_10001359 Ga0075365_1000135912 216
140 3300006163 Ga0070715_10113237 Ga0070715_101132372 216
141 3300006195 Ga0075366_10056646 Ga0075366_100566462 216
142 3300006237 Ga0097621_100463884 Ga0097621_1004638841 216
143 3300006852 Ga0075433_10086392 Ga0075433_100863923 216
144 3300006871 Ga0075434_100116001 Ga0075434_1001160013 216
145 3300006881 Ga0068865_100203962 Ga0068865_1002039621 216
146 3300006914 Ga0075436_100202613 Ga0075436_1002026132 216
147 3300006931 Ga0097620_100130968 Ga0097620_1001309682 216
148 3300007076 Ga0075435_100171625 Ga0075435_1001716252 216
149 3300009094 Ga0111539_10130687 Ga0111539_101306873 216
150 3300009174 Ga0105241_10325777 Ga0105241_103257772 216
151 3300009177 Ga0105248_10024110 Ga0105248_100241106 216
152 3300013104 Ga0157370_10126008 Ga0157370_101260082 216
153 3300013297 Ga0157378_10084666 Ga0157378_100846663 216
154 3300013306 Ga0163162_10437877 Ga0163162_104378772 216
155 3300025906 Ga0207699_10326631 Ga0207699_103266311 216
156 3300025906 Ga0207699_10446266 Ga0207699_104462661 216
157 3300025912 Ga0207707_10060719 Ga0207707_100607192 216
158 3300025912 Ga0207707_10363668 Ga0207707_103636681 216
159 3300025915 Ga0207693_10083746 Ga0207693_100837463 216
160 3300025916 Ga0207663_10089420 Ga0207663_100894202 216
161 3300025921 Ga0207652_10308290 Ga0207652_103082902 216
162 3300025921 Ga0207652_10562239 Ga0207652_105622392 216
163 3300025928 Ga0207700_10033806 Ga0207700_100338064 216
164 3300025934 Ga0207686_10181464 Ga0207686_101814642 216
165 3300025937 Ga0207669_10247152 Ga0207669_102471521 216
166 3300025938 Ga0207704_10166503 Ga0207704_101665031 216
167 3300025939 Ga0207665_10104873 Ga0207665_101048732 216
168 3300025941 Ga0207711_10013853 Ga0207711_100138536 216
169 3300025949 Ga0207667_10401627 Ga0207667_104016272 216
170 3300025961 Ga0207712_10258379 Ga0207712_102583792 216
171 3300025986 Ga0207658_10204159 Ga0207658_102041591 216
172 3300026067 Ga0207678_10024906 Ga0207678_100249066 216
173 3300026089 Ga0207648_10040324 Ga0207648_100403242 216
174 3300026095 Ga0207676_10070676 Ga0207676_100706762 216
175 3300028381 Ga0268264_10529318 Ga0268264_105293182 216
176 3300028800 Ga0265338_10217329 Ga0265338_102173291 216
177 3300031241 Ga0265325_10000162 Ga0265325_1000016240 216
178 3300031249 Ga0265339_10064128 Ga0265339_100641283 216
179 3300031548 Ga0307408_100416972 Ga0307408_1004169722 216
180 3300031595 Ga0265313_10044247 Ga0265313_100442471 216
181 3300032004 Ga0307414_10454691 Ga0307414_104546912 216
182 3300035083 Ga0373926_0013371 Ga0373926_0013371_1698_2423 216
183 3300035089 Ga0373944_0077766 Ga0373944_0077766_147_872 216
184 3300035092 Ga0373952_0044723 Ga0373952_0044723_85_810 216
185 3300035112 Ga0373932_0115549 Ga0373932_0115549_101_826 216
186 3300035114 Ga0373939_0069833 Ga0373939_0069833_276_1001 216
187 3300035116 Ga0373945_0043837 Ga0373945_0043837_820_1545 216
188 3300035118 Ga0373954_0130741 Ga0373954_0130741_168_893 216
189 3300035119 Ga0373956_0012834 Ga0373956_0012834_2318_3043 216
190 3300035170 Ga0373943_0169117 Ga0373943_0169117_31_756 216
191 3300035171 Ga0373946_0047849 Ga0373946_0047849_791_1516 216
192 3300035172 Ga0373955_0026576 Ga0373955_0026576_298_1023 216
193 3300035172 Ga0373955_0053551 Ga0373955_0053551_793_1518 216
194 3300035241 Ga0373961_0004207 Ga0373961_0004207_187_912 216
195 3300035691 Ga0373931_0009777 Ga0373931_0009777_2003_2728 216
196 3300035691 Ga0373931_0109768 Ga0373931_0109768_274_999 216
197 3300035691 Ga0373931_0217475 Ga0373931_0217475_332_1057 216
198 3300035724 Ga0373933_0007091 Ga0373933_0007091_5327_6052 216
199 3300035724 Ga0373933_0134085 Ga0373933_0134085_558_1283 216
200 3300035725 Ga0373947_0134997 Ga0373947_0134997_248_973 216
201 3300036401 Ga0373937_0017483 Ga0373937_0017483_1993_2718 216
202 3300036401 Ga0373937_0041928 Ga0373937_0041928_1774_2499 216
203 3300036401 Ga0373937_0078240 Ga0373937_0078240_1751_2476 216
204 3300037068 Ga0373925_0076180 Ga0373925_0076180_656_1381 216
205 3300039062 Ga0400483_057704 Ga0400483_057704_820_1545 216
206 3300039062 Ga0400483_185859 Ga0400483_185859_1364_2089 216
207 3300039062 Ga0400483_228929 Ga0400483_228929_21793_22518 216
208 3300039437 Ga0436365_0563707 Ga0436365_0563707_213_950 216
209 3300046454 Ga0495592_0114599 Ga0495592_0114599_858_1583 216
210 3300046454 Ga0495592_0204443 Ga0495592_0204443_248_973 216
211 3300046455 Ga0495603_0227915 Ga0495603_0227915_321_1046 216
212 3300046459 Ga0495629_0102696 Ga0495629_0102696_996_1721 216
213 3300046461 Ga0495641_0042091 Ga0495641_0042091_1382_2107 216
214 3300046462 Ga0495651_0144049 Ga0495651_0144049_113_838 216
215 3300046474 Ga0495605_0219105 Ga0495605_0219105_11_736 216
216 3300046475 Ga0495639_0024480 Ga0495639_0024480_1462_2187 216
217 3300046477 Ga0495664_0102269 Ga0495664_0102269_135_860 216
218 3300046516 Ga0495628_0011369 Ga0495628_0011369_2017_2742 216
219 3300046516 Ga0495628_0052125 Ga0495628_0052125_1062_1787 216
220 3300046526 Ga0495666_0036055 Ga0495666_0036055_261_986 216
221 3300046529 Ga0495652_0002263 Ga0495652_0002263_10098_10823 216
222 3300046531 Ga0495665_0226647 Ga0495665_0226647_182_907 216
223 3300046533 Ga0495640_0023878 Ga0495640_0023878_2296_3021 216
224 3300046533 Ga0495640_0109377 Ga0495640_0109377_184_909 216
225 3300046536 Ga0495587_0110028 Ga0495587_0110028_807_1532 216
226 3300046543 Ga0495645_0004817 Ga0495645_0004817_7269_7994 216
227 3300046543 Ga0495645_0087084 Ga0495645_0087084_921_1646 216
228 3300046559 Ga0495667_0083496 Ga0495667_0083496_673_1398 216
229 3300046642 Ga0495634_0353951 Ga0495634_0353951_128_853 216
230 3300046663 Ga0495635_0018165 Ga0495635_0018165_2787_3512 216
231 3300046663 Ga0495635_0020590 Ga0495635_0020590_2886_3611 216
232 3300046663 Ga0495635_0405216 Ga0495635_0405216_125_850 216
233 3300046675 Ga0495657_0034710 Ga0495657_0034710_2475_3200 216
234 3300046675 Ga0495657_0306561 Ga0495657_0306561_193_918 216
235 3300046678 Ga0495599_0024129 Ga0495599_0024129_1163_1888 216
236 3300046679 Ga0495623_0003236 Ga0495623_0003236_182_907 216
237 3300046681 Ga0495647_0039384 Ga0495647_0039384_1018_1743 216
238 3300046681 Ga0495647_0103155 Ga0495647_0103155_133_858 216
239 3300046809 Ga0495600_0049453 Ga0495600_0049453_772_1497 216
240 3300046809 Ga0495600_0281681 Ga0495600_0281681_192_917 216
241 3300047317 Ga0495604_0005468 Ga0495604_0005468_2601_3326 216
242 3300047317 Ga0495604_0077274 Ga0495604_0077274_1753_2478 216
243 3300047319 Ga0495674_0018921 Ga0495674_0018921_4532_5257 216
244 3300047319 Ga0495674_0102023 Ga0495674_0102023_140_865 216
245 3300047319 Ga0495674_0308239 Ga0495674_0308239_184_909 216
246 3300047321 Ga0495676_0114954 Ga0495676_0114954_1100_1825 216
247 3300047322 Ga0495680_0016511 Ga0495680_0016511_3526_4251 216
248 3300047322 Ga0495680_0142257 Ga0495680_0142257_469_1194 216
249 3300047322 Ga0495680_0350950 Ga0495680_0350950_167_892 216
250 3300047471 Ga0495684_0059336 Ga0495684_0059336_865_1590 216
251 3300047673 Ga0495593_0154447 Ga0495593_0154447_290_1015 216
252 3300048088 Ga0495602_0014643 Ga0495602_0014643_4757_5482 216
253 3300048089 Ga0495614_0147956 Ga0495614_0147956_67_792 216
254 3300048903 Ga0496100_0001589 Ga0496100_0001589_9252_9977 216
255 3300048904 Ga0496101_0009861 Ga0496101_0009861_555_1280 216
256 3300048904 Ga0496101_0057632 Ga0496101_0057632_1463_2188 216
257 3300048904 Ga0496101_0363146 Ga0496101_0363146_260_985 216
258 3300048905 Ga0496102_0294986 Ga0496102_0294986_725_1450 216
259 3300048905 Ga0496102_0343096 Ga0496102_0343096_97_822 216
260 3300048906 Ga0496103_0112598 Ga0496103_0112598_175_900 216
261 3300048907 Ga0496104_0000311 Ga0496104_0000311_17361_18086 216
262 3300048907 Ga0496104_0129894 Ga0496104_0129894_941_1666 216
263 3300048907 Ga0496104_0406085 Ga0496104_0406085_487_1212 216
264 3300048908 Ga0496105_0014977 Ga0496105_0014977_1341_2066 216
265 3300048908 Ga0496105_0080525 Ga0496105_0080525_662_1387 216
266 3300048908 Ga0496105_0091271 Ga0496105_0091271_1463_2188 216
267 3300048910 Ga0496107_0043194 Ga0496107_0043194_719_1444 216
268 3300048910 Ga0496107_0147874 Ga0496107_0147874_507_1232 216
269 3300048911 Ga0496108_0044300 Ga0496108_0044300_546_1271 216
270 3300048913 Ga0496110_0014478 Ga0496110_0014478_2593_3318 216
271 3300048914 Ga0496111_0066041 Ga0496111_0066041_425_1150 216
272 3300048915 Ga0496112_0007190 Ga0496112_0007190_7072_7797 216
273 3300048915 Ga0496112_0062681 Ga0496112_0062681_1799_2524 216
274 3300048917 Ga0496114_0090001 Ga0496114_0090001_140_865 216
275 3300048918 Ga0496115_0029287 Ga0496115_0029287_3552_4277 216
276 3300048918 Ga0496115_0050532 Ga0496115_0050532_1539_2264 216
277 3300049571 Ga0501034_0049808 Ga0501034_0049808_2567_3283 216
278 3300049575 Ga0501039_0292085 Ga0501039_0292085_237_962 216
279 3300049577 Ga0501041_0341204 Ga0501041_0341204_123_848 216
280 3300049582 Ga0501048_0419858 Ga0501048_0419858_76_801 216
281 3300049587 Ga0501071_0114814 Ga0501071_0114814_943_1668 216
282 3300049588 Ga0501072_0390934 Ga0501072_0390934_155_880 216
283 3300049589 Ga0501073_0089648 Ga0501073_0089648_1308_2024 216
284 3300049591 Ga0501075_0116511 Ga0501075_0116511_704_1429 216
285 3300049591 Ga0501075_0118558 Ga0501075_0118558_284_1009 216
286 3300049592 Ga0501076_0154071 Ga0501076_0154071_304_1029 216
287 3300049741 Ga0501079_0087366 Ga0501079_0087366_1316_2041 216
288 3300049741 Ga0501079_0279845 Ga0501079_0279845_109_834 216
289 3300049824 Ga0501045_0495086 Ga0501045_0495086_152_877 216
290 3300050492 nmdc:mga0yw44_6325_c1 nmdc:mga0yw44_6325_c1_149_874 216
291 3300050493 nmdc:mga0k408_10105_c1 nmdc:mga0k408_10105_c1_3135_3860 216
292 3300050493 nmdc:mga0k408_11707_c1 nmdc:mga0k408_11707_c1_430_1155 216
293 3300050494 nmdc:mga06z11_200658_c1 nmdc:mga06z11_200658_c1_338_1063 216
294 3300050496 nmdc:mga07m45_33236_c1 nmdc:mga07m45_33236_c1_1934_2659 216
295 3300050512 nmdc:mga0n895_173354_c1 nmdc:mga0n895_173354_c1_390_1115 216
296 3300050513 nmdc:mga0rr50_132364_c1 nmdc:mga0rr50_132364_c1_466_1191 216
297 3300050515 nmdc:mga0a205_27393_c1 nmdc:mga0a205_27393_c1_1172_1897 216
298 3300053077 Ga0495601_0000436 Ga0495601_0000436_8466_9191 216
299 3300053077 Ga0495601_0000441 Ga0495601_0000441_645_1370 216
300 3300053077 Ga0495601_0001594 Ga0495601_0001594_7542_8267 216
301 3300053078 Ga0495612_0000238 Ga0495612_0000238_13301_14026 216
302 3300053078 Ga0495612_0007090 Ga0495612_0007090_74_799 216
303 3300053078 Ga0495612_0022460 Ga0495612_0022460_1252_1977 216
304 3300053084 Ga0495595_0005043 Ga0495595_0005043_1169_1894 216
305 3300053084 Ga0495595_0016582 Ga0495595_0016582_558_1283 216
306 3300053084 Ga0495595_0037977 Ga0495595_0037977_107_832 216
307 3300053085 Ga0495619_0000063 Ga0495619_0000063_11835_12560 216
308 3300053085 Ga0495619_0004091 Ga0495619_0004091_6780_7505 216
309 3300053085 Ga0495619_0029031 Ga0495619_0029031_1221_1946 216
310 3300053085 Ga0495619_0072135 Ga0495619_0072135_769_1494 216
311 3300053117 Ga0500593_018097 Ga0500593_018097_37_762 216
312 3300054114 Ga0501084_0361279 Ga0501084_0361279_305_1030 216
313 3300054114 Ga0501084_0813697 Ga0501084_0813697_25_750 216
314 3300060353 Ga0501082_0226635 Ga0501082_0226635_32_757 216
315 3300061734 Ga0530510_0083357 Ga0530510_0083357_1145_1870 216
316 3300061734 Ga0530510_0112341 Ga0530510_0112341_1106_1831 216
317 3300061734 Ga0530510_0258438 Ga0530510_0258438_336_1061 216
318 iso_pu_bacteria 2829745981 2829746079 216
319 3300002239 JGI24034J26672_10034825 JGI24034J26672_100348251 217
320 3300005327 Ga0070658_10006314 Ga0070658_100063146 217
321 3300005328 Ga0070676_10014503 Ga0070676_100145035 217
322 3300005329 Ga0070683_100048470 Ga0070683_1000484702 217
323 3300005329 Ga0070683_100298148 Ga0070683_1002981483 217
324 3300005330 Ga0070690_100098133 Ga0070690_1000981334 217
325 3300005334 Ga0068869_100042291 Ga0068869_1000422913 217
326 3300005335 Ga0070666_10083329 Ga0070666_100833292 217
327 3300005336 Ga0070680_100002836 Ga0070680_10000283611 217
328 3300005339 Ga0070660_100029666 Ga0070660_1000296662 217
329 3300005339 Ga0070660_100169739 Ga0070660_1001697392 217
330 3300005344 Ga0070661_100065654 Ga0070661_1000656542 217
331 3300005354 Ga0070675_100106888 Ga0070675_1001068882 217
332 3300005355 Ga0070671_100027164 Ga0070671_1000271643 217
333 3300005364 Ga0070673_100046607 Ga0070673_1000466072 217
334 3300005365 Ga0070688_100007841 Ga0070688_1000078414 217
335 3300005367 Ga0070667_100014555 Ga0070667_1000145551 217
336 3300005434 Ga0070709_10013751 Ga0070709_100137513 217
337 3300005435 Ga0070714_100122525 Ga0070714_1001225252 217
338 3300005436 Ga0070713_100017477 Ga0070713_1000174775 217
339 3300005436 Ga0070713_100179817 Ga0070713_1001798172 217
340 3300005437 Ga0070710_10047902 Ga0070710_100479023 217
341 3300005438 Ga0070701_10033348 Ga0070701_100333483 217
342 3300005439 Ga0070711_100181748 Ga0070711_1001817481 217
343 3300005456 Ga0070678_100072545 Ga0070678_1000725454 217
344 3300005457 Ga0070662_100456839 Ga0070662_1004568391 217
345 3300005458 Ga0070681_10078648 Ga0070681_100786481 217
346 3300005466 Ga0070685_10006441 Ga0070685_100064415 217
347 3300005530 Ga0070679_100042577 Ga0070679_1000425776 217
348 3300005530 Ga0070679_100545260 Ga0070679_1005452602 217
349 3300005539 Ga0068853_100502907 Ga0068853_1005029072 217
350 3300005543 Ga0070672_100798134 Ga0070672_1007981341 217
351 3300005544 Ga0070686_100018983 Ga0070686_1000189832 217
352 3300005547 Ga0070693_100078684 Ga0070693_1000786842 217
353 3300005548 Ga0070665_100609835 Ga0070665_1006098351 217
354 3300005563 Ga0068855_100048582 Ga0068855_1000485825 217
355 3300005563 Ga0068855_100108304 Ga0068855_1001083044 217
356 3300005563 Ga0068855_100157729 Ga0068855_1001577292 217
357 3300005564 Ga0070664_100146232 Ga0070664_1001462323 217
358 3300005577 Ga0068857_100359504 Ga0068857_1003595042 217
359 3300005614 Ga0068856_100318837 Ga0068856_1003188372 217
360 3300005614 Ga0068856_100824585 Ga0068856_1008245852 217
361 3300005616 Ga0068852_100051991 Ga0068852_1000519912 217
362 3300005616 Ga0068852_100052192 Ga0068852_1000521922 217
363 3300005616 Ga0068852_100163143 Ga0068852_1001631432 217
364 3300005617 Ga0068859_100017208 Ga0068859_1000172089 217
365 3300005618 Ga0068864_100037945 Ga0068864_1000379451 217
366 3300005718 Ga0068866_10045382 Ga0068866_100453822 217
367 3300005719 Ga0068861_100053737 Ga0068861_1000537373 217
368 3300005834 Ga0068851_10051665 Ga0068851_100516652 217
369 3300005841 Ga0068863_100017793 Ga0068863_1000177934 217
370 3300005842 Ga0068858_100444807 Ga0068858_1004448071 217
371 3300005843 Ga0068860_100571721 Ga0068860_1005717212 217
372 3300005843 Ga0068860_100728360 Ga0068860_1007283602 217
373 3300005844 Ga0068862_100021405 Ga0068862_1000214055 217
374 3300006028 Ga0070717_10035744 Ga0070717_100357445 217
375 3300006028 Ga0070717_10127131 Ga0070717_101271314 217
376 3300006038 Ga0075365_10002417 Ga0075365_1000241710 217
377 3300006038 Ga0075365_10224602 Ga0075365_102246021 217
378 3300006042 Ga0075368_10099462 Ga0075368_100994622 217
379 3300006051 Ga0075364_10091048 Ga0075364_100910482 217
380 3300006163 Ga0070715_10004118 Ga0070715_100041183 217
381 3300006173 Ga0070716_100003919 Ga0070716_1000039195 217
382 3300006177 Ga0075362_10114499 Ga0075362_101144992 217
383 3300006178 Ga0075367_10213346 Ga0075367_102133462 217
384 3300006195 Ga0075366_10097265 Ga0075366_100972652 217
385 3300006237 Ga0097621_100027391 Ga0097621_1000273912 217
386 3300006353 Ga0075370_10325211 Ga0075370_103252111 217
387 3300006358 Ga0068871_100026947 Ga0068871_1000269475 217
388 3300006881 Ga0068865_100079145 Ga0068865_1000791453 217
389 3300006914 Ga0075436_100002454 Ga0075436_1000024545 217
390 3300006931 Ga0097620_100017208 Ga0097620_1000172082 217
391 3300007076 Ga0075435_100143724 Ga0075435_1001437242 217
392 3300009011 Ga0105251_10036311 Ga0105251_100363112 217
393 3300009098 Ga0105245_10046875 Ga0105245_100468751 217
394 3300009147 Ga0114129_10016241 Ga0114129_100162415 217
395 3300009147 Ga0114129_10586916 Ga0114129_105869162 217
396 3300009148 Ga0105243_10010687 Ga0105243_100106875 217
397 3300009174 Ga0105241_10007122 Ga0105241_100071226 217
398 3300009551 Ga0105238_10027892 Ga0105238_100278925 217
399 3300009551 Ga0105238_10103323 Ga0105238_101033232 217
400 3300012481 Ga0157320_1000901 Ga0157320_10009013 217
401 3300012513 Ga0157326_1004618 Ga0157326_10046182 217
402 3300013102 Ga0157371_10104933 Ga0157371_101049333 217
403 3300013102 Ga0157371_10532723 Ga0157371_105327231 217
404 3300013297 Ga0157378_10031786 Ga0157378_100317863 217
405 3300014745 Ga0157377_10093540 Ga0157377_100935401 217
406 3300017792 Ga0163161_10063750 Ga0163161_100637502 217
407 3300017792 Ga0163161_10696976 Ga0163161_106969761 217
408 3300025297 Ga0209758_1018161 Ga0209758_10181612 217
409 3300025299 Ga0209256_1054962 Ga0209256_10549621 217
410 3300025735 Ga0207713_1034320 Ga0207713_10343202 217
411 3300025898 Ga0207692_10004710 Ga0207692_100047103 217
412 3300025900 Ga0207710_10001892 Ga0207710_100018922 217
413 3300025903 Ga0207680_10031159 Ga0207680_100311593 217
414 3300025904 Ga0207647_10065556 Ga0207647_100655561 217
415 3300025905 Ga0207685_10001418 Ga0207685_100014185 217
416 3300025906 Ga0207699_10011151 Ga0207699_100111515 217
417 3300025907 Ga0207645_10010546 Ga0207645_100105463 217
418 3300025911 Ga0207654_10037526 Ga0207654_100375262 217
419 3300025914 Ga0207671_10057435 Ga0207671_100574351 217
420 3300025915 Ga0207693_10022575 Ga0207693_100225756 217
421 3300025917 Ga0207660_10011260 Ga0207660_100112602 217
422 3300025919 Ga0207657_10015839 Ga0207657_100158396 217
423 3300025919 Ga0207657_10092257 Ga0207657_100922572 217
424 3300025920 Ga0207649_10152002 Ga0207649_101520022 217
425 3300025920 Ga0207649_10307614 Ga0207649_103076141 217
426 3300025921 Ga0207652_10253084 Ga0207652_102530841 217
427 3300025921 Ga0207652_10689166 Ga0207652_106891661 217
428 3300025924 Ga0207694_10024893 Ga0207694_100248935 217
429 3300025925 Ga0207650_10037723 Ga0207650_100377232 217
430 3300025926 Ga0207659_10157313 Ga0207659_101573132 217
431 3300025927 Ga0207687_10019823 Ga0207687_100198235 217
432 3300025928 Ga0207700_10006313 Ga0207700_100063135 217
433 3300025928 Ga0207700_10165505 Ga0207700_101655052 217
434 3300025929 Ga0207664_10018710 Ga0207664_100187103 217
435 3300025929 Ga0207664_10132028 Ga0207664_101320282 217
436 3300025931 Ga0207644_10017503 Ga0207644_100175036 217
437 3300025932 Ga0207690_10091710 Ga0207690_100917102 217
438 3300025934 Ga0207686_10010210 Ga0207686_100102104 217
439 3300025935 Ga0207709_10016990 Ga0207709_100169905 217
440 3300025936 Ga0207670_10076632 Ga0207670_100766324 217
441 3300025937 Ga0207669_10317259 Ga0207669_103172592 217
442 3300025938 Ga0207704_10019430 Ga0207704_100194305 217
443 3300025939 Ga0207665_10000210 Ga0207665_100002109 217
444 3300025940 Ga0207691_10133928 Ga0207691_101339281 217
445 3300025941 Ga0207711_10010865 Ga0207711_100108657 217
446 3300025942 Ga0207689_10012163 Ga0207689_100121635 217
447 3300025942 Ga0207689_10160808 Ga0207689_101608082 217
448 3300025944 Ga0207661_10163247 Ga0207661_101632472 217
449 3300025944 Ga0207661_10266857 Ga0207661_102668572 217
450 3300025945 Ga0207679_10025554 Ga0207679_100255543 217
451 3300025945 Ga0207679_10189976 Ga0207679_101899763 217
452 3300025949 Ga0207667_10186932 Ga0207667_101869322 217
453 3300025960 Ga0207651_10104736 Ga0207651_101047362 217
454 3300025986 Ga0207658_10130185 Ga0207658_101301852 217
455 3300026035 Ga0207703_10248110 Ga0207703_102481103 217
456 3300026067 Ga0207678_10008960 Ga0207678_100089608 217
457 3300026088 Ga0207641_10023568 Ga0207641_100235685 217
458 3300026095 Ga0207676_10009273 Ga0207676_100092733 217
459 3300026116 Ga0207674_10202399 Ga0207674_102023992 217
460 3300026116 Ga0207674_10205934 Ga0207674_102059342 217
461 3300026121 Ga0207683_10008834 Ga0207683_100088345 217
462 3300026142 Ga0207698_10206211 Ga0207698_102062112 217
463 3300026142 Ga0207698_10448262 Ga0207698_104482622 217
464 3300028379 Ga0268266_10016289 Ga0268266_100162896 217
465 3300028380 Ga0268265_10082764 Ga0268265_100827642 217
466 3300028381 Ga0268264_10024794 Ga0268264_100247944 217
467 3300031595 Ga0265313_10009102 Ga0265313_100091023 217
468 3300031595 Ga0265313_10068633 Ga0265313_100686332 217
469 3300031711 Ga0265314_10001560 Ga0265314_100015607 217
470 3300031712 Ga0265342_10000608 Ga0265342_1000060829 217
471 3300035115 Ga0373941_0159112 Ga0373941_0159112_42_767 217
472 3300037312 Ga0395899_0145037 Ga0395899_0145037_353_1078 217
473 3300037418 Ga0395900_0038369 Ga0395900_0038369_772_1497 217
474 3300037418 Ga0395900_0253369 Ga0395900_0253369_61_786 217
475 3300037466 Ga0395898_0002812 Ga0395898_0002812_16975_17700 217
476 3300037466 Ga0395898_0070704 Ga0395898_0070704_12_737 217
477 3300038443 Ga0395901_0318189 Ga0395901_0318189_746_1471 217
478 3300044684 Ga0466966_0049822 Ga0466966_0049822_1605_2330 217
479 3300044693 Ga0466961_0094591 Ga0466961_0094591_235_960 217
480 3300044719 Ga0466971_0054028 Ga0466971_0054028_305_1030 217
481 3300044842 Ga0466957_0008064 Ga0466957_0008064_4770_5495 217
482 3300045049 Ga0466959_0021717 Ga0466959_0021717_3222_3947 217
483 3300045836 Ga0466958_0060091 Ga0466958_0060091_582_1307 217
484 3300046475 Ga0495639_0028611 Ga0495639_0028611_160_879 217
485 3300046516 Ga0495628_0022925 Ga0495628_0022925_3754_4530 217
486 3300048903 Ga0496100_0169109 Ga0496100_0169109_33_758 217
487 3300048904 Ga0496101_0241609 Ga0496101_0241609_192_917 217
488 3300048905 Ga0496102_0058140 Ga0496102_0058140_1830_2555 217
489 3300048906 Ga0496103_0044117 Ga0496103_0044117_192_917 217
490 3300048909 Ga0496106_0032219 Ga0496106_0032219_1821_2546 217
491 3300048910 Ga0496107_0053037 Ga0496107_0053037_1362_2087 217
492 3300048911 Ga0496108_0086659 Ga0496108_0086659_1279_2004 217
493 3300048913 Ga0496110_0140581 Ga0496110_0140581_645_1370 217
494 3300048915 Ga0496112_0152444 Ga0496112_0152444_539_1264 217
495 3300048916 Ga0496113_0047215 Ga0496113_0047215_645_1370 217
496 3300048917 Ga0496114_0034874 Ga0496114_0034874_1599_2324 217
497 3300048918 Ga0496115_0015333 Ga0496115_0015333_1005_1730 217
498 3300048922 Ga0496119_0120375 Ga0496119_0120375_54_779 217
499 3300048923 Ga0496120_0248603 Ga0496120_0248603_92_817 217
500 3300048929 Ga0496126_0089178 Ga0496126_0089178_1072_1800 217
501 3300049581 Ga0501047_0040982 Ga0501047_0040982_1704_2429 217
502 3300049586 Ga0501070_0058997 Ga0501070_0058997_812_1537 217
503 3300049822 Ga0501035_0175644 Ga0501035_0175644_1033_1758 217
504 3300049823 Ga0501044_0140143 Ga0501044_0140143_1661_2386 217
505 3300049823 Ga0501044_0267882 Ga0501044_0267882_843_1568 217
506 3300050492 nmdc:mga0yw44_1172_c1 nmdc:mga0yw44_1172_c1_2985_3713 217
507 3300050496 nmdc:mga07m45_325344_c1 nmdc:mga07m45_325344_c1_11_736 217
508 3300050507 nmdc:mga05p37_448459_c1 nmdc:mga05p37_448459_c1_512_1237 217
509 3300050511 nmdc:mga08y16_184340_c1 nmdc:mga08y16_184340_c1_368_1093 217
510 3300050514 nmdc:mga08x19_1357_c1 nmdc:mga08x19_1357_c1_8307_9032 217
511 3300053096 Ga0500641_0004747 Ga0500641_0004747_3844_4569 217
512 3300053153 Ga0500616_0056025 Ga0500616_0056025_1133_1858 217
513 3300053153 Ga0500616_0077655 Ga0500616_0077655_106_933 217
514 3300061719 Ga0466962_0169587 Ga0466962_0169587_220_945 217
515 3300005343 Ga0070687_100006984 Ga0070687_1000069847 218
516 3300005366 Ga0070659_100054380 Ga0070659_1000543802 218
517 3300005436 Ga0070713_100101051 Ga0070713_1001010512 218
518 3300005466 Ga0070685_10003855 Ga0070685_100038558 218
519 3300005471 Ga0070698_100138896 Ga0070698_1001388963 218
520 3300005546 Ga0070696_100129398 Ga0070696_1001293981 218
521 3300005615 Ga0070702_100483937 Ga0070702_1004839371 218
522 3300005937 Ga0081455_10001108 Ga0081455_1000110811 218
523 3300006028 Ga0070717_10080726 Ga0070717_100807261 218
524 3300006051 Ga0075364_10158611 Ga0075364_101586111 218
525 3300006163 Ga0070715_10331504 Ga0070715_103315041 218
526 3300006844 Ga0075428_100037884 Ga0075428_1000378842 218
527 3300006847 Ga0075431_100358218 Ga0075431_1003582182 218
528 3300006871 Ga0075434_100064484 Ga0075434_1000644843 218
529 3300009094 Ga0111539_10336041 Ga0111539_103360413 218
530 3300009147 Ga0114129_10040156 Ga0114129_100401564 218
531 3300021361 Ga0213872_10000703 Ga0213872_100007035 218
532 3300021384 Ga0213876_10006896 Ga0213876_100068968 218
533 3300024227 Ga0228598_1000875 Ga0228598_10008756 218
534 3300025302 Ga0207426_1065481 Ga0207426_10654811 218
535 3300026118 Ga0207675_100031108 Ga0207675_1000311086 218
536 3300027695 Ga0209966_1000738 Ga0209966_10007383 218
537 3300027907 Ga0207428_10099113 Ga0207428_100991133 218
538 3300031247 Ga0265340_10039855 Ga0265340_100398553 218
539 3300031251 Ga0265327_10000496 Ga0265327_1000049640 218
540 3300031507 Ga0307509_10001262 Ga0307509_1000126224 218
541 3300035086 Ga0373934_0079627 Ga0373934_0079627_270_995 218
542 3300035118 Ga0373954_0052525 Ga0373954_0052525_506_1231 218
543 3300035172 Ga0373955_0221682 Ga0373955_0221682_199_924 218
544 3300035724 Ga0373933_0039115 Ga0373933_0039115_334_1059 218
545 3300036401 Ga0373937_0014589 Ga0373937_0014589_1590_2315 218
546 3300037312 Ga0395899_0424030 Ga0395899_0424030_79_804 218
547 3300037418 Ga0395900_0075666 Ga0395900_0075666_991_1713 218
548 3300037418 Ga0395900_0087040 Ga0395900_0087040_1352_2077 218
549 3300037466 Ga0395898_0440497 Ga0395898_0440497_445_1167 218
550 3300037471 Ga0395905_0053222 Ga0395905_0053222_460_1182 218
551 3300037853 Ga0436364_0143493 Ga0436364_0143493_14_736 218
552 3300038443 Ga0395901_0091577 Ga0395901_0091577_2108_2830 218
553 3300039437 Ga0436365_0382338 Ga0436365_0382338_104_889 218
554 3300039437 Ga0436365_0414414 Ga0436365_0414414_22846_23571 218
555 3300039447 Ga0436361_0492958 Ga0436361_0492958_3450_4172 218
556 3300041411 Ga0439466_0061186 Ga0439466_0061186_361_1083 218
557 3300041413 Ga0439465_0013151 Ga0439465_0013151_1087_1809 218
558 3300041413 Ga0439465_0090364 Ga0439465_0090364_276_998 218
559 3300044706 Ga0466964_0094272 Ga0466964_0094272_241_972 218
560 3300044712 Ga0453684_0005046 Ga0453684_0005046_7963_8706 218
561 3300045976 Ga0466967_0031475 Ga0466967_0031475_1801_2526 218
562 3300046454 Ga0495592_0080782 Ga0495592_0080782_1084_1809 218
563 3300046463 Ga0495653_0096589 Ga0495653_0096589_456_1181 218
564 3300046511 Ga0495608_0094658 Ga0495608_0094658_184_909 218
565 3300046536 Ga0495587_0018878 Ga0495587_0018878_846_1571 218
566 3300046543 Ga0495645_0152759 Ga0495645_0152759_169_894 218
567 3300046642 Ga0495634_0306465 Ga0495634_0306465_94_819 218
568 3300046679 Ga0495623_0061099 Ga0495623_0061099_548_1273 218
569 3300046680 Ga0495646_0120946 Ga0495646_0120946_374_1099 218
570 3300047317 Ga0495604_0024793 Ga0495604_0024793_3602_4327 218
571 3300047320 Ga0495672_0046593 Ga0495672_0046593_541_1266 218
572 3300047322 Ga0495680_0081464 Ga0495680_0081464_34_759 218
573 3300047444 Ga0495675_0377683 Ga0495675_0377683_53_778 218
574 3300048088 Ga0495602_0024310 Ga0495602_0024310_3212_3937 218
575 3300048903 Ga0496100_0010967 Ga0496100_0010967_1956_2681 218
576 3300048905 Ga0496102_0038711 Ga0496102_0038711_2826_3551 218
577 3300048906 Ga0496103_0194201 Ga0496103_0194201_285_1010 218
578 3300048907 Ga0496104_0009349 Ga0496104_0009349_317_1042 218
579 3300048907 Ga0496104_0013664 Ga0496104_0013664_711_1472 218
580 3300048908 Ga0496105_0006002 Ga0496105_0006002_6154_6915 218
581 3300048909 Ga0496106_0003164 Ga0496106_0003164_6279_7004 218
582 3300048910 Ga0496107_0005584 Ga0496107_0005584_4752_5477 218
583 3300048911 Ga0496108_0010630 Ga0496108_0010630_4924_5649 218
584 3300048912 Ga0496109_0505388 Ga0496109_0505388_216_977 218
585 3300048912 Ga0496109_0921889 Ga0496109_0921889_18_743 218
586 3300048913 Ga0496110_0007488 Ga0496110_0007488_2576_3301 218
587 3300048913 Ga0496110_0175536 Ga0496110_0175536_723_1448 218
588 3300048915 Ga0496112_0060353 Ga0496112_0060353_2978_3703 218
589 3300048915 Ga0496112_0443252 Ga0496112_0443252_383_1108 218
590 3300049568 Ga0501031_0002030 Ga0501031_0002030_7834_8556 218
591 3300049569 Ga0501032_0000074 Ga0501032_0000074_27845_28567 218
592 3300049569 Ga0501032_0108696 Ga0501032_0108696_1057_1782 218
593 3300049570 Ga0501033_0000796 Ga0501033_0000796_22653_23375 218
594 3300049571 Ga0501034_0000249 Ga0501034_0000249_41646_42368 218
595 3300049571 Ga0501034_0000436 Ga0501034_0000436_7183_7908 218
596 3300049571 Ga0501034_0003203 Ga0501034_0003203_9527_10252 218
597 3300049572 Ga0501036_0000472 Ga0501036_0000472_22704_23426 218
598 3300049572 Ga0501036_0002786 Ga0501036_0002786_6353_7078 218
599 3300049572 Ga0501036_0052535 Ga0501036_0052535_1452_2177 218
600 3300049573 Ga0501037_0000129 Ga0501037_0000129_12982_13704 218
601 3300049573 Ga0501037_0003344 Ga0501037_0003344_1450_2175 218
602 3300049573 Ga0501037_0041626 Ga0501037_0041626_607_1332 218
603 3300049574 Ga0501038_0000202 Ga0501038_0000202_22535_23257 218
604 3300049574 Ga0501038_0009422 Ga0501038_0009422_3505_4230 218
605 3300049575 Ga0501039_0000027 Ga0501039_0000027_126943_127665 218
606 3300049577 Ga0501041_0076719 Ga0501041_0076719_1026_1748 218
607 3300049579 Ga0501043_0000047 Ga0501043_0000047_53255_53977 218
608 3300049580 Ga0501046_0038661 Ga0501046_0038661_2740_3462 218
609 3300049581 Ga0501047_0000384 Ga0501047_0000384_14783_15508 218
610 3300049581 Ga0501047_0050031 Ga0501047_0050031_1716_2441 218
611 3300049581 Ga0501047_0081713 Ga0501047_0081713_2122_2847 218
612 3300049582 Ga0501048_0000074 Ga0501048_0000074_35019_35744 218
613 3300049586 Ga0501070_0006228 Ga0501070_0006228_3235_3960 218
614 3300049589 Ga0501073_0010194 Ga0501073_0010194_4264_4989 218
615 3300049589 Ga0501073_0047630 Ga0501073_0047630_1113_1838 218
616 3300049742 Ga0501080_0001148 Ga0501080_0001148_6246_6971 218
617 3300049742 Ga0501080_0026165 Ga0501080_0026165_159_884 218
618 3300049744 Ga0501083_0003658 Ga0501083_0003658_4789_5544 218
619 3300049822 Ga0501035_0000132 Ga0501035_0000132_22543_23265 218
620 3300049823 Ga0501044_0010183 Ga0501044_0010183_7686_8408 218
621 3300049823 Ga0501044_0017087 Ga0501044_0017087_1862_2587 218
622 3300049824 Ga0501045_0165728 Ga0501045_0165728_849_1604 218
623 3300050507 nmdc:mga05p37_10714_c1 nmdc:mga05p37_10714_c1_1981_2706 218
624 3300050507 nmdc:mga05p37_17777_c1 nmdc:mga05p37_17777_c1_4711_5436 218
625 3300050507 nmdc:mga05p37_561174_c1 nmdc:mga05p37_561174_c1_288_1013 218
626 3300050510 nmdc:mga06r32_92563_c1 nmdc:mga06r32_92563_c1_303_1028 218
627 3300050511 nmdc:mga08y16_313456_c1 nmdc:mga08y16_313456_c1_336_1061 218
628 3300050512 nmdc:mga0n895_61493_c1 nmdc:mga0n895_61493_c1_1243_1968 218
629 3300050513 nmdc:mga0rr50_452107_c1 nmdc:mga0rr50_452107_c1_341_1066 218
630 3300050515 nmdc:mga0a205_26885_c1 nmdc:mga0a205_26885_c1_2254_2979 218
631 3300053087 Ga0500643_010715 Ga0500643_010715_530_1252 218
632 3300053130 Ga0500642_0069863 Ga0500642_0069863_214_936 218
633 3300053730 Ga0500645_000592 Ga0500645_000592_17723_18448 218
634 3300060353 Ga0501082_0000510 Ga0501082_0000510_1026_1751 218
635 3300060353 Ga0501082_0617968 Ga0501082_0617968_16_741 218
636 3300000041 ARcpr5oldR_c000003 ARcpr5oldR_00000344 219
637 3300000042 ARSoilYngRDRAFT_c00037 ARSoilYngRDRAFT_0003721 219
638 3300000043 ARcpr5yngRDRAFT_c000010 ARcpr5yngRDRAFT_00001025 219
639 3300000044 ARSoilOldRDRAFT_c000114 ARSoilOldRDRAFT_0001146 219
640 3300000044 ARSoilOldRDRAFT_c002000 ARSoilOldRDRAFT_0020002 219
641 3300000045 ARCol0oldRDRAFT_c00094 ARCol0oldRDRAFT_000946 219
642 3300000652 ARCol0yngRDRAFT_1000202 ARCol0yngRDRAFT_10002025 219
643 3300002076 JGI24749J21850_1004353 JGI24749J21850_10043533 219
644 3300002739 JGI25158J39367_1004631 JGI25158J39367_10046312 219
645 3300002774 JGI25150J39212_1000171 JGI25150J39212_100017125 219
646 3300002774 JGI25150J39212_1000433 JGI25150J39212_100043312 219
647 3300002987 JGI25159J45721_1000017 JGI25159J45721_100001751 219
648 3300003187 JGI25151J46595_10000034 JGI25151J46595_1000003425 219
649 3300003187 JGI25151J46595_10008877 JGI25151J46595_100088775 219
650 3300003187 JGI25151J46595_10009621 JGI25151J46595_100096215 219
651 3300003215 JGI25153J46596_10000673 JGI25153J46596_100006734 219
652 3300003215 JGI25153J46596_10011382 JGI25153J46596_100113826 219
653 3300003354 JGI25160J50197_1000027 JGI25160J50197_1000027131 219
654 3300003374 JGI25161J50226_1000160 JGI25161J50226_10001608 219
655 3300003775 Ga0055524_1000782 Ga0055524_10007822 219
656 3300003781 Ga0055536_1000711 Ga0055536_100071118 219
657 3300003791 Ga0055530_10019826 Ga0055530_100198261 219
658 3300003794 Ga0055531_10010747 Ga0055531_100107471 219
659 3300004625 Ga0055543_1000030 Ga0055543_1000030139 219
660 3300005262 Ga0065165_1000122 Ga0065165_100012251 219
661 3300005289 Ga0065704_10073674 Ga0065704_100736745 219
662 3300005290 Ga0065712_10009067 Ga0065712_100090674 219
663 3300005290 Ga0065712_10078443 Ga0065712_100784431 219
664 3300005295 Ga0065707_10150122 Ga0065707_101501222 219
665 3300005327 Ga0070658_10288976 Ga0070658_102889761 219
666 3300005330 Ga0070690_100179140 Ga0070690_1001791403 219
667 3300005331 Ga0070670_100057539 Ga0070670_1000575395 219
668 3300005336 Ga0070680_100043291 Ga0070680_1000432916 219
669 3300005336 Ga0070680_100262573 Ga0070680_1002625732 219
670 3300005339 Ga0070660_100013941 Ga0070660_1000139414 219
671 3300005343 Ga0070687_100063265 Ga0070687_1000632652 219
672 3300005344 Ga0070661_100276399 Ga0070661_1002763992 219
673 3300005347 Ga0070668_100605437 Ga0070668_1006054371 219
674 3300005353 Ga0070669_100143324 Ga0070669_1001433243 219
675 3300005354 Ga0070675_100118472 Ga0070675_1001184723 219
676 3300005354 Ga0070675_100167573 Ga0070675_1001675731 219
677 3300005354 Ga0070675_100299740 Ga0070675_1002997402 219
678 3300005354 Ga0070675_100526022 Ga0070675_1005260221 219
679 3300005355 Ga0070671_100039483 Ga0070671_1000394834 219
680 3300005356 Ga0070674_100013309 Ga0070674_1000133092 219
681 3300005356 Ga0070674_100097334 Ga0070674_1000973343 219
682 3300005364 Ga0070673_100016812 Ga0070673_1000168126 219
683 3300005364 Ga0070673_100067712 Ga0070673_1000677122 219
684 3300005366 Ga0070659_100236030 Ga0070659_1002360302 219
685 3300005367 Ga0070667_100275292 Ga0070667_1002752923 219
686 3300005435 Ga0070714_100081920 Ga0070714_1000819203 219
687 3300005435 Ga0070714_100681979 Ga0070714_1006819791 219
688 3300005436 Ga0070713_100037681 Ga0070713_1000376814 219
689 3300005436 Ga0070713_100115215 Ga0070713_1001152153 219
690 3300005437 Ga0070710_10021576 Ga0070710_100215762 219
691 3300005437 Ga0070710_10334790 Ga0070710_103347901 219
692 3300005437 Ga0070710_10409533 Ga0070710_104095331 219
693 3300005438 Ga0070701_10019213 Ga0070701_100192135 219
694 3300005439 Ga0070711_100088519 Ga0070711_1000885192 219
695 3300005440 Ga0070705_100054445 Ga0070705_1000544452 219
696 3300005440 Ga0070705_100381993 Ga0070705_1003819932 219
697 3300005441 Ga0070700_100178583 Ga0070700_1001785832 219
698 3300005445 Ga0070708_100026124 Ga0070708_1000261244 219
699 3300005455 Ga0070663_100098827 Ga0070663_1000988272 219
700 3300005456 Ga0070678_100239338 Ga0070678_1002393381 219
701 3300005457 Ga0070662_100037740 Ga0070662_1000377403 219
702 3300005457 Ga0070662_100143904 Ga0070662_1001439043 219
703 3300005459 Ga0068867_100070345 Ga0068867_1000703455 219
704 3300005459 Ga0068867_100596314 Ga0068867_1005963141 219
705 3300005466 Ga0070685_10105298 Ga0070685_101052982 219
706 3300005468 Ga0070707_100217959 Ga0070707_1002179593 219
707 3300005518 Ga0070699_100106603 Ga0070699_1001066032 219
708 3300005530 Ga0070679_100221983 Ga0070679_1002219832 219
709 3300005535 Ga0070684_100044013 Ga0070684_1000440133 219
710 3300005536 Ga0070697_100202527 Ga0070697_1002025272 219
711 3300005545 Ga0070695_100404566 Ga0070695_1004045662 219
712 3300005546 Ga0070696_100173830 Ga0070696_1001738302 219
713 3300005547 Ga0070693_100092445 Ga0070693_1000924452 219
714 3300005548 Ga0070665_100006101 Ga0070665_10000610111 219
715 3300005549 Ga0070704_100180226 Ga0070704_1001802262 219
716 3300005563 Ga0068855_100217262 Ga0068855_1002172621 219
717 3300005578 Ga0068854_100331354 Ga0068854_1003313542 219
718 3300005616 Ga0068852_100057208 Ga0068852_1000572087 219
719 3300005617 Ga0068859_100194167 Ga0068859_1001941674 219
720 3300005719 Ga0068861_100007388 Ga0068861_1000073888 219
721 3300005834 Ga0068851_10006192 Ga0068851_100061926 219
722 3300005834 Ga0068851_10181466 Ga0068851_101814662 219
723 3300005840 Ga0068870_10021003 Ga0068870_100210033 219
724 3300005843 Ga0068860_100055931 Ga0068860_1000559311 219
725 3300005844 Ga0068862_100007073 Ga0068862_1000070739 219
726 3300005983 Ga0081540_1017391 Ga0081540_10173913 219
727 3300005983 Ga0081540_1074291 Ga0081540_10742912 219
728 3300006028 Ga0070717_10049830 Ga0070717_100498301 219
729 3300006028 Ga0070717_10056608 Ga0070717_100566082 219
730 3300006028 Ga0070717_10057481 Ga0070717_100574812 219
731 3300006028 Ga0070717_10359769 Ga0070717_103597692 219
732 3300006048 Ga0075363_100038942 Ga0075363_1000389421 219
733 3300006048 Ga0075363_100143393 Ga0075363_1001433933 219
734 3300006048 Ga0075363_100176382 Ga0075363_1001763821 219
735 3300006051 Ga0075364_10220641 Ga0075364_102206411 219
736 3300006051 Ga0075364_10366452 Ga0075364_103664521 219
737 3300006163 Ga0070715_10138731 Ga0070715_101387312 219
738 3300006173 Ga0070716_100027329 Ga0070716_1000273291 219
739 3300006175 Ga0070712_100009184 Ga0070712_1000091842 219
740 3300006178 Ga0075367_10045574 Ga0075367_100455741 219
741 3300006178 Ga0075367_10101821 Ga0075367_101018212 219
742 3300006178 Ga0075367_10190180 Ga0075367_101901802 219
743 3300006186 Ga0075369_10111023 Ga0075369_101110232 219
744 3300006195 Ga0075366_10058954 Ga0075366_100589542 219
745 3300006195 Ga0075366_10297632 Ga0075366_102976321 219
746 3300006353 Ga0075370_10110717 Ga0075370_101107174 219
747 3300006353 Ga0075370_10246794 Ga0075370_102467941 219
748 3300006358 Ga0068871_100155111 Ga0068871_1001551113 219
749 3300006846 Ga0075430_100000387 Ga0075430_10000038728 219
750 3300006846 Ga0075430_100008653 Ga0075430_1000086534 219
751 3300006847 Ga0075431_100201902 Ga0075431_1002019022 219
752 3300006871 Ga0075434_100243841 Ga0075434_1002438412 219
753 3300006871 Ga0075434_100310082 Ga0075434_1003100821 219
754 3300006871 Ga0075434_100455406 Ga0075434_1004554061 219
755 3300006871 Ga0075434_100898291 Ga0075434_1008982912 219
756 3300006881 Ga0068865_100240253 Ga0068865_1002402533 219
757 3300006931 Ga0097620_100194159 Ga0097620_1001941594 219
758 3300006946 Ga0079104_1009515 Ga0079104_10095154 219
759 3300006946 Ga0079104_1010076 Ga0079104_10100764 219
760 3300006948 Ga0099826_10107837 Ga0099826_101078372 219
761 3300007076 Ga0075435_100029369 Ga0075435_1000293691 219
762 3300007076 Ga0075435_100296022 Ga0075435_1002960222 219
763 3300007265 Ga0099794_10007856 Ga0099794_100078562 219
764 3300007788 Ga0099795_10042556 Ga0099795_100425562 219
765 3300009093 Ga0105240_10304316 Ga0105240_103043163 219
766 3300009094 Ga0111539_10001645 Ga0111539_1000164527 219
767 3300009094 Ga0111539_10109798 Ga0111539_101097984 219
768 3300009094 Ga0111539_10503355 Ga0111539_105033552 219
769 3300009147 Ga0114129_10479400 Ga0114129_104794002 219
770 3300009148 Ga0105243_10019915 Ga0105243_100199153 219
771 3300009176 Ga0105242_10028564 Ga0105242_100285642 219
772 3300009176 Ga0105242_10859882 Ga0105242_108598821 219
773 3300009176 Ga0105242_11165972 Ga0105242_111659721 219
774 3300009545 Ga0105237_10051335 Ga0105237_100513356 219
775 3300009553 Ga0105249_10049209 Ga0105249_100492094 219
776 3300009553 Ga0105249_10212603 Ga0105249_102126033 219
777 3300010159 Ga0099796_10000988 Ga0099796_100009886 219
778 3300010375 Ga0105239_10058907 Ga0105239_100589073 219
779 3300012495 Ga0157323_1001518 Ga0157323_10015182 219
780 3300012495 Ga0157323_1005307 Ga0157323_10053072 219
781 3300012507 Ga0157342_1000875 Ga0157342_10008752 219
782 3300013105 Ga0157369_10222684 Ga0157369_102226842 219
783 3300013105 Ga0157369_10380314 Ga0157369_103803142 219
784 3300013297 Ga0157378_10333822 Ga0157378_103338222 219
785 3300013297 Ga0157378_10873672 Ga0157378_108736721 219
786 3300013306 Ga0163162_10178252 Ga0163162_101782524 219
787 3300013306 Ga0163162_10451086 Ga0163162_104510862 219
788 3300013307 Ga0157372_10111381 Ga0157372_101113814 219
789 3300013308 Ga0157375_10138524 Ga0157375_101385243 219
790 3300013308 Ga0157375_10580574 Ga0157375_105805742 219
791 3300014326 Ga0157380_10040992 Ga0157380_100409925 219
792 3300014326 Ga0157380_10323571 Ga0157380_103235712 219
793 3300014969 Ga0157376_10222589 Ga0157376_102225893 219
794 3300015262 Ga0182007_10035892 Ga0182007_100358922 219
795 3300015690 Ga0183363_1290 Ga0183363_12909 219
796 3300021320 Ga0214544_1000087 Ga0214544_100008734 219
797 3300021321 Ga0214542_1000018 Ga0214542_1000018105 219
798 3300021324 Ga0214545_1000009 Ga0214545_100000977 219
799 3300021327 Ga0214543_1000037 Ga0214543_100003796 219
800 3300021361 Ga0213872_10106770 Ga0213872_101067702 219
801 3300021377 Ga0213874_10057809 Ga0213874_100578091 219
802 3300021377 Ga0213874_10068712 Ga0213874_100687121 219
803 3300021377 Ga0213874_10076317 Ga0213874_100763172 219
804 3300021384 Ga0213876_10101221 Ga0213876_101012211 219
805 3300022467 Ga0224712_10059476 Ga0224712_100594762 219
806 3300022739 Ga0228711_1000004 Ga0228711_1000004147 219
807 3300022740 Ga0228710_1000002 Ga0228710_100000296 219
808 3300025208 Ga0209436_101378 Ga0209436_1013782 219
809 3300025233 Ga0209437_111240 Ga0209437_1112402 219
810 3300025245 Ga0207425_1000035 Ga0207425_100003548 219
811 3300025253 Ga0209677_100265 Ga0209677_1002657 219
812 3300025254 Ga0209148_1016880 Ga0209148_10168802 219
813 3300025258 Ga0209129_1000029 Ga0209129_100002948 219
814 3300025261 Ga0209233_1000255 Ga0209233_100025566 219
815 3300025261 Ga0209233_1007650 Ga0209233_10076501 219
816 3300025261 Ga0209233_1015962 Ga0209233_10159622 219
817 3300025272 Ga0209455_1003697 Ga0209455_10036973 219
818 3300025273 Ga0209673_1025959 Ga0209673_10259592 219
819 3300025284 Ga0209130_1000027 Ga0209130_1000027266 219
820 3300025292 Ga0209676_1000956 Ga0209676_100095625 219
821 3300025294 Ga0209025_1000042 Ga0209025_1000042245 219
822 3300025294 Ga0209025_1000132 Ga0209025_1000132158 219
823 3300025294 Ga0209025_1000591 Ga0209025_100059152 219
824 3300025295 Ga0209564_1000193 Ga0209564_10001932 219
825 3300025297 Ga0209758_1000255 Ga0209758_100025555 219
826 3300025297 Ga0209758_1000430 Ga0209758_100043063 219
827 3300025297 Ga0209758_1002586 Ga0209758_100258612 219
828 3300025298 Ga0209050_1000572 Ga0209050_100057257 219
829 3300025299 Ga0209256_1010178 Ga0209256_10101783 219
830 3300025299 Ga0209256_1012263 Ga0209256_10122632 219
831 3300025302 Ga0207426_1000072 Ga0207426_100007250 219
832 3300025302 Ga0207426_1027720 Ga0207426_10277202 219
833 3300025303 Ga0209051_1020024 Ga0209051_10200243 219
834 3300025304 Ga0209257_1001382 Ga0209257_100138218 219
835 3300025315 Ga0207697_10070204 Ga0207697_100702042 219
836 3300025885 Ga0207653_10022402 Ga0207653_100224022 219
837 3300025898 Ga0207692_10022673 Ga0207692_100226731 219
838 3300025898 Ga0207692_10092058 Ga0207692_100920581 219
839 3300025905 Ga0207685_10004693 Ga0207685_100046933 219
840 3300025905 Ga0207685_10227456 Ga0207685_102274561 219
841 3300025908 Ga0207643_10000613 Ga0207643_1000061312 219
842 3300025909 Ga0207705_10048689 Ga0207705_100486892 219
843 3300025909 Ga0207705_10180181 Ga0207705_101801811 219
844 3300025910 Ga0207684_10033976 Ga0207684_100339763 219
845 3300025913 Ga0207695_10000044 Ga0207695_10000044360 219
846 3300025914 Ga0207671_10000043 Ga0207671_10000043128 219
847 3300025916 Ga0207663_10019794 Ga0207663_100197944 219
848 3300025918 Ga0207662_10093154 Ga0207662_100931543 219
849 3300025918 Ga0207662_10096897 Ga0207662_100968971 219
850 3300025919 Ga0207657_10025505 Ga0207657_100255053 219
851 3300025920 Ga0207649_10373945 Ga0207649_103739451 219
852 3300025922 Ga0207646_10065889 Ga0207646_100658892 219
853 3300025923 Ga0207681_10736860 Ga0207681_107368601 219
854 3300025925 Ga0207650_10002443 Ga0207650_100024439 219
855 3300025926 Ga0207659_10661015 Ga0207659_106610151 219
856 3300025928 Ga0207700_10007976 Ga0207700_100079766 219
857 3300025928 Ga0207700_10075251 Ga0207700_100752513 219
858 3300025928 Ga0207700_10093294 Ga0207700_100932943 219
859 3300025928 Ga0207700_10290320 Ga0207700_102903202 219
860 3300025928 Ga0207700_10295244 Ga0207700_102952442 219
861 3300025928 Ga0207700_10522858 Ga0207700_105228581 219
862 3300025929 Ga0207664_10107314 Ga0207664_101073142 219
863 3300025929 Ga0207664_10310075 Ga0207664_103100752 219
864 3300025929 Ga0207664_10630357 Ga0207664_106303571 219
865 3300025931 Ga0207644_10183935 Ga0207644_101839352 219
866 3300025933 Ga0207706_10008654 Ga0207706_100086549 219
867 3300025933 Ga0207706_10095800 Ga0207706_100958002 219
868 3300025937 Ga0207669_10003551 Ga0207669_100035512 219
869 3300025937 Ga0207669_10580931 Ga0207669_105809311 219
870 3300025938 Ga0207704_10337409 Ga0207704_103374092 219
871 3300025939 Ga0207665_10000117 Ga0207665_1000011746 219
872 3300025939 Ga0207665_10036842 Ga0207665_100368421 219
873 3300025945 Ga0207679_10127977 Ga0207679_101279771 219
874 3300025949 Ga0207667_10136980 Ga0207667_101369804 219
875 3300025960 Ga0207651_10171172 Ga0207651_101711722 219
876 3300025961 Ga0207712_10056760 Ga0207712_100567602 219
877 3300025961 Ga0207712_10510485 Ga0207712_105104851 219
878 3300025986 Ga0207658_10055410 Ga0207658_100554102 219
879 3300025986 Ga0207658_10094692 Ga0207658_100946922 219
880 3300025986 Ga0207658_10344464 Ga0207658_103444641 219
881 3300026075 Ga0207708_10025996 Ga0207708_100259965 219
882 3300026088 Ga0207641_10287063 Ga0207641_102870633 219
883 3300026089 Ga0207648_10612286 Ga0207648_106122862 219
884 3300026118 Ga0207675_100670225 Ga0207675_1006702252 219
885 3300026142 Ga0207698_10040894 Ga0207698_100408942 219
886 3300027111 Ga0209281_1000030 Ga0209281_1000030164 219
887 3300027111 Ga0209281_1000144 Ga0209281_1000144107 219
888 3300027312 Ga0209371_1027003 Ga0209371_10270031 219
889 3300027378 Ga0209981_1011464 Ga0209981_10114642 219
890 3300027512 Ga0209179_1000861 Ga0209179_10008613 219
891 3300027543 Ga0209999_1016117 Ga0209999_10161172 219
892 3300027552 Ga0209982_1019550 Ga0209982_10195502 219
893 3300027665 Ga0209983_1030478 Ga0209983_10304782 219
894 3300027666 Ga0209282_1000004 Ga0209282_1000004164 219
895 3300027682 Ga0209971_1019044 Ga0209971_10190442 219
896 3300027695 Ga0209966_1013935 Ga0209966_10139352 219
897 3300028379 Ga0268266_10018885 Ga0268266_100188856 219
898 3300028380 Ga0268265_10092590 Ga0268265_100925902 219
899 3300028556 Ga0265337_1036207 Ga0265337_10362072 219
900 3300028577 Ga0265318_10023551 Ga0265318_100235512 219
901 3300030500 Ga0268256_1030724 Ga0268256_10307241 219
902 3300031235 Ga0265330_10011684 Ga0265330_100116842 219
903 3300031238 Ga0265332_10000616 Ga0265332_1000061614 219
904 3300031238 Ga0265332_10006156 Ga0265332_100061566 219
905 3300031240 Ga0265320_10019560 Ga0265320_100195602 219
906 3300031241 Ga0265325_10020612 Ga0265325_100206124 219
907 3300031241 Ga0265325_10042414 Ga0265325_100424142 219
908 3300031242 Ga0265329_10005375 Ga0265329_100053752 219
909 3300031247 Ga0265340_10001157 Ga0265340_100011573 219
910 3300031247 Ga0265340_10015097 Ga0265340_100150971 219
911 3300031249 Ga0265339_10001689 Ga0265339_100016898 219
912 3300031249 Ga0265339_10009337 Ga0265339_100093375 219
913 3300031250 Ga0265331_10005352 Ga0265331_100053526 219
914 3300031250 Ga0265331_10026552 Ga0265331_100265522 219
915 3300031250 Ga0265331_10028156 Ga0265331_100281562 219
916 3300031250 Ga0265331_10063039 Ga0265331_100630391 219
917 3300031344 Ga0265316_10070623 Ga0265316_100706231 219
918 3300031548 Ga0307408_100093069 Ga0307408_1000930692 219
919 3300031595 Ga0265313_10164797 Ga0265313_101647972 219
920 3300031665 Ga0316575_10029492 Ga0316575_100294923 219
921 3300031691 Ga0316579_10048692 Ga0316579_100486923 219
922 3300031711 Ga0265314_10007969 Ga0265314_100079699 219
923 3300031711 Ga0265314_10025875 Ga0265314_100258752 219
924 3300031711 Ga0265314_10036683 Ga0265314_100366834 219
925 3300031712 Ga0265342_10000139 Ga0265342_1000013964 219
926 3300031712 Ga0265342_10006975 Ga0265342_100069756 219
927 3300031712 Ga0265342_10103009 Ga0265342_101030092 219
928 3300031727 Ga0316576_10016655 Ga0316576_100166553 219
929 3300031731 Ga0307405_10000319 Ga0307405_100003195 219
930 3300031901 Ga0307406_10038296 Ga0307406_100382964 219
931 3300031967 Ga0315914_1000001 Ga0315914_1000001219 219
932 3300031995 Ga0307409_101167152 Ga0307409_1011671521 219
933 3300032133 Ga0316583_10077037 Ga0316583_100770372 219
934 3300033430 Ga0315913_1000004 Ga0315913_100000481 219
935 3300033464 Ga0315915_1000002 Ga0315915_1000002165 219
936 3300033541 Ga0316596_1061347 Ga0316596_10613471 219
937 3300034820 Ga0373959_0041399 Ga0373959_0041399_138_863 219
938 3300034957 Ga0373938_0019224 Ga0373938_0019224_195_920 219
939 3300035083 Ga0373926_0018146 Ga0373926_0018146_506_1231 219
940 3300035083 Ga0373926_0031361 Ga0373926_0031361_167_892 219
941 3300035086 Ga0373934_0019496 Ga0373934_0019496_338_1063 219
942 3300035089 Ga0373944_0001048 Ga0373944_0001048_5595_6320 219
943 3300035089 Ga0373944_0002385 Ga0373944_0002385_327_1052 219
944 3300035089 Ga0373944_0043865 Ga0373944_0043865_115_873 219
945 3300035092 Ga0373952_0041741 Ga0373952_0041741_77_802 219
946 3300035113 Ga0373936_0007303 Ga0373936_0007303_2785_3510 219
947 3300035114 Ga0373939_0113468 Ga0373939_0113468_123_848 219
948 3300035115 Ga0373941_0003432 Ga0373941_0003432_915_1640 219
949 3300035116 Ga0373945_0009707 Ga0373945_0009707_1927_2652 219
950 3300035116 Ga0373945_0027358 Ga0373945_0027358_330_1088 219
951 3300035117 Ga0373953_0000163 Ga0373953_0000163_12876_13601 219
952 3300035117 Ga0373953_0027416 Ga0373953_0027416_605_1330 219
953 3300035118 Ga0373954_0000145 Ga0373954_0000145_13570_14295 219
954 3300035118 Ga0373954_0004821 Ga0373954_0004821_2425_3150 219
955 3300035119 Ga0373956_0001494 Ga0373956_0001494_149_874 219
956 3300035119 Ga0373956_0105178 Ga0373956_0105178_416_1141 219
957 3300035120 Ga0373957_0003169 Ga0373957_0003169_3819_4544 219
958 3300035170 Ga0373943_0005333 Ga0373943_0005333_1463_2188 219
959 3300035170 Ga0373943_0005440 Ga0373943_0005440_4366_5091 219
960 3300035170 Ga0373943_0007037 Ga0373943_0007037_2135_2860 219
961 3300035170 Ga0373943_0008557 Ga0373943_0008557_3086_3817 219
962 3300035170 Ga0373943_0015761 Ga0373943_0015761_506_1231 219
963 3300035170 Ga0373943_0050796 Ga0373943_0050796_737_1462 219
964 3300035170 Ga0373943_0126950 Ga0373943_0126950_25_783 219
965 3300035171 Ga0373946_0090582 Ga0373946_0090582_373_1131 219
966 3300035171 Ga0373946_0104233 Ga0373946_0104233_454_1179 219
967 3300035172 Ga0373955_0000129 Ga0373955_0000129_13280_14005 219
968 3300035172 Ga0373955_0009700 Ga0373955_0009700_2071_2796 219
969 3300035242 Ga0373962_0017573 Ga0373962_0017573_762_1487 219
970 3300035398 Ga0316574_0172630 Ga0316574_0172630_42_767 219
971 3300035410 Ga0373924_0002728 Ga0373924_0002728_2013_2738 219
972 3300035410 Ga0373924_0009624 Ga0373924_0009624_2065_2790 219
973 3300035691 Ga0373931_0100454 Ga0373931_0100454_342_1067 219
974 3300035692 Ga0373935_0001583 Ga0373935_0001583_673_1398 219
975 3300035692 Ga0373935_0008943 Ga0373935_0008943_1608_2333 219
976 3300035692 Ga0373935_0029303 Ga0373935_0029303_1295_2026 219
977 3300035692 Ga0373935_0034563 Ga0373935_0034563_17_775 219
978 3300035692 Ga0373935_0070266 Ga0373935_0070266_1236_1961 219
979 3300035695 Ga0373927_0000243 Ga0373927_0000243_9920_10645 219
980 3300035695 Ga0373927_0016658 Ga0373927_0016658_2611_3336 219
981 3300035695 Ga0373927_0040324 Ga0373927_0040324_1465_2190 219
982 3300035695 Ga0373927_0223252 Ga0373927_0223252_215_940 219
983 3300035724 Ga0373933_0000999 Ga0373933_0000999_5439_6164 219
984 3300035724 Ga0373933_0014674 Ga0373933_0014674_1189_1914 219
985 3300035725 Ga0373947_0004234 Ga0373947_0004234_2548_3306 219
986 3300035725 Ga0373947_0006288 Ga0373947_0006288_4069_4794 219
987 3300035725 Ga0373947_0022019 Ga0373947_0022019_2922_3647 219
988 3300035725 Ga0373947_0145550 Ga0373947_0145550_424_1149 219
989 3300035725 Ga0373947_0154857 Ga0373947_0154857_565_1296 219
990 3300035725 Ga0373947_0268394 Ga0373947_0268394_10_735 219
991 3300036401 Ga0373937_0001770 Ga0373937_0001770_14920_15645 219
992 3300036401 Ga0373937_0050791 Ga0373937_0050791_2780_3505 219
993 3300036401 Ga0373937_0211788 Ga0373937_0211788_793_1518 219
994 3300036712 Ga0316584_0025549 Ga0316584_0025549_76_801 219
995 3300037068 Ga0373925_0002474 Ga0373925_0002474_10567_11292 219
996 3300037068 Ga0373925_0006021 Ga0373925_0006021_7239_7997 219
997 3300037068 Ga0373925_0007690 Ga0373925_0007690_720_1445 219
998 3300037068 Ga0373925_0010149 Ga0373925_0010149_57_782 219
999 3300037068 Ga0373925_0070975 Ga0373925_0070975_1049_1780 219
1000 3300037068 Ga0373925_0102445 Ga0373925_0102445_1351_2076 219
1001 3300037068 Ga0373925_0131664 Ga0373925_0131664_731_1456 219
1002 3300037068 Ga0373925_0382068 Ga0373925_0382068_174_899 219
1003 3300037312 Ga0395899_0020603 Ga0395899_0020603_2661_3386 219
1004 3300037418 Ga0395900_0293717 Ga0395900_0293717_411_1136 219
1005 3300037418 Ga0395900_0560326 Ga0395900_0560326_280_1005 219
1006 3300037466 Ga0395898_0040958 Ga0395898_0040958_3761_4489 219
1007 3300037466 Ga0395898_0041459 Ga0395898_0041459_1351_2076 219
1008 3300037466 Ga0395898_0081359 Ga0395898_0081359_2326_3051 219
1009 3300037471 Ga0395905_0134471 Ga0395905_0134471_873_1598 219
1010 3300037853 Ga0436364_1293698 Ga0436364_1293698_177_902 219
1011 3300037853 Ga0436364_1378623 Ga0436364_1378623_218_943 219
1012 3300038443 Ga0395901_0516912 Ga0395901_0516912_461_1186 219
1013 3300039062 Ga0400483_184981 Ga0400483_184981_24_767 219
1014 3300039437 Ga0436365_0008071 Ga0436365_0008071_5893_6618 219
1015 3300039437 Ga0436365_0047534 Ga0436365_0047534_480_1205 219
1016 3300039437 Ga0436365_1561193 Ga0436365_1561193_249_974 219
1017 3300039438 Ga0436360_0205543 Ga0436360_0205543_291_1016 219
1018 3300039438 Ga0436360_0224814 Ga0436360_0224814_93_818 219
1019 3300039447 Ga0436361_0092227 Ga0436361_0092227_1049_1774 219
1020 3300039447 Ga0436361_0494886 Ga0436361_0494886_361_1086 219
1021 3300039450 Ga0436363_0639451 Ga0436363_0639451_33_770 219
1022 3300039450 Ga0436363_0780921 Ga0436363_0780921_1987_2712 219
1023 3300039450 Ga0436363_1418375 Ga0436363_1418375_538_1263 219
1024 3300041404 Ga0439436_0047100 Ga0439436_0047100_484_1209 219
1025 3300041463 Ga0451804_0220353 Ga0451804_0220353_16_741 219
1026 3300042001 Ga0439441_002900 Ga0439441_002900_1466_2191 219
1027 3300042007 Ga0439449_0006122 Ga0439449_0006122_182_907 219
1028 3300042008 Ga0439450_023665 Ga0439450_023665_112_837 219
1029 3300044684 Ga0466966_0229552 Ga0466966_0229552_342_1070 219
1030 3300044735 Ga0466968_0064700 Ga0466968_0064700_184_918 219
1031 3300045049 Ga0466959_0048305 Ga0466959_0048305_2128_2853 219
1032 3300045051 Ga0451576_0003376 Ga0451576_0003376_6762_7487 219
1033 3300045836 Ga0466958_0198665 Ga0466958_0198665_97_873 219
1034 3300045976 Ga0466967_0677786 Ga0466967_0677786_83_808 219
1035 3300046454 Ga0495592_0001415 Ga0495592_0001415_8654_9379 219
1036 3300046454 Ga0495592_0066586 Ga0495592_0066586_37_762 219
1037 3300046455 Ga0495603_0026000 Ga0495603_0026000_1505_2230 219
1038 3300046458 Ga0495591_038725 Ga0495591_038725_259_984 219
1039 3300046459 Ga0495629_0000668 Ga0495629_0000668_16991_17716 219
1040 3300046459 Ga0495629_0001605 Ga0495629_0001605_2753_3478 219
1041 3300046459 Ga0495629_0047268 Ga0495629_0047268_961_1686 219
1042 3300046460 Ga0495638_0163759 Ga0495638_0163759_181_906 219
1043 3300046461 Ga0495641_0007758 Ga0495641_0007758_4432_5157 219
1044 3300046461 Ga0495641_0019335 Ga0495641_0019335_1654_2385 219
1045 3300046462 Ga0495651_0021179 Ga0495651_0021179_2103_2828 219
1046 3300046463 Ga0495653_0000300 Ga0495653_0000300_14842_15567 219
1047 3300046463 Ga0495653_0027546 Ga0495653_0027546_2504_3229 219
1048 3300046472 Ga0495580_0018640 Ga0495580_0018640_3014_3745 219
1049 3300046472 Ga0495580_0031293 Ga0495580_0031293_378_1103 219
1050 3300046473 Ga0495582_0002207 Ga0495582_0002207_7255_7980 219
1051 3300046473 Ga0495582_0028720 Ga0495582_0028720_1923_2654 219
1052 3300046475 Ga0495639_0022873 Ga0495639_0022873_2004_2729 219
1053 3300046476 Ga0495662_0046886 Ga0495662_0046886_764_1489 219
1054 3300046477 Ga0495664_0000877 Ga0495664_0000877_14489_15214 219
1055 3300046477 Ga0495664_0074144 Ga0495664_0074144_16_741 219
1056 3300046491 Ga0495584_0096965 Ga0495584_0096965_732_1457 219
1057 3300046492 Ga0495585_0004225 Ga0495585_0004225_7625_8350 219
1058 3300046499 Ga0495594_0036748 Ga0495594_0036748_1391_2116 219
1059 3300046499 Ga0495594_0130699 Ga0495594_0130699_336_1067 219
1060 3300046501 Ga0495607_0005594 Ga0495607_0005594_2024_2749 219
1061 3300046511 Ga0495608_0001863 Ga0495608_0001863_14190_14915 219
1062 3300046511 Ga0495608_0021002 Ga0495608_0021002_1372_2097 219
1063 3300046512 Ga0495610_0000530 Ga0495610_0000530_11600_12325 219
1064 3300046514 Ga0495618_0007932 Ga0495618_0007932_2426_3151 219
1065 3300046514 Ga0495618_0015011 Ga0495618_0015011_465_1190 219
1066 3300046516 Ga0495628_0015340 Ga0495628_0015340_3797_4522 219
1067 3300046516 Ga0495628_0055939 Ga0495628_0055939_255_980 219
1068 3300046517 Ga0495630_0012446 Ga0495630_0012446_4494_5219 219
1069 3300046517 Ga0495630_0078757 Ga0495630_0078757_1011_1736 219
1070 3300046519 Ga0495632_0001108 Ga0495632_0001108_1558_2283 219
1071 3300046520 Ga0495637_0054046 Ga0495637_0054046_801_1526 219
1072 3300046522 Ga0495643_0025174 Ga0495643_0025174_1632_2357 219
1073 3300046523 Ga0495644_0000306 Ga0495644_0000306_9968_10693 219
1074 3300046524 Ga0495648_0077361 Ga0495648_0077361_826_1584 219
1075 3300046526 Ga0495666_0015401 Ga0495666_0015401_1548_2279 219
1076 3300046528 Ga0495642_0228251 Ga0495642_0228251_73_798 219
1077 3300046529 Ga0495652_0002115 Ga0495652_0002115_6168_6893 219
1078 3300046529 Ga0495652_0013648 Ga0495652_0013648_1726_2451 219
1079 3300046529 Ga0495652_0305975 Ga0495652_0305975_95_820 219
1080 3300046531 Ga0495665_0062590 Ga0495665_0062590_223_948 219
1081 3300046533 Ga0495640_0005373 Ga0495640_0005373_9348_10073 219
1082 3300046533 Ga0495640_0013146 Ga0495640_0013146_3643_4401 219
1083 3300046533 Ga0495640_0015102 Ga0495640_0015102_1087_1812 219
1084 3300046533 Ga0495640_0159277 Ga0495640_0159277_582_1307 219
1085 3300046535 Ga0495586_0027068 Ga0495586_0027068_2273_2998 219
1086 3300046535 Ga0495586_0112940 Ga0495586_0112940_659_1417 219
1087 3300046536 Ga0495587_0002255 Ga0495587_0002255_898_1623 219
1088 3300046536 Ga0495587_0178859 Ga0495587_0178859_295_1020 219
1089 3300046537 Ga0495598_0002277 Ga0495598_0002277_228_953 219
1090 3300046539 Ga0495621_0080055 Ga0495621_0080055_85_810 219
1091 3300046543 Ga0495645_0001277 Ga0495645_0001277_14177_14902 219
1092 3300046543 Ga0495645_0033438 Ga0495645_0033438_2411_3136 219
1093 3300046543 Ga0495645_0144812 Ga0495645_0144812_591_1316 219
1094 3300046557 Ga0495622_0004842 Ga0495622_0004842_4216_4941 219
1095 3300046558 Ga0495633_0001183 Ga0495633_0001183_10326_11051 219
1096 3300046558 Ga0495633_0094773 Ga0495633_0094773_82_807 219
1097 3300046559 Ga0495667_0000121 Ga0495667_0000121_48781_49506 219
1098 3300046559 Ga0495667_0043767 Ga0495667_0043767_239_964 219
1099 3300046615 Ga0495656_0072048 Ga0495656_0072048_562_1287 219
1100 3300046642 Ga0495634_0002835 Ga0495634_0002835_12510_13235 219
1101 3300046642 Ga0495634_0016888 Ga0495634_0016888_3194_3952 219
1102 3300046642 Ga0495634_0020441 Ga0495634_0020441_3464_4189 219
1103 3300046648 Ga0495611_0003332 Ga0495611_0003332_1011_1736 219
1104 3300046663 Ga0495635_0000072 Ga0495635_0000072_49803_50528 219
1105 3300046663 Ga0495635_0017419 Ga0495635_0017419_3295_4020 219
1106 3300046663 Ga0495635_0044207 Ga0495635_0044207_1135_1860 219
1107 3300046664 Ga0495659_0000645 Ga0495659_0000645_9964_10689 219
1108 3300046674 Ga0495588_0003103 Ga0495588_0003103_4038_4763 219
1109 3300046674 Ga0495588_0113522 Ga0495588_0113522_638_1369 219
1110 3300046675 Ga0495657_0001284 Ga0495657_0001284_11048_11773 219
1111 3300046675 Ga0495657_0107448 Ga0495657_0107448_165_890 219
1112 3300046678 Ga0495599_0000695 Ga0495599_0000695_11641_12366 219
1113 3300046678 Ga0495599_0017266 Ga0495599_0017266_2104_2829 219
1114 3300046679 Ga0495623_0000291 Ga0495623_0000291_11091_11816 219
1115 3300046680 Ga0495646_0031506 Ga0495646_0031506_1679_2404 219
1116 3300046680 Ga0495646_0037206 Ga0495646_0037206_2276_3001 219
1117 3300046680 Ga0495646_0048349 Ga0495646_0048349_1711_2436 219
1118 3300046681 Ga0495647_0057825 Ga0495647_0057825_45_770 219
1119 3300046681 Ga0495647_0110990 Ga0495647_0110990_42_767 219
1120 3300046683 Ga0495658_0000229 Ga0495658_0000229_16182_16907 219
1121 3300046683 Ga0495658_0023036 Ga0495658_0023036_1613_2344 219
1122 3300046683 Ga0495658_0049426 Ga0495658_0049426_1013_1738 219
1123 3300046689 Ga0495613_0002758 Ga0495613_0002758_10284_11009 219
1124 3300046689 Ga0495613_0007587 Ga0495613_0007587_1329_2054 219
1125 3300046689 Ga0495613_0037004 Ga0495613_0037004_472_1197 219
1126 3300046689 Ga0495613_0038838 Ga0495613_0038838_1307_2038 219
1127 3300046689 Ga0495613_0074812 Ga0495613_0074812_16_741 219
1128 3300046690 Ga0495624_0028910 Ga0495624_0028910_2769_3494 219
1129 3300046690 Ga0495624_0074972 Ga0495624_0074972_699_1424 219
1130 3300046691 Ga0495670_0004752 Ga0495670_0004752_2163_2888 219
1131 3300046691 Ga0495670_0062899 Ga0495670_0062899_961_1692 219
1132 3300046692 Ga0495671_0039884 Ga0495671_0039884_413_1150 219
1133 3300046809 Ga0495600_0000330 Ga0495600_0000330_10710_11435 219
1134 3300046809 Ga0495600_0045949 Ga0495600_0045949_16_741 219
1135 3300047315 Ga0495581_0006942 Ga0495581_0006942_1736_2461 219
1136 3300047315 Ga0495581_0008513 Ga0495581_0008513_610_1335 219
1137 3300047317 Ga0495604_0003872 Ga0495604_0003872_3926_4651 219
1138 3300047319 Ga0495674_0002065 Ga0495674_0002065_14968_15693 219
1139 3300047319 Ga0495674_0017187 Ga0495674_0017187_495_1253 219
1140 3300047319 Ga0495674_0019117 Ga0495674_0019117_3833_4558 219
1141 3300047319 Ga0495674_0098730 Ga0495674_0098730_296_1021 219
1142 3300047321 Ga0495676_0012443 Ga0495676_0012443_3672_4397 219
1143 3300047321 Ga0495676_0152323 Ga0495676_0152323_747_1472 219
1144 3300047321 Ga0495676_0231937 Ga0495676_0231937_37_762 219
1145 3300047322 Ga0495680_0009139 Ga0495680_0009139_2405_3130 219
1146 3300047322 Ga0495680_0036945 Ga0495680_0036945_2004_2729 219
1147 3300047322 Ga0495680_0080264 Ga0495680_0080264_506_1231 219
1148 3300047322 Ga0495680_0401106 Ga0495680_0401106_65_790 219
1149 3300047444 Ga0495675_0000796 Ga0495675_0000796_16505_17230 219
1150 3300047444 Ga0495675_0243369 Ga0495675_0243369_335_1060 219
1151 3300047445 Ga0495677_0184934 Ga0495677_0184934_25_750 219
1152 3300047446 Ga0495679_034322 Ga0495679_034322_537_1262 219
1153 3300047470 Ga0495681_0003767 Ga0495681_0003767_9297_10034 219
1154 3300047470 Ga0495681_0090686 Ga0495681_0090686_40_765 219
1155 3300047471 Ga0495684_0000594 Ga0495684_0000594_2530_3255 219
1156 3300047471 Ga0495684_0014934 Ga0495684_0014934_762_1487 219
1157 3300047471 Ga0495684_0091239 Ga0495684_0091239_132_857 219
1158 3300047471 Ga0495684_0248620 Ga0495684_0248620_417_1142 219
1159 3300047472 Ga0495686_0000269 Ga0495686_0000269_87336_88061 219
1160 3300047472 Ga0495686_0003611 Ga0495686_0003611_1803_2528 219
1161 3300047673 Ga0495593_0000641 Ga0495593_0000641_8273_8998 219
1162 3300047673 Ga0495593_0015025 Ga0495593_0015025_2629_3354 219
1163 3300047673 Ga0495593_0024445 Ga0495593_0024445_2474_3199 219
1164 3300047673 Ga0495593_0040039 Ga0495593_0040039_435_1160 219
1165 3300048088 Ga0495602_0004847 Ga0495602_0004847_3589_4314 219
1166 3300048088 Ga0495602_0057882 Ga0495602_0057882_1164_1889 219
1167 3300048089 Ga0495614_0005547 Ga0495614_0005547_4230_4955 219
1168 3300048090 Ga0495615_0055265 Ga0495615_0055265_20_745 219
1169 3300048903 Ga0496100_0270443 Ga0496100_0270443_248_973 219
1170 3300048904 Ga0496101_0365362 Ga0496101_0365362_343_1068 219
1171 3300048905 Ga0496102_0381817 Ga0496102_0381817_148_873 219
1172 3300048907 Ga0496104_0033322 Ga0496104_0033322_2990_3715 219
1173 3300048908 Ga0496105_0382335 Ga0496105_0382335_300_1025 219
1174 3300048909 Ga0496106_0022817 Ga0496106_0022817_2343_3068 219
1175 3300048909 Ga0496106_0335659 Ga0496106_0335659_242_967 219
1176 3300048910 Ga0496107_0159415 Ga0496107_0159415_632_1357 219
1177 3300048912 Ga0496109_0091484 Ga0496109_0091484_352_1077 219
1178 3300048913 Ga0496110_0006378 Ga0496110_0006378_6771_7496 219
1179 3300048915 Ga0496112_0028322 Ga0496112_0028322_3411_4136 219
1180 3300048915 Ga0496112_0073057 Ga0496112_0073057_21_746 219
1181 3300048916 Ga0496113_0417097 Ga0496113_0417097_106_831 219
1182 3300048918 Ga0496115_0116250 Ga0496115_0116250_632_1357 219
1183 3300048919 Ga0496116_0001796 Ga0496116_0001796_21129_21854 219
1184 3300048919 Ga0496116_0006429 Ga0496116_0006429_8473_9198 219
1185 3300048919 Ga0496116_0010738 Ga0496116_0010738_1539_2264 219
1186 3300048919 Ga0496116_0025017 Ga0496116_0025017_1290_2015 219
1187 3300048920 Ga0496117_0012169 Ga0496117_0012169_3999_4724 219
1188 3300048920 Ga0496117_0040813 Ga0496117_0040813_2403_3128 219
1189 3300048921 Ga0496118_0037860 Ga0496118_0037860_2286_3011 219
1190 3300048921 Ga0496118_0071833 Ga0496118_0071833_1548_2273 219
1191 3300048922 Ga0496119_0154257 Ga0496119_0154257_429_1157 219
1192 3300048924 Ga0496121_0017255 Ga0496121_0017255_1329_2054 219
1193 3300048924 Ga0496121_0046016 Ga0496121_0046016_2659_3384 219
1194 3300048924 Ga0496121_0099426 Ga0496121_0099426_1328_2053 219
1195 3300048925 Ga0496122_0011409 Ga0496122_0011409_6041_6766 219
1196 3300048925 Ga0496122_0042101 Ga0496122_0042101_2774_3499 219
1197 3300048925 Ga0496122_0072861 Ga0496122_0072861_1307_2032 219
1198 3300048925 Ga0496122_0079885 Ga0496122_0079885_599_1324 219
1199 3300048926 Ga0496123_0003477 Ga0496123_0003477_5763_6488 219
1200 3300048926 Ga0496123_0014908 Ga0496123_0014908_5206_5931 219
1201 3300048926 Ga0496123_0031554 Ga0496123_0031554_2318_3043 219
1202 3300048927 Ga0496124_0006309 Ga0496124_0006309_5496_6221 219
1203 3300048927 Ga0496124_0008251 Ga0496124_0008251_5511_6236 219
1204 3300048927 Ga0496124_0022918 Ga0496124_0022918_886_1611 219
1205 3300048927 Ga0496124_0040338 Ga0496124_0040338_2909_3634 219
1206 3300048927 Ga0496124_0303193 Ga0496124_0303193_137_862 219
1207 3300048928 Ga0496125_0002335 Ga0496125_0002335_1514_2239 219
1208 3300049568 Ga0501031_0412925 Ga0501031_0412925_132_857 219
1209 3300049571 Ga0501034_0041027 Ga0501034_0041027_1956_2681 219
1210 3300049571 Ga0501034_0127319 Ga0501034_0127319_191_916 219
1211 3300049572 Ga0501036_0020355 Ga0501036_0020355_2613_3338 219
1212 3300049572 Ga0501036_0030645 Ga0501036_0030645_1731_2456 219
1213 3300049574 Ga0501038_0056984 Ga0501038_0056984_151_876 219
1214 3300049574 Ga0501038_0059157 Ga0501038_0059157_491_1216 219
1215 3300049574 Ga0501038_0142330 Ga0501038_0142330_495_1220 219
1216 3300049575 Ga0501039_0009471 Ga0501039_0009471_504_1229 219
1217 3300049575 Ga0501039_0522172 Ga0501039_0522172_39_764 219
1218 3300049579 Ga0501043_0050717 Ga0501043_0050717_378_1103 219
1219 3300049581 Ga0501047_0026320 Ga0501047_0026320_1792_2517 219
1220 3300049581 Ga0501047_0043963 Ga0501047_0043963_3314_4039 219
1221 3300049581 Ga0501047_0234621 Ga0501047_0234621_750_1475 219
1222 3300049582 Ga0501048_0000302 Ga0501048_0000302_31045_31773 219
1223 3300049583 Ga0501067_0049133 Ga0501067_0049133_1149_1874 219
1224 3300049584 Ga0501068_0030914 Ga0501068_0030914_1531_2256 219
1225 3300049584 Ga0501068_0062769 Ga0501068_0062769_351_1076 219
1226 3300049585 Ga0501069_0258577 Ga0501069_0258577_252_977 219
1227 3300049586 Ga0501070_0022527 Ga0501070_0022527_3142_3867 219
1228 3300049586 Ga0501070_0201742 Ga0501070_0201742_336_1061 219
1229 3300049589 Ga0501073_0027419 Ga0501073_0027419_372_1187 219
1230 3300049589 Ga0501073_0536421 Ga0501073_0536421_17_745 219
1231 3300049590 Ga0501074_0038453 Ga0501074_0038453_1113_1838 219
1232 3300049592 Ga0501076_0630322 Ga0501076_0630322_84_809 219
1233 3300049593 Ga0501077_0010467 Ga0501077_0010467_421_1146 219
1234 3300049593 Ga0501077_0120998 Ga0501077_0120998_797_1522 219
1235 3300049593 Ga0501077_0300785 Ga0501077_0300785_65_790 219
1236 3300049741 Ga0501079_0026337 Ga0501079_0026337_1356_2081 219
1237 3300049741 Ga0501079_0330179 Ga0501079_0330179_16_741 219
1238 3300049742 Ga0501080_0099024 Ga0501080_0099024_1367_2092 219
1239 3300049744 Ga0501083_0009432 Ga0501083_0009432_1558_2283 219
1240 3300049744 Ga0501083_0101265 Ga0501083_0101265_1098_1823 219
1241 3300049822 Ga0501035_0141034 Ga0501035_0141034_17_742 219
1242 3300049823 Ga0501044_0000509 Ga0501044_0000509_11874_12599 219
1243 3300049823 Ga0501044_0023168 Ga0501044_0023168_5027_5752 219
1244 3300049823 Ga0501044_0099694 Ga0501044_0099694_1536_2261 219
1245 3300049823 Ga0501044_0121115 Ga0501044_0121115_264_989 219
1246 3300049823 Ga0501044_0124359 Ga0501044_0124359_1709_2434 219
1247 3300049823 Ga0501044_0155855 Ga0501044_0155855_1479_2204 219
1248 3300049823 Ga0501044_0268553 Ga0501044_0268553_704_1429 219
1249 3300049824 Ga0501045_0263972 Ga0501045_0263972_161_886 219
1250 3300050492 nmdc:mga0yw44_29500_c1 nmdc:mga0yw44_29500_c1_690_1415 219
1251 3300050493 nmdc:mga0k408_245651_c1 nmdc:mga0k408_245651_c1_177_902 219
1252 3300050494 nmdc:mga06z11_161499_c1 nmdc:mga06z11_161499_c1_126_914 219
1253 3300050496 nmdc:mga07m45_167326_c1 nmdc:mga07m45_167326_c1_201_932 219
1254 3300050496 nmdc:mga07m45_69540_c1 nmdc:mga07m45_69540_c1_957_1682 219
1255 3300050507 nmdc:mga05p37_960127_c1 nmdc:mga05p37_960127_c1_178_903 219
1256 3300050509 nmdc:mga0qj67_128_c1 nmdc:mga0qj67_128_c1_24815_25549 219
1257 3300050509 nmdc:mga0qj67_295557_c1 nmdc:mga0qj67_295557_c1_315_1040 219
1258 3300050509 nmdc:mga0qj67_452593_c1 nmdc:mga0qj67_452593_c1_145_870 219
1259 3300050511 nmdc:mga08y16_173974_c1 nmdc:mga08y16_173974_c1_944_1669 219
1260 3300050511 nmdc:mga08y16_220666_c1 nmdc:mga08y16_220666_c1_1146_1871 219
1261 3300050511 nmdc:mga08y16_361824_c1 nmdc:mga08y16_361824_c1_611_1387 219
1262 3300050512 nmdc:mga0n895_147647_c1 nmdc:mga0n895_147647_c1_1559_2284 219
1263 3300050512 nmdc:mga0n895_58450_c1 nmdc:mga0n895_58450_c1_1998_2723 219
1264 3300050512 nmdc:mga0n895_773241_c1 nmdc:mga0n895_773241_c1_170_895 219
1265 3300050513 nmdc:mga0rr50_659953_c1 nmdc:mga0rr50_659953_c1_128_853 219
1266 3300050514 nmdc:mga08x19_80332_c1 nmdc:mga08x19_80332_c1_35_760 219
1267 3300050515 nmdc:mga0a205_323455_c1 nmdc:mga0a205_323455_c1_292_1017 219
1268 3300053077 Ga0495601_0001526 Ga0495601_0001526_5963_6688 219
1269 3300053077 Ga0495601_0095959 Ga0495601_0095959_1068_1826 219
1270 3300053078 Ga0495612_0001337 Ga0495612_0001337_1403_2128 219
1271 3300053078 Ga0495612_0008988 Ga0495612_0008988_1235_1960 219
1272 3300053084 Ga0495595_0002985 Ga0495595_0002985_1646_2371 219
1273 3300053084 Ga0495595_0068618 Ga0495595_0068618_297_1022 219
1274 3300053085 Ga0495619_0001864 Ga0495619_0001864_9521_10246 219
1275 3300053085 Ga0495619_0002658 Ga0495619_0002658_147_872 219
1276 3300053085 Ga0495619_0005185 Ga0495619_0005185_5574_6299 219
1277 3300053085 Ga0495619_0137769 Ga0495619_0137769_578_1303 219
1278 3300053093 Ga0500651_0006750 Ga0500651_0006750_2887_3612 219
1279 3300053094 Ga0500566_0043210 Ga0500566_0043210_1615_2361 219
1280 3300053103 Ga0500555_001006 Ga0500555_001006_7538_8263 219
1281 3300053119 Ga0500595_000001 Ga0500595_000001_1081335_1082081 219
1282 3300053119 Ga0500595_011782 Ga0500595_011782_1537_2262 219
1283 3300053131 Ga0500652_000056 Ga0500652_000056_27069_27794 219
1284 3300053134 Ga0500658_0037202 Ga0500658_0037202_543_1268 219
1285 3300053136 Ga0500559_0005651 Ga0500559_0005651_2372_3097 219
1286 3300053153 Ga0500616_0000001 Ga0500616_0000001_908860_909717 219
1287 3300053153 Ga0500616_0000441 Ga0500616_0000441_41366_42094 219
1288 3300053177 Ga0500636_0012034 Ga0500636_0012034_852_1577 219
1289 3300053737 Ga0500601_000399 Ga0500601_000399_135_860 219
1290 3300054114 Ga0501084_0139445 Ga0501084_0139445_716_1441 219
1291 3300055283 Ga0500661_014610 Ga0500661_014610_66_791 219
1292 3300059493 Ga0587077_037182 Ga0587077_037182_13_828 219
1293 3300060353 Ga0501082_0061318 Ga0501082_0061318_2350_3075 219
1294 3300060353 Ga0501082_0184800 Ga0501082_0184800_23_748 219
1295 3300060353 Ga0501082_0202907 Ga0501082_0202907_189_914 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

53

273

0.97

PF00106

adh_short

short chain dehydrogenase

47

227

0.95

PF13460

NAD_binding_10

NAD(P)H-binding

53

209

0.79

PF08659

KR

KR domain

48

215

0.77

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

49

201

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vt6-assembly1.cif.gz_A crystal structure of acetoacetyl-coa reductase from burkholderia pseudomallei 1710b complexed with nadp 0.9626 2 219
4k6c-assembly1.cif.gz_A x-ray crystal structure of a putative acetoacyl-coa reductase from burkholderia cenocepacia 0.9576 2 219
5vt6-assembly1.cif.gz_A crystal structure of acetoacetyl-coa reductase from burkholderia pseudomallei 1710b complexed with nadp 0.954 2 219
4nbu-assembly1.cif.gz_D crystal structure of fabg from bacillus sp 0.9527 1 215
5vml-assembly1.cif.gz_A crystal structure of acetoacetyl-coa reductase from burkholderia pseudomallei 1710b with bound nadp 0.951 1 219
ID Description Score Start End Superfamily
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9462 74 218 3.40.50.720
2cfcD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.945 1 214 3.40.50.720
3awdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9422 1 214 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9374 2 218 3.40.50.720
af_A0A1D6J5I0_53_326_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9359 1 218 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A529PGN1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9906 1 129
AF-A0A529IRX2-F1-model_v4 deleted 0.9894 1 187
AF-A0A529LSD5-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9875 1 111 GO:0008667
GO:0019290
AF-A0A529ZRP8-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9866 1 105
AF-A0A526RE03-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.985 1 152 GO:0016491

Feature Viewer

pLDDT pTM Quality
91.53 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map