F492268

General Info

Members Datasets Scaffolds Average Seq Length
1257 471 1257 187

Family's Representative Sequence

Representative Sequence 3300049762|Ga0501265_002920|Ga0501265_002920_39_728
Length 229
Sequence MHEALRIDGDSTMNNHGVLSPRLASRVPIESAGRIDYARRKEFCVEVLQLDVSGRPQAWISAKEAACIYASDGIAWTLGDAFYVLRGGTQRRTGLQSRIEVHPIIAVRGAIPSRAWRQTPALSNPKLFARDRHVCAYCGGHFHADDLTREHITPTSRGGRDTWMNCITACRPCNGRKGNRMPEEAHMSLMYLPYVPNLHEDMILRGRRILVDQMEFLLASVPRHSRLHG

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
100 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
117 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
135 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
141 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
142 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
143 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
145 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
146 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
150 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
212 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
213 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
218 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
223 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
224 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
225 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
226 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
227 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
228 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
229 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
230 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
231 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
232 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
233 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
234 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
235 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
236 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
237 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
238 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
239 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
240 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
241 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
242 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
245 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
246 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
247 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
248 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
249 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
250 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
251 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
252 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
253 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
254 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
255 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
256 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
257 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
258 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
259 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
260 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
261 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
262 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
263 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
264 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
265 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
266 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
267 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
274 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
275 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
276 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
277 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
278 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
279 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
280 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
281 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
282 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
283 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
284 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
285 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
286 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
287 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
288 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
289 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
290 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
291 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
292 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
293 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
294 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
295 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
296 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
297 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
298 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
299 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
300 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
301 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
302 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
303 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
304 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
305 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
306 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
307 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
308 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
309 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
310 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
311 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
312 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
313 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
314 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
315 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
316 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
317 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
318 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
319 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
320 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
321 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
322 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
323 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
324 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
325 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
326 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
327 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
328 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
329 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
330 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
331 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
332 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
333 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
334 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
335 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
336 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
337 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
338 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
339 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
340 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
341 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
342 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
343 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
344 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
345 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
346 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
347 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
348 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
349 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
350 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
351 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
352 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
353 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
354 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
355 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
356 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
357 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
358 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
359 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
360 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
361 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
362 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
363 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
364 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
365 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
366 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
367 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
368 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
369 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
370 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
371 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
372 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
373 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
374 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
375 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
376 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
377 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
378 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
379 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
380 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
381 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
382 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
383 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
384 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
385 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
386 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
387 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
388 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
389 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
390 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
391 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
392 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
393 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
394 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
395 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
399 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
400 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
401 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
402 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
403 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
404 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
405 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
406 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
407 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
408 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
409 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
410 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
411 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
412 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
413 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
414 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
415 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
416 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
417 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
418 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
419 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
420 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
423 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
424 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
425 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
426 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
427 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
428 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
429 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
430 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
431 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
432 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
433 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
434 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
435 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
436 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
437 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
438 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
439 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
440 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
441 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
442 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
443 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
444 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
445 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
446 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
447 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
448 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
449 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
450 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
451 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
452 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
453 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
454 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
455 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
456 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
457 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
458 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
459 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
460 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
461 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
462 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
463 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
464 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
465 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
466 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
467 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
468 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
469 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
470 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
471 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.27
Nodule 0.4
Rhizoplane 3.74
Rhizosphere 74.07
Stem 0
Stem Tuber 0
Unclassified 6.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004029 3300001979 Bacteria 6361
2 JGI24744J21845_10010959 3300002077 Bacteria 1856
3 JGI25156J39149_1001303 3300002705 Bacteria 10788
4 JGI25156J39149_1012545 3300002705 Bacteria 1853
5 JGI25154J39366_1000343 3300002738 Bacteria 26705
6 JGI25157J39369_1000304 3300002741 Bacteria 35531
7 JGI25152J39213_1000710 3300002773 Bacteria 17271
8 JGI25150J39212_1017649 3300002774 Bacteria 1149
9 JGI25153J46596_10004579 3300003215 Bacteria 7412
10 JGI25153J46596_10006328 3300003215 Bacteria 6019
11 rootH1_10000527 3300003316 Bacteria 4022
12 rootH1_10010629 3300003316 Bacteria 5506
13 rootH2_10057083 3300003320 Bacteria 6357
14 rootL2_10003309 3300003322 Bacteria 4899
15 rootL2_10004014 3300003322 Bacteria 6597
16 rootL2_10056084 3300003322 Bacteria 1258
17 rootH1_10000048 3300003323 Bacteria 2903
18 rootH1_10020306 3300003323 Bacteria 16958
19 rootH1_10021990 3300003323 Bacteria 3895
20 JGI26128J50194_1004871 3300003347 Bacteria 885
21 Ga0055539_1002131 3300003752 Bacteria 3198
22 Ga0055539_1002241 3300003752 Bacteria 3057
23 Ga0055533_1000016 3300003756 Bacteria 396179
24 Ga0055525_1000031 3300003759 Bacteria 314909
25 Ga0055525_1000802 3300003759 Bacteria 9854
26 Ga0055529_1000963 3300003763 Bacteria 14815
27 Ga0055524_1000052 3300003775 Bacteria 144959
28 Ga0055524_1017112 3300003775 Bacteria 2569
29 Ga0055528_1051731 3300003790 Bacteria 826
30 Ga0055530_10004973 3300003791 Bacteria 6572
31 Ga0055530_10008463 3300003791 Bacteria 4117
32 Ga0055540_1000123 3300003792 Bacteria 80351
33 Ga0055540_1011833 3300003792 Bacteria 2782
34 Ga0055531_10000001 3300003794 Bacteria 543586
35 Ga0055531_10011952 3300003794 Bacteria 4129
36 Ga0065165_1000836 3300005262 Bacteria 40452
37 Ga0065165_1003047 3300005262 Bacteria 12576
38 Ga0065707_10084569 3300005295 Bacteria 7048
39 Ga0070658_10216772 3300005327 Bacteria 1618
40 Ga0070658_10247639 3300005327 Bacteria 1511
41 Ga0070658_10775629 3300005327 Bacteria 833
42 Ga0070676_10008317 3300005328 Bacteria 5590
43 Ga0070676_10010756 3300005328 Bacteria 4965
44 Ga0070676_10081103 3300005328 Bacteria 1968
45 Ga0070683_100231589 3300005329 Bacteria 1756
46 Ga0070683_100802241 3300005329 Bacteria 902
47 Ga0070690_100017502 3300005330 Bacteria 4311
48 Ga0070690_100019706 3300005330 Bacteria 4100
49 Ga0070690_100484460 3300005330 Bacteria 923
50 Ga0070670_100009305 3300005331 Bacteria 8392
51 Ga0070670_100009633 3300005331 Bacteria 8245
52 Ga0070670_100081596 3300005331 Bacteria 2778
53 Ga0070670_100290394 3300005331 Bacteria 1429
54 Ga0070670_100728717 3300005331 Bacteria 893
55 Ga0070677_10007611 3300005333 Bacteria 3621
56 Ga0070677_10019703 3300005333 Bacteria 2448
57 Ga0070677_10045673 3300005333 Bacteria 1748
58 Ga0070677_10057710 3300005333 Bacteria 1592
59 Ga0070677_10061857 3300005333 Bacteria 1547
60 Ga0070677_10112427 3300005333 Bacteria 1218
61 Ga0068869_100007348 3300005334 Bacteria 7032
62 Ga0068869_100019197 3300005334 Bacteria 4665
63 Ga0068869_100029467 3300005334 Bacteria 3846
64 Ga0070666_10024212 3300005335 Bacteria 3954
65 Ga0070666_10259975 3300005335 Bacteria 1230
66 Ga0070680_100047155 3300005336 Bacteria 3508
67 Ga0068868_100007149 3300005338 Bacteria 7933
68 Ga0068868_100008040 3300005338 Bacteria 7542
69 Ga0068868_100078021 3300005338 Bacteria 2651
70 Ga0068868_100095120 3300005338 Bacteria 2404
71 Ga0068868_100148702 3300005338 Bacteria 1928
72 Ga0068868_100235186 3300005338 Bacteria 1538
73 Ga0068868_100359980 3300005338 Bacteria 1248
74 Ga0068868_100411011 3300005338 Bacteria 1170
75 Ga0070660_100165433 3300005339 Bacteria 1784
76 Ga0070660_100193201 3300005339 Bacteria 1649
77 Ga0070689_100037388 3300005340 Bacteria 3712
78 Ga0070689_100199233 3300005340 Bacteria 1634
79 Ga0070687_100086448 3300005343 Bacteria 1724
80 Ga0070661_100005819 3300005344 Bacteria 8479
81 Ga0070661_100089480 3300005344 Bacteria 2279
82 Ga0070661_100288126 3300005344 Bacteria 1275
83 Ga0070661_100300894 3300005344 Bacteria 1249
84 Ga0070668_100007635 3300005347 Bacteria 8026
85 Ga0070668_100068725 3300005347 Bacteria 2754
86 Ga0070668_100090366 3300005347 Bacteria 2412
87 Ga0070668_100364257 3300005347 Bacteria 1226
88 Ga0070669_100012068 3300005353 Bacteria 6131
89 Ga0070669_100031165 3300005353 Bacteria 3851
90 Ga0070669_100038839 3300005353 Bacteria 3457
91 Ga0070669_100152211 3300005353 Bacteria 1791
92 Ga0070669_100287569 3300005353 Bacteria 1319
93 Ga0070675_100002907 3300005354 Bacteria 12912
94 Ga0070675_100009944 3300005354 Bacteria 7417
95 Ga0070675_100054029 3300005354 Bacteria 3304
96 Ga0070675_100077116 3300005354 Bacteria 2773
97 Ga0070675_100135095 3300005354 Bacteria 2104
98 Ga0070675_100213751 3300005354 Bacteria 1677
99 Ga0070675_100913163 3300005354 Bacteria 805
100 Ga0070671_100004848 3300005355 Bacteria 10696
101 Ga0070671_100009961 3300005355 Bacteria 7632
102 Ga0070671_100016969 3300005355 Bacteria 5888
103 Ga0070671_100023124 3300005355 Bacteria 5081
104 Ga0070671_100048071 3300005355 Bacteria 3547
105 Ga0070671_100064228 3300005355 Bacteria 3057
106 Ga0070671_100236517 3300005355 Bacteria 1550
107 Ga0070671_100490293 3300005355 Bacteria 1056
108 Ga0070674_100013025 3300005356 Bacteria 5127
109 Ga0070674_100017473 3300005356 Bacteria 4514
110 Ga0070674_100035720 3300005356 Bacteria 3330
111 Ga0070674_100123792 3300005356 Bacteria 1918
112 Ga0070674_100266210 3300005356 Bacteria 1352
113 Ga0070674_100372436 3300005356 Bacteria 1159
114 Ga0070674_100599488 3300005356 Bacteria 931
115 Ga0070673_100019027 3300005364 Bacteria 4925
116 Ga0070673_100049839 3300005364 Bacteria 3271
117 Ga0070673_100058470 3300005364 Bacteria 3048
118 Ga0070673_100100373 3300005364 Bacteria 2382
119 Ga0070673_100175085 3300005364 Bacteria 1833
120 Ga0070673_100235304 3300005364 Bacteria 1590
121 Ga0070673_100304247 3300005364 Bacteria 1404
122 Ga0070673_100391149 3300005364 Bacteria 1241
123 Ga0070688_100391523 3300005365 Bacteria 1027
124 Ga0070659_100123684 3300005366 Bacteria 2097
125 Ga0070659_100391202 3300005366 Bacteria 1172
126 Ga0070667_100003174 3300005367 Bacteria 14089
127 Ga0070667_100004063 3300005367 Bacteria 12377
128 Ga0070667_100008844 3300005367 Bacteria 8337
129 Ga0070667_100065662 3300005367 Bacteria 3081
130 Ga0070667_100645831 3300005367 Bacteria 977
131 Ga0070700_100091680 3300005441 Bacteria 1984
132 Ga0070700_100314714 3300005441 Bacteria 1148
133 Ga0070708_100063311 3300005445 Bacteria 3311
134 Ga0070663_100018301 3300005455 Bacteria 4590
135 Ga0070663_100371537 3300005455 Bacteria 1162
136 Ga0070678_100022312 3300005456 Bacteria 4192
137 Ga0070678_100073203 3300005456 Bacteria 2571
138 Ga0070678_100083403 3300005456 Bacteria 2429
139 Ga0070678_100108578 3300005456 Bacteria 2166
140 Ga0070678_100109497 3300005456 Bacteria 2158
141 Ga0070678_100144742 3300005456 Bacteria 1906
142 Ga0070678_100192744 3300005456 Bacteria 1677
143 Ga0070678_100295525 3300005456 Bacteria 1375
144 Ga0070662_100021790 3300005457 Bacteria 4379
145 Ga0070662_100036702 3300005457 Bacteria 3469
146 Ga0070662_100039945 3300005457 Bacteria 3339
147 Ga0070662_100105156 3300005457 Bacteria 2143
148 Ga0070662_100151308 3300005457 Bacteria 1807
149 Ga0070681_10176795 3300005458 Bacteria 2057
150 Ga0070681_10237670 3300005458 Bacteria 1736
151 Ga0068867_100000042 3300005459 Bacteria 77140
152 Ga0068867_100002881 3300005459 Bacteria 12104
153 Ga0068867_100005007 3300005459 Bacteria 9339
154 Ga0068867_100010032 3300005459 Bacteria 6675
155 Ga0068867_100027327 3300005459 Bacteria 4099
156 Ga0068867_100045630 3300005459 Bacteria 3215
157 Ga0068867_100078153 3300005459 Bacteria 2488
158 Ga0068867_100080494 3300005459 Bacteria 2453
159 Ga0068867_100171787 3300005459 Bacteria 1717
160 Ga0068867_100290688 3300005459 Bacteria 1343
161 Ga0070685_10191322 3300005466 Bacteria 1324
162 Ga0070706_100003166 3300005467 Bacteria 16258
163 Ga0070707_100072018 3300005468 Bacteria 3330
164 Ga0070707_100512976 3300005468 Bacteria 1161
165 Ga0070698_100072233 3300005471 Bacteria 3459
166 Ga0070679_100024208 3300005530 Bacteria 5949
167 Ga0070684_100556718 3300005535 Bacteria 1064
168 Ga0068853_100008284 3300005539 Bacteria 8344
169 Ga0068853_100144732 3300005539 Bacteria 2135
170 Ga0068853_100278576 3300005539 Bacteria 1541
171 Ga0068853_100294740 3300005539 Bacteria 1498
172 Ga0068853_100405931 3300005539 Bacteria 1276
173 Ga0068853_100407871 3300005539 Bacteria 1273
174 Ga0068853_100429041 3300005539 Bacteria 1241
175 Ga0070672_100000214 3300005543 Bacteria 31887
176 Ga0070672_100003206 3300005543 Bacteria 10589
177 Ga0070672_100012364 3300005543 Bacteria 5989
178 Ga0070672_100111789 3300005543 Bacteria 2227
179 Ga0070672_100132610 3300005543 Bacteria 2049
180 Ga0070672_100137980 3300005543 Bacteria 2009
181 Ga0070672_100286236 3300005543 Bacteria 1394
182 Ga0070672_100378726 3300005543 Bacteria 1210
183 Ga0070693_100446755 3300005547 Bacteria 906
184 Ga0070665_100005964 3300005548 Bacteria 12470
185 Ga0070665_100158040 3300005548 Bacteria 2269
186 Ga0070665_100208289 3300005548 Bacteria 1956
187 Ga0070665_100326872 3300005548 Bacteria 1538
188 Ga0068855_100099856 3300005563 Bacteria 3342
189 Ga0068855_100203891 3300005563 Bacteria 2225
190 Ga0070664_100010180 3300005564 Bacteria 7627
191 Ga0070664_100038998 3300005564 Bacteria 4001
192 Ga0070664_100051636 3300005564 Bacteria 3481
193 Ga0070664_100081876 3300005564 Bacteria 2782
194 Ga0070664_100195387 3300005564 Bacteria 1803
195 Ga0068857_100001367 3300005577 Bacteria 19219
196 Ga0068857_100045914 3300005577 Bacteria 3876
197 Ga0068857_100469934 3300005577 Bacteria 1178
198 Ga0068854_100008084 3300005578 Bacteria 6746
199 Ga0068854_100093052 3300005578 Bacteria 2246
200 Ga0068854_100231763 3300005578 Bacteria 1466
201 Ga0068856_100019461 3300005614 Bacteria 6589
202 Ga0068856_100190462 3300005614 Bacteria 2065
203 Ga0068856_100367005 3300005614 Bacteria 1458
204 Ga0070702_100104818 3300005615 Bacteria 1741
205 Ga0068852_100008019 3300005616 Bacteria 7746
206 Ga0068852_100011640 3300005616 Bacteria 6635
207 Ga0068852_100048307 3300005616 Bacteria 3635
208 Ga0068852_100073257 3300005616 Bacteria 3012
209 Ga0068852_100177745 3300005616 Bacteria 1999
210 Ga0068852_100187534 3300005616 Bacteria 1949
211 Ga0068852_100279862 3300005616 Bacteria 1608
212 Ga0068852_100437440 3300005616 Bacteria 1292
213 Ga0068852_100581796 3300005616 Bacteria 1122
214 Ga0068859_100003371 3300005617 Bacteria 16241
215 Ga0068859_100035640 3300005617 Bacteria 4993
216 Ga0068859_100233270 3300005617 Bacteria 1929
217 Ga0068859_100384114 3300005617 Bacteria 1500
218 Ga0068864_100001559 3300005618 Bacteria 18876
219 Ga0068864_100012414 3300005618 Bacteria 7045
220 Ga0068864_100031702 3300005618 Bacteria 4486
221 Ga0068864_100037258 3300005618 Bacteria 4150
222 Ga0068864_100049747 3300005618 Bacteria 3607
223 Ga0068864_100097230 3300005618 Bacteria 2606
224 Ga0068864_100137810 3300005618 Bacteria 2198
225 Ga0068864_100155641 3300005618 Bacteria 2074
226 Ga0068864_100521484 3300005618 Bacteria 1145
227 Ga0068864_100562440 3300005618 Bacteria 1103
228 Ga0068866_10002006 3300005718 Bacteria 8473
229 Ga0068866_10017749 3300005718 Bacteria 3205
230 Ga0068866_10072147 3300005718 Bacteria 1828
231 Ga0068861_100000532 3300005719 Bacteria 22319
232 Ga0068861_100013654 3300005719 Bacteria 5687
233 Ga0068861_100084254 3300005719 Bacteria 2495
234 Ga0068861_100261087 3300005719 Bacteria 1483
235 Ga0068861_101255109 3300005719 Bacteria 719
236 Ga0068851_10020913 3300005834 Bacteria 3173
237 Ga0068851_10067896 3300005834 Bacteria 1840
238 Ga0068851_10159697 3300005834 Bacteria 1237
239 Ga0068851_10381614 3300005834 Bacteria 826
240 Ga0068870_10007498 3300005840 Bacteria 4868
241 Ga0068870_10061290 3300005840 Bacteria 2022
242 Ga0068870_10602287 3300005840 Bacteria 747
243 Ga0068870_10625302 3300005840 Bacteria 734
244 Ga0068863_100004398 3300005841 Bacteria 13892
245 Ga0068863_100021795 3300005841 Bacteria 6114
246 Ga0068863_100154370 3300005841 Bacteria 2198
247 Ga0068863_100170460 3300005841 Bacteria 2087
248 Ga0068863_100234480 3300005841 Bacteria 1771
249 Ga0068858_100002862 3300005842 Bacteria 17353
250 Ga0068858_100005186 3300005842 Bacteria 12762
251 Ga0068858_100134191 3300005842 Bacteria 2322
252 Ga0068858_100365770 3300005842 Bacteria 1383
253 Ga0068858_100750717 3300005842 Bacteria 951
254 Ga0068860_100007631 3300005843 Bacteria 10824
255 Ga0068860_100027719 3300005843 Bacteria 5455
256 Ga0068860_100050579 3300005843 Bacteria 3955
257 Ga0068860_100478826 3300005843 Bacteria 1241
258 Ga0068860_100702461 3300005843 Bacteria 1021
259 Ga0068862_100011630 3300005844 Bacteria 7262
260 Ga0068862_100021891 3300005844 Bacteria 5346
261 Ga0068862_100044354 3300005844 Bacteria 3793
262 Ga0068862_100299030 3300005844 Bacteria 1480
263 Ga0068862_100902779 3300005844 Bacteria 869
264 Ga0075368_10004618 3300006042 Bacteria 4682
265 Ga0075368_10044832 3300006042 Bacteria 1746
266 Ga0075368_10060057 3300006042 Bacteria 1522
267 Ga0075363_100023918 3300006048 Bacteria 3102
268 Ga0075363_100128897 3300006048 Bacteria 1418
269 Ga0075364_10243101 3300006051 Bacteria 1223
270 Ga0075432_10076876 3300006058 Bacteria 1206
271 Ga0070715_10175733 3300006163 Bacteria 1070
272 Ga0075362_10016384 3300006177 Bacteria 3034
273 Ga0075362_10051026 3300006177 Bacteria 1851
274 Ga0075362_10061016 3300006177 Bacteria 1705
275 Ga0075367_10003951 3300006178 Bacteria 7153
276 Ga0075367_10055501 3300006178 Bacteria 2351
277 Ga0075367_10107393 3300006178 Bacteria 1711
278 Ga0075369_10013422 3300006186 Bacteria 3252
279 Ga0075369_10091722 3300006186 Bacteria 1356
280 Ga0075369_10097041 3300006186 Bacteria 1320
281 Ga0075366_10001365 3300006195 Bacteria 12201
282 Ga0075366_10001515 3300006195 Bacteria 11597
283 Ga0075366_10002469 3300006195 Bacteria 9470
284 Ga0075366_10044579 3300006195 Bacteria 2629
285 Ga0075366_10056238 3300006195 Bacteria 2337
286 Ga0075366_10074701 3300006195 Bacteria 2021
287 Ga0075366_10083894 3300006195 Bacteria 1904
288 Ga0075366_10111437 3300006195 Bacteria 1646
289 Ga0075366_10133817 3300006195 Bacteria 1497
290 Ga0075366_10149214 3300006195 Bacteria 1415
291 Ga0075366_10187262 3300006195 Bacteria 1257
292 Ga0075366_10194922 3300006195 Bacteria 1231
293 Ga0075366_10222552 3300006195 Bacteria 1150
294 Ga0075366_10317254 3300006195 Bacteria 954
295 Ga0075366_10327403 3300006195 Bacteria 939
296 Ga0097621_100014007 3300006237 Bacteria 5991
297 Ga0097621_100044502 3300006237 Bacteria 3581
298 Ga0097621_100321429 3300006237 Bacteria 1371
299 Ga0097621_100352274 3300006237 Bacteria 1309
300 Ga0075370_10003547 3300006353 Bacteria 7454
301 Ga0075370_10003987 3300006353 Bacteria 7092
302 Ga0075370_10005826 3300006353 Bacteria 6156
303 Ga0075370_10116873 3300006353 Bacteria 1550
304 Ga0075370_10170466 3300006353 Bacteria 1279
305 Ga0075370_10281879 3300006353 Bacteria 987
306 Ga0068871_100023551 3300006358 Bacteria 4765
307 Ga0068871_100028476 3300006358 Bacteria 4379
308 Ga0068871_100053309 3300006358 Bacteria 3277
309 Ga0068871_100149108 3300006358 Bacteria 1993
310 Ga0068871_100444250 3300006358 Bacteria 1161
311 Ga0075430_100065902 3300006846 Bacteria 3042
312 Ga0075433_10575585 3300006852 Bacteria 989
313 Ga0075429_100229141 3300006880 Bacteria 1627
314 Ga0075429_100949764 3300006880 Bacteria 752
315 Ga0068865_100017684 3300006881 Bacteria 4589
316 Ga0068865_100023045 3300006881 Bacteria 4071
317 Ga0068865_100074788 3300006881 Bacteria 2414
318 Ga0068865_100188060 3300006881 Bacteria 1595
319 Ga0068865_100357524 3300006881 Bacteria 1185
320 Ga0068865_100360153 3300006881 Bacteria 1181
321 Ga0068865_100407493 3300006881 Bacteria 1115
322 Ga0068865_100766538 3300006881 Bacteria 830
323 Ga0097620_100003371 3300006931 Bacteria 16241
324 Ga0097620_100035640 3300006931 Bacteria 4993
325 Ga0097620_100233247 3300006931 Bacteria 1929
326 Ga0097620_100384094 3300006931 Bacteria 1500
327 Ga0099824_1044356 3300006942 Bacteria 965
328 Ga0099823_1000478 3300006944 Bacteria 26702
329 Ga0079104_1000073 3300006946 Bacteria 152269
330 Ga0105240_10238988 3300009093 Bacteria 2107
331 Ga0105240_10316716 3300009093 Bacteria 1779
332 Ga0105240_10406912 3300009093 Bacteria 1531
333 Ga0111539_11204405 3300009094 Bacteria 880
334 Ga0111539_11424277 3300009094 Bacteria 804
335 Ga0105245_10040028 3300009098 Bacteria 4173
336 Ga0105245_10057446 3300009098 Bacteria 3500
337 Ga0105245_10080074 3300009098 Bacteria 2984
338 Ga0105247_10152680 3300009101 Bacteria 1523
339 Ga0114129_10221541 3300009147 Bacteria 2552
340 Ga0114129_10816605 3300009147 Bacteria 1188
341 Ga0105243_10000525 3300009148 Bacteria 39020
342 Ga0105243_10016853 3300009148 Bacteria 5523
343 Ga0105243_10103056 3300009148 Bacteria 2372
344 Ga0105243_10108081 3300009148 Bacteria 2321
345 Ga0105243_10233869 3300009148 Bacteria 1632
346 Ga0105243_10308096 3300009148 Bacteria 1438
347 Ga0105243_10583100 3300009148 Bacteria 1074
348 Ga0105241_10177180 3300009174 Bacteria 1765
349 Ga0105241_10265770 3300009174 Bacteria 1459
350 Ga0105241_10271203 3300009174 Bacteria 1446
351 Ga0105241_11281576 3300009174 Bacteria 697
352 Ga0105242_10201510 3300009176 Bacteria 1768
353 Ga0105242_10227154 3300009176 Bacteria 1671
354 Ga0105242_10402634 3300009176 Bacteria 1278
355 Ga0105242_10954026 3300009176 Bacteria 862
356 Ga0105248_10004278 3300009177 Bacteria 15797
357 Ga0105248_10020342 3300009177 Bacteria 7353
358 Ga0105248_10034541 3300009177 Bacteria 5655
359 Ga0105248_10096649 3300009177 Bacteria 3327
360 Ga0105248_10472538 3300009177 Bacteria 1413
361 Ga0105248_10687688 3300009177 Bacteria 1154
362 Ga0105237_10000293 3300009545 Bacteria 69295
363 Ga0105237_10010430 3300009545 Bacteria 9881
364 Ga0105237_10124824 3300009545 Bacteria 2569
365 Ga0105237_10339544 3300009545 Bacteria 1507
366 Ga0105238_10003562 3300009551 Bacteria 15522
367 Ga0105238_10068232 3300009551 Bacteria 3557
368 Ga0105238_10094092 3300009551 Bacteria 2984
369 Ga0105249_10001432 3300009553 Bacteria 20917
370 Ga0105249_10012730 3300009553 Bacteria 7414
371 Ga0105249_10020599 3300009553 Bacteria 5896
372 Ga0105249_10720438 3300009553 Bacteria 1059
373 Ga0105239_10002857 3300010375 Bacteria 21611
374 Ga0105239_10075916 3300010375 Bacteria 3696
375 Ga0105239_10092418 3300010375 Bacteria 3340
376 Ga0105246_10509203 3300011119 Bacteria 1024
377 Ga0157327_1002776 3300012512 Bacteria 1238
378 Ga0157326_1035709 3300012513 Bacteria 677
379 Ga0157371_10075565 3300013102 Bacteria 2386
380 Ga0157371_10107401 3300013102 Bacteria 1981
381 Ga0157371_10235021 3300013102 Bacteria 1318
382 Ga0157371_10277075 3300013102 Bacteria 1211
383 Ga0157369_10097256 3300013105 Bacteria 3140
384 Ga0157369_10097287 3300013105 Bacteria 3140
385 Ga0157374_10012660 3300013296 Bacteria 7347
386 Ga0157374_10023686 3300013296 Bacteria 5495
387 Ga0157374_10023909 3300013296 Bacteria 5473
388 Ga0157374_10139538 3300013296 Bacteria 2352
389 Ga0157374_10802172 3300013296 Bacteria 957
390 Ga0157374_10989530 3300013296 Bacteria 860
391 Ga0157378_10002431 3300013297 Bacteria 16564
392 Ga0157378_10058929 3300013297 Bacteria 3425
393 Ga0157378_10071947 3300013297 Bacteria 3106
394 Ga0157378_10102354 3300013297 Bacteria 2616
395 Ga0157378_10225438 3300013297 Bacteria 1783
396 Ga0157378_10352336 3300013297 Bacteria 1438
397 Ga0157378_10554131 3300013297 Bacteria 1155
398 Ga0163162_10001627 3300013306 Bacteria 21036
399 Ga0163162_10019603 3300013306 Bacteria 6639
400 Ga0163162_10244234 3300013306 Bacteria 1927
401 Ga0157372_10030878 3300013307 Bacteria 5863
402 Ga0157372_10201706 3300013307 Bacteria 2304
403 Ga0157372_10321478 3300013307 Bacteria 1802
404 Ga0157375_10008159 3300013308 Bacteria 9164
405 Ga0157375_10016322 3300013308 Bacteria 6666
406 Ga0157375_10056678 3300013308 Bacteria 3870
407 Ga0157375_10063864 3300013308 Bacteria 3665
408 Ga0157375_10066431 3300013308 Bacteria 3601
409 Ga0157375_10126863 3300013308 Bacteria 2667
410 Ga0157375_10191158 3300013308 Bacteria 2202
411 Ga0157375_11167324 3300013308 Bacteria 902
412 Ga0163163_10009402 3300014325 Bacteria 8727
413 Ga0163163_10153059 3300014325 Bacteria 2349
414 Ga0163163_10848203 3300014325 Bacteria 977
415 Ga0157380_10006027 3300014326 Bacteria 8491
416 Ga0157380_10006297 3300014326 Bacteria 8337
417 Ga0157380_10028112 3300014326 Bacteria 4284
418 Ga0157380_10203981 3300014326 Bacteria 1756
419 Ga0157380_10221352 3300014326 Bacteria 1693
420 Ga0157380_10509047 3300014326 Bacteria 1171
421 Ga0157377_10000038 3300014745 Bacteria 113777
422 Ga0157377_10000784 3300014745 Bacteria 13139
423 Ga0157379_10001736 3300014968 Bacteria 18030
424 Ga0157379_10002470 3300014968 Bacteria 15473
425 Ga0157379_10015679 3300014968 Bacteria 6659
426 Ga0157379_10018191 3300014968 Bacteria 6192
427 Ga0157379_10038599 3300014968 Bacteria 4260
428 Ga0157379_10047186 3300014968 Bacteria 3842
429 Ga0157379_10055645 3300014968 Bacteria 3534
430 Ga0157379_10263463 3300014968 Bacteria 1566
431 Ga0157379_10318507 3300014968 Bacteria 1420
432 Ga0157379_10339058 3300014968 Bacteria 1375
433 Ga0157379_10539603 3300014968 Bacteria 1084
434 Ga0157376_10023720 3300014969 Bacteria 4807
435 Ga0157376_10061547 3300014969 Bacteria 3156
436 Ga0157376_10092091 3300014969 Bacteria 2627
437 Ga0157376_10179041 3300014969 Bacteria 1936
438 Ga0157376_10360712 3300014969 Bacteria 1394
439 Ga0182006_1121151 3300015261 Bacteria 908
440 Ga0182007_10076658 3300015262 Bacteria 1096
441 Ga0182005_1076329 3300015265 Bacteria 923
442 Ga0163161_10005593 3300017792 Bacteria 8712
443 Ga0163161_10043874 3300017792 Bacteria 3220
444 Ga0163161_10113550 3300017792 Bacteria 2028
445 Ga0213872_10000006 3300021361 Bacteria 249845
446 Ga0213872_10000085 3300021361 Bacteria 85496
447 Ga0213872_10001073 3300021361 Bacteria 18880
448 Ga0213872_10057925 3300021361 Bacteria 1754
449 Ga0209674_100041 3300025226 Bacteria 396231
450 Ga0209672_104503 3300025228 Bacteria 2576
451 Ga0209563_100043 3300025230 Bacteria 397271
452 Ga0209563_100044 3300025230 Bacteria 396812
453 Ga0207427_100341 3300025231 Bacteria 30455
454 Ga0209258_100515 3300025242 Bacteria 37293
455 Ga0209258_100693 3300025242 Bacteria 23226
456 Ga0207425_1000802 3300025245 Bacteria 15938
457 Ga0207425_1018613 3300025245 Bacteria 1505
458 Ga0209646_1000069 3300025246 Bacteria 230340
459 Ga0209026_1000006 3300025250 Bacteria 677225
460 Ga0209677_100077 3300025253 Bacteria 126245
461 Ga0209677_101016 3300025253 Bacteria 13419
462 Ga0209677_104838 3300025253 Bacteria 3716
463 Ga0209759_1000189 3300025256 Bacteria 98732
464 Ga0209759_1002556 3300025256 Bacteria 7893
465 Ga0209759_1005450 3300025256 Bacteria 4455
466 Ga0209759_1006592 3300025256 Bacteria 3877
467 Ga0209129_1000012 3300025258 Bacteria 541516
468 Ga0209565_1024949 3300025263 Bacteria 1212
469 Ga0209455_1000597 3300025272 Bacteria 23218
470 Ga0209673_1001736 3300025273 Bacteria 18320
471 Ga0209673_1005928 3300025273 Bacteria 6031
472 Ga0209673_1007378 3300025273 Bacteria 5086
473 Ga0209673_1014115 3300025273 Bacteria 3109
474 Ga0207673_1020590 3300025290 Bacteria 890
475 Ga0209564_1000008 3300025295 Bacteria 953227
476 Ga0209564_1000022 3300025295 Bacteria 555109
477 Ga0209758_1000099 3300025297 Bacteria 230054
478 Ga0209758_1000234 3300025297 Bacteria 116217
479 Ga0209050_1000691 3300025298 Bacteria 50632
480 Ga0209050_1002840 3300025298 Bacteria 13744
481 Ga0209050_1012415 3300025298 Bacteria 3908
482 Ga0209050_1015253 3300025298 Bacteria 3243
483 Ga0209256_1000036 3300025299 Bacteria 386664
484 Ga0209256_1002027 3300025299 Bacteria 18044
485 Ga0209256_1022129 3300025299 Bacteria 1933
486 Ga0209051_1000068 3300025303 Bacteria 220063
487 Ga0209051_1001546 3300025303 Bacteria 19061
488 Ga0209051_1004282 3300025303 Bacteria 8877
489 Ga0209051_1011828 3300025303 Bacteria 4272
490 Ga0209051_1044190 3300025303 Bacteria 1554
491 Ga0209257_1000033 3300025304 Bacteria 671006
492 Ga0209257_1000146 3300025304 Bacteria 194261
493 Ga0209257_1018570 3300025304 Bacteria 2667
494 Ga0207697_10082007 3300025315 Bacteria 1359
495 Ga0207656_10037754 3300025321 Bacteria 2034
496 Ga0207656_10253131 3300025321 Bacteria 863
497 Ga0207682_10002764 3300025893 Bacteria 7775
498 Ga0207682_10006249 3300025893 Bacteria 4811
499 Ga0207682_10022286 3300025893 Bacteria 2495
500 Ga0207682_10057601 3300025893 Bacteria 1620
501 Ga0207682_10069461 3300025893 Bacteria 1490
502 Ga0207642_10007749 3300025899 Bacteria 3640
503 Ga0207642_10030199 3300025899 Bacteria 2255
504 Ga0207642_10032222 3300025899 Bacteria 2204
505 Ga0207680_10013435 3300025903 Bacteria 4206
506 Ga0207680_10064225 3300025903 Bacteria 2250
507 Ga0207680_10548713 3300025903 Bacteria 825
508 Ga0207645_10003679 3300025907 Bacteria 11565
509 Ga0207645_10010823 3300025907 Bacteria 6252
510 Ga0207645_10027395 3300025907 Bacteria 3680
511 Ga0207645_10032784 3300025907 Bacteria 3339
512 Ga0207645_10034580 3300025907 Bacteria 3247
513 Ga0207645_10123856 3300025907 Bacteria 1679
514 Ga0207645_10184706 3300025907 Bacteria 1368
515 Ga0207645_10329518 3300025907 Bacteria 1019
516 Ga0207645_10343404 3300025907 Bacteria 998
517 Ga0207643_10009192 3300025908 Bacteria 5306
518 Ga0207643_10106545 3300025908 Bacteria 1648
519 Ga0207705_10031141 3300025909 Bacteria 3806
520 Ga0207705_10074065 3300025909 Bacteria 2471
521 Ga0207705_10100357 3300025909 Bacteria 2129
522 Ga0207705_10158779 3300025909 Bacteria 1698
523 Ga0207684_10002063 3300025910 Bacteria 20676
524 Ga0207707_10117012 3300025912 Bacteria 2330
525 Ga0207707_10137881 3300025912 Bacteria 2133
526 Ga0207695_10054703 3300025913 Bacteria 4165
527 Ga0207695_10110263 3300025913 Bacteria 2732
528 Ga0207671_10002885 3300025914 Bacteria 17803
529 Ga0207671_10056267 3300025914 Bacteria 2914
530 Ga0207671_10289600 3300025914 Bacteria 1293
531 Ga0207660_10018222 3300025917 Bacteria 4677
532 Ga0207662_10010982 3300025918 Bacteria 5011
533 Ga0207662_10051527 3300025918 Bacteria 2449
534 Ga0207657_10119150 3300025919 Bacteria 2172
535 Ga0207657_10165076 3300025919 Bacteria 1797
536 Ga0207657_10213629 3300025919 Bacteria 1547
537 Ga0207657_10326074 3300025919 Bacteria 1213
538 Ga0207657_10331574 3300025919 Bacteria 1202
539 Ga0207649_10001094 3300025920 Bacteria 16484
540 Ga0207649_10051405 3300025920 Bacteria 2552
541 Ga0207649_10312387 3300025920 Bacteria 1152
542 Ga0207649_10384869 3300025920 Bacteria 1046
543 Ga0207652_10013195 3300025921 Bacteria 6691
544 Ga0207681_10015959 3300025923 Bacteria 4690
545 Ga0207681_10028289 3300025923 Bacteria 3630
546 Ga0207681_10096707 3300025923 Bacteria 2120
547 Ga0207681_10126404 3300025923 Bacteria 1883
548 Ga0207681_11176146 3300025923 Bacteria 644
549 Ga0207694_10036898 3300025924 Bacteria 3751
550 Ga0207694_10242241 3300025924 Bacteria 1474
551 Ga0207694_10536374 3300025924 Bacteria 981
552 Ga0207650_10001670 3300025925 Bacteria 15762
553 Ga0207650_10003627 3300025925 Bacteria 10576
554 Ga0207650_10005846 3300025925 Bacteria 8397
555 Ga0207650_10064306 3300025925 Bacteria 2746
556 Ga0207650_10195654 3300025925 Bacteria 1617
557 Ga0207659_10002852 3300025926 Bacteria 10305
558 Ga0207659_10008593 3300025926 Bacteria 6350
559 Ga0207659_10055044 3300025926 Bacteria 2843
560 Ga0207659_10115972 3300025926 Bacteria 2044
561 Ga0207659_10238027 3300025926 Bacteria 1471
562 Ga0207659_10457999 3300025926 Bacteria 1075
563 Ga0207659_10580892 3300025926 Bacteria 954
564 Ga0207687_10062753 3300025927 Bacteria 2629
565 Ga0207687_10088022 3300025927 Bacteria 2258
566 Ga0207687_10092521 3300025927 Bacteria 2208
567 Ga0207687_10246672 3300025927 Bacteria 1418
568 Ga0207644_10014014 3300025931 Bacteria 5358
569 Ga0207644_10024985 3300025931 Bacteria 4104
570 Ga0207644_10048053 3300025931 Bacteria 3048
571 Ga0207644_10130504 3300025931 Bacteria 1923
572 Ga0207644_10347617 3300025931 Bacteria 1203
573 Ga0207644_10519550 3300025931 Bacteria 983
574 Ga0207644_11059510 3300025931 Bacteria 681
575 Ga0207690_10002003 3300025932 Bacteria 12479
576 Ga0207690_10017625 3300025932 Bacteria 4366
577 Ga0207690_10236024 3300025932 Bacteria 1406
578 Ga0207690_10383752 3300025932 Bacteria 1117
579 Ga0207690_10401396 3300025932 Bacteria 1093
580 Ga0207690_11197902 3300025932 Bacteria 634
581 Ga0207706_10003398 3300025933 Bacteria 15204
582 Ga0207706_10003614 3300025933 Bacteria 14775
583 Ga0207706_10057563 3300025933 Bacteria 3424
584 Ga0207706_10105780 3300025933 Bacteria 2476
585 Ga0207706_10185836 3300025933 Bacteria 1825
586 Ga0207686_10160889 3300025934 Bacteria 1573
587 Ga0207686_10262340 3300025934 Bacteria 1267
588 Ga0207686_10328181 3300025934 Bacteria 1146
589 Ga0207686_10342093 3300025934 Bacteria 1124
590 Ga0207709_10001781 3300025935 Bacteria 14449
591 Ga0207709_10006230 3300025935 Bacteria 6708
592 Ga0207709_10339145 3300025935 Bacteria 1131
593 Ga0207670_10280059 3300025936 Bacteria 1299
594 Ga0207669_10007179 3300025937 Bacteria 5131
595 Ga0207669_10066197 3300025937 Bacteria 2245
596 Ga0207669_10205381 3300025937 Bacteria 1433
597 Ga0207669_10420893 3300025937 Bacteria 1051
598 Ga0207704_10000810 3300025938 Bacteria 13815
599 Ga0207704_10026710 3300025938 Bacteria 3172
600 Ga0207704_10031983 3300025938 Bacteria 2971
601 Ga0207704_10035673 3300025938 Bacteria 2853
602 Ga0207704_10313538 3300025938 Bacteria 1207
603 Ga0207665_10101598 3300025939 Bacteria 2008
604 Ga0207691_10002842 3300025940 Bacteria 16869
605 Ga0207691_10003320 3300025940 Bacteria 15667
606 Ga0207691_10012250 3300025940 Bacteria 8221
607 Ga0207691_10031619 3300025940 Bacteria 4938
608 Ga0207691_10037603 3300025940 Bacteria 4482
609 Ga0207691_10087976 3300025940 Bacteria 2786
610 Ga0207691_10128681 3300025940 Bacteria 2238
611 Ga0207711_10024886 3300025941 Bacteria 5022
612 Ga0207711_10033943 3300025941 Bacteria 4319
613 Ga0207711_10046960 3300025941 Bacteria 3690
614 Ga0207711_10058246 3300025941 Bacteria 3323
615 Ga0207711_10067665 3300025941 Bacteria 3092
616 Ga0207711_10261951 3300025941 Bacteria 1589
617 Ga0207711_10645761 3300025941 Bacteria 987
618 Ga0207689_10004129 3300025942 Bacteria 13196
619 Ga0207689_10015115 3300025942 Bacteria 6544
620 Ga0207689_10018115 3300025942 Bacteria 5947
621 Ga0207689_10048816 3300025942 Bacteria 3492
622 Ga0207689_10131531 3300025942 Bacteria 2059
623 Ga0207689_10151649 3300025942 Bacteria 1911
624 Ga0207661_10150790 3300025944 Bacteria 2009
625 Ga0207661_10364047 3300025944 Bacteria 1306
626 Ga0207679_10008499 3300025945 Bacteria 6542
627 Ga0207679_10027429 3300025945 Bacteria 3938
628 Ga0207679_10118822 3300025945 Bacteria 2100
629 Ga0207679_10179239 3300025945 Bacteria 1751
630 Ga0207679_10239298 3300025945 Bacteria 1537
631 Ga0207679_10277212 3300025945 Bacteria 1437
632 Ga0207679_10279880 3300025945 Bacteria 1430
633 Ga0207679_10387234 3300025945 Bacteria 1227
634 Ga0207679_10453038 3300025945 Bacteria 1138
635 Ga0207667_10057801 3300025949 Bacteria 4070
636 Ga0207667_10074299 3300025949 Bacteria 3531
637 Ga0207667_10178337 3300025949 Bacteria 2182
638 Ga0207667_10191020 3300025949 Bacteria 2101
639 Ga0207667_10278911 3300025949 Bacteria 1708
640 Ga0207667_10728589 3300025949 Bacteria 992
641 Ga0207651_10012328 3300025960 Bacteria 4833
642 Ga0207651_10018112 3300025960 Bacteria 4182
643 Ga0207651_10035487 3300025960 Bacteria 3243
644 Ga0207651_10184451 3300025960 Bacteria 1658
645 Ga0207651_10186327 3300025960 Bacteria 1651
646 Ga0207651_10589679 3300025960 Bacteria 970
647 Ga0207712_10004226 3300025961 Bacteria 9060
648 Ga0207712_10006036 3300025961 Bacteria 7641
649 Ga0207712_10123761 3300025961 Bacteria 1961
650 Ga0207712_10375602 3300025961 Bacteria 1188
651 Ga0207668_10013659 3300025972 Bacteria 5009
652 Ga0207668_10028650 3300025972 Bacteria 3644
653 Ga0207668_10240814 3300025972 Bacteria 1463
654 Ga0207668_10419226 3300025972 Bacteria 1136
655 Ga0207640_10003992 3300025981 Bacteria 7969
656 Ga0207640_10072562 3300025981 Bacteria 2323
657 Ga0207640_10073987 3300025981 Bacteria 2304
658 Ga0207640_10262206 3300025981 Bacteria 1347
659 Ga0207658_10003042 3300025986 Bacteria 11987
660 Ga0207658_10005459 3300025986 Bacteria 8722
661 Ga0207658_10016705 3300025986 Bacteria 5051
662 Ga0207658_10172763 3300025986 Bacteria 1782
663 Ga0207658_10246403 3300025986 Bacteria 1516
664 Ga0207658_10464734 3300025986 Bacteria 1122
665 Ga0207658_10570336 3300025986 Bacteria 1014
666 Ga0207658_10624764 3300025986 Bacteria 969
667 Ga0207677_10035383 3300026023 Bacteria 3243
668 Ga0207677_10053941 3300026023 Bacteria 2740
669 Ga0207677_10093173 3300026023 Bacteria 2195
670 Ga0207677_10105233 3300026023 Bacteria 2088
671 Ga0207677_10305150 3300026023 Bacteria 1316
672 Ga0207677_10393288 3300026023 Bacteria 1173
673 Ga0207703_10007785 3300026035 Bacteria 8479
674 Ga0207703_10020766 3300026035 Bacteria 5139
675 Ga0207703_10037216 3300026035 Bacteria 3876
676 Ga0207703_10118229 3300026035 Bacteria 2272
677 Ga0207703_10127660 3300026035 Bacteria 2192
678 Ga0207703_10298809 3300026035 Bacteria 1468
679 Ga0207703_10369466 3300026035 Bacteria 1325
680 Ga0207639_10060943 3300026041 Bacteria 2912
681 Ga0207639_10240583 3300026041 Bacteria 1573
682 Ga0207639_10284363 3300026041 Bacteria 1456
683 Ga0207639_10308364 3300026041 Bacteria 1401
684 Ga0207639_10718561 3300026041 Bacteria 928
685 Ga0207639_10879865 3300026041 Bacteria 837
686 Ga0207678_10004010 3300026067 Bacteria 13252
687 Ga0207678_10048730 3300026067 Bacteria 3661
688 Ga0207678_10101468 3300026067 Bacteria 2457
689 Ga0207678_10166070 3300026067 Bacteria 1885
690 Ga0207678_10188630 3300026067 Bacteria 1761
691 Ga0207678_10381762 3300026067 Bacteria 1218
692 Ga0207678_11358459 3300026067 Bacteria 628
693 Ga0207708_10026826 3300026075 Bacteria 4361
694 Ga0207708_10046076 3300026075 Bacteria 3322
695 Ga0207708_10056463 3300026075 Bacteria 2995
696 Ga0207702_10084197 3300026078 Bacteria 2768
697 Ga0207702_10479534 3300026078 Bacteria 1210
698 Ga0207702_10662444 3300026078 Bacteria 1027
699 Ga0207641_10002465 3300026088 Bacteria 17092
700 Ga0207641_10048522 3300026088 Bacteria 3583
701 Ga0207641_10101777 3300026088 Bacteria 2532
702 Ga0207641_10119819 3300026088 Bacteria 2346
703 Ga0207641_10175133 3300026088 Bacteria 1961
704 Ga0207641_10430282 3300026088 Bacteria 1272
705 Ga0207641_10559951 3300026088 Bacteria 1115
706 Ga0207641_10707034 3300026088 Bacteria 993
707 Ga0207641_10740094 3300026088 Bacteria 970
708 Ga0207648_10000118 3300026089 Bacteria 77144
709 Ga0207648_10000842 3300026089 Bacteria 34576
710 Ga0207648_10005129 3300026089 Bacteria 13267
711 Ga0207648_10006969 3300026089 Bacteria 11186
712 Ga0207648_10024991 3300026089 Bacteria 5325
713 Ga0207648_10048224 3300026089 Bacteria 3730
714 Ga0207648_10096211 3300026089 Bacteria 2591
715 Ga0207648_10344581 3300026089 Bacteria 1342
716 Ga0207648_10401067 3300026089 Bacteria 1243
717 Ga0207676_10058884 3300026095 Bacteria 3032
718 Ga0207676_10070932 3300026095 Bacteria 2795
719 Ga0207676_10099637 3300026095 Bacteria 2405
720 Ga0207676_10148246 3300026095 Bacteria 2017
721 Ga0207676_10317590 3300026095 Bacteria 1428
722 Ga0207676_10535952 3300026095 Bacteria 1116
723 Ga0207674_10021612 3300026116 Bacteria 6927
724 Ga0207674_10069067 3300026116 Bacteria 3554
725 Ga0207674_10102519 3300026116 Bacteria 2842
726 Ga0207674_10235918 3300026116 Bacteria 1777
727 Ga0207674_10385128 3300026116 Bacteria 1356
728 Ga0207675_100001529 3300026118 Bacteria 23189
729 Ga0207675_100017659 3300026118 Bacteria 6655
730 Ga0207675_100033361 3300026118 Bacteria 4797
731 Ga0207675_100033388 3300026118 Bacteria 4795
732 Ga0207675_100052353 3300026118 Bacteria 3809
733 Ga0207675_100164655 3300026118 Bacteria 2117
734 Ga0207675_100284304 3300026118 Bacteria 1608
735 Ga0207675_100584014 3300026118 Bacteria 1119
736 Ga0207675_101081565 3300026118 Bacteria 821
737 Ga0207683_10044884 3300026121 Bacteria 3864
738 Ga0207683_10087739 3300026121 Bacteria 2767
739 Ga0207683_10098615 3300026121 Bacteria 2607
740 Ga0207683_10112711 3300026121 Bacteria 2436
741 Ga0207683_10152584 3300026121 Bacteria 2085
742 Ga0207683_10304377 3300026121 Bacteria 1458
743 Ga0207683_10405959 3300026121 Bacteria 1254
744 Ga0207683_10634584 3300026121 Bacteria 989
745 Ga0207698_10001763 3300026142 Bacteria 12625
746 Ga0207698_10074135 3300026142 Bacteria 2713
747 Ga0207698_10089371 3300026142 Bacteria 2515
748 Ga0207698_10094822 3300026142 Bacteria 2455
749 Ga0207698_10219326 3300026142 Bacteria 1717
750 Ga0207698_10376661 3300026142 Bacteria 1349
751 Ga0207698_10396163 3300026142 Bacteria 1318
752 Ga0207698_10547501 3300026142 Bacteria 1133
753 Ga0207698_11700686 3300026142 Bacteria 646
754 Ga0209281_1000736 3300027111 Bacteria 32018
755 Ga0209389_1020739 3300027296 Bacteria 5862
756 Ga0209995_1005033 3300027471 Bacteria 2121
757 Ga0209968_1001331 3300027526 Bacteria 3755
758 Ga0209971_1008514 3300027682 Bacteria 2434
759 Ga0209966_1000162 3300027695 Bacteria 28187
760 Ga0209813_10005576 3300027866 Bacteria 3063
761 Ga0209813_10181558 3300027866 Bacteria 770
762 Ga0209974_10005095 3300027876 Bacteria 4638
763 Ga0268266_10121172 3300028379 Bacteria 2328
764 Ga0268266_10195518 3300028379 Bacteria 1848
765 Ga0268266_10487036 3300028379 Bacteria 1176
766 Ga0268265_10024537 3300028380 Bacteria 4267
767 Ga0268265_10077830 3300028380 Bacteria 2606
768 Ga0268265_10553223 3300028380 Bacteria 1093
769 Ga0268265_10988912 3300028380 Bacteria 830
770 Ga0268264_10000858 3300028381 Bacteria 32293
771 Ga0268264_10040299 3300028381 Bacteria 3859
772 Ga0268264_10043465 3300028381 Bacteria 3723
773 Ga0268264_10245396 3300028381 Bacteria 1661
774 Ga0268264_10514003 3300028381 Bacteria 1170
775 Ga0268264_10856558 3300028381 Bacteria 910
776 Ga0265336_10000013 3300028666 Bacteria 252156
777 Ga0307517_10000131 3300028786 Bacteria 113233
778 Ga0307517_10139515 3300028786 Bacteria 1708
779 Ga0307517_10216895 3300028786 Bacteria 1169
780 Ga0307517_10458448 3300028786 Bacteria 658
781 Ga0307515_10000011 3300028794 Bacteria 633903
782 Ga0307515_10000138 3300028794 Bacteria 173220
783 Ga0307515_10000382 3300028794 Bacteria 107907
784 Ga0307515_10001206 3300028794 Bacteria 59045
785 Ga0307515_10003938 3300028794 Bacteria 30997
786 Ga0307515_10030322 3300028794 Bacteria 9088
787 Ga0307515_10049807 3300028794 Bacteria 6289
788 Ga0307515_10065551 3300028794 Bacteria 5051
789 Ga0307515_10207397 3300028794 Bacteria 1815
790 Ga0307515_10250785 3300028794 Bacteria 1523
791 Ga0307515_10368899 3300028794 Bacteria 1073
792 Ga0265324_10000432 3300029957 Bacteria 29768
793 Ga0307512_10037633 3300030522 Bacteria 4083
794 Ga0307512_10056737 3300030522 Bacteria 3071
795 Ga0307512_10057621 3300030522 Bacteria 3036
796 Ga0307512_10222233 3300030522 Bacteria 985
797 Ga0265328_10011442 3300031239 Bacteria 3543
798 Ga0265328_10011544 3300031239 Bacteria 3526
799 Ga0265331_10001252 3300031250 Bacteria 19038
800 Ga0265327_10000042 3300031251 Bacteria 287487
801 Ga0265327_10000174 3300031251 Bacteria 138922
802 Ga0307513_10006637 3300031456 Bacteria 15105
803 Ga0307513_10008888 3300031456 Bacteria 12776
804 Ga0307513_10040500 3300031456 Bacteria 5150
805 Ga0307513_10249003 3300031456 Bacteria 1575
806 Ga0307513_10253042 3300031456 Bacteria 1557
807 Ga0307513_10390773 3300031456 Bacteria 1128
808 Ga0307509_10004119 3300031507 Bacteria 21260
809 Ga0307509_10005021 3300031507 Bacteria 18658
810 Ga0307509_10007961 3300031507 Bacteria 13668
811 Ga0307509_10045866 3300031507 Bacteria 4709
812 Ga0307509_10068229 3300031507 Bacteria 3722
813 Ga0307509_10131019 3300031507 Bacteria 2463
814 Ga0307509_10251599 3300031507 Bacteria 1550
815 Ga0307509_10297350 3300031507 Bacteria 1365
816 Ga0307408_100000037 3300031548 Bacteria 187096
817 Ga0307408_100405031 3300031548 Bacteria 1172
818 Ga0307508_10000727 3300031616 Bacteria 39082
819 Ga0307508_10016265 3300031616 Bacteria 6770
820 Ga0307508_10063507 3300031616 Bacteria 3258
821 Ga0307508_10322762 3300031616 Bacteria 1136
822 Ga0307508_10344109 3300031616 Bacteria 1082
823 Ga0307508_10393564 3300031616 Bacteria 977
824 Ga0307514_10000390 3300031649 Bacteria 99924
825 Ga0307514_10002716 3300031649 Bacteria 17874
826 Ga0307514_10065265 3300031649 Bacteria 2758
827 Ga0307516_10000559 3300031730 Bacteria 50194
828 Ga0307516_10001343 3300031730 Bacteria 34183
829 Ga0307516_10006485 3300031730 Bacteria 13704
830 Ga0307516_10335360 3300031730 Bacteria 1180
831 Ga0307516_10475680 3300031730 Bacteria 904
832 Ga0307405_10002935 3300031731 Bacteria 7692
833 Ga0307405_10107459 3300031731 Bacteria 1884
834 Ga0307405_10150554 3300031731 Bacteria 1635
835 Ga0307405_10365846 3300031731 Bacteria 1118
836 Ga0307413_10016247 3300031824 Bacteria 3839
837 Ga0307413_11257263 3300031824 Bacteria 646
838 Ga0307410_10028168 3300031852 Bacteria 3560
839 Ga0307410_10174111 3300031852 Bacteria 1624
840 Ga0307410_10249965 3300031852 Bacteria 1378
841 Ga0307410_10308742 3300031852 Bacteria 1251
842 Ga0307410_10368146 3300031852 Bacteria 1153
843 Ga0307406_10178736 3300031901 Bacteria 1543
844 Ga0307407_10347238 3300031903 Bacteria 1050
845 Ga0307407_10489762 3300031903 Bacteria 899
846 Ga0307412_10023995 3300031911 Bacteria 3761
847 Ga0307412_10127635 3300031911 Bacteria 1842
848 Ga0307409_100014831 3300031995 Bacteria 5087
849 Ga0307409_100015029 3300031995 Bacteria 5063
850 Ga0307409_100350884 3300031995 Bacteria 1392
851 Ga0307416_100001622 3300032002 Bacteria 12383
852 Ga0307416_100074296 3300032002 Bacteria 2839
853 Ga0307416_100079922 3300032002 Bacteria 2758
854 Ga0307416_100092016 3300032002 Bacteria 2607
855 Ga0307416_100409062 3300032002 Bacteria 1397
856 Ga0307416_100715878 3300032002 Bacteria 1091
857 Ga0307416_100864899 3300032002 Bacteria 1003
858 Ga0307416_101147545 3300032002 Bacteria 882
859 Ga0307416_101977863 3300032002 Bacteria 686
860 Ga0307414_10016912 3300032004 Bacteria 4450
861 Ga0307414_10820959 3300032004 Bacteria 849
862 Ga0307411_10000494 3300032005 Bacteria 13741
863 Ga0307411_10027470 3300032005 Bacteria 3444
864 Ga0307415_100002203 3300032126 Bacteria 9643
865 Ga0307415_100034318 3300032126 Bacteria 3302
866 Ga0307507_10029403 3300033179 Bacteria 5827
867 Ga0307507_10151038 3300033179 Bacteria 1747
868 Ga0307510_10007325 3300033180 Bacteria 13142
869 Ga0307510_10047690 3300033180 Bacteria 4585
870 Ga0307510_10178338 3300033180 Bacteria 1691
871 Ga0373930_0040359 3300034816 Bacteria 992
872 Ga0373959_0026677 3300034820 Bacteria 1143
873 Ga0373959_0120729 3300034820 Bacteria 640
874 Ga0373940_0034838 3300035088 Bacteria 1360
875 Ga0373951_0029991 3300035091 Bacteria 1278
876 Ga0373932_0114193 3300035112 Bacteria 893
877 Ga0373936_0030416 3300035113 Bacteria 2129
878 Ga0373936_0114062 3300035113 Bacteria 1150
879 Ga0373939_0000130 3300035114 Bacteria 22040
880 Ga0373939_0034204 3300035114 Bacteria 1490
881 Ga0373939_0196592 3300035114 Bacteria 760
882 Ga0373941_0171835 3300035115 Bacteria 808
883 Ga0373945_0024452 3300035116 Bacteria 2093
884 Ga0373945_0109486 3300035116 Bacteria 1089
885 Ga0373954_0096475 3300035118 Bacteria 1424
886 Ga0373960_0152422 3300035121 Bacteria 790
887 Ga0373943_0031046 3300035170 Bacteria 2533
888 Ga0373946_0132198 3300035171 Bacteria 1149
889 Ga0373955_0026724 3300035172 Bacteria 2977
890 Ga0373961_0016647 3300035241 Bacteria 1896
891 Ga0373962_0083098 3300035242 Bacteria 975
892 Ga0373924_0033543 3300035410 Bacteria 2073
893 Ga0373931_0000077 3300035691 Bacteria 45225
894 Ga0373931_0004391 3300035691 Bacteria 6440
895 Ga0373931_0043713 3300035691 Bacteria 2360
896 Ga0373931_0309889 3300035691 Bacteria 977
897 Ga0373931_0645903 3300035691 Bacteria 695
898 Ga0373937_0029553 3300036401 Bacteria 4964
899 Ga0373937_0553807 3300036401 Bacteria 1092
900 Ga0373925_0037784 3300037068 Bacteria 3566
901 Ga0395900_0000879 3300037418 Bacteria 39414
902 Ga0395900_0414590 3300037418 Bacteria 1309
903 Ga0395898_0001863 3300037466 Bacteria 27013
904 Ga0395905_0003332 3300037471 Bacteria 17241
905 Ga0395905_0007069 3300037471 Bacteria 11222
906 Ga0395905_0019367 3300037471 Bacteria 6451
907 Ga0395905_0504915 3300037471 Bacteria 1109
908 Ga0395901_0001781 3300038443 Bacteria 22224
909 Ga0436361_0019641 3300039447 Bacteria 127735
910 Ga0436361_0085209 3300039447 Bacteria 38016
911 Ga0436361_0255611 3300039447 Bacteria 10944
912 Ga0436361_0463922 3300039447 Bacteria 6537
913 Ga0436361_1020604 3300039447 Bacteria 2364
914 Ga0436361_1048578 3300039447 Bacteria 2558
915 Ga0436361_1181151 3300039447 Bacteria 5390
916 Ga0436363_0491953 3300039450 Bacteria 788
917 Ga0436363_1399792 3300039450 Bacteria 2141
918 Ga0451789_0465154 3300041443 Bacteria 2628
919 Ga0451789_1272523 3300041443 Bacteria 1044
920 Ga0451791_1347236 3300041451 Bacteria 860
921 Ga0451797_1576900 3300041453 Bacteria 1055
922 Ga0451798_0217509 3300041458 Bacteria 655
923 Ga0451798_0867094 3300041458 Bacteria 1556
924 Ga0451807_1959080 3300041486 Bacteria 1176
925 Ga0451833_0958391 3300041491 Bacteria 919
926 Ga0451839_0595639 3300041496 Bacteria 766
927 Ga0451851_0070177 3300041507 Bacteria 668
928 Ga0451843_1230032 3300041509 Bacteria 1584
929 Ga0451853_0407793 3300041512 Bacteria 1592
930 Ga0439431_0010770 3300041997 Bacteria 2081
931 Ga0439433_0112376 3300041999 Bacteria 682
932 Ga0439437_006821 3300042000 Bacteria 1268
933 Ga0439441_037049 3300042001 Bacteria 966
934 Ga0439449_0055644 3300042007 Bacteria 1461
935 Ga0439449_0146662 3300042007 Bacteria 880
936 Ga0439450_004588 3300042008 Bacteria 2371
937 Ga0439457_042981 3300042014 Bacteria 1008
938 Ga0450917_001065 3300042120 Bacteria 2015
939 Ga0450888_000177 3300042126 Bacteria 5576
940 Ga0450890_000922 3300042127 Bacteria 4247
941 Ga0450891_000060 3300042129 Bacteria 8748
942 Ga0450898_015057 3300042134 Bacteria 1307
943 Ga0450899_013185 3300042135 Bacteria 932
944 Ga0450903_013782 3300042138 Bacteria 1285
945 Ga0450889_000922 3300042144 Bacteria 3132
946 Ga0439435_0160003 3300042436 Bacteria 727
947 Ga0439459_0010455 3300042438 Bacteria 1619
948 Ga0439464_0015176 3300042439 Bacteria 2077
949 Ga0450916_001089 3300042530 Bacteria 2648
950 Ga0450918_000326 3300042531 Bacteria 10718
951 Ga0450893_0010581 3300042532 Bacteria 1517
952 Ga0450901_026210 3300042533 Bacteria 636
953 Ga0451577_0001866 3300042876 Bacteria 26858
954 Ga0451577_0032633 3300042876 Bacteria 4691
955 Ga0451577_0127972 3300042876 Bacteria 2277
956 Ga0466969_0000020 3300044656 Bacteria 101861
957 Ga0466969_0101384 3300044656 Bacteria 1354
958 Ga0466965_0000493 3300044683 Bacteria 14004
959 Ga0466965_0011312 3300044683 Bacteria 4179
960 Ga0466965_0038922 3300044683 Bacteria 2336
961 Ga0466965_0109992 3300044683 Bacteria 1415
962 Ga0466966_0001239 3300044684 Bacteria 16360
963 Ga0466966_0011170 3300044684 Bacteria 5956
964 Ga0466961_0013718 3300044693 Bacteria 5192
965 Ga0466961_0037361 3300044693 Bacteria 3115
966 Ga0466963_0039303 3300044694 Bacteria 3098
967 Ga0466963_0077538 3300044694 Bacteria 2245
968 Ga0466963_0101194 3300044694 Bacteria 1973
969 Ga0466964_0000949 3300044706 Bacteria 9595
970 Ga0466964_0014413 3300044706 Bacteria 3006
971 Ga0466964_0062857 3300044706 Bacteria 1549
972 Ga0453684_0042883 3300044712 Bacteria 6090
973 Ga0453684_0066790 3300044712 Bacteria 4577
974 Ga0453684_0410522 3300044712 Bacteria 1515
975 Ga0453684_0591572 3300044712 Bacteria 1217
976 Ga0453684_0687081 3300044712 Bacteria 1113
977 Ga0453684_0875581 3300044712 Bacteria 963
978 Ga0466971_0002813 3300044719 Bacteria 7367
979 Ga0466971_0003163 3300044719 Bacteria 7020
980 Ga0466971_0023819 3300044719 Bacteria 2728
981 Ga0466968_0013862 3300044735 Bacteria 3175
982 Ga0466970_0005378 3300044765 Bacteria 6352
983 Ga0466970_0033153 3300044765 Bacteria 2730
984 Ga0466970_0192540 3300044765 Bacteria 1133
985 Ga0466957_0027220 3300044842 Bacteria 3396
986 Ga0466957_0063458 3300044842 Bacteria 2271
987 Ga0466957_0269486 3300044842 Bacteria 1136
988 Ga0466959_0001531 3300045049 Bacteria 14217
989 Ga0466959_0046516 3300045049 Bacteria 3192
990 Ga0466959_0067872 3300045049 Bacteria 2584
991 Ga0451576_0009077 3300045051 Bacteria 11576
992 Ga0451576_0124243 3300045051 Bacteria 2688
993 Ga0451576_0257121 3300045051 Bacteria 1825
994 Ga0451576_0284685 3300045051 Bacteria 1728
995 Ga0451576_0509554 3300045051 Bacteria 1264
996 Ga0451576_0665852 3300045051 Bacteria 1094
997 Ga0451576_1515972 3300045051 Bacteria 696
998 Ga0466958_0041460 3300045836 Bacteria 2768
999 Ga0466958_0063036 3300045836 Bacteria 2260
1000 Ga0466967_0025052 3300045976 Bacteria 4913
1001 Ga0495592_0000746 3300046454 Bacteria 22679
1002 Ga0495592_0215835 3300046454 Bacteria 1286
1003 Ga0495592_0272189 3300046454 Bacteria 1111
1004 Ga0495603_0078723 3300046455 Bacteria 1933
1005 Ga0495590_0031730 3300046457 Bacteria 1848
1006 Ga0495590_0141131 3300046457 Bacteria 869
1007 Ga0495629_0166233 3300046459 Bacteria 1532
1008 Ga0495638_0031475 3300046460 Bacteria 3410
1009 Ga0495651_0106790 3300046462 Bacteria 2075
1010 Ga0495653_0559191 3300046463 Bacteria 707
1011 Ga0495650_0008561 3300046471 Bacteria 5947
1012 Ga0495650_0029377 3300046471 Bacteria 2506
1013 Ga0495580_0041734 3300046472 Bacteria 3271
1014 Ga0495580_0626935 3300046472 Bacteria 709
1015 Ga0495662_0395224 3300046476 Bacteria 679
1016 Ga0495583_0000034 3300046506 Bacteria 246856
1017 Ga0495583_0079676 3300046506 Bacteria 1425
1018 Ga0495606_0006285 3300046507 Bacteria 11017
1019 Ga0495606_0358723 3300046507 Bacteria 771
1020 Ga0495608_0264507 3300046511 Bacteria 1070
1021 Ga0495610_0024206 3300046512 Bacteria 3281
1022 Ga0495610_0036866 3300046512 Bacteria 2495
1023 Ga0495618_0406174 3300046514 Bacteria 832
1024 Ga0495620_0259601 3300046515 Bacteria 662
1025 Ga0495628_0163090 3300046516 Bacteria 1693
1026 Ga0495630_0040768 3300046517 Bacteria 3470
1027 Ga0495631_0098292 3300046518 Bacteria 1260
1028 Ga0495632_0066020 3300046519 Bacteria 1746
1029 Ga0495632_0095371 3300046519 Bacteria 1406
1030 Ga0495643_0072167 3300046522 Bacteria 1811
1031 Ga0495644_0192133 3300046523 Bacteria 786
1032 Ga0495648_0055873 3300046524 Bacteria 2378
1033 Ga0495648_0064351 3300046524 Bacteria 2161
1034 Ga0495648_0122432 3300046524 Bacteria 1396
1035 Ga0495663_0077585 3300046525 Bacteria 1066
1036 Ga0495640_0292472 3300046533 Bacteria 1013
1037 Ga0495586_0120873 3300046535 Bacteria 1463
1038 Ga0495598_0018950 3300046537 Bacteria 1796
1039 Ga0495609_0167602 3300046538 Bacteria 929
1040 Ga0495621_0021135 3300046539 Bacteria 2142
1041 Ga0495621_0279558 3300046539 Bacteria 687
1042 Ga0495621_0285045 3300046539 Bacteria 681
1043 Ga0495597_0017935 3300046542 Bacteria 3324
1044 Ga0495667_0174150 3300046559 Bacteria 1382
1045 Ga0495656_0129509 3300046615 Bacteria 1200
1046 Ga0495668_0021789 3300046616 Bacteria 3668
1047 Ga0495668_0294669 3300046616 Bacteria 889
1048 Ga0495625_0006159 3300046660 Bacteria 10745
1049 Ga0495625_0020810 3300046660 Bacteria 5058
1050 Ga0495635_0101360 3300046663 Bacteria 1968
1051 Ga0495646_0040454 3300046680 Bacteria 2871
1052 Ga0495646_0157199 3300046680 Bacteria 1261
1053 Ga0495647_0245915 3300046681 Bacteria 795
1054 Ga0495658_0204009 3300046683 Bacteria 1233
1055 Ga0495669_0026759 3300046684 Bacteria 2521
1056 Ga0495669_0317274 3300046684 Bacteria 752
1057 Ga0495613_0152544 3300046689 Bacteria 1647
1058 Ga0495670_0060761 3300046691 Bacteria 1899
1059 Ga0495670_0129903 3300046691 Bacteria 1313
1060 Ga0495671_0097137 3300046692 Bacteria 1441
1061 Ga0495671_0106988 3300046692 Bacteria 1366
1062 Ga0495649_0000728 3300046694 Bacteria 26762
1063 Ga0495649_0029913 3300046694 Bacteria 3009
1064 Ga0495660_0015408 3300046810 Bacteria 4416
1065 Ga0495660_0079409 3300046810 Bacteria 1723
1066 Ga0495674_0289346 3300047319 Bacteria 1340
1067 Ga0495680_0111095 3300047322 Bacteria 2031
1068 Ga0495687_000248 3300047443 Bacteria 72947
1069 Ga0495687_018539 3300047443 Bacteria 3438
1070 Ga0495673_0183303 3300047469 Bacteria 792
1071 Ga0495681_0172549 3300047470 Bacteria 894
1072 Ga0495686_0000739 3300047472 Bacteria 43610
1073 Ga0495686_0039653 3300047472 Bacteria 3006
1074 Ga0495686_0165775 3300047472 Bacteria 1288
1075 Ga0495614_0217942 3300048089 Bacteria 867
1076 Ga0495626_0073934 3300048091 Bacteria 1526
1077 Ga0496100_0035391 3300048903 Bacteria 3140
1078 Ga0496100_0103186 3300048903 Bacteria 1969
1079 Ga0496100_0582321 3300048903 Bacteria 868
1080 Ga0496100_0774405 3300048903 Bacteria 751
1081 Ga0496100_1044664 3300048903 Bacteria 643
1082 Ga0496101_0024303 3300048904 Bacteria 4193
1083 Ga0496102_0006045 3300048905 Bacteria 10311
1084 Ga0496102_0008100 3300048905 Bacteria 8990
1085 Ga0496102_0095541 3300048905 Bacteria 2755
1086 Ga0496103_0378788 3300048906 Bacteria 909
1087 Ga0496104_0087183 3300048907 Bacteria 2981
1088 Ga0496104_0123106 3300048907 Bacteria 2490
1089 Ga0496104_0212089 3300048907 Bacteria 1848
1090 Ga0496104_0994531 3300048907 Bacteria 743
1091 Ga0496105_0218711 3300048908 Bacteria 1551
1092 Ga0496105_0284964 3300048908 Bacteria 1331
1093 Ga0496105_0388177 3300048908 Bacteria 1110
1094 Ga0496106_0023565 3300048909 Bacteria 4572
1095 Ga0496106_0027147 3300048909 Bacteria 4264
1096 Ga0496107_0004099 3300048910 Bacteria 9815
1097 Ga0496108_0112517 3300048911 Bacteria 2329
1098 Ga0496108_0132616 3300048911 Bacteria 2141
1099 Ga0496108_0133591 3300048911 Bacteria 2133
1100 Ga0496109_0042557 3300048912 Bacteria 4115
1101 Ga0496109_0143033 3300048912 Bacteria 2237
1102 Ga0496109_0179034 3300048912 Bacteria 1991
1103 Ga0496109_0195803 3300048912 Bacteria 1899
1104 Ga0496109_0328802 3300048912 Bacteria 1443
1105 Ga0496109_0337113 3300048912 Bacteria 1424
1106 Ga0496110_0069048 3300048913 Bacteria 3128
1107 Ga0496110_0394290 3300048913 Bacteria 1262
1108 Ga0496111_0176869 3300048914 Bacteria 1586
1109 Ga0496111_0477267 3300048914 Bacteria 919
1110 Ga0496112_0061214 3300048915 Bacteria 3710
1111 Ga0496112_0425437 3300048915 Bacteria 1266
1112 Ga0496113_0013003 3300048916 Bacteria 5617
1113 Ga0496113_0241481 3300048916 Bacteria 1441
1114 Ga0496113_0398556 3300048916 Bacteria 1105
1115 Ga0496114_0070435 3300048917 Bacteria 2937
1116 Ga0496114_0599381 3300048917 Bacteria 971
1117 Ga0496121_0026182 3300048924 Bacteria 5506
1118 Ga0496124_0000126 3300048927 Bacteria 159539
1119 Ga0496124_0079515 3300048927 Bacteria 2700
1120 Ga0496125_0003500 3300048928 Bacteria 18970
1121 Ga0501298_011150 3300049521 Bacteria 1557
1122 Ga0501300_009888 3300049523 Bacteria 1390
1123 Ga0501043_0000009 3300049579 Bacteria 214823
1124 Ga0501046_0000022 3300049580 Bacteria 215451
1125 Ga0501047_0000021 3300049581 Bacteria 254841
1126 Ga0501198_000019 3300049649 Bacteria 83282
1127 Ga0501201_001792 3300049651 Bacteria 1989
1128 Ga0501211_000655 3300049658 Bacteria 3485
1129 Ga0501222_000059 3300049662 Bacteria 34949
1130 Ga0501222_002805 3300049662 Bacteria 2412
1131 Ga0501223_012519 3300049663 Bacteria 1695
1132 Ga0501233_008494 3300049668 Bacteria 1981
1133 Ga0501235_002288 3300049669 Bacteria 4120
1134 Ga0501236_019964 3300049670 Bacteria 982
1135 Ga0501249_007648 3300049679 Bacteria 2237
1136 Ga0501253_020996 3300049683 Bacteria 1145
1137 Ga0501253_060348 3300049683 Bacteria 816
1138 Ga0501255_023119 3300049684 Bacteria 819
1139 Ga0501221_004219 3300049704 Bacteria 2381
1140 Ga0501229_000329 3300049706 Bacteria 5361
1141 Ga0501232_007753 3300049757 Bacteria 1140
1142 Ga0501262_001965 3300049759 Bacteria 2316
1143 Ga0501263_040320 3300049760 Bacteria 685
1144 Ga0501265_002920 3300049762 Bacteria 1940
1145 Ga0501266_015299 3300049763 Bacteria 1012
1146 Ga0501267_001228 3300049764 Bacteria 2158
1147 Ga0501271_004112 3300049768 Bacteria 1368
1148 Ga0501272_005415 3300049769 Bacteria 1342
1149 Ga0501283_005530 3300049779 Bacteria 1741
1150 Ga0501035_0304530 3300049822 Bacteria 1342
1151 Ga0501044_0661707 3300049823 Bacteria 933
1152 Ga0501045_0025044 3300049824 Bacteria 4287
1153 nmdc:mga03683_287767_c1 3300050489 Bacteria 769
1154 nmdc:mga03683_439_c1 3300050489 Bacteria 9088
1155 nmdc:mga03683_5178_c1 3300050489 Bacteria 4384
1156 nmdc:mga03n38_361453_c1 3300050490 Bacteria 792
1157 nmdc:mga03n38_70060_c1 3300050490 Bacteria 1621
1158 nmdc:mga03n38_86560_c1 3300050490 Bacteria 1483
1159 nmdc:mga00v17_297159_c1 3300050491 Bacteria 1049
1160 nmdc:mga0yw44_19242_c1 3300050492 Bacteria 3760
1161 nmdc:mga0k408_118638_c1 3300050493 Bacteria 1566
1162 nmdc:mga0k408_127486_c1 3300050493 Bacteria 1510
1163 nmdc:mga0k408_12953_c1 3300050493 Bacteria 4566
1164 nmdc:mga0k408_130339_c1 3300050493 Bacteria 1493
1165 nmdc:mga0k408_146879_c1 3300050493 Bacteria 1404
1166 nmdc:mga0k408_1705_c1 3300050493 Bacteria 11835
1167 nmdc:mga0k408_173373_c1 3300050493 Bacteria 1286
1168 nmdc:mga0k408_19355_c1 3300050493 Bacteria 3804
1169 nmdc:mga0k408_212864_c1 3300050493 Bacteria 1154
1170 nmdc:mga0k408_240212_c1 3300050493 Bacteria 1082
1171 nmdc:mga0k408_259539_c1 3300050493 Bacteria 1038
1172 nmdc:mga0k408_27836_c1 3300050493 Bacteria 3212
1173 nmdc:mga0k408_376315_c1 3300050493 Bacteria 846
1174 nmdc:mga0k408_406_c1 3300050493 Bacteria 23501
1175 nmdc:mga0k408_41032_c1 3300050493 Bacteria 2664
1176 nmdc:mga0k408_42240_c1 3300050493 Bacteria 2626
1177 nmdc:mga0k408_527_c1 3300050493 Bacteria 11830
1178 nmdc:mga0k408_54354_c1 3300050493 Bacteria 2320
1179 nmdc:mga0k408_59264_c1 3300050493 Bacteria 2224
1180 nmdc:mga0k408_85785_c1 3300050493 Bacteria 1848
1181 nmdc:mga0k408_88156_c1 3300050493 Bacteria 1822
1182 nmdc:mga06z11_11864_c1 3300050494 Bacteria 3771
1183 nmdc:mga06z11_258805_c1 3300050494 Bacteria 1026
1184 nmdc:mga06z11_57689_c1 3300050494 Bacteria 2012
1185 nmdc:mga06z11_64211_c1 3300050494 Bacteria 1923
1186 nmdc:mga06z11_76716_c1 3300050494 Bacteria 1782
1187 nmdc:mga04h51_317948_c1 3300050495 Bacteria 638
1188 nmdc:mga04h51_7612_c1 3300050495 Bacteria 2866
1189 nmdc:mga07m45_10360_c1 3300050496 Bacteria 4867
1190 nmdc:mga07m45_103654_c1 3300050496 Bacteria 1635
1191 nmdc:mga07m45_10939_c1 3300050496 Bacteria 4754
1192 nmdc:mga07m45_117_c1 3300050496 Bacteria 31533
1193 nmdc:mga07m45_136154_c1 3300050496 Bacteria 1422
1194 nmdc:mga07m45_1620_c1 3300050496 Bacteria 10359
1195 nmdc:mga07m45_207586_c1 3300050496 Bacteria 1140
1196 nmdc:mga07m45_30645_c1 3300050496 Bacteria 2980
1197 nmdc:mga07m45_4614_c1 3300050496 Bacteria 6755
1198 nmdc:mga07m45_5537_c1 3300050496 Bacteria 6298
1199 nmdc:mga07m45_6725_c1 3300050496 Bacteria 5835
1200 nmdc:mga05p37_109740_c1 3300050507 Bacteria 3394
1201 nmdc:mga09592_53741_c1 3300050508 Bacteria 3402
1202 nmdc:mga0qj67_360672_c1 3300050509 Bacteria 1174
1203 nmdc:mga0qj67_76608_c1 3300050509 Bacteria 2675
1204 nmdc:mga08y16_1178426_c1 3300050511 Bacteria 738
1205 nmdc:mga0sz30_17453_c1 3300050516 Bacteria 2863
1206 nmdc:mga0sz30_191152_c1 3300050516 Bacteria 909
1207 nmdc:mga0sz30_69443_c1 3300050516 Bacteria 1515
1208 Ga0495601_0019457 3300053077 Bacteria 4140
1209 Ga0500635_0000011 3300053080 Bacteria 144219
1210 Ga0495619_0143834 3300053085 Bacteria 1643
1211 Ga0500578_0000673 3300053086 Bacteria 40901
1212 Ga0500578_0174805 3300053086 Bacteria 1326
1213 Ga0500578_0554643 3300053086 Bacteria 638
1214 Ga0500643_032481 3300053087 Bacteria 1585
1215 Ga0500644_0018787 3300053088 Bacteria 2031
1216 Ga0500646_0014486 3300053090 Bacteria 2047
1217 Ga0500583_0054394 3300053092 Bacteria 1869
1218 Ga0500651_0051962 3300053093 Bacteria 2570
1219 Ga0500651_0229625 3300053093 Bacteria 1086
1220 Ga0500648_346063 3300053097 Bacteria 611
1221 Ga0500650_0046653 3300053098 Bacteria 2007
1222 Ga0500555_030106 3300053103 Bacteria 1541
1223 Ga0500562_026334 3300053108 Bacteria 1524
1224 Ga0500562_037530 3300053108 Bacteria 1286
1225 Ga0500569_007978 3300053109 Bacteria 2403
1226 Ga0500593_000680 3300053117 Bacteria 12914
1227 Ga0500594_0000470 3300053118 Bacteria 8860
1228 Ga0500595_073612 3300053119 Bacteria 1010
1229 Ga0500607_118133 3300053121 Bacteria 1288
1230 Ga0500608_246768 3300053122 Bacteria 700
1231 Ga0500623_072496 3300053127 Bacteria 1666
1232 Ga0500628_018338 3300053129 Bacteria 1378
1233 Ga0500628_075548 3300053129 Bacteria 853
1234 Ga0500652_000123 3300053131 Bacteria 29418
1235 Ga0500652_208186 3300053131 Bacteria 791
1236 Ga0500655_004744 3300053133 Bacteria 2445
1237 Ga0500655_017284 3300053133 Bacteria 1333
1238 Ga0500658_0044915 3300053134 Bacteria 1784
1239 Ga0500658_0237260 3300053134 Bacteria 837
1240 Ga0500559_0000407 3300053136 Bacteria 30942
1241 Ga0500559_0153931 3300053136 Bacteria 1079
1242 Ga0500568_0112756 3300053139 Bacteria 1015
1243 Ga0500577_0009622 3300053142 Bacteria 2813
1244 Ga0500590_023408 3300053148 Bacteria 3207
1245 Ga0500604_0007671 3300053151 Bacteria 2859
1246 Ga0500619_000006 3300053154 Bacteria 77270
1247 Ga0500622_0000799 3300053156 Bacteria 27135
1248 Ga0500622_0006741 3300053156 Bacteria 6616
1249 Ga0500622_0095912 3300053156 Bacteria 1466
1250 Ga0500622_0097209 3300053156 Bacteria 1454
1251 Ga0500636_0005079 3300053177 Bacteria 7470
1252 Ga0500645_008009 3300053730 Bacteria 3640
1253 Ga0500645_042335 3300053730 Bacteria 1344
1254 Ga0500661_002023 3300055283 Bacteria 3827
1255 Ga0590071_000174 3300059421 Bacteria 18568
1256 Ga0466962_0004166 3300061719 Bacteria 6929
1257 Ga0466962_0046420 3300061719 Bacteria 2075

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046472 Ga0495580_0041734 Ga0495580_0041734_941_1612 162
2 3300039450 Ga0436363_0491953 Ga0436363_0491953_87_728 163
3 3300025942 Ga0207689_10131531 Ga0207689_101315312 183
4 3300003316 rootH1_10010629 rootH1_100106295 184
5 3300003322 rootL2_10004014 rootL2_100040144 184
6 3300005328 Ga0070676_10010756 Ga0070676_100107562 184
7 3300005334 Ga0068869_100019197 Ga0068869_1000191974 184
8 3300005338 Ga0068868_100148702 Ga0068868_1001487022 184
9 3300005338 Ga0068868_100235186 Ga0068868_1002351861 184
10 3300005355 Ga0070671_100023124 Ga0070671_1000231243 184
11 3300005364 Ga0070673_100019027 Ga0070673_1000190275 184
12 3300005367 Ga0070667_100003174 Ga0070667_10000317412 184
13 3300005367 Ga0070667_100065662 Ga0070667_1000656624 184
14 3300005459 Ga0068867_100002881 Ga0068867_1000028815 184
15 3300005467 Ga0070706_100003166 Ga0070706_1000031669 184
16 3300005468 Ga0070707_100072018 Ga0070707_1000720182 184
17 3300005471 Ga0070698_100072233 Ga0070698_1000722333 184
18 3300005539 Ga0068853_100294740 Ga0068853_1002947401 184
19 3300005548 Ga0070665_100158040 Ga0070665_1001580402 184
20 3300005840 Ga0068870_10007498 Ga0068870_100074985 184
21 3300006042 Ga0075368_10004618 Ga0075368_100046182 184
22 3300006042 Ga0075368_10060057 Ga0075368_100600572 184
23 3300006048 Ga0075363_100023918 Ga0075363_1000239182 184
24 3300006051 Ga0075364_10243101 Ga0075364_102431012 184
25 3300006058 Ga0075432_10076876 Ga0075432_100768762 184
26 3300006177 Ga0075362_10016384 Ga0075362_100163842 184
27 3300006178 Ga0075367_10003951 Ga0075367_100039516 184
28 3300006178 Ga0075367_10107393 Ga0075367_101073932 184
29 3300006186 Ga0075369_10013422 Ga0075369_100134223 184
30 3300006186 Ga0075369_10091722 Ga0075369_100917222 184
31 3300006186 Ga0075369_10097041 Ga0075369_100970412 184
32 3300006195 Ga0075366_10149214 Ga0075366_101492142 184
33 3300006195 Ga0075366_10194922 Ga0075366_101949222 184
34 3300006353 Ga0075370_10003547 Ga0075370_100035472 184
35 3300006353 Ga0075370_10003987 Ga0075370_100039873 184
36 3300006353 Ga0075370_10116873 Ga0075370_101168732 184
37 3300006353 Ga0075370_10170466 Ga0075370_101704662 184
38 3300006881 Ga0068865_100357524 Ga0068865_1003575242 184
39 3300006881 Ga0068865_100360153 Ga0068865_1003601532 184
40 3300009148 Ga0105243_10308096 Ga0105243_103080962 184
41 3300009545 Ga0105237_10000293 Ga0105237_1000029340 184
42 3300009545 Ga0105237_10010430 Ga0105237_100104306 184
43 3300009551 Ga0105238_10003562 Ga0105238_100035623 184
44 3300010375 Ga0105239_10002857 Ga0105239_100028577 184
45 3300014325 Ga0163163_10153059 Ga0163163_101530593 184
46 3300014968 Ga0157379_10539603 Ga0157379_105396032 184
47 3300025907 Ga0207645_10003679 Ga0207645_100036795 184
48 3300025907 Ga0207645_10123856 Ga0207645_101238562 184
49 3300025908 Ga0207643_10009192 Ga0207643_100091925 184
50 3300025910 Ga0207684_10002063 Ga0207684_1000206314 184
51 3300025914 Ga0207671_10002885 Ga0207671_1000288514 184
52 3300025924 Ga0207694_10242241 Ga0207694_102422412 184
53 3300025927 Ga0207687_10062753 Ga0207687_100627533 184
54 3300025933 Ga0207706_10057563 Ga0207706_100575632 184
55 3300025938 Ga0207704_10313538 Ga0207704_103135382 184
56 3300025940 Ga0207691_10037603 Ga0207691_100376033 184
57 3300025942 Ga0207689_10015115 Ga0207689_100151155 184
58 3300025942 Ga0207689_10151649 Ga0207689_101516492 184
59 3300025960 Ga0207651_10012328 Ga0207651_100123285 184
60 3300025986 Ga0207658_10003042 Ga0207658_1000304210 184
61 3300025986 Ga0207658_10246403 Ga0207658_102464032 184
62 3300025986 Ga0207658_10624764 Ga0207658_106247641 184
63 3300026023 Ga0207677_10105233 Ga0207677_101052333 184
64 3300026041 Ga0207639_10240583 Ga0207639_102405831 184
65 3300026067 Ga0207678_10048730 Ga0207678_100487303 184
66 3300026089 Ga0207648_10006969 Ga0207648_100069697 184
67 3300026116 Ga0207674_10069067 Ga0207674_100690674 184
68 3300026118 Ga0207675_100284304 Ga0207675_1002843042 184
69 3300026121 Ga0207683_10405959 Ga0207683_104059591 184
70 3300026121 Ga0207683_10634584 Ga0207683_106345841 184
71 3300027866 Ga0209813_10005576 Ga0209813_100055762 184
72 3300027866 Ga0209813_10181558 Ga0209813_101815581 184
73 3300028379 Ga0268266_10121172 Ga0268266_101211722 184
74 3300028381 Ga0268264_10514003 Ga0268264_105140032 184
75 3300028794 Ga0307515_10250785 Ga0307515_102507852 184
76 3300031456 Ga0307513_10040500 Ga0307513_100405006 184
77 3300031456 Ga0307513_10249003 Ga0307513_102490034 184
78 3300031456 Ga0307513_10253042 Ga0307513_102530422 184
79 3300031616 Ga0307508_10322762 Ga0307508_103227621 184
80 3300035691 Ga0373931_0645903 Ga0373931_0645903_62_646 184
81 3300046457 Ga0495590_0141131 Ga0495590_0141131_161_715 184
82 3300046506 Ga0495583_0079676 Ga0495583_0079676_484_1038 184
83 3300046518 Ga0495631_0098292 Ga0495631_0098292_587_1141 184
84 3300046538 Ga0495609_0167602 Ga0495609_0167602_223_777 184
85 3300046542 Ga0495597_0017935 Ga0495597_0017935_16_570 184
86 3300046616 Ga0495668_0294669 Ga0495668_0294669_73_627 184
87 3300046692 Ga0495671_0097137 Ga0495671_0097137_435_989 184
88 3300046694 Ga0495649_0029913 Ga0495649_0029913_1566_2120 184
89 3300046810 Ga0495660_0015408 Ga0495660_0015408_1728_2282 184
90 3300047443 Ga0495687_000248 Ga0495687_000248_6833_7387 184
91 3300047443 Ga0495687_018539 Ga0495687_018539_1036_1590 184
92 3300047469 Ga0495673_0183303 Ga0495673_0183303_76_630 184
93 3300048091 Ga0495626_0073934 Ga0495626_0073934_960_1514 184
94 3300050489 nmdc:mga03683_439_c1 nmdc:mga03683_439_c1_4660_5214 184
95 3300050491 nmdc:mga00v17_297159_c1 nmdc:mga00v17_297159_c1_185_739 184
96 3300050492 nmdc:mga0yw44_19242_c1 nmdc:mga0yw44_19242_c1_2179_2733 184
97 3300050493 nmdc:mga0k408_1705_c1 nmdc:mga0k408_1705_c1_7196_7750 184
98 3300050493 nmdc:mga0k408_19355_c1 nmdc:mga0k408_19355_c1_566_1120 184
99 3300050493 nmdc:mga0k408_240212_c1 nmdc:mga0k408_240212_c1_82_636 184
100 3300050493 nmdc:mga0k408_259539_c1 nmdc:mga0k408_259539_c1_470_1024 184
101 3300050493 nmdc:mga0k408_41032_c1 nmdc:mga0k408_41032_c1_87_641 184
102 3300050493 nmdc:mga0k408_527_c1 nmdc:mga0k408_527_c1_4738_5292 184
103 3300050493 nmdc:mga0k408_54354_c1 nmdc:mga0k408_54354_c1_657_1241 184
104 3300050494 nmdc:mga06z11_11864_c1 nmdc:mga06z11_11864_c1_1731_2285 184
105 3300050494 nmdc:mga06z11_57689_c1 nmdc:mga06z11_57689_c1_534_1088 184
106 3300050495 nmdc:mga04h51_317948_c1 nmdc:mga04h51_317948_c1_57_611 184
107 3300050495 nmdc:mga04h51_7612_c1 nmdc:mga04h51_7612_c1_1171_1725 184
108 3300050496 nmdc:mga07m45_10360_c1 nmdc:mga07m45_10360_c1_275_829 184
109 3300050496 nmdc:mga07m45_10939_c1 nmdc:mga07m45_10939_c1_3194_3748 184
110 3300050496 nmdc:mga07m45_117_c1 nmdc:mga07m45_117_c1_7010_7564 184
111 3300050496 nmdc:mga07m45_1620_c1 nmdc:mga07m45_1620_c1_4401_4955 184
112 3300050496 nmdc:mga07m45_207586_c1 nmdc:mga07m45_207586_c1_223_777 184
113 3300050496 nmdc:mga07m45_4614_c1 nmdc:mga07m45_4614_c1_5402_5956 184
114 3300050516 nmdc:mga0sz30_17453_c1 nmdc:mga0sz30_17453_c1_1466_2020 184
115 3300050516 nmdc:mga0sz30_191152_c1 nmdc:mga0sz30_191152_c1_39_593 184
116 3300050516 nmdc:mga0sz30_69443_c1 nmdc:mga0sz30_69443_c1_21_575 184
117 3300053086 Ga0500578_0174805 Ga0500578_0174805_185_739 184
118 3300053134 Ga0500658_0044915 Ga0500658_0044915_173_727 184
119 3300001979 JGI24740J21852_10004029 JGI24740J21852_100040292 185
120 3300002077 JGI24744J21845_10010959 JGI24744J21845_100109592 185
121 3300002705 JGI25156J39149_1001303 JGI25156J39149_100130311 185
122 3300002705 JGI25156J39149_1012545 JGI25156J39149_10125452 185
123 3300002738 JGI25154J39366_1000343 JGI25154J39366_100034324 185
124 3300002741 JGI25157J39369_1000304 JGI25157J39369_100030425 185
125 3300002773 JGI25152J39213_1000710 JGI25152J39213_100071011 185
126 3300002774 JGI25150J39212_1017649 JGI25150J39212_10176492 185
127 3300003215 JGI25153J46596_10004579 JGI25153J46596_100045793 185
128 3300003215 JGI25153J46596_10006328 JGI25153J46596_100063282 185
129 3300003316 rootH1_10000527 rootH1_100005276 185
130 3300003320 rootH2_10057083 rootH2_100570839 185
131 3300003322 rootL2_10003309 rootL2_100033096 185
132 3300003322 rootL2_10056084 rootL2_100560842 185
133 3300003323 rootH1_10000048 rootH1_100000483 185
134 3300003323 rootH1_10020306 rootH1_100203069 185
135 3300003323 rootH1_10021990 rootH1_100219905 185
136 3300003347 JGI26128J50194_1004871 JGI26128J50194_10048711 185
137 3300003752 Ga0055539_1002131 Ga0055539_10021313 185
138 3300003752 Ga0055539_1002241 Ga0055539_10022413 185
139 3300003756 Ga0055533_1000016 Ga0055533_1000016259 185
140 3300003759 Ga0055525_1000031 Ga0055525_1000031105 185
141 3300003759 Ga0055525_1000802 Ga0055525_10008027 185
142 3300003763 Ga0055529_1000963 Ga0055529_10009638 185
143 3300003775 Ga0055524_1000052 Ga0055524_100005221 185
144 3300003775 Ga0055524_1017112 Ga0055524_10171123 185
145 3300003790 Ga0055528_1051731 Ga0055528_10517311 185
146 3300003791 Ga0055530_10004973 Ga0055530_100049735 185
147 3300003791 Ga0055530_10008463 Ga0055530_100084633 185
148 3300003792 Ga0055540_1000123 Ga0055540_100012319 185
149 3300003792 Ga0055540_1011833 Ga0055540_10118332 185
150 3300003794 Ga0055531_10000001 Ga0055531_1000000148 185
151 3300003794 Ga0055531_10011952 Ga0055531_100119524 185
152 3300005262 Ga0065165_1000836 Ga0065165_100083614 185
153 3300005262 Ga0065165_1003047 Ga0065165_10030475 185
154 3300005295 Ga0065707_10084569 Ga0065707_100845692 185
155 3300005327 Ga0070658_10216772 Ga0070658_102167722 185
156 3300005327 Ga0070658_10247639 Ga0070658_102476392 185
157 3300005327 Ga0070658_10775629 Ga0070658_107756291 185
158 3300005328 Ga0070676_10008317 Ga0070676_100083171 185
159 3300005328 Ga0070676_10081103 Ga0070676_100811032 185
160 3300005329 Ga0070683_100231589 Ga0070683_1002315893 185
161 3300005329 Ga0070683_100802241 Ga0070683_1008022411 185
162 3300005330 Ga0070690_100017502 Ga0070690_1000175024 185
163 3300005330 Ga0070690_100019706 Ga0070690_1000197063 185
164 3300005330 Ga0070690_100484460 Ga0070690_1004844601 185
165 3300005331 Ga0070670_100009305 Ga0070670_1000093055 185
166 3300005331 Ga0070670_100009633 Ga0070670_1000096336 185
167 3300005331 Ga0070670_100081596 Ga0070670_1000815962 185
168 3300005331 Ga0070670_100290394 Ga0070670_1002903942 185
169 3300005331 Ga0070670_100728717 Ga0070670_1007287171 185
170 3300005333 Ga0070677_10007611 Ga0070677_100076114 185
171 3300005333 Ga0070677_10019703 Ga0070677_100197032 185
172 3300005333 Ga0070677_10045673 Ga0070677_100456733 185
173 3300005333 Ga0070677_10057710 Ga0070677_100577102 185
174 3300005333 Ga0070677_10061857 Ga0070677_100618572 185
175 3300005333 Ga0070677_10112427 Ga0070677_101124272 185
176 3300005334 Ga0068869_100007348 Ga0068869_1000073486 185
177 3300005334 Ga0068869_100029467 Ga0068869_1000294672 185
178 3300005335 Ga0070666_10024212 Ga0070666_100242123 185
179 3300005335 Ga0070666_10259975 Ga0070666_102599752 185
180 3300005336 Ga0070680_100047155 Ga0070680_1000471554 185
181 3300005338 Ga0068868_100007149 Ga0068868_1000071497 185
182 3300005338 Ga0068868_100008040 Ga0068868_1000080404 185
183 3300005338 Ga0068868_100078021 Ga0068868_1000780212 185
184 3300005338 Ga0068868_100095120 Ga0068868_1000951202 185
185 3300005338 Ga0068868_100359980 Ga0068868_1003599802 185
186 3300005338 Ga0068868_100411011 Ga0068868_1004110112 185
187 3300005339 Ga0070660_100165433 Ga0070660_1001654333 185
188 3300005339 Ga0070660_100193201 Ga0070660_1001932011 185
189 3300005340 Ga0070689_100037388 Ga0070689_1000373884 185
190 3300005340 Ga0070689_100199233 Ga0070689_1001992333 185
191 3300005343 Ga0070687_100086448 Ga0070687_1000864481 185
192 3300005344 Ga0070661_100005819 Ga0070661_1000058195 185
193 3300005344 Ga0070661_100089480 Ga0070661_1000894803 185
194 3300005344 Ga0070661_100288126 Ga0070661_1002881262 185
195 3300005344 Ga0070661_100300894 Ga0070661_1003008942 185
196 3300005347 Ga0070668_100007635 Ga0070668_10000763510 185
197 3300005347 Ga0070668_100068725 Ga0070668_1000687252 185
198 3300005347 Ga0070668_100090366 Ga0070668_1000903662 185
199 3300005347 Ga0070668_100364257 Ga0070668_1003642572 185
200 3300005353 Ga0070669_100012068 Ga0070669_1000120686 185
201 3300005353 Ga0070669_100031165 Ga0070669_1000311652 185
202 3300005353 Ga0070669_100038839 Ga0070669_1000388391 185
203 3300005353 Ga0070669_100152211 Ga0070669_1001522112 185
204 3300005353 Ga0070669_100287569 Ga0070669_1002875692 185
205 3300005354 Ga0070675_100002907 Ga0070675_1000029077 185
206 3300005354 Ga0070675_100009944 Ga0070675_1000099444 185
207 3300005354 Ga0070675_100054029 Ga0070675_1000540293 185
208 3300005354 Ga0070675_100077116 Ga0070675_1000771163 185
209 3300005354 Ga0070675_100135095 Ga0070675_1001350953 185
210 3300005354 Ga0070675_100213751 Ga0070675_1002137511 185
211 3300005354 Ga0070675_100913163 Ga0070675_1009131631 185
212 3300005355 Ga0070671_100004848 Ga0070671_1000048486 185
213 3300005355 Ga0070671_100009961 Ga0070671_1000099612 185
214 3300005355 Ga0070671_100016969 Ga0070671_1000169694 185
215 3300005355 Ga0070671_100048071 Ga0070671_1000480714 185
216 3300005355 Ga0070671_100064228 Ga0070671_1000642283 185
217 3300005355 Ga0070671_100236517 Ga0070671_1002365172 185
218 3300005355 Ga0070671_100490293 Ga0070671_1004902932 185
219 3300005356 Ga0070674_100013025 Ga0070674_1000130253 185
220 3300005356 Ga0070674_100017473 Ga0070674_1000174733 185
221 3300005356 Ga0070674_100035720 Ga0070674_1000357203 185
222 3300005356 Ga0070674_100123792 Ga0070674_1001237921 185
223 3300005356 Ga0070674_100266210 Ga0070674_1002662102 185
224 3300005356 Ga0070674_100372436 Ga0070674_1003724362 185
225 3300005356 Ga0070674_100599488 Ga0070674_1005994881 185
226 3300005364 Ga0070673_100049839 Ga0070673_1000498392 185
227 3300005364 Ga0070673_100058470 Ga0070673_1000584702 185
228 3300005364 Ga0070673_100100373 Ga0070673_1001003733 185
229 3300005364 Ga0070673_100175085 Ga0070673_1001750852 185
230 3300005364 Ga0070673_100235304 Ga0070673_1002353042 185
231 3300005364 Ga0070673_100304247 Ga0070673_1003042472 185
232 3300005364 Ga0070673_100391149 Ga0070673_1003911491 185
233 3300005365 Ga0070688_100391523 Ga0070688_1003915232 185
234 3300005366 Ga0070659_100123684 Ga0070659_1001236843 185
235 3300005366 Ga0070659_100391202 Ga0070659_1003912022 185
236 3300005367 Ga0070667_100004063 Ga0070667_1000040633 185
237 3300005367 Ga0070667_100008844 Ga0070667_1000088445 185
238 3300005367 Ga0070667_100645831 Ga0070667_1006458311 185
239 3300005441 Ga0070700_100091680 Ga0070700_1000916802 185
240 3300005441 Ga0070700_100314714 Ga0070700_1003147142 185
241 3300005445 Ga0070708_100063311 Ga0070708_1000633116 185
242 3300005455 Ga0070663_100018301 Ga0070663_1000183014 185
243 3300005455 Ga0070663_100371537 Ga0070663_1003715372 185
244 3300005456 Ga0070678_100022312 Ga0070678_1000223122 185
245 3300005456 Ga0070678_100073203 Ga0070678_1000732033 185
246 3300005456 Ga0070678_100083403 Ga0070678_1000834032 185
247 3300005456 Ga0070678_100108578 Ga0070678_1001085783 185
248 3300005456 Ga0070678_100109497 Ga0070678_1001094972 185
249 3300005456 Ga0070678_100144742 Ga0070678_1001447422 185
250 3300005456 Ga0070678_100192744 Ga0070678_1001927441 185
251 3300005456 Ga0070678_100295525 Ga0070678_1002955252 185
252 3300005457 Ga0070662_100021790 Ga0070662_1000217904 185
253 3300005457 Ga0070662_100036702 Ga0070662_1000367022 185
254 3300005457 Ga0070662_100039945 Ga0070662_1000399454 185
255 3300005457 Ga0070662_100105156 Ga0070662_1001051562 185
256 3300005457 Ga0070662_100151308 Ga0070662_1001513081 185
257 3300005458 Ga0070681_10176795 Ga0070681_101767953 185
258 3300005458 Ga0070681_10237670 Ga0070681_102376702 185
259 3300005459 Ga0068867_100000042 Ga0068867_10000004232 185
260 3300005459 Ga0068867_100005007 Ga0068867_1000050076 185
261 3300005459 Ga0068867_100010032 Ga0068867_1000100323 185
262 3300005459 Ga0068867_100027327 Ga0068867_1000273273 185
263 3300005459 Ga0068867_100045630 Ga0068867_1000456303 185
264 3300005459 Ga0068867_100078153 Ga0068867_1000781532 185
265 3300005459 Ga0068867_100080494 Ga0068867_1000804943 185
266 3300005459 Ga0068867_100171787 Ga0068867_1001717873 185
267 3300005459 Ga0068867_100290688 Ga0068867_1002906882 185
268 3300005466 Ga0070685_10191322 Ga0070685_101913222 185
269 3300005468 Ga0070707_100512976 Ga0070707_1005129762 185
270 3300005530 Ga0070679_100024208 Ga0070679_1000242082 185
271 3300005535 Ga0070684_100556718 Ga0070684_1005567181 185
272 3300005539 Ga0068853_100008284 Ga0068853_1000082847 185
273 3300005539 Ga0068853_100144732 Ga0068853_1001447322 185
274 3300005539 Ga0068853_100278576 Ga0068853_1002785762 185
275 3300005539 Ga0068853_100405931 Ga0068853_1004059312 185
276 3300005539 Ga0068853_100407871 Ga0068853_1004078712 185
277 3300005539 Ga0068853_100429041 Ga0068853_1004290412 185
278 3300005543 Ga0070672_100000214 Ga0070672_1000002146 185
279 3300005543 Ga0070672_100003206 Ga0070672_1000032066 185
280 3300005543 Ga0070672_100012364 Ga0070672_1000123646 185
281 3300005543 Ga0070672_100111789 Ga0070672_1001117892 185
282 3300005543 Ga0070672_100132610 Ga0070672_1001326102 185
283 3300005543 Ga0070672_100137980 Ga0070672_1001379802 185
284 3300005543 Ga0070672_100286236 Ga0070672_1002862362 185
285 3300005543 Ga0070672_100378726 Ga0070672_1003787262 185
286 3300005547 Ga0070693_100446755 Ga0070693_1004467551 185
287 3300005548 Ga0070665_100005964 Ga0070665_1000059648 185
288 3300005548 Ga0070665_100208289 Ga0070665_1002082892 185
289 3300005548 Ga0070665_100326872 Ga0070665_1003268722 185
290 3300005563 Ga0068855_100099856 Ga0068855_1000998563 185
291 3300005563 Ga0068855_100203891 Ga0068855_1002038912 185
292 3300005564 Ga0070664_100010180 Ga0070664_1000101805 185
293 3300005564 Ga0070664_100038998 Ga0070664_1000389984 185
294 3300005564 Ga0070664_100051636 Ga0070664_1000516362 185
295 3300005564 Ga0070664_100081876 Ga0070664_1000818763 185
296 3300005564 Ga0070664_100195387 Ga0070664_1001953873 185
297 3300005577 Ga0068857_100001367 Ga0068857_10000136720 185
298 3300005577 Ga0068857_100045914 Ga0068857_1000459142 185
299 3300005577 Ga0068857_100469934 Ga0068857_1004699342 185
300 3300005578 Ga0068854_100008084 Ga0068854_1000080842 185
301 3300005578 Ga0068854_100093052 Ga0068854_1000930522 185
302 3300005578 Ga0068854_100231763 Ga0068854_1002317632 185
303 3300005614 Ga0068856_100019461 Ga0068856_1000194615 185
304 3300005614 Ga0068856_100190462 Ga0068856_1001904622 185
305 3300005614 Ga0068856_100367005 Ga0068856_1003670052 185
306 3300005615 Ga0070702_100104818 Ga0070702_1001048182 185
307 3300005616 Ga0068852_100008019 Ga0068852_1000080197 185
308 3300005616 Ga0068852_100011640 Ga0068852_1000116406 185
309 3300005616 Ga0068852_100048307 Ga0068852_1000483072 185
310 3300005616 Ga0068852_100073257 Ga0068852_1000732573 185
311 3300005616 Ga0068852_100177745 Ga0068852_1001777452 185
312 3300005616 Ga0068852_100187534 Ga0068852_1001875342 185
313 3300005616 Ga0068852_100279862 Ga0068852_1002798622 185
314 3300005616 Ga0068852_100437440 Ga0068852_1004374402 185
315 3300005616 Ga0068852_100581796 Ga0068852_1005817962 185
316 3300005617 Ga0068859_100003371 Ga0068859_10000337113 185
317 3300005617 Ga0068859_100035640 Ga0068859_1000356403 185
318 3300005617 Ga0068859_100233270 Ga0068859_1002332702 185
319 3300005617 Ga0068859_100384114 Ga0068859_1003841143 185
320 3300005618 Ga0068864_100001559 Ga0068864_10000155916 185
321 3300005618 Ga0068864_100012414 Ga0068864_1000124146 185
322 3300005618 Ga0068864_100031702 Ga0068864_1000317022 185
323 3300005618 Ga0068864_100037258 Ga0068864_1000372584 185
324 3300005618 Ga0068864_100049747 Ga0068864_1000497472 185
325 3300005618 Ga0068864_100097230 Ga0068864_1000972302 185
326 3300005618 Ga0068864_100137810 Ga0068864_1001378101 185
327 3300005618 Ga0068864_100155641 Ga0068864_1001556412 185
328 3300005618 Ga0068864_100521484 Ga0068864_1005214842 185
329 3300005618 Ga0068864_100562440 Ga0068864_1005624402 185
330 3300005718 Ga0068866_10002006 Ga0068866_100020068 185
331 3300005718 Ga0068866_10017749 Ga0068866_100177492 185
332 3300005718 Ga0068866_10072147 Ga0068866_100721472 185
333 3300005719 Ga0068861_100000532 Ga0068861_10000053213 185
334 3300005719 Ga0068861_100013654 Ga0068861_1000136545 185
335 3300005719 Ga0068861_100084254 Ga0068861_1000842543 185
336 3300005719 Ga0068861_100261087 Ga0068861_1002610872 185
337 3300005719 Ga0068861_101255109 Ga0068861_1012551091 185
338 3300005834 Ga0068851_10020913 Ga0068851_100209133 185
339 3300005834 Ga0068851_10067896 Ga0068851_100678961 185
340 3300005834 Ga0068851_10159697 Ga0068851_101596972 185
341 3300005834 Ga0068851_10381614 Ga0068851_103816141 185
342 3300005840 Ga0068870_10061290 Ga0068870_100612901 185
343 3300005840 Ga0068870_10602287 Ga0068870_106022871 185
344 3300005840 Ga0068870_10625302 Ga0068870_106253021 185
345 3300005841 Ga0068863_100004398 Ga0068863_1000043982 185
346 3300005841 Ga0068863_100021795 Ga0068863_1000217954 185
347 3300005841 Ga0068863_100154370 Ga0068863_1001543702 185
348 3300005841 Ga0068863_100170460 Ga0068863_1001704602 185
349 3300005841 Ga0068863_100234480 Ga0068863_1002344802 185
350 3300005842 Ga0068858_100002862 Ga0068858_10000286210 185
351 3300005842 Ga0068858_100005186 Ga0068858_10000518610 185
352 3300005842 Ga0068858_100134191 Ga0068858_1001341912 185
353 3300005842 Ga0068858_100365770 Ga0068858_1003657702 185
354 3300005842 Ga0068858_100750717 Ga0068858_1007507171 185
355 3300005843 Ga0068860_100007631 Ga0068860_10000763110 185
356 3300005843 Ga0068860_100027719 Ga0068860_1000277194 185
357 3300005843 Ga0068860_100050579 Ga0068860_1000505792 185
358 3300005843 Ga0068860_100478826 Ga0068860_1004788262 185
359 3300005843 Ga0068860_100702461 Ga0068860_1007024612 185
360 3300005844 Ga0068862_100011630 Ga0068862_1000116305 185
361 3300005844 Ga0068862_100021891 Ga0068862_1000218916 185
362 3300005844 Ga0068862_100044354 Ga0068862_1000443543 185
363 3300005844 Ga0068862_100299030 Ga0068862_1002990302 185
364 3300005844 Ga0068862_100902779 Ga0068862_1009027792 185
365 3300006042 Ga0075368_10044832 Ga0075368_100448322 185
366 3300006048 Ga0075363_100128897 Ga0075363_1001288972 185
367 3300006163 Ga0070715_10175733 Ga0070715_101757331 185
368 3300006177 Ga0075362_10051026 Ga0075362_100510261 185
369 3300006177 Ga0075362_10061016 Ga0075362_100610162 185
370 3300006178 Ga0075367_10055501 Ga0075367_100555012 185
371 3300006195 Ga0075366_10001365 Ga0075366_100013658 185
372 3300006195 Ga0075366_10001515 Ga0075366_100015156 185
373 3300006195 Ga0075366_10002469 Ga0075366_1000246912 185
374 3300006195 Ga0075366_10044579 Ga0075366_100445793 185
375 3300006195 Ga0075366_10056238 Ga0075366_100562383 185
376 3300006195 Ga0075366_10074701 Ga0075366_100747012 185
377 3300006195 Ga0075366_10083894 Ga0075366_100838943 185
378 3300006195 Ga0075366_10111437 Ga0075366_101114372 185
379 3300006195 Ga0075366_10133817 Ga0075366_101338172 185
380 3300006195 Ga0075366_10187262 Ga0075366_101872622 185
381 3300006195 Ga0075366_10222552 Ga0075366_102225522 185
382 3300006195 Ga0075366_10317254 Ga0075366_103172541 185
383 3300006195 Ga0075366_10327403 Ga0075366_103274032 185
384 3300006237 Ga0097621_100014007 Ga0097621_1000140074 185
385 3300006237 Ga0097621_100044502 Ga0097621_1000445025 185
386 3300006237 Ga0097621_100321429 Ga0097621_1003214292 185
387 3300006237 Ga0097621_100352274 Ga0097621_1003522741 185
388 3300006353 Ga0075370_10005826 Ga0075370_100058266 185
389 3300006353 Ga0075370_10281879 Ga0075370_102818791 185
390 3300006358 Ga0068871_100023551 Ga0068871_1000235512 185
391 3300006358 Ga0068871_100028476 Ga0068871_1000284764 185
392 3300006358 Ga0068871_100053309 Ga0068871_1000533092 185
393 3300006358 Ga0068871_100149108 Ga0068871_1001491084 185
394 3300006358 Ga0068871_100444250 Ga0068871_1004442501 185
395 3300006846 Ga0075430_100065902 Ga0075430_1000659023 185
396 3300006852 Ga0075433_10575585 Ga0075433_105755852 185
397 3300006880 Ga0075429_100229141 Ga0075429_1002291412 185
398 3300006880 Ga0075429_100949764 Ga0075429_1009497641 185
399 3300006881 Ga0068865_100017684 Ga0068865_1000176842 185
400 3300006881 Ga0068865_100023045 Ga0068865_1000230454 185
401 3300006881 Ga0068865_100074788 Ga0068865_1000747884 185
402 3300006881 Ga0068865_100188060 Ga0068865_1001880602 185
403 3300006881 Ga0068865_100407493 Ga0068865_1004074932 185
404 3300006881 Ga0068865_100766538 Ga0068865_1007665382 185
405 3300006931 Ga0097620_100003371 Ga0097620_10000337113 185
406 3300006931 Ga0097620_100035640 Ga0097620_1000356404 185
407 3300006931 Ga0097620_100233247 Ga0097620_1002332472 185
408 3300006931 Ga0097620_100384094 Ga0097620_1003840943 185
409 3300006942 Ga0099824_1044356 Ga0099824_10443561 185
410 3300006944 Ga0099823_1000478 Ga0099823_100047822 185
411 3300006946 Ga0079104_1000073 Ga0079104_1000073119 185
412 3300009093 Ga0105240_10238988 Ga0105240_102389883 185
413 3300009093 Ga0105240_10316716 Ga0105240_103167162 185
414 3300009093 Ga0105240_10406912 Ga0105240_104069121 185
415 3300009094 Ga0111539_11204405 Ga0111539_112044052 185
416 3300009094 Ga0111539_11424277 Ga0111539_114242771 185
417 3300009098 Ga0105245_10040028 Ga0105245_100400284 185
418 3300009098 Ga0105245_10057446 Ga0105245_100574463 185
419 3300009098 Ga0105245_10080074 Ga0105245_100800743 185
420 3300009101 Ga0105247_10152680 Ga0105247_101526802 185
421 3300009147 Ga0114129_10221541 Ga0114129_102215415 185
422 3300009147 Ga0114129_10816605 Ga0114129_108166051 185
423 3300009148 Ga0105243_10000525 Ga0105243_100005257 185
424 3300009148 Ga0105243_10016853 Ga0105243_100168534 185
425 3300009148 Ga0105243_10103056 Ga0105243_101030561 185
426 3300009148 Ga0105243_10108081 Ga0105243_101080815 185
427 3300009148 Ga0105243_10233869 Ga0105243_102338692 185
428 3300009148 Ga0105243_10583100 Ga0105243_105831002 185
429 3300009174 Ga0105241_10177180 Ga0105241_101771802 185
430 3300009174 Ga0105241_10265770 Ga0105241_102657702 185
431 3300009174 Ga0105241_10271203 Ga0105241_102712032 185
432 3300009174 Ga0105241_11281576 Ga0105241_112815762 185
433 3300009176 Ga0105242_10201510 Ga0105242_102015102 185
434 3300009176 Ga0105242_10227154 Ga0105242_102271542 185
435 3300009176 Ga0105242_10402634 Ga0105242_104026342 185
436 3300009176 Ga0105242_10954026 Ga0105242_109540261 185
437 3300009177 Ga0105248_10004278 Ga0105248_100042782 185
438 3300009177 Ga0105248_10020342 Ga0105248_100203424 185
439 3300009177 Ga0105248_10034541 Ga0105248_100345414 185
440 3300009177 Ga0105248_10096649 Ga0105248_100966494 185
441 3300009177 Ga0105248_10472538 Ga0105248_104725382 185
442 3300009177 Ga0105248_10687688 Ga0105248_106876881 185
443 3300009545 Ga0105237_10124824 Ga0105237_101248243 185
444 3300009545 Ga0105237_10339544 Ga0105237_103395441 185
445 3300009551 Ga0105238_10068232 Ga0105238_100682324 185
446 3300009551 Ga0105238_10094092 Ga0105238_100940924 185
447 3300009553 Ga0105249_10001432 Ga0105249_100014327 185
448 3300009553 Ga0105249_10012730 Ga0105249_100127305 185
449 3300009553 Ga0105249_10020599 Ga0105249_100205994 185
450 3300009553 Ga0105249_10720438 Ga0105249_107204381 185
451 3300010375 Ga0105239_10075916 Ga0105239_100759161 185
452 3300010375 Ga0105239_10092418 Ga0105239_100924184 185
453 3300011119 Ga0105246_10509203 Ga0105246_105092032 185
454 3300012512 Ga0157327_1002776 Ga0157327_10027761 185
455 3300012513 Ga0157326_1035709 Ga0157326_10357091 185
456 3300013102 Ga0157371_10075565 Ga0157371_100755654 185
457 3300013102 Ga0157371_10107401 Ga0157371_101074012 185
458 3300013102 Ga0157371_10235021 Ga0157371_102350211 185
459 3300013102 Ga0157371_10277075 Ga0157371_102770752 185
460 3300013105 Ga0157369_10097256 Ga0157369_100972562 185
461 3300013105 Ga0157369_10097287 Ga0157369_100972873 185
462 3300013296 Ga0157374_10012660 Ga0157374_100126606 185
463 3300013296 Ga0157374_10023686 Ga0157374_100236864 185
464 3300013296 Ga0157374_10023909 Ga0157374_100239093 185
465 3300013296 Ga0157374_10139538 Ga0157374_101395383 185
466 3300013296 Ga0157374_10802172 Ga0157374_108021721 185
467 3300013296 Ga0157374_10989530 Ga0157374_109895301 185
468 3300013297 Ga0157378_10002431 Ga0157378_100024315 185
469 3300013297 Ga0157378_10058929 Ga0157378_100589292 185
470 3300013297 Ga0157378_10071947 Ga0157378_100719473 185
471 3300013297 Ga0157378_10102354 Ga0157378_101023543 185
472 3300013297 Ga0157378_10225438 Ga0157378_102254383 185
473 3300013297 Ga0157378_10352336 Ga0157378_103523361 185
474 3300013297 Ga0157378_10554131 Ga0157378_105541312 185
475 3300013306 Ga0163162_10001627 Ga0163162_1000162711 185
476 3300013306 Ga0163162_10019603 Ga0163162_100196033 185
477 3300013306 Ga0163162_10244234 Ga0163162_102442343 185
478 3300013307 Ga0157372_10030878 Ga0157372_100308785 185
479 3300013307 Ga0157372_10201706 Ga0157372_102017063 185
480 3300013307 Ga0157372_10321478 Ga0157372_103214782 185
481 3300013308 Ga0157375_10008159 Ga0157375_100081592 185
482 3300013308 Ga0157375_10016322 Ga0157375_100163224 185
483 3300013308 Ga0157375_10056678 Ga0157375_100566784 185
484 3300013308 Ga0157375_10063864 Ga0157375_100638643 185
485 3300013308 Ga0157375_10066431 Ga0157375_100664313 185
486 3300013308 Ga0157375_10126863 Ga0157375_101268632 185
487 3300013308 Ga0157375_10191158 Ga0157375_101911583 185
488 3300013308 Ga0157375_11167324 Ga0157375_111673241 185
489 3300014325 Ga0163163_10009402 Ga0163163_100094027 185
490 3300014325 Ga0163163_10848203 Ga0163163_108482032 185
491 3300014326 Ga0157380_10006027 Ga0157380_100060274 185
492 3300014326 Ga0157380_10006297 Ga0157380_100062975 185
493 3300014326 Ga0157380_10028112 Ga0157380_100281124 185
494 3300014326 Ga0157380_10203981 Ga0157380_102039812 185
495 3300014326 Ga0157380_10221352 Ga0157380_102213522 185
496 3300014326 Ga0157380_10509047 Ga0157380_105090472 185
497 3300014745 Ga0157377_10000038 Ga0157377_1000003831 185
498 3300014745 Ga0157377_10000784 Ga0157377_1000078410 185
499 3300014968 Ga0157379_10001736 Ga0157379_100017366 185
500 3300014968 Ga0157379_10002470 Ga0157379_100024705 185
501 3300014968 Ga0157379_10015679 Ga0157379_100156792 185
502 3300014968 Ga0157379_10018191 Ga0157379_100181912 185
503 3300014968 Ga0157379_10038599 Ga0157379_100385991 185
504 3300014968 Ga0157379_10047186 Ga0157379_100471864 185
505 3300014968 Ga0157379_10055645 Ga0157379_100556453 185
506 3300014968 Ga0157379_10263463 Ga0157379_102634631 185
507 3300014968 Ga0157379_10318507 Ga0157379_103185072 185
508 3300014968 Ga0157379_10339058 Ga0157379_103390582 185
509 3300014969 Ga0157376_10023720 Ga0157376_100237205 185
510 3300014969 Ga0157376_10061547 Ga0157376_100615472 185
511 3300014969 Ga0157376_10092091 Ga0157376_100920912 185
512 3300014969 Ga0157376_10179041 Ga0157376_101790411 185
513 3300014969 Ga0157376_10360712 Ga0157376_103607122 185
514 3300015261 Ga0182006_1121151 Ga0182006_11211512 185
515 3300015262 Ga0182007_10076658 Ga0182007_100766582 185
516 3300015265 Ga0182005_1076329 Ga0182005_10763292 185
517 3300017792 Ga0163161_10005593 Ga0163161_100055938 185
518 3300017792 Ga0163161_10043874 Ga0163161_100438742 185
519 3300017792 Ga0163161_10113550 Ga0163161_101135502 185
520 3300021361 Ga0213872_10000006 Ga0213872_1000000628 185
521 3300021361 Ga0213872_10000085 Ga0213872_1000008567 185
522 3300021361 Ga0213872_10001073 Ga0213872_1000107314 185
523 3300021361 Ga0213872_10057925 Ga0213872_100579251 185
524 3300025226 Ga0209674_100041 Ga0209674_100041125 185
525 3300025228 Ga0209672_104503 Ga0209672_1045032 185
526 3300025230 Ga0209563_100043 Ga0209563_100043125 185
527 3300025230 Ga0209563_100044 Ga0209563_100044174 185
528 3300025231 Ga0207427_100341 Ga0207427_10034111 185
529 3300025242 Ga0209258_100515 Ga0209258_10051533 185
530 3300025242 Ga0209258_100693 Ga0209258_1006938 185
531 3300025245 Ga0207425_1000802 Ga0207425_10008026 185
532 3300025245 Ga0207425_1018613 Ga0207425_10186132 185
533 3300025246 Ga0209646_1000069 Ga0209646_1000069167 185
534 3300025250 Ga0209026_1000006 Ga0209026_1000006262 185
535 3300025253 Ga0209677_100077 Ga0209677_100077125 185
536 3300025253 Ga0209677_101016 Ga0209677_10101613 185
537 3300025253 Ga0209677_104838 Ga0209677_1048383 185
538 3300025256 Ga0209759_1000189 Ga0209759_10001893 185
539 3300025256 Ga0209759_1002556 Ga0209759_10025568 185
540 3300025256 Ga0209759_1005450 Ga0209759_10054503 185
541 3300025256 Ga0209759_1006592 Ga0209759_10065923 185
542 3300025258 Ga0209129_1000012 Ga0209129_1000012272 185
543 3300025263 Ga0209565_1024949 Ga0209565_10249491 185
544 3300025272 Ga0209455_1000597 Ga0209455_10005978 185
545 3300025273 Ga0209673_1001736 Ga0209673_100173618 185
546 3300025273 Ga0209673_1005928 Ga0209673_10059286 185
547 3300025273 Ga0209673_1007378 Ga0209673_10073782 185
548 3300025273 Ga0209673_1014115 Ga0209673_10141153 185
549 3300025290 Ga0207673_1020590 Ga0207673_10205902 185
550 3300025295 Ga0209564_1000008 Ga0209564_1000008581 185
551 3300025295 Ga0209564_1000022 Ga0209564_1000022242 185
552 3300025297 Ga0209758_1000099 Ga0209758_10000997 185
553 3300025297 Ga0209758_1000234 Ga0209758_1000234117 185
554 3300025298 Ga0209050_1000691 Ga0209050_10006915 185
555 3300025298 Ga0209050_1002840 Ga0209050_10028407 185
556 3300025298 Ga0209050_1012415 Ga0209050_10124152 185
557 3300025298 Ga0209050_1015253 Ga0209050_10152532 185
558 3300025299 Ga0209256_1000036 Ga0209256_1000036152 185
559 3300025299 Ga0209256_1002027 Ga0209256_10020278 185
560 3300025299 Ga0209256_1022129 Ga0209256_10221292 185
561 3300025303 Ga0209051_1000068 Ga0209051_100006859 185
562 3300025303 Ga0209051_1001546 Ga0209051_100154614 185
563 3300025303 Ga0209051_1004282 Ga0209051_10042825 185
564 3300025303 Ga0209051_1011828 Ga0209051_10118283 185
565 3300025303 Ga0209051_1044190 Ga0209051_10441902 185
566 3300025304 Ga0209257_1000033 Ga0209257_1000033135 185
567 3300025304 Ga0209257_1000146 Ga0209257_100014633 185
568 3300025304 Ga0209257_1018570 Ga0209257_10185702 185
569 3300025315 Ga0207697_10082007 Ga0207697_100820072 185
570 3300025321 Ga0207656_10037754 Ga0207656_100377542 185
571 3300025321 Ga0207656_10253131 Ga0207656_102531312 185
572 3300025893 Ga0207682_10002764 Ga0207682_100027642 185
573 3300025893 Ga0207682_10006249 Ga0207682_100062494 185
574 3300025893 Ga0207682_10022286 Ga0207682_100222863 185
575 3300025893 Ga0207682_10057601 Ga0207682_100576012 185
576 3300025893 Ga0207682_10069461 Ga0207682_100694612 185
577 3300025899 Ga0207642_10007749 Ga0207642_100077492 185
578 3300025899 Ga0207642_10030199 Ga0207642_100301993 185
579 3300025899 Ga0207642_10032222 Ga0207642_100322222 185
580 3300025903 Ga0207680_10013435 Ga0207680_100134355 185
581 3300025903 Ga0207680_10064225 Ga0207680_100642251 185
582 3300025903 Ga0207680_10548713 Ga0207680_105487132 185
583 3300025907 Ga0207645_10010823 Ga0207645_100108236 185
584 3300025907 Ga0207645_10027395 Ga0207645_100273954 185
585 3300025907 Ga0207645_10032784 Ga0207645_100327842 185
586 3300025907 Ga0207645_10034580 Ga0207645_100345803 185
587 3300025907 Ga0207645_10184706 Ga0207645_101847062 185
588 3300025907 Ga0207645_10329518 Ga0207645_103295182 185
589 3300025907 Ga0207645_10343404 Ga0207645_103434042 185
590 3300025908 Ga0207643_10106545 Ga0207643_101065452 185
591 3300025909 Ga0207705_10031141 Ga0207705_100311412 185
592 3300025909 Ga0207705_10074065 Ga0207705_100740653 185
593 3300025909 Ga0207705_10100357 Ga0207705_101003572 185
594 3300025909 Ga0207705_10158779 Ga0207705_101587792 185
595 3300025912 Ga0207707_10117012 Ga0207707_101170122 185
596 3300025912 Ga0207707_10137881 Ga0207707_101378813 185
597 3300025913 Ga0207695_10054703 Ga0207695_100547033 185
598 3300025913 Ga0207695_10110263 Ga0207695_101102633 185
599 3300025914 Ga0207671_10056267 Ga0207671_100562672 185
600 3300025914 Ga0207671_10289600 Ga0207671_102896002 185
601 3300025917 Ga0207660_10018222 Ga0207660_100182225 185
602 3300025918 Ga0207662_10010982 Ga0207662_100109821 185
603 3300025918 Ga0207662_10051527 Ga0207662_100515272 185
604 3300025919 Ga0207657_10119150 Ga0207657_101191501 185
605 3300025919 Ga0207657_10165076 Ga0207657_101650763 185
606 3300025919 Ga0207657_10213629 Ga0207657_102136292 185
607 3300025919 Ga0207657_10326074 Ga0207657_103260741 185
608 3300025919 Ga0207657_10331574 Ga0207657_103315742 185
609 3300025920 Ga0207649_10001094 Ga0207649_100010942 185
610 3300025920 Ga0207649_10051405 Ga0207649_100514053 185
611 3300025920 Ga0207649_10312387 Ga0207649_103123872 185
612 3300025920 Ga0207649_10384869 Ga0207649_103848691 185
613 3300025921 Ga0207652_10013195 Ga0207652_100131952 185
614 3300025923 Ga0207681_10015959 Ga0207681_100159593 185
615 3300025923 Ga0207681_10028289 Ga0207681_100282894 185
616 3300025923 Ga0207681_10096707 Ga0207681_100967072 185
617 3300025923 Ga0207681_10126404 Ga0207681_101264042 185
618 3300025923 Ga0207681_11176146 Ga0207681_111761461 185
619 3300025924 Ga0207694_10036898 Ga0207694_100368984 185
620 3300025924 Ga0207694_10536374 Ga0207694_105363741 185
621 3300025925 Ga0207650_10001670 Ga0207650_100016702 185
622 3300025925 Ga0207650_10003627 Ga0207650_100036277 185
623 3300025925 Ga0207650_10005846 Ga0207650_100058463 185
624 3300025925 Ga0207650_10064306 Ga0207650_100643064 185
625 3300025925 Ga0207650_10195654 Ga0207650_101956543 185
626 3300025926 Ga0207659_10002852 Ga0207659_100028523 185
627 3300025926 Ga0207659_10008593 Ga0207659_100085936 185
628 3300025926 Ga0207659_10055044 Ga0207659_100550444 185
629 3300025926 Ga0207659_10115972 Ga0207659_101159723 185
630 3300025926 Ga0207659_10238027 Ga0207659_102380272 185
631 3300025926 Ga0207659_10457999 Ga0207659_104579991 185
632 3300025926 Ga0207659_10580892 Ga0207659_105808921 185
633 3300025927 Ga0207687_10088022 Ga0207687_100880222 185
634 3300025927 Ga0207687_10092521 Ga0207687_100925212 185
635 3300025927 Ga0207687_10246672 Ga0207687_102466723 185
636 3300025931 Ga0207644_10014014 Ga0207644_100140143 185
637 3300025931 Ga0207644_10024985 Ga0207644_100249852 185
638 3300025931 Ga0207644_10048053 Ga0207644_100480533 185
639 3300025931 Ga0207644_10130504 Ga0207644_101305043 185
640 3300025931 Ga0207644_10347617 Ga0207644_103476172 185
641 3300025931 Ga0207644_10519550 Ga0207644_105195502 185
642 3300025931 Ga0207644_11059510 Ga0207644_110595101 185
643 3300025932 Ga0207690_10002003 Ga0207690_100020035 185
644 3300025932 Ga0207690_10017625 Ga0207690_100176253 185
645 3300025932 Ga0207690_10236024 Ga0207690_102360242 185
646 3300025932 Ga0207690_10383752 Ga0207690_103837521 185
647 3300025932 Ga0207690_10401396 Ga0207690_104013962 185
648 3300025932 Ga0207690_11197902 Ga0207690_111979021 185
649 3300025933 Ga0207706_10003398 Ga0207706_100033984 185
650 3300025933 Ga0207706_10003614 Ga0207706_100036145 185
651 3300025933 Ga0207706_10105780 Ga0207706_101057802 185
652 3300025933 Ga0207706_10185836 Ga0207706_101858362 185
653 3300025934 Ga0207686_10160889 Ga0207686_101608892 185
654 3300025934 Ga0207686_10262340 Ga0207686_102623401 185
655 3300025934 Ga0207686_10328181 Ga0207686_103281811 185
656 3300025934 Ga0207686_10342093 Ga0207686_103420932 185
657 3300025935 Ga0207709_10001781 Ga0207709_100017817 185
658 3300025935 Ga0207709_10006230 Ga0207709_100062309 185
659 3300025935 Ga0207709_10339145 Ga0207709_103391452 185
660 3300025936 Ga0207670_10280059 Ga0207670_102800592 185
661 3300025937 Ga0207669_10007179 Ga0207669_100071796 185
662 3300025937 Ga0207669_10066197 Ga0207669_100661973 185
663 3300025937 Ga0207669_10205381 Ga0207669_102053811 185
664 3300025937 Ga0207669_10420893 Ga0207669_104208931 185
665 3300025938 Ga0207704_10000810 Ga0207704_100008103 185
666 3300025938 Ga0207704_10026710 Ga0207704_100267102 185
667 3300025938 Ga0207704_10031983 Ga0207704_100319834 185
668 3300025938 Ga0207704_10035673 Ga0207704_100356734 185
669 3300025939 Ga0207665_10101598 Ga0207665_101015982 185
670 3300025940 Ga0207691_10002842 Ga0207691_100028426 185
671 3300025940 Ga0207691_10003320 Ga0207691_100033206 185
672 3300025940 Ga0207691_10012250 Ga0207691_100122504 185
673 3300025940 Ga0207691_10031619 Ga0207691_100316194 185
674 3300025940 Ga0207691_10087976 Ga0207691_100879763 185
675 3300025940 Ga0207691_10128681 Ga0207691_101286812 185
676 3300025941 Ga0207711_10024886 Ga0207711_100248866 185
677 3300025941 Ga0207711_10033943 Ga0207711_100339432 185
678 3300025941 Ga0207711_10046960 Ga0207711_100469602 185
679 3300025941 Ga0207711_10058246 Ga0207711_100582462 185
680 3300025941 Ga0207711_10067665 Ga0207711_100676653 185
681 3300025941 Ga0207711_10261951 Ga0207711_102619512 185
682 3300025941 Ga0207711_10645761 Ga0207711_106457612 185
683 3300025942 Ga0207689_10004129 Ga0207689_1000412910 185
684 3300025942 Ga0207689_10018115 Ga0207689_100181157 185
685 3300025942 Ga0207689_10048816 Ga0207689_100488162 185
686 3300025944 Ga0207661_10150790 Ga0207661_101507902 185
687 3300025944 Ga0207661_10364047 Ga0207661_103640472 185
688 3300025945 Ga0207679_10008499 Ga0207679_100084994 185
689 3300025945 Ga0207679_10027429 Ga0207679_100274293 185
690 3300025945 Ga0207679_10118822 Ga0207679_101188223 185
691 3300025945 Ga0207679_10179239 Ga0207679_101792392 185
692 3300025945 Ga0207679_10239298 Ga0207679_102392982 185
693 3300025945 Ga0207679_10277212 Ga0207679_102772122 185
694 3300025945 Ga0207679_10279880 Ga0207679_102798802 185
695 3300025945 Ga0207679_10387234 Ga0207679_103872342 185
696 3300025945 Ga0207679_10453038 Ga0207679_104530381 185
697 3300025949 Ga0207667_10057801 Ga0207667_100578013 185
698 3300025949 Ga0207667_10074299 Ga0207667_100742993 185
699 3300025949 Ga0207667_10178337 Ga0207667_101783371 185
700 3300025949 Ga0207667_10191020 Ga0207667_101910202 185
701 3300025949 Ga0207667_10278911 Ga0207667_102789112 185
702 3300025949 Ga0207667_10728589 Ga0207667_107285892 185
703 3300025960 Ga0207651_10018112 Ga0207651_100181123 185
704 3300025960 Ga0207651_10035487 Ga0207651_100354872 185
705 3300025960 Ga0207651_10184451 Ga0207651_101844513 185
706 3300025960 Ga0207651_10186327 Ga0207651_101863272 185
707 3300025960 Ga0207651_10589679 Ga0207651_105896792 185
708 3300025961 Ga0207712_10004226 Ga0207712_100042267 185
709 3300025961 Ga0207712_10006036 Ga0207712_100060363 185
710 3300025961 Ga0207712_10123761 Ga0207712_101237611 185
711 3300025961 Ga0207712_10375602 Ga0207712_103756022 185
712 3300025972 Ga0207668_10013659 Ga0207668_100136596 185
713 3300025972 Ga0207668_10028650 Ga0207668_100286504 185
714 3300025972 Ga0207668_10240814 Ga0207668_102408142 185
715 3300025972 Ga0207668_10419226 Ga0207668_104192262 185
716 3300025981 Ga0207640_10003992 Ga0207640_100039926 185
717 3300025981 Ga0207640_10072562 Ga0207640_100725622 185
718 3300025981 Ga0207640_10073987 Ga0207640_100739871 185
719 3300025981 Ga0207640_10262206 Ga0207640_102622062 185
720 3300025986 Ga0207658_10005459 Ga0207658_100054593 185
721 3300025986 Ga0207658_10016705 Ga0207658_100167054 185
722 3300025986 Ga0207658_10172763 Ga0207658_101727631 185
723 3300025986 Ga0207658_10464734 Ga0207658_104647342 185
724 3300025986 Ga0207658_10570336 Ga0207658_105703361 185
725 3300026023 Ga0207677_10035383 Ga0207677_100353833 185
726 3300026023 Ga0207677_10053941 Ga0207677_100539412 185
727 3300026023 Ga0207677_10093173 Ga0207677_100931731 185
728 3300026023 Ga0207677_10305150 Ga0207677_103051502 185
729 3300026023 Ga0207677_10393288 Ga0207677_103932882 185
730 3300026035 Ga0207703_10007785 Ga0207703_100077854 185
731 3300026035 Ga0207703_10020766 Ga0207703_100207663 185
732 3300026035 Ga0207703_10037216 Ga0207703_100372164 185
733 3300026035 Ga0207703_10118229 Ga0207703_101182293 185
734 3300026035 Ga0207703_10127660 Ga0207703_101276603 185
735 3300026035 Ga0207703_10298809 Ga0207703_102988092 185
736 3300026035 Ga0207703_10369466 Ga0207703_103694662 185
737 3300026041 Ga0207639_10060943 Ga0207639_100609432 185
738 3300026041 Ga0207639_10284363 Ga0207639_102843632 185
739 3300026041 Ga0207639_10308364 Ga0207639_103083642 185
740 3300026041 Ga0207639_10718561 Ga0207639_107185611 185
741 3300026041 Ga0207639_10879865 Ga0207639_108798651 185
742 3300026067 Ga0207678_10004010 Ga0207678_100040103 185
743 3300026067 Ga0207678_10101468 Ga0207678_101014684 185
744 3300026067 Ga0207678_10166070 Ga0207678_101660702 185
745 3300026067 Ga0207678_10188630 Ga0207678_101886302 185
746 3300026067 Ga0207678_10381762 Ga0207678_103817622 185
747 3300026067 Ga0207678_11358459 Ga0207678_113584591 185
748 3300026075 Ga0207708_10026826 Ga0207708_100268263 185
749 3300026075 Ga0207708_10046076 Ga0207708_100460764 185
750 3300026075 Ga0207708_10056463 Ga0207708_100564632 185
751 3300026078 Ga0207702_10084197 Ga0207702_100841972 185
752 3300026078 Ga0207702_10479534 Ga0207702_104795342 185
753 3300026078 Ga0207702_10662444 Ga0207702_106624441 185
754 3300026088 Ga0207641_10002465 Ga0207641_100024653 185
755 3300026088 Ga0207641_10048522 Ga0207641_100485223 185
756 3300026088 Ga0207641_10101777 Ga0207641_101017774 185
757 3300026088 Ga0207641_10119819 Ga0207641_101198193 185
758 3300026088 Ga0207641_10175133 Ga0207641_101751332 185
759 3300026088 Ga0207641_10430282 Ga0207641_104302822 185
760 3300026088 Ga0207641_10559951 Ga0207641_105599512 185
761 3300026088 Ga0207641_10707034 Ga0207641_107070341 185
762 3300026088 Ga0207641_10740094 Ga0207641_107400942 185
763 3300026089 Ga0207648_10000118 Ga0207648_1000011831 185
764 3300026089 Ga0207648_10000842 Ga0207648_1000084230 185
765 3300026089 Ga0207648_10005129 Ga0207648_100051291 185
766 3300026089 Ga0207648_10024991 Ga0207648_100249913 185
767 3300026089 Ga0207648_10048224 Ga0207648_100482244 185
768 3300026089 Ga0207648_10096211 Ga0207648_100962113 185
769 3300026089 Ga0207648_10344581 Ga0207648_103445811 185
770 3300026089 Ga0207648_10401067 Ga0207648_104010672 185
771 3300026095 Ga0207676_10058884 Ga0207676_100588842 185
772 3300026095 Ga0207676_10070932 Ga0207676_100709322 185
773 3300026095 Ga0207676_10099637 Ga0207676_100996372 185
774 3300026095 Ga0207676_10148246 Ga0207676_101482462 185
775 3300026095 Ga0207676_10317590 Ga0207676_103175902 185
776 3300026095 Ga0207676_10535952 Ga0207676_105359522 185
777 3300026116 Ga0207674_10021612 Ga0207674_100216129 185
778 3300026116 Ga0207674_10102519 Ga0207674_101025193 185
779 3300026116 Ga0207674_10235918 Ga0207674_102359182 185
780 3300026116 Ga0207674_10385128 Ga0207674_103851282 185
781 3300026118 Ga0207675_100001529 Ga0207675_1000015296 185
782 3300026118 Ga0207675_100017659 Ga0207675_1000176595 185
783 3300026118 Ga0207675_100033361 Ga0207675_1000333615 185
784 3300026118 Ga0207675_100033388 Ga0207675_1000333883 185
785 3300026118 Ga0207675_100052353 Ga0207675_1000523532 185
786 3300026118 Ga0207675_100164655 Ga0207675_1001646552 185
787 3300026118 Ga0207675_100584014 Ga0207675_1005840142 185
788 3300026118 Ga0207675_101081565 Ga0207675_1010815651 185
789 3300026121 Ga0207683_10044884 Ga0207683_100448844 185
790 3300026121 Ga0207683_10087739 Ga0207683_100877393 185
791 3300026121 Ga0207683_10098615 Ga0207683_100986153 185
792 3300026121 Ga0207683_10112711 Ga0207683_101127112 185
793 3300026121 Ga0207683_10152584 Ga0207683_101525842 185
794 3300026121 Ga0207683_10304377 Ga0207683_103043772 185
795 3300026142 Ga0207698_10001763 Ga0207698_1000176313 185
796 3300026142 Ga0207698_10074135 Ga0207698_100741353 185
797 3300026142 Ga0207698_10089371 Ga0207698_100893711 185
798 3300026142 Ga0207698_10094822 Ga0207698_100948222 185
799 3300026142 Ga0207698_10219326 Ga0207698_102193262 185
800 3300026142 Ga0207698_10376661 Ga0207698_103766611 185
801 3300026142 Ga0207698_10396163 Ga0207698_103961632 185
802 3300026142 Ga0207698_10547501 Ga0207698_105475012 185
803 3300026142 Ga0207698_11700686 Ga0207698_117006861 185
804 3300027111 Ga0209281_1000736 Ga0209281_10007366 185
805 3300027296 Ga0209389_1020739 Ga0209389_10207393 185
806 3300027471 Ga0209995_1005033 Ga0209995_10050331 185
807 3300027526 Ga0209968_1001331 Ga0209968_10013314 185
808 3300027682 Ga0209971_1008514 Ga0209971_10085143 185
809 3300027695 Ga0209966_1000162 Ga0209966_100016218 185
810 3300027876 Ga0209974_10005095 Ga0209974_100050953 185
811 3300028379 Ga0268266_10195518 Ga0268266_101955182 185
812 3300028379 Ga0268266_10487036 Ga0268266_104870362 185
813 3300028380 Ga0268265_10024537 Ga0268265_100245373 185
814 3300028380 Ga0268265_10077830 Ga0268265_100778302 185
815 3300028380 Ga0268265_10553223 Ga0268265_105532232 185
816 3300028380 Ga0268265_10988912 Ga0268265_109889121 185
817 3300028381 Ga0268264_10000858 Ga0268264_1000085825 185
818 3300028381 Ga0268264_10040299 Ga0268264_100402994 185
819 3300028381 Ga0268264_10043465 Ga0268264_100434653 185
820 3300028381 Ga0268264_10245396 Ga0268264_102453962 185
821 3300028381 Ga0268264_10856558 Ga0268264_108565582 185
822 3300028666 Ga0265336_10000013 Ga0265336_10000013140 185
823 3300028786 Ga0307517_10000131 Ga0307517_1000013176 185
824 3300028786 Ga0307517_10139515 Ga0307517_101395153 185
825 3300028786 Ga0307517_10216895 Ga0307517_102168952 185
826 3300028786 Ga0307517_10458448 Ga0307517_104584481 185
827 3300028794 Ga0307515_10000011 Ga0307515_10000011202 185
828 3300028794 Ga0307515_10000138 Ga0307515_1000013854 185
829 3300028794 Ga0307515_10000382 Ga0307515_1000038262 185
830 3300028794 Ga0307515_10001206 Ga0307515_1000120615 185
831 3300028794 Ga0307515_10003938 Ga0307515_100039381 185
832 3300028794 Ga0307515_10030322 Ga0307515_100303226 185
833 3300028794 Ga0307515_10049807 Ga0307515_100498074 185
834 3300028794 Ga0307515_10065551 Ga0307515_100655513 185
835 3300028794 Ga0307515_10207397 Ga0307515_102073973 185
836 3300028794 Ga0307515_10368899 Ga0307515_103688992 185
837 3300029957 Ga0265324_10000432 Ga0265324_1000043228 185
838 3300030522 Ga0307512_10037633 Ga0307512_100376332 185
839 3300030522 Ga0307512_10056737 Ga0307512_100567373 185
840 3300030522 Ga0307512_10057621 Ga0307512_100576212 185
841 3300030522 Ga0307512_10222233 Ga0307512_102222331 185
842 3300031239 Ga0265328_10011442 Ga0265328_100114422 185
843 3300031239 Ga0265328_10011544 Ga0265328_100115442 185
844 3300031250 Ga0265331_10001252 Ga0265331_1000125215 185
845 3300031251 Ga0265327_10000042 Ga0265327_10000042210 185
846 3300031251 Ga0265327_10000174 Ga0265327_1000017426 185
847 3300031456 Ga0307513_10006637 Ga0307513_100066378 185
848 3300031456 Ga0307513_10008888 Ga0307513_1000888811 185
849 3300031456 Ga0307513_10390773 Ga0307513_103907732 185
850 3300031507 Ga0307509_10004119 Ga0307509_1000411916 185
851 3300031507 Ga0307509_10005021 Ga0307509_100050219 185
852 3300031507 Ga0307509_10007961 Ga0307509_100079616 185
853 3300031507 Ga0307509_10045866 Ga0307509_100458665 185
854 3300031507 Ga0307509_10068229 Ga0307509_100682293 185
855 3300031507 Ga0307509_10131019 Ga0307509_101310193 185
856 3300031507 Ga0307509_10251599 Ga0307509_102515992 185
857 3300031507 Ga0307509_10297350 Ga0307509_102973501 185
858 3300031548 Ga0307408_100000037 Ga0307408_10000003763 185
859 3300031548 Ga0307408_100405031 Ga0307408_1004050312 185
860 3300031616 Ga0307508_10000727 Ga0307508_1000072722 185
861 3300031616 Ga0307508_10016265 Ga0307508_100162652 185
862 3300031616 Ga0307508_10063507 Ga0307508_100635073 185
863 3300031616 Ga0307508_10344109 Ga0307508_103441091 185
864 3300031616 Ga0307508_10393564 Ga0307508_103935642 185
865 3300031649 Ga0307514_10000390 Ga0307514_1000039075 185
866 3300031649 Ga0307514_10002716 Ga0307514_1000271616 185
867 3300031649 Ga0307514_10065265 Ga0307514_100652653 185
868 3300031730 Ga0307516_10000559 Ga0307516_1000055940 185
869 3300031730 Ga0307516_10001343 Ga0307516_1000134334 185
870 3300031730 Ga0307516_10006485 Ga0307516_100064855 185
871 3300031730 Ga0307516_10335360 Ga0307516_103353602 185
872 3300031730 Ga0307516_10475680 Ga0307516_104756802 185
873 3300031731 Ga0307405_10002935 Ga0307405_100029356 185
874 3300031731 Ga0307405_10107459 Ga0307405_101074592 185
875 3300031731 Ga0307405_10150554 Ga0307405_101505542 185
876 3300031731 Ga0307405_10365846 Ga0307405_103658462 185
877 3300031824 Ga0307413_10016247 Ga0307413_100162474 185
878 3300031824 Ga0307413_11257263 Ga0307413_112572631 185
879 3300031852 Ga0307410_10028168 Ga0307410_100281684 185
880 3300031852 Ga0307410_10174111 Ga0307410_101741112 185
881 3300031852 Ga0307410_10249965 Ga0307410_102499652 185
882 3300031852 Ga0307410_10308742 Ga0307410_103087421 185
883 3300031852 Ga0307410_10368146 Ga0307410_103681462 185
884 3300031901 Ga0307406_10178736 Ga0307406_101787362 185
885 3300031903 Ga0307407_10347238 Ga0307407_103472381 185
886 3300031903 Ga0307407_10489762 Ga0307407_104897621 185
887 3300031911 Ga0307412_10023995 Ga0307412_100239954 185
888 3300031911 Ga0307412_10127635 Ga0307412_101276352 185
889 3300031995 Ga0307409_100014831 Ga0307409_1000148315 185
890 3300031995 Ga0307409_100015029 Ga0307409_1000150294 185
891 3300031995 Ga0307409_100350884 Ga0307409_1003508842 185
892 3300032002 Ga0307416_100001622 Ga0307416_1000016226 185
893 3300032002 Ga0307416_100074296 Ga0307416_1000742963 185
894 3300032002 Ga0307416_100079922 Ga0307416_1000799222 185
895 3300032002 Ga0307416_100092016 Ga0307416_1000920162 185
896 3300032002 Ga0307416_100409062 Ga0307416_1004090622 185
897 3300032002 Ga0307416_100715878 Ga0307416_1007158782 185
898 3300032002 Ga0307416_100864899 Ga0307416_1008648992 185
899 3300032002 Ga0307416_101147545 Ga0307416_1011475452 185
900 3300032002 Ga0307416_101977863 Ga0307416_1019778631 185
901 3300032004 Ga0307414_10016912 Ga0307414_100169124 185
902 3300032004 Ga0307414_10820959 Ga0307414_108209591 185
903 3300032005 Ga0307411_10000494 Ga0307411_100004947 185
904 3300032005 Ga0307411_10027470 Ga0307411_100274703 185
905 3300032126 Ga0307415_100002203 Ga0307415_1000022032 185
906 3300032126 Ga0307415_100034318 Ga0307415_1000343182 185
907 3300033179 Ga0307507_10029403 Ga0307507_100294036 185
908 3300033179 Ga0307507_10151038 Ga0307507_101510381 185
909 3300033180 Ga0307510_10007325 Ga0307510_100073254 185
910 3300033180 Ga0307510_10047690 Ga0307510_100476902 185
911 3300033180 Ga0307510_10178338 Ga0307510_101783381 185
912 3300034816 Ga0373930_0040359 Ga0373930_0040359_203_760 185
913 3300034820 Ga0373959_0026677 Ga0373959_0026677_296_853 185
914 3300034820 Ga0373959_0120729 Ga0373959_0120729_33_590 185
915 3300035088 Ga0373940_0034838 Ga0373940_0034838_744_1301 185
916 3300035091 Ga0373951_0029991 Ga0373951_0029991_119_676 185
917 3300035112 Ga0373932_0114193 Ga0373932_0114193_38_595 185
918 3300035113 Ga0373936_0030416 Ga0373936_0030416_1560_2117 185
919 3300035113 Ga0373936_0114062 Ga0373936_0114062_102_659 185
920 3300035114 Ga0373939_0000130 Ga0373939_0000130_17620_18177 185
921 3300035114 Ga0373939_0034204 Ga0373939_0034204_187_744 185
922 3300035114 Ga0373939_0196592 Ga0373939_0196592_101_658 185
923 3300035115 Ga0373941_0171835 Ga0373941_0171835_115_672 185
924 3300035116 Ga0373945_0024452 Ga0373945_0024452_1244_1801 185
925 3300035116 Ga0373945_0109486 Ga0373945_0109486_478_1035 185
926 3300035118 Ga0373954_0096475 Ga0373954_0096475_812_1369 185
927 3300035121 Ga0373960_0152422 Ga0373960_0152422_204_761 185
928 3300035170 Ga0373943_0031046 Ga0373943_0031046_1040_1618 185
929 3300035171 Ga0373946_0132198 Ga0373946_0132198_414_971 185
930 3300035172 Ga0373955_0026724 Ga0373955_0026724_1780_2337 185
931 3300035241 Ga0373961_0016647 Ga0373961_0016647_123_680 185
932 3300035242 Ga0373962_0083098 Ga0373962_0083098_56_613 185
933 3300035410 Ga0373924_0033543 Ga0373924_0033543_1038_1595 185
934 3300035691 Ga0373931_0000077 Ga0373931_0000077_15781_16338 185
935 3300035691 Ga0373931_0004391 Ga0373931_0004391_3780_4337 185
936 3300035691 Ga0373931_0043713 Ga0373931_0043713_820_1377 185
937 3300035691 Ga0373931_0309889 Ga0373931_0309889_317_874 185
938 3300036401 Ga0373937_0029553 Ga0373937_0029553_3013_3570 185
939 3300036401 Ga0373937_0553807 Ga0373937_0553807_501_1079 185
940 3300037068 Ga0373925_0037784 Ga0373925_0037784_1506_2063 185
941 3300037418 Ga0395900_0000879 Ga0395900_0000879_13482_14108 185
942 3300037418 Ga0395900_0414590 Ga0395900_0414590_715_1272 185
943 3300037466 Ga0395898_0001863 Ga0395898_0001863_25145_25702 185
944 3300037471 Ga0395905_0003332 Ga0395905_0003332_1329_1886 185
945 3300037471 Ga0395905_0007069 Ga0395905_0007069_6387_6944 185
946 3300037471 Ga0395905_0019367 Ga0395905_0019367_985_1542 185
947 3300037471 Ga0395905_0504915 Ga0395905_0504915_526_1083 185
948 3300038443 Ga0395901_0001781 Ga0395901_0001781_10259_10816 185
949 3300039447 Ga0436361_0019641 Ga0436361_0019641_36442_36999 185
950 3300039447 Ga0436361_0085209 Ga0436361_0085209_3972_4529 185
951 3300039447 Ga0436361_0255611 Ga0436361_0255611_2661_3218 185
952 3300039447 Ga0436361_0463922 Ga0436361_0463922_1887_2516 185
953 3300039447 Ga0436361_1020604 Ga0436361_1020604_86_655 185
954 3300039447 Ga0436361_1048578 Ga0436361_1048578_1857_2507 185
955 3300039447 Ga0436361_1181151 Ga0436361_1181151_1271_1840 185
956 3300039450 Ga0436363_1399792 Ga0436363_1399792_1060_1617 185
957 3300041443 Ga0451789_0465154 Ga0451789_0465154_289_846 185
958 3300041443 Ga0451789_1272523 Ga0451789_1272523_447_1004 185
959 3300041451 Ga0451791_1347236 Ga0451791_1347236_178_735 185
960 3300041453 Ga0451797_1576900 Ga0451797_1576900_321_878 185
961 3300041458 Ga0451798_0217509 Ga0451798_0217509_82_639 185
962 3300041458 Ga0451798_0867094 Ga0451798_0867094_677_1234 185
963 3300041486 Ga0451807_1959080 Ga0451807_1959080_361_918 185
964 3300041491 Ga0451833_0958391 Ga0451833_0958391_66_623 185
965 3300041496 Ga0451839_0595639 Ga0451839_0595639_172_729 185
966 3300041507 Ga0451851_0070177 Ga0451851_0070177_101_658 185
967 3300041509 Ga0451843_1230032 Ga0451843_1230032_114_671 185
968 3300041512 Ga0451853_0407793 Ga0451853_0407793_478_1035 185
969 3300041997 Ga0439431_0010770 Ga0439431_0010770_447_1010 185
970 3300041999 Ga0439433_0112376 Ga0439433_0112376_56_613 185
971 3300042000 Ga0439437_006821 Ga0439437_006821_220_777 185
972 3300042001 Ga0439441_037049 Ga0439441_037049_74_631 185
973 3300042007 Ga0439449_0055644 Ga0439449_0055644_217_774 185
974 3300042007 Ga0439449_0146662 Ga0439449_0146662_297_860 185
975 3300042008 Ga0439450_004588 Ga0439450_004588_1422_1979 185
976 3300042014 Ga0439457_042981 Ga0439457_042981_207_764 185
977 3300042120 Ga0450917_001065 Ga0450917_001065_802_1359 185
978 3300042126 Ga0450888_000177 Ga0450888_000177_572_1129 185
979 3300042127 Ga0450890_000922 Ga0450890_000922_169_726 185
980 3300042129 Ga0450891_000060 Ga0450891_000060_3668_4225 185
981 3300042134 Ga0450898_015057 Ga0450898_015057_251_808 185
982 3300042135 Ga0450899_013185 Ga0450899_013185_318_875 185
983 3300042138 Ga0450903_013782 Ga0450903_013782_492_1049 185
984 3300042144 Ga0450889_000922 Ga0450889_000922_1666_2223 185
985 3300042436 Ga0439435_0160003 Ga0439435_0160003_61_618 185
986 3300042438 Ga0439459_0010455 Ga0439459_0010455_10_567 185
987 3300042439 Ga0439464_0015176 Ga0439464_0015176_638_1195 185
988 3300042530 Ga0450916_001089 Ga0450916_001089_816_1373 185
989 3300042531 Ga0450918_000326 Ga0450918_000326_9016_9573 185
990 3300042532 Ga0450893_0010581 Ga0450893_0010581_792_1349 185
991 3300042533 Ga0450901_026210 Ga0450901_026210_22_579 185
992 3300042876 Ga0451577_0001866 Ga0451577_0001866_22519_23076 185
993 3300042876 Ga0451577_0032633 Ga0451577_0032633_3657_4214 185
994 3300042876 Ga0451577_0127972 Ga0451577_0127972_1017_1574 185
995 3300044656 Ga0466969_0000020 Ga0466969_0000020_97393_97950 185
996 3300044656 Ga0466969_0101384 Ga0466969_0101384_133_690 185
997 3300044683 Ga0466965_0000493 Ga0466965_0000493_11040_11636 185
998 3300044683 Ga0466965_0011312 Ga0466965_0011312_2695_3252 185
999 3300044683 Ga0466965_0038922 Ga0466965_0038922_857_1414 185
1000 3300044683 Ga0466965_0109992 Ga0466965_0109992_452_1009 185
1001 3300044684 Ga0466966_0001239 Ga0466966_0001239_8283_8840 185
1002 3300044684 Ga0466966_0011170 Ga0466966_0011170_3802_4398 185
1003 3300044693 Ga0466961_0013718 Ga0466961_0013718_4359_4916 185
1004 3300044693 Ga0466961_0037361 Ga0466961_0037361_1774_2331 185
1005 3300044694 Ga0466963_0039303 Ga0466963_0039303_1764_2360 185
1006 3300044694 Ga0466963_0077538 Ga0466963_0077538_1228_1785 185
1007 3300044694 Ga0466963_0101194 Ga0466963_0101194_239_796 185
1008 3300044706 Ga0466964_0000949 Ga0466964_0000949_6374_6970 185
1009 3300044706 Ga0466964_0014413 Ga0466964_0014413_1355_1912 185
1010 3300044706 Ga0466964_0062857 Ga0466964_0062857_627_1187 185
1011 3300044712 Ga0453684_0042883 Ga0453684_0042883_5012_5581 185
1012 3300044712 Ga0453684_0066790 Ga0453684_0066790_3545_4102 185
1013 3300044712 Ga0453684_0410522 Ga0453684_0410522_159_716 185
1014 3300044712 Ga0453684_0591572 Ga0453684_0591572_46_603 185
1015 3300044712 Ga0453684_0687081 Ga0453684_0687081_483_1040 185
1016 3300044712 Ga0453684_0875581 Ga0453684_0875581_159_716 185
1017 3300044719 Ga0466971_0002813 Ga0466971_0002813_1430_2026 185
1018 3300044719 Ga0466971_0003163 Ga0466971_0003163_3425_4078 185
1019 3300044719 Ga0466971_0023819 Ga0466971_0023819_132_689 185
1020 3300044735 Ga0466968_0013862 Ga0466968_0013862_769_1365 185
1021 3300044765 Ga0466970_0005378 Ga0466970_0005378_5133_5690 185
1022 3300044765 Ga0466970_0033153 Ga0466970_0033153_615_1211 185
1023 3300044765 Ga0466970_0192540 Ga0466970_0192540_359_916 185
1024 3300044842 Ga0466957_0027220 Ga0466957_0027220_852_1448 185
1025 3300044842 Ga0466957_0063458 Ga0466957_0063458_315_968 185
1026 3300044842 Ga0466957_0269486 Ga0466957_0269486_211_768 185
1027 3300045049 Ga0466959_0001531 Ga0466959_0001531_8061_8618 185
1028 3300045049 Ga0466959_0046516 Ga0466959_0046516_2461_3018 185
1029 3300045049 Ga0466959_0067872 Ga0466959_0067872_1783_2379 185
1030 3300045051 Ga0451576_0009077 Ga0451576_0009077_933_1490 185
1031 3300045051 Ga0451576_0124243 Ga0451576_0124243_1067_1624 185
1032 3300045051 Ga0451576_0257121 Ga0451576_0257121_548_1186 185
1033 3300045051 Ga0451576_0284685 Ga0451576_0284685_491_1048 185
1034 3300045051 Ga0451576_0509554 Ga0451576_0509554_383_940 185
1035 3300045051 Ga0451576_0665852 Ga0451576_0665852_153_710 185
1036 3300045051 Ga0451576_1515972 Ga0451576_1515972_23_580 185
1037 3300045836 Ga0466958_0041460 Ga0466958_0041460_711_1268 185
1038 3300045836 Ga0466958_0063036 Ga0466958_0063036_748_1344 185
1039 3300045976 Ga0466967_0025052 Ga0466967_0025052_4241_4798 185
1040 3300046454 Ga0495592_0000746 Ga0495592_0000746_4738_5295 185
1041 3300046454 Ga0495592_0215835 Ga0495592_0215835_296_853 185
1042 3300046454 Ga0495592_0272189 Ga0495592_0272189_363_920 185
1043 3300046455 Ga0495603_0078723 Ga0495603_0078723_579_1205 185
1044 3300046457 Ga0495590_0031730 Ga0495590_0031730_656_1213 185
1045 3300046459 Ga0495629_0166233 Ga0495629_0166233_778_1335 185
1046 3300046460 Ga0495638_0031475 Ga0495638_0031475_2497_3054 185
1047 3300046462 Ga0495651_0106790 Ga0495651_0106790_1157_1714 185
1048 3300046463 Ga0495653_0559191 Ga0495653_0559191_59_616 185
1049 3300046471 Ga0495650_0008561 Ga0495650_0008561_4929_5486 185
1050 3300046471 Ga0495650_0029377 Ga0495650_0029377_359_916 185
1051 3300046472 Ga0495580_0626935 Ga0495580_0626935_51_608 185
1052 3300046476 Ga0495662_0395224 Ga0495662_0395224_112_669 185
1053 3300046506 Ga0495583_0000034 Ga0495583_0000034_244637_245194 185
1054 3300046507 Ga0495606_0006285 Ga0495606_0006285_2147_2704 185
1055 3300046507 Ga0495606_0358723 Ga0495606_0358723_19_576 185
1056 3300046511 Ga0495608_0264507 Ga0495608_0264507_206_763 185
1057 3300046512 Ga0495610_0024206 Ga0495610_0024206_2191_2748 185
1058 3300046512 Ga0495610_0036866 Ga0495610_0036866_328_885 185
1059 3300046514 Ga0495618_0406174 Ga0495618_0406174_83_640 185
1060 3300046515 Ga0495620_0259601 Ga0495620_0259601_17_643 185
1061 3300046516 Ga0495628_0163090 Ga0495628_0163090_443_1000 185
1062 3300046517 Ga0495630_0040768 Ga0495630_0040768_2505_3062 185
1063 3300046519 Ga0495632_0066020 Ga0495632_0066020_48_605 185
1064 3300046519 Ga0495632_0095371 Ga0495632_0095371_564_1121 185
1065 3300046522 Ga0495643_0072167 Ga0495643_0072167_743_1300 185
1066 3300046523 Ga0495644_0192133 Ga0495644_0192133_126_683 185
1067 3300046524 Ga0495648_0055873 Ga0495648_0055873_1609_2166 185
1068 3300046524 Ga0495648_0064351 Ga0495648_0064351_102_659 185
1069 3300046524 Ga0495648_0122432 Ga0495648_0122432_105_662 185
1070 3300046525 Ga0495663_0077585 Ga0495663_0077585_252_830 185
1071 3300046533 Ga0495640_0292472 Ga0495640_0292472_14_571 185
1072 3300046535 Ga0495586_0120873 Ga0495586_0120873_412_969 185
1073 3300046537 Ga0495598_0018950 Ga0495598_0018950_971_1528 185
1074 3300046539 Ga0495621_0021135 Ga0495621_0021135_1328_1885 185
1075 3300046539 Ga0495621_0279558 Ga0495621_0279558_72_629 185
1076 3300046539 Ga0495621_0285045 Ga0495621_0285045_55_612 185
1077 3300046559 Ga0495667_0174150 Ga0495667_0174150_146_703 185
1078 3300046615 Ga0495656_0129509 Ga0495656_0129509_531_1175 185
1079 3300046616 Ga0495668_0021789 Ga0495668_0021789_1028_1585 185
1080 3300046660 Ga0495625_0006159 Ga0495625_0006159_2463_3020 185
1081 3300046660 Ga0495625_0020810 Ga0495625_0020810_1852_2409 185
1082 3300046663 Ga0495635_0101360 Ga0495635_0101360_570_1127 185
1083 3300046680 Ga0495646_0040454 Ga0495646_0040454_35_592 185
1084 3300046680 Ga0495646_0157199 Ga0495646_0157199_600_1157 185
1085 3300046681 Ga0495647_0245915 Ga0495647_0245915_171_728 185
1086 3300046683 Ga0495658_0204009 Ga0495658_0204009_632_1189 185
1087 3300046684 Ga0495669_0026759 Ga0495669_0026759_202_759 185
1088 3300046684 Ga0495669_0317274 Ga0495669_0317274_42_668 185
1089 3300046689 Ga0495613_0152544 Ga0495613_0152544_463_1020 185
1090 3300046691 Ga0495670_0060761 Ga0495670_0060761_1244_1804 185
1091 3300046691 Ga0495670_0129903 Ga0495670_0129903_731_1288 185
1092 3300046692 Ga0495671_0106988 Ga0495671_0106988_742_1299 185
1093 3300046694 Ga0495649_0000728 Ga0495649_0000728_24166_24723 185
1094 3300046810 Ga0495660_0079409 Ga0495660_0079409_302_859 185
1095 3300047319 Ga0495674_0289346 Ga0495674_0289346_657_1214 185
1096 3300047322 Ga0495680_0111095 Ga0495680_0111095_78_635 185
1097 3300047470 Ga0495681_0172549 Ga0495681_0172549_17_595 185
1098 3300047472 Ga0495686_0000739 Ga0495686_0000739_41080_41637 185
1099 3300047472 Ga0495686_0039653 Ga0495686_0039653_1291_1848 185
1100 3300047472 Ga0495686_0165775 Ga0495686_0165775_262_819 185
1101 3300048089 Ga0495614_0217942 Ga0495614_0217942_242_799 185
1102 3300048903 Ga0496100_0035391 Ga0496100_0035391_2236_2793 185
1103 3300048903 Ga0496100_0103186 Ga0496100_0103186_911_1468 185
1104 3300048903 Ga0496100_0582321 Ga0496100_0582321_142_699 185
1105 3300048903 Ga0496100_0774405 Ga0496100_0774405_118_675 185
1106 3300048903 Ga0496100_1044664 Ga0496100_1044664_72_629 185
1107 3300048904 Ga0496101_0024303 Ga0496101_0024303_1313_1870 185
1108 3300048905 Ga0496102_0006045 Ga0496102_0006045_8182_8742 185
1109 3300048905 Ga0496102_0008100 Ga0496102_0008100_5371_5928 185
1110 3300048905 Ga0496102_0095541 Ga0496102_0095541_799_1356 185
1111 3300048906 Ga0496103_0378788 Ga0496103_0378788_156_713 185
1112 3300048907 Ga0496104_0087183 Ga0496104_0087183_648_1205 185
1113 3300048907 Ga0496104_0123106 Ga0496104_0123106_1316_1942 185
1114 3300048907 Ga0496104_0212089 Ga0496104_0212089_798_1355 185
1115 3300048907 Ga0496104_0994531 Ga0496104_0994531_20_577 185
1116 3300048908 Ga0496105_0218711 Ga0496105_0218711_851_1408 185
1117 3300048908 Ga0496105_0284964 Ga0496105_0284964_182_739 185
1118 3300048908 Ga0496105_0388177 Ga0496105_0388177_240_797 185
1119 3300048909 Ga0496106_0023565 Ga0496106_0023565_1389_1946 185
1120 3300048909 Ga0496106_0027147 Ga0496106_0027147_3285_3842 185
1121 3300048910 Ga0496107_0004099 Ga0496107_0004099_6084_6641 185
1122 3300048911 Ga0496108_0112517 Ga0496108_0112517_1343_1900 185
1123 3300048911 Ga0496108_0132616 Ga0496108_0132616_800_1357 185
1124 3300048911 Ga0496108_0133591 Ga0496108_0133591_860_1417 185
1125 3300048912 Ga0496109_0042557 Ga0496109_0042557_1049_1606 185
1126 3300048912 Ga0496109_0143033 Ga0496109_0143033_125_682 185
1127 3300048912 Ga0496109_0179034 Ga0496109_0179034_852_1433 185
1128 3300048912 Ga0496109_0195803 Ga0496109_0195803_623_1180 185
1129 3300048912 Ga0496109_0328802 Ga0496109_0328802_120_677 185
1130 3300048912 Ga0496109_0337113 Ga0496109_0337113_610_1167 185
1131 3300048913 Ga0496110_0069048 Ga0496110_0069048_1046_1603 185
1132 3300048913 Ga0496110_0394290 Ga0496110_0394290_456_1013 185
1133 3300048914 Ga0496111_0176869 Ga0496111_0176869_914_1474 185
1134 3300048914 Ga0496111_0477267 Ga0496111_0477267_19_576 185
1135 3300048915 Ga0496112_0061214 Ga0496112_0061214_2933_3490 185
1136 3300048915 Ga0496112_0425437 Ga0496112_0425437_138_695 185
1137 3300048916 Ga0496113_0013003 Ga0496113_0013003_2798_3355 185
1138 3300048916 Ga0496113_0241481 Ga0496113_0241481_185_742 185
1139 3300048916 Ga0496113_0398556 Ga0496113_0398556_211_768 185
1140 3300048917 Ga0496114_0070435 Ga0496114_0070435_797_1423 185
1141 3300048917 Ga0496114_0599381 Ga0496114_0599381_365_922 185
1142 3300048924 Ga0496121_0026182 Ga0496121_0026182_630_1247 185
1143 3300048927 Ga0496124_0000126 Ga0496124_0000126_86402_87019 185
1144 3300048927 Ga0496124_0079515 Ga0496124_0079515_1806_2363 185
1145 3300048928 Ga0496125_0003500 Ga0496125_0003500_3047_3664 185
1146 3300049521 Ga0501298_011150 Ga0501298_011150_495_1052 185
1147 3300049523 Ga0501300_009888 Ga0501300_009888_586_1143 185
1148 3300049579 Ga0501043_0000009 Ga0501043_0000009_109079_109636 185
1149 3300049580 Ga0501046_0000022 Ga0501046_0000022_109068_109625 185
1150 3300049581 Ga0501047_0000021 Ga0501047_0000021_109126_109683 185
1151 3300049649 Ga0501198_000019 Ga0501198_000019_69301_69873 185
1152 3300049651 Ga0501201_001792 Ga0501201_001792_177_734 185
1153 3300049658 Ga0501211_000655 Ga0501211_000655_1224_1781 185
1154 3300049662 Ga0501222_000059 Ga0501222_000059_20966_21538 185
1155 3300049662 Ga0501222_002805 Ga0501222_002805_607_1164 185
1156 3300049663 Ga0501223_012519 Ga0501223_012519_86_643 185
1157 3300049668 Ga0501233_008494 Ga0501233_008494_497_1054 185
1158 3300049669 Ga0501235_002288 Ga0501235_002288_1490_2047 185
1159 3300049670 Ga0501236_019964 Ga0501236_019964_403_960 185
1160 3300049679 Ga0501249_007648 Ga0501249_007648_218_775 185
1161 3300049683 Ga0501253_020996 Ga0501253_020996_508_1065 185
1162 3300049683 Ga0501253_060348 Ga0501253_060348_247_804 185
1163 3300049684 Ga0501255_023119 Ga0501255_023119_124_681 185
1164 3300049704 Ga0501221_004219 Ga0501221_004219_303_860 185
1165 3300049706 Ga0501229_000329 Ga0501229_000329_4482_5039 185
1166 3300049757 Ga0501232_007753 Ga0501232_007753_329_886 185
1167 3300049759 Ga0501262_001965 Ga0501262_001965_510_1067 185
1168 3300049760 Ga0501263_040320 Ga0501263_040320_26_586 185
1169 3300049762 Ga0501265_002920 Ga0501265_002920_39_728 185
1170 3300049763 Ga0501266_015299 Ga0501266_015299_36_593 185
1171 3300049764 Ga0501267_001228 Ga0501267_001228_158_715 185
1172 3300049768 Ga0501271_004112 Ga0501271_004112_19_576 185
1173 3300049769 Ga0501272_005415 Ga0501272_005415_269_826 185
1174 3300049779 Ga0501283_005530 Ga0501283_005530_234_791 185
1175 3300049822 Ga0501035_0304530 Ga0501035_0304530_268_825 185
1176 3300049823 Ga0501044_0661707 Ga0501044_0661707_122_679 185
1177 3300049824 Ga0501045_0025044 Ga0501045_0025044_1790_2347 185
1178 3300050489 nmdc:mga03683_287767_c1 nmdc:mga03683_287767_c1_112_690 185
1179 3300050489 nmdc:mga03683_5178_c1 nmdc:mga03683_5178_c1_2187_2753 185
1180 3300050490 nmdc:mga03n38_361453_c1 nmdc:mga03n38_361453_c1_177_755 185
1181 3300050490 nmdc:mga03n38_70060_c1 nmdc:mga03n38_70060_c1_100_657 185
1182 3300050490 nmdc:mga03n38_86560_c1 nmdc:mga03n38_86560_c1_381_947 185
1183 3300050493 nmdc:mga0k408_118638_c1 nmdc:mga0k408_118638_c1_776_1333 185
1184 3300050493 nmdc:mga0k408_127486_c1 nmdc:mga0k408_127486_c1_598_1155 185
1185 3300050493 nmdc:mga0k408_12953_c1 nmdc:mga0k408_12953_c1_2912_3469 185
1186 3300050493 nmdc:mga0k408_130339_c1 nmdc:mga0k408_130339_c1_496_1059 185
1187 3300050493 nmdc:mga0k408_146879_c1 nmdc:mga0k408_146879_c1_428_985 185
1188 3300050493 nmdc:mga0k408_173373_c1 nmdc:mga0k408_173373_c1_424_981 185
1189 3300050493 nmdc:mga0k408_212864_c1 nmdc:mga0k408_212864_c1_400_978 185
1190 3300050493 nmdc:mga0k408_27836_c1 nmdc:mga0k408_27836_c1_2219_2785 185
1191 3300050493 nmdc:mga0k408_376315_c1 nmdc:mga0k408_376315_c1_218_775 185
1192 3300050493 nmdc:mga0k408_406_c1 nmdc:mga0k408_406_c1_16959_17537 185
1193 3300050493 nmdc:mga0k408_42240_c1 nmdc:mga0k408_42240_c1_476_1033 185
1194 3300050493 nmdc:mga0k408_59264_c1 nmdc:mga0k408_59264_c1_609_1166 185
1195 3300050493 nmdc:mga0k408_85785_c1 nmdc:mga0k408_85785_c1_884_1441 185
1196 3300050493 nmdc:mga0k408_88156_c1 nmdc:mga0k408_88156_c1_659_1216 185
1197 3300050494 nmdc:mga06z11_258805_c1 nmdc:mga06z11_258805_c1_19_585 185
1198 3300050494 nmdc:mga06z11_64211_c1 nmdc:mga06z11_64211_c1_1352_1909 185
1199 3300050494 nmdc:mga06z11_76716_c1 nmdc:mga06z11_76716_c1_222_800 185
1200 3300050496 nmdc:mga07m45_103654_c1 nmdc:mga07m45_103654_c1_253_810 185
1201 3300050496 nmdc:mga07m45_136154_c1 nmdc:mga07m45_136154_c1_296_853 185
1202 3300050496 nmdc:mga07m45_30645_c1 nmdc:mga07m45_30645_c1_1886_2443 185
1203 3300050496 nmdc:mga07m45_5537_c1 nmdc:mga07m45_5537_c1_1521_2078 185
1204 3300050496 nmdc:mga07m45_6725_c1 nmdc:mga07m45_6725_c1_2114_2671 185
1205 3300050507 nmdc:mga05p37_109740_c1 nmdc:mga05p37_109740_c1_17_574 185
1206 3300050508 nmdc:mga09592_53741_c1 nmdc:mga09592_53741_c1_644_1201 185
1207 3300050509 nmdc:mga0qj67_360672_c1 nmdc:mga0qj67_360672_c1_508_1074 185
1208 3300050509 nmdc:mga0qj67_76608_c1 nmdc:mga0qj67_76608_c1_1362_1919 185
1209 3300050511 nmdc:mga08y16_1178426_c1 nmdc:mga08y16_1178426_c1_42_668 185
1210 3300053077 Ga0495601_0019457 Ga0495601_0019457_793_1350 185
1211 3300053080 Ga0500635_0000011 Ga0500635_0000011_141055_141612 185
1212 3300053085 Ga0495619_0143834 Ga0495619_0143834_507_1064 185
1213 3300053086 Ga0500578_0000673 Ga0500578_0000673_17717_18274 185
1214 3300053086 Ga0500578_0554643 Ga0500578_0554643_13_570 185
1215 3300053087 Ga0500643_032481 Ga0500643_032481_292_849 185
1216 3300053088 Ga0500644_0018787 Ga0500644_0018787_128_685 185
1217 3300053090 Ga0500646_0014486 Ga0500646_0014486_168_725 185
1218 3300053092 Ga0500583_0054394 Ga0500583_0054394_744_1301 185
1219 3300053093 Ga0500651_0051962 Ga0500651_0051962_1773_2330 185
1220 3300053093 Ga0500651_0229625 Ga0500651_0229625_294_851 185
1221 3300053097 Ga0500648_346063 Ga0500648_346063_39_596 185
1222 3300053098 Ga0500650_0046653 Ga0500650_0046653_128_685 185
1223 3300053103 Ga0500555_030106 Ga0500555_030106_246_803 185
1224 3300053108 Ga0500562_026334 Ga0500562_026334_291_848 185
1225 3300053108 Ga0500562_037530 Ga0500562_037530_449_1006 185
1226 3300053109 Ga0500569_007978 Ga0500569_007978_587_1144 185
1227 3300053117 Ga0500593_000680 Ga0500593_000680_8571_9128 185
1228 3300053118 Ga0500594_0000470 Ga0500594_0000470_6774_7331 185
1229 3300053119 Ga0500595_073612 Ga0500595_073612_310_867 185
1230 3300053121 Ga0500607_118133 Ga0500607_118133_60_617 185
1231 3300053122 Ga0500608_246768 Ga0500608_246768_124_681 185
1232 3300053127 Ga0500623_072496 Ga0500623_072496_783_1340 185
1233 3300053129 Ga0500628_018338 Ga0500628_018338_161_718 185
1234 3300053129 Ga0500628_075548 Ga0500628_075548_180_737 185
1235 3300053131 Ga0500652_000123 Ga0500652_000123_3677_4234 185
1236 3300053131 Ga0500652_208186 Ga0500652_208186_64_621 185
1237 3300053133 Ga0500655_004744 Ga0500655_004744_1290_1847 185
1238 3300053133 Ga0500655_017284 Ga0500655_017284_443_1000 185
1239 3300053134 Ga0500658_0237260 Ga0500658_0237260_236_793 185
1240 3300053136 Ga0500559_0000407 Ga0500559_0000407_27088_27645 185
1241 3300053136 Ga0500559_0153931 Ga0500559_0153931_232_789 185
1242 3300053139 Ga0500568_0112756 Ga0500568_0112756_363_920 185
1243 3300053142 Ga0500577_0009622 Ga0500577_0009622_1291_1848 185
1244 3300053148 Ga0500590_023408 Ga0500590_023408_296_853 185
1245 3300053151 Ga0500604_0007671 Ga0500604_0007671_601_1158 185
1246 3300053154 Ga0500619_000006 Ga0500619_000006_6654_7211 185
1247 3300053156 Ga0500622_0000799 Ga0500622_0000799_4665_5222 185
1248 3300053156 Ga0500622_0006741 Ga0500622_0006741_1343_1900 185
1249 3300053156 Ga0500622_0095912 Ga0500622_0095912_245_802 185
1250 3300053156 Ga0500622_0097209 Ga0500622_0097209_400_960 185
1251 3300053177 Ga0500636_0005079 Ga0500636_0005079_5270_5827 185
1252 3300053730 Ga0500645_008009 Ga0500645_008009_2956_3513 185
1253 3300053730 Ga0500645_042335 Ga0500645_042335_431_988 185
1254 3300055283 Ga0500661_002023 Ga0500661_002023_1811_2368 185
1255 3300059421 Ga0590071_000174 Ga0590071_000174_3982_4539 185
1256 3300061719 Ga0466962_0004166 Ga0466962_0004166_1947_2543 185
1257 3300061719 Ga0466962_0046420 Ga0466962_0046420_737_1294 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01844

HNH

HNH endonuclease

135

180

0.97

PF13395

HNH_4

HNH endonuclease

135

183

0.97

PF14279

HNH_5

HNH endonuclease

135

190

0.97

Feature Viewer

pLDDT pTM Quality
58.47 0.38 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map