F492268
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1257 | 471 | 1257 | 187 |
Family's Representative Sequence
| Representative Sequence | 3300049762|Ga0501265_002920|Ga0501265_002920_39_728 |
| Length | 229 |
| Sequence | MHEALRIDGDSTMNNHGVLSPRLASRVPIESAGRIDYARRKEFCVEVLQLDVSGRPQAWISAKEAACIYASDGIAWTLGDAFYVLRGGTQRRTGLQSRIEVHPIIAVRGAIPSRAWRQTPALSNPKLFARDRHVCAYCGGHFHADDLTREHITPTSRGGRDTWMNCITACRPCNGRKGNRMPEEAHMSLMYLPYVPNLHEDMILRGRRILVDQMEFLLASVPRHSRLHG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 88 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 89 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 100 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 101 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 117 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 135 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 212 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 213 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 224 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 225 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 227 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 228 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 230 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 231 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 232 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 233 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 234 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 235 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 236 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 238 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 239 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 240 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 241 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 243 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 244 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 245 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 246 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 247 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 248 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 249 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 250 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 255 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 256 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 259 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 265 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 266 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 267 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 270 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 271 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 274 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 275 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 281 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 282 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 283 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 284 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 285 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 286 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 287 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 288 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 289 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 290 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 291 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 292 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 293 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 294 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 295 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 296 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 297 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 298 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 299 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 300 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 301 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 302 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 303 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 304 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 305 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 306 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 307 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 308 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 309 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 310 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 311 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 312 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 313 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 314 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 315 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 316 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 317 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 318 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 319 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 320 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 321 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 322 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 323 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 378 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 379 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 380 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 381 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 382 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 383 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 386 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 387 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 388 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 389 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 390 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 391 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 392 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 393 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 394 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 395 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 399 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 400 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 401 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 402 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 403 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 404 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 405 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 406 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 407 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 408 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 409 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 410 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 411 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 412 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 413 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 414 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 415 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 416 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 417 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 418 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 419 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 420 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 424 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 425 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 426 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 427 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 428 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 429 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 430 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 431 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 436 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 438 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 440 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 441 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 442 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 443 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 444 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 445 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 446 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 447 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 448 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 449 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 450 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 451 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 452 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 453 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 454 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 455 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 456 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 457 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 458 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 459 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 460 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 461 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 462 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 463 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 464 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 465 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 466 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 467 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 468 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 469 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 470 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 471 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.27 |
| Nodule | 0.4 |
| Rhizoplane | 3.74 |
| Rhizosphere | 74.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10004029 | 3300001979 | Bacteria | 6361 |
| 2 | JGI24744J21845_10010959 | 3300002077 | Bacteria | 1856 |
| 3 | JGI25156J39149_1001303 | 3300002705 | Bacteria | 10788 |
| 4 | JGI25156J39149_1012545 | 3300002705 | Bacteria | 1853 |
| 5 | JGI25154J39366_1000343 | 3300002738 | Bacteria | 26705 |
| 6 | JGI25157J39369_1000304 | 3300002741 | Bacteria | 35531 |
| 7 | JGI25152J39213_1000710 | 3300002773 | Bacteria | 17271 |
| 8 | JGI25150J39212_1017649 | 3300002774 | Bacteria | 1149 |
| 9 | JGI25153J46596_10004579 | 3300003215 | Bacteria | 7412 |
| 10 | JGI25153J46596_10006328 | 3300003215 | Bacteria | 6019 |
| 11 | rootH1_10000527 | 3300003316 | Bacteria | 4022 |
| 12 | rootH1_10010629 | 3300003316 | Bacteria | 5506 |
| 13 | rootH2_10057083 | 3300003320 | Bacteria | 6357 |
| 14 | rootL2_10003309 | 3300003322 | Bacteria | 4899 |
| 15 | rootL2_10004014 | 3300003322 | Bacteria | 6597 |
| 16 | rootL2_10056084 | 3300003322 | Bacteria | 1258 |
| 17 | rootH1_10000048 | 3300003323 | Bacteria | 2903 |
| 18 | rootH1_10020306 | 3300003323 | Bacteria | 16958 |
| 19 | rootH1_10021990 | 3300003323 | Bacteria | 3895 |
| 20 | JGI26128J50194_1004871 | 3300003347 | Bacteria | 885 |
| 21 | Ga0055539_1002131 | 3300003752 | Bacteria | 3198 |
| 22 | Ga0055539_1002241 | 3300003752 | Bacteria | 3057 |
| 23 | Ga0055533_1000016 | 3300003756 | Bacteria | 396179 |
| 24 | Ga0055525_1000031 | 3300003759 | Bacteria | 314909 |
| 25 | Ga0055525_1000802 | 3300003759 | Bacteria | 9854 |
| 26 | Ga0055529_1000963 | 3300003763 | Bacteria | 14815 |
| 27 | Ga0055524_1000052 | 3300003775 | Bacteria | 144959 |
| 28 | Ga0055524_1017112 | 3300003775 | Bacteria | 2569 |
| 29 | Ga0055528_1051731 | 3300003790 | Bacteria | 826 |
| 30 | Ga0055530_10004973 | 3300003791 | Bacteria | 6572 |
| 31 | Ga0055530_10008463 | 3300003791 | Bacteria | 4117 |
| 32 | Ga0055540_1000123 | 3300003792 | Bacteria | 80351 |
| 33 | Ga0055540_1011833 | 3300003792 | Bacteria | 2782 |
| 34 | Ga0055531_10000001 | 3300003794 | Bacteria | 543586 |
| 35 | Ga0055531_10011952 | 3300003794 | Bacteria | 4129 |
| 36 | Ga0065165_1000836 | 3300005262 | Bacteria | 40452 |
| 37 | Ga0065165_1003047 | 3300005262 | Bacteria | 12576 |
| 38 | Ga0065707_10084569 | 3300005295 | Bacteria | 7048 |
| 39 | Ga0070658_10216772 | 3300005327 | Bacteria | 1618 |
| 40 | Ga0070658_10247639 | 3300005327 | Bacteria | 1511 |
| 41 | Ga0070658_10775629 | 3300005327 | Bacteria | 833 |
| 42 | Ga0070676_10008317 | 3300005328 | Bacteria | 5590 |
| 43 | Ga0070676_10010756 | 3300005328 | Bacteria | 4965 |
| 44 | Ga0070676_10081103 | 3300005328 | Bacteria | 1968 |
| 45 | Ga0070683_100231589 | 3300005329 | Bacteria | 1756 |
| 46 | Ga0070683_100802241 | 3300005329 | Bacteria | 902 |
| 47 | Ga0070690_100017502 | 3300005330 | Bacteria | 4311 |
| 48 | Ga0070690_100019706 | 3300005330 | Bacteria | 4100 |
| 49 | Ga0070690_100484460 | 3300005330 | Bacteria | 923 |
| 50 | Ga0070670_100009305 | 3300005331 | Bacteria | 8392 |
| 51 | Ga0070670_100009633 | 3300005331 | Bacteria | 8245 |
| 52 | Ga0070670_100081596 | 3300005331 | Bacteria | 2778 |
| 53 | Ga0070670_100290394 | 3300005331 | Bacteria | 1429 |
| 54 | Ga0070670_100728717 | 3300005331 | Bacteria | 893 |
| 55 | Ga0070677_10007611 | 3300005333 | Bacteria | 3621 |
| 56 | Ga0070677_10019703 | 3300005333 | Bacteria | 2448 |
| 57 | Ga0070677_10045673 | 3300005333 | Bacteria | 1748 |
| 58 | Ga0070677_10057710 | 3300005333 | Bacteria | 1592 |
| 59 | Ga0070677_10061857 | 3300005333 | Bacteria | 1547 |
| 60 | Ga0070677_10112427 | 3300005333 | Bacteria | 1218 |
| 61 | Ga0068869_100007348 | 3300005334 | Bacteria | 7032 |
| 62 | Ga0068869_100019197 | 3300005334 | Bacteria | 4665 |
| 63 | Ga0068869_100029467 | 3300005334 | Bacteria | 3846 |
| 64 | Ga0070666_10024212 | 3300005335 | Bacteria | 3954 |
| 65 | Ga0070666_10259975 | 3300005335 | Bacteria | 1230 |
| 66 | Ga0070680_100047155 | 3300005336 | Bacteria | 3508 |
| 67 | Ga0068868_100007149 | 3300005338 | Bacteria | 7933 |
| 68 | Ga0068868_100008040 | 3300005338 | Bacteria | 7542 |
| 69 | Ga0068868_100078021 | 3300005338 | Bacteria | 2651 |
| 70 | Ga0068868_100095120 | 3300005338 | Bacteria | 2404 |
| 71 | Ga0068868_100148702 | 3300005338 | Bacteria | 1928 |
| 72 | Ga0068868_100235186 | 3300005338 | Bacteria | 1538 |
| 73 | Ga0068868_100359980 | 3300005338 | Bacteria | 1248 |
| 74 | Ga0068868_100411011 | 3300005338 | Bacteria | 1170 |
| 75 | Ga0070660_100165433 | 3300005339 | Bacteria | 1784 |
| 76 | Ga0070660_100193201 | 3300005339 | Bacteria | 1649 |
| 77 | Ga0070689_100037388 | 3300005340 | Bacteria | 3712 |
| 78 | Ga0070689_100199233 | 3300005340 | Bacteria | 1634 |
| 79 | Ga0070687_100086448 | 3300005343 | Bacteria | 1724 |
| 80 | Ga0070661_100005819 | 3300005344 | Bacteria | 8479 |
| 81 | Ga0070661_100089480 | 3300005344 | Bacteria | 2279 |
| 82 | Ga0070661_100288126 | 3300005344 | Bacteria | 1275 |
| 83 | Ga0070661_100300894 | 3300005344 | Bacteria | 1249 |
| 84 | Ga0070668_100007635 | 3300005347 | Bacteria | 8026 |
| 85 | Ga0070668_100068725 | 3300005347 | Bacteria | 2754 |
| 86 | Ga0070668_100090366 | 3300005347 | Bacteria | 2412 |
| 87 | Ga0070668_100364257 | 3300005347 | Bacteria | 1226 |
| 88 | Ga0070669_100012068 | 3300005353 | Bacteria | 6131 |
| 89 | Ga0070669_100031165 | 3300005353 | Bacteria | 3851 |
| 90 | Ga0070669_100038839 | 3300005353 | Bacteria | 3457 |
| 91 | Ga0070669_100152211 | 3300005353 | Bacteria | 1791 |
| 92 | Ga0070669_100287569 | 3300005353 | Bacteria | 1319 |
| 93 | Ga0070675_100002907 | 3300005354 | Bacteria | 12912 |
| 94 | Ga0070675_100009944 | 3300005354 | Bacteria | 7417 |
| 95 | Ga0070675_100054029 | 3300005354 | Bacteria | 3304 |
| 96 | Ga0070675_100077116 | 3300005354 | Bacteria | 2773 |
| 97 | Ga0070675_100135095 | 3300005354 | Bacteria | 2104 |
| 98 | Ga0070675_100213751 | 3300005354 | Bacteria | 1677 |
| 99 | Ga0070675_100913163 | 3300005354 | Bacteria | 805 |
| 100 | Ga0070671_100004848 | 3300005355 | Bacteria | 10696 |
| 101 | Ga0070671_100009961 | 3300005355 | Bacteria | 7632 |
| 102 | Ga0070671_100016969 | 3300005355 | Bacteria | 5888 |
| 103 | Ga0070671_100023124 | 3300005355 | Bacteria | 5081 |
| 104 | Ga0070671_100048071 | 3300005355 | Bacteria | 3547 |
| 105 | Ga0070671_100064228 | 3300005355 | Bacteria | 3057 |
| 106 | Ga0070671_100236517 | 3300005355 | Bacteria | 1550 |
| 107 | Ga0070671_100490293 | 3300005355 | Bacteria | 1056 |
| 108 | Ga0070674_100013025 | 3300005356 | Bacteria | 5127 |
| 109 | Ga0070674_100017473 | 3300005356 | Bacteria | 4514 |
| 110 | Ga0070674_100035720 | 3300005356 | Bacteria | 3330 |
| 111 | Ga0070674_100123792 | 3300005356 | Bacteria | 1918 |
| 112 | Ga0070674_100266210 | 3300005356 | Bacteria | 1352 |
| 113 | Ga0070674_100372436 | 3300005356 | Bacteria | 1159 |
| 114 | Ga0070674_100599488 | 3300005356 | Bacteria | 931 |
| 115 | Ga0070673_100019027 | 3300005364 | Bacteria | 4925 |
| 116 | Ga0070673_100049839 | 3300005364 | Bacteria | 3271 |
| 117 | Ga0070673_100058470 | 3300005364 | Bacteria | 3048 |
| 118 | Ga0070673_100100373 | 3300005364 | Bacteria | 2382 |
| 119 | Ga0070673_100175085 | 3300005364 | Bacteria | 1833 |
| 120 | Ga0070673_100235304 | 3300005364 | Bacteria | 1590 |
| 121 | Ga0070673_100304247 | 3300005364 | Bacteria | 1404 |
| 122 | Ga0070673_100391149 | 3300005364 | Bacteria | 1241 |
| 123 | Ga0070688_100391523 | 3300005365 | Bacteria | 1027 |
| 124 | Ga0070659_100123684 | 3300005366 | Bacteria | 2097 |
| 125 | Ga0070659_100391202 | 3300005366 | Bacteria | 1172 |
| 126 | Ga0070667_100003174 | 3300005367 | Bacteria | 14089 |
| 127 | Ga0070667_100004063 | 3300005367 | Bacteria | 12377 |
| 128 | Ga0070667_100008844 | 3300005367 | Bacteria | 8337 |
| 129 | Ga0070667_100065662 | 3300005367 | Bacteria | 3081 |
| 130 | Ga0070667_100645831 | 3300005367 | Bacteria | 977 |
| 131 | Ga0070700_100091680 | 3300005441 | Bacteria | 1984 |
| 132 | Ga0070700_100314714 | 3300005441 | Bacteria | 1148 |
| 133 | Ga0070708_100063311 | 3300005445 | Bacteria | 3311 |
| 134 | Ga0070663_100018301 | 3300005455 | Bacteria | 4590 |
| 135 | Ga0070663_100371537 | 3300005455 | Bacteria | 1162 |
| 136 | Ga0070678_100022312 | 3300005456 | Bacteria | 4192 |
| 137 | Ga0070678_100073203 | 3300005456 | Bacteria | 2571 |
| 138 | Ga0070678_100083403 | 3300005456 | Bacteria | 2429 |
| 139 | Ga0070678_100108578 | 3300005456 | Bacteria | 2166 |
| 140 | Ga0070678_100109497 | 3300005456 | Bacteria | 2158 |
| 141 | Ga0070678_100144742 | 3300005456 | Bacteria | 1906 |
| 142 | Ga0070678_100192744 | 3300005456 | Bacteria | 1677 |
| 143 | Ga0070678_100295525 | 3300005456 | Bacteria | 1375 |
| 144 | Ga0070662_100021790 | 3300005457 | Bacteria | 4379 |
| 145 | Ga0070662_100036702 | 3300005457 | Bacteria | 3469 |
| 146 | Ga0070662_100039945 | 3300005457 | Bacteria | 3339 |
| 147 | Ga0070662_100105156 | 3300005457 | Bacteria | 2143 |
| 148 | Ga0070662_100151308 | 3300005457 | Bacteria | 1807 |
| 149 | Ga0070681_10176795 | 3300005458 | Bacteria | 2057 |
| 150 | Ga0070681_10237670 | 3300005458 | Bacteria | 1736 |
| 151 | Ga0068867_100000042 | 3300005459 | Bacteria | 77140 |
| 152 | Ga0068867_100002881 | 3300005459 | Bacteria | 12104 |
| 153 | Ga0068867_100005007 | 3300005459 | Bacteria | 9339 |
| 154 | Ga0068867_100010032 | 3300005459 | Bacteria | 6675 |
| 155 | Ga0068867_100027327 | 3300005459 | Bacteria | 4099 |
| 156 | Ga0068867_100045630 | 3300005459 | Bacteria | 3215 |
| 157 | Ga0068867_100078153 | 3300005459 | Bacteria | 2488 |
| 158 | Ga0068867_100080494 | 3300005459 | Bacteria | 2453 |
| 159 | Ga0068867_100171787 | 3300005459 | Bacteria | 1717 |
| 160 | Ga0068867_100290688 | 3300005459 | Bacteria | 1343 |
| 161 | Ga0070685_10191322 | 3300005466 | Bacteria | 1324 |
| 162 | Ga0070706_100003166 | 3300005467 | Bacteria | 16258 |
| 163 | Ga0070707_100072018 | 3300005468 | Bacteria | 3330 |
| 164 | Ga0070707_100512976 | 3300005468 | Bacteria | 1161 |
| 165 | Ga0070698_100072233 | 3300005471 | Bacteria | 3459 |
| 166 | Ga0070679_100024208 | 3300005530 | Bacteria | 5949 |
| 167 | Ga0070684_100556718 | 3300005535 | Bacteria | 1064 |
| 168 | Ga0068853_100008284 | 3300005539 | Bacteria | 8344 |
| 169 | Ga0068853_100144732 | 3300005539 | Bacteria | 2135 |
| 170 | Ga0068853_100278576 | 3300005539 | Bacteria | 1541 |
| 171 | Ga0068853_100294740 | 3300005539 | Bacteria | 1498 |
| 172 | Ga0068853_100405931 | 3300005539 | Bacteria | 1276 |
| 173 | Ga0068853_100407871 | 3300005539 | Bacteria | 1273 |
| 174 | Ga0068853_100429041 | 3300005539 | Bacteria | 1241 |
| 175 | Ga0070672_100000214 | 3300005543 | Bacteria | 31887 |
| 176 | Ga0070672_100003206 | 3300005543 | Bacteria | 10589 |
| 177 | Ga0070672_100012364 | 3300005543 | Bacteria | 5989 |
| 178 | Ga0070672_100111789 | 3300005543 | Bacteria | 2227 |
| 179 | Ga0070672_100132610 | 3300005543 | Bacteria | 2049 |
| 180 | Ga0070672_100137980 | 3300005543 | Bacteria | 2009 |
| 181 | Ga0070672_100286236 | 3300005543 | Bacteria | 1394 |
| 182 | Ga0070672_100378726 | 3300005543 | Bacteria | 1210 |
| 183 | Ga0070693_100446755 | 3300005547 | Bacteria | 906 |
| 184 | Ga0070665_100005964 | 3300005548 | Bacteria | 12470 |
| 185 | Ga0070665_100158040 | 3300005548 | Bacteria | 2269 |
| 186 | Ga0070665_100208289 | 3300005548 | Bacteria | 1956 |
| 187 | Ga0070665_100326872 | 3300005548 | Bacteria | 1538 |
| 188 | Ga0068855_100099856 | 3300005563 | Bacteria | 3342 |
| 189 | Ga0068855_100203891 | 3300005563 | Bacteria | 2225 |
| 190 | Ga0070664_100010180 | 3300005564 | Bacteria | 7627 |
| 191 | Ga0070664_100038998 | 3300005564 | Bacteria | 4001 |
| 192 | Ga0070664_100051636 | 3300005564 | Bacteria | 3481 |
| 193 | Ga0070664_100081876 | 3300005564 | Bacteria | 2782 |
| 194 | Ga0070664_100195387 | 3300005564 | Bacteria | 1803 |
| 195 | Ga0068857_100001367 | 3300005577 | Bacteria | 19219 |
| 196 | Ga0068857_100045914 | 3300005577 | Bacteria | 3876 |
| 197 | Ga0068857_100469934 | 3300005577 | Bacteria | 1178 |
| 198 | Ga0068854_100008084 | 3300005578 | Bacteria | 6746 |
| 199 | Ga0068854_100093052 | 3300005578 | Bacteria | 2246 |
| 200 | Ga0068854_100231763 | 3300005578 | Bacteria | 1466 |
| 201 | Ga0068856_100019461 | 3300005614 | Bacteria | 6589 |
| 202 | Ga0068856_100190462 | 3300005614 | Bacteria | 2065 |
| 203 | Ga0068856_100367005 | 3300005614 | Bacteria | 1458 |
| 204 | Ga0070702_100104818 | 3300005615 | Bacteria | 1741 |
| 205 | Ga0068852_100008019 | 3300005616 | Bacteria | 7746 |
| 206 | Ga0068852_100011640 | 3300005616 | Bacteria | 6635 |
| 207 | Ga0068852_100048307 | 3300005616 | Bacteria | 3635 |
| 208 | Ga0068852_100073257 | 3300005616 | Bacteria | 3012 |
| 209 | Ga0068852_100177745 | 3300005616 | Bacteria | 1999 |
| 210 | Ga0068852_100187534 | 3300005616 | Bacteria | 1949 |
| 211 | Ga0068852_100279862 | 3300005616 | Bacteria | 1608 |
| 212 | Ga0068852_100437440 | 3300005616 | Bacteria | 1292 |
| 213 | Ga0068852_100581796 | 3300005616 | Bacteria | 1122 |
| 214 | Ga0068859_100003371 | 3300005617 | Bacteria | 16241 |
| 215 | Ga0068859_100035640 | 3300005617 | Bacteria | 4993 |
| 216 | Ga0068859_100233270 | 3300005617 | Bacteria | 1929 |
| 217 | Ga0068859_100384114 | 3300005617 | Bacteria | 1500 |
| 218 | Ga0068864_100001559 | 3300005618 | Bacteria | 18876 |
| 219 | Ga0068864_100012414 | 3300005618 | Bacteria | 7045 |
| 220 | Ga0068864_100031702 | 3300005618 | Bacteria | 4486 |
| 221 | Ga0068864_100037258 | 3300005618 | Bacteria | 4150 |
| 222 | Ga0068864_100049747 | 3300005618 | Bacteria | 3607 |
| 223 | Ga0068864_100097230 | 3300005618 | Bacteria | 2606 |
| 224 | Ga0068864_100137810 | 3300005618 | Bacteria | 2198 |
| 225 | Ga0068864_100155641 | 3300005618 | Bacteria | 2074 |
| 226 | Ga0068864_100521484 | 3300005618 | Bacteria | 1145 |
| 227 | Ga0068864_100562440 | 3300005618 | Bacteria | 1103 |
| 228 | Ga0068866_10002006 | 3300005718 | Bacteria | 8473 |
| 229 | Ga0068866_10017749 | 3300005718 | Bacteria | 3205 |
| 230 | Ga0068866_10072147 | 3300005718 | Bacteria | 1828 |
| 231 | Ga0068861_100000532 | 3300005719 | Bacteria | 22319 |
| 232 | Ga0068861_100013654 | 3300005719 | Bacteria | 5687 |
| 233 | Ga0068861_100084254 | 3300005719 | Bacteria | 2495 |
| 234 | Ga0068861_100261087 | 3300005719 | Bacteria | 1483 |
| 235 | Ga0068861_101255109 | 3300005719 | Bacteria | 719 |
| 236 | Ga0068851_10020913 | 3300005834 | Bacteria | 3173 |
| 237 | Ga0068851_10067896 | 3300005834 | Bacteria | 1840 |
| 238 | Ga0068851_10159697 | 3300005834 | Bacteria | 1237 |
| 239 | Ga0068851_10381614 | 3300005834 | Bacteria | 826 |
| 240 | Ga0068870_10007498 | 3300005840 | Bacteria | 4868 |
| 241 | Ga0068870_10061290 | 3300005840 | Bacteria | 2022 |
| 242 | Ga0068870_10602287 | 3300005840 | Bacteria | 747 |
| 243 | Ga0068870_10625302 | 3300005840 | Bacteria | 734 |
| 244 | Ga0068863_100004398 | 3300005841 | Bacteria | 13892 |
| 245 | Ga0068863_100021795 | 3300005841 | Bacteria | 6114 |
| 246 | Ga0068863_100154370 | 3300005841 | Bacteria | 2198 |
| 247 | Ga0068863_100170460 | 3300005841 | Bacteria | 2087 |
| 248 | Ga0068863_100234480 | 3300005841 | Bacteria | 1771 |
| 249 | Ga0068858_100002862 | 3300005842 | Bacteria | 17353 |
| 250 | Ga0068858_100005186 | 3300005842 | Bacteria | 12762 |
| 251 | Ga0068858_100134191 | 3300005842 | Bacteria | 2322 |
| 252 | Ga0068858_100365770 | 3300005842 | Bacteria | 1383 |
| 253 | Ga0068858_100750717 | 3300005842 | Bacteria | 951 |
| 254 | Ga0068860_100007631 | 3300005843 | Bacteria | 10824 |
| 255 | Ga0068860_100027719 | 3300005843 | Bacteria | 5455 |
| 256 | Ga0068860_100050579 | 3300005843 | Bacteria | 3955 |
| 257 | Ga0068860_100478826 | 3300005843 | Bacteria | 1241 |
| 258 | Ga0068860_100702461 | 3300005843 | Bacteria | 1021 |
| 259 | Ga0068862_100011630 | 3300005844 | Bacteria | 7262 |
| 260 | Ga0068862_100021891 | 3300005844 | Bacteria | 5346 |
| 261 | Ga0068862_100044354 | 3300005844 | Bacteria | 3793 |
| 262 | Ga0068862_100299030 | 3300005844 | Bacteria | 1480 |
| 263 | Ga0068862_100902779 | 3300005844 | Bacteria | 869 |
| 264 | Ga0075368_10004618 | 3300006042 | Bacteria | 4682 |
| 265 | Ga0075368_10044832 | 3300006042 | Bacteria | 1746 |
| 266 | Ga0075368_10060057 | 3300006042 | Bacteria | 1522 |
| 267 | Ga0075363_100023918 | 3300006048 | Bacteria | 3102 |
| 268 | Ga0075363_100128897 | 3300006048 | Bacteria | 1418 |
| 269 | Ga0075364_10243101 | 3300006051 | Bacteria | 1223 |
| 270 | Ga0075432_10076876 | 3300006058 | Bacteria | 1206 |
| 271 | Ga0070715_10175733 | 3300006163 | Bacteria | 1070 |
| 272 | Ga0075362_10016384 | 3300006177 | Bacteria | 3034 |
| 273 | Ga0075362_10051026 | 3300006177 | Bacteria | 1851 |
| 274 | Ga0075362_10061016 | 3300006177 | Bacteria | 1705 |
| 275 | Ga0075367_10003951 | 3300006178 | Bacteria | 7153 |
| 276 | Ga0075367_10055501 | 3300006178 | Bacteria | 2351 |
| 277 | Ga0075367_10107393 | 3300006178 | Bacteria | 1711 |
| 278 | Ga0075369_10013422 | 3300006186 | Bacteria | 3252 |
| 279 | Ga0075369_10091722 | 3300006186 | Bacteria | 1356 |
| 280 | Ga0075369_10097041 | 3300006186 | Bacteria | 1320 |
| 281 | Ga0075366_10001365 | 3300006195 | Bacteria | 12201 |
| 282 | Ga0075366_10001515 | 3300006195 | Bacteria | 11597 |
| 283 | Ga0075366_10002469 | 3300006195 | Bacteria | 9470 |
| 284 | Ga0075366_10044579 | 3300006195 | Bacteria | 2629 |
| 285 | Ga0075366_10056238 | 3300006195 | Bacteria | 2337 |
| 286 | Ga0075366_10074701 | 3300006195 | Bacteria | 2021 |
| 287 | Ga0075366_10083894 | 3300006195 | Bacteria | 1904 |
| 288 | Ga0075366_10111437 | 3300006195 | Bacteria | 1646 |
| 289 | Ga0075366_10133817 | 3300006195 | Bacteria | 1497 |
| 290 | Ga0075366_10149214 | 3300006195 | Bacteria | 1415 |
| 291 | Ga0075366_10187262 | 3300006195 | Bacteria | 1257 |
| 292 | Ga0075366_10194922 | 3300006195 | Bacteria | 1231 |
| 293 | Ga0075366_10222552 | 3300006195 | Bacteria | 1150 |
| 294 | Ga0075366_10317254 | 3300006195 | Bacteria | 954 |
| 295 | Ga0075366_10327403 | 3300006195 | Bacteria | 939 |
| 296 | Ga0097621_100014007 | 3300006237 | Bacteria | 5991 |
| 297 | Ga0097621_100044502 | 3300006237 | Bacteria | 3581 |
| 298 | Ga0097621_100321429 | 3300006237 | Bacteria | 1371 |
| 299 | Ga0097621_100352274 | 3300006237 | Bacteria | 1309 |
| 300 | Ga0075370_10003547 | 3300006353 | Bacteria | 7454 |
| 301 | Ga0075370_10003987 | 3300006353 | Bacteria | 7092 |
| 302 | Ga0075370_10005826 | 3300006353 | Bacteria | 6156 |
| 303 | Ga0075370_10116873 | 3300006353 | Bacteria | 1550 |
| 304 | Ga0075370_10170466 | 3300006353 | Bacteria | 1279 |
| 305 | Ga0075370_10281879 | 3300006353 | Bacteria | 987 |
| 306 | Ga0068871_100023551 | 3300006358 | Bacteria | 4765 |
| 307 | Ga0068871_100028476 | 3300006358 | Bacteria | 4379 |
| 308 | Ga0068871_100053309 | 3300006358 | Bacteria | 3277 |
| 309 | Ga0068871_100149108 | 3300006358 | Bacteria | 1993 |
| 310 | Ga0068871_100444250 | 3300006358 | Bacteria | 1161 |
| 311 | Ga0075430_100065902 | 3300006846 | Bacteria | 3042 |
| 312 | Ga0075433_10575585 | 3300006852 | Bacteria | 989 |
| 313 | Ga0075429_100229141 | 3300006880 | Bacteria | 1627 |
| 314 | Ga0075429_100949764 | 3300006880 | Bacteria | 752 |
| 315 | Ga0068865_100017684 | 3300006881 | Bacteria | 4589 |
| 316 | Ga0068865_100023045 | 3300006881 | Bacteria | 4071 |
| 317 | Ga0068865_100074788 | 3300006881 | Bacteria | 2414 |
| 318 | Ga0068865_100188060 | 3300006881 | Bacteria | 1595 |
| 319 | Ga0068865_100357524 | 3300006881 | Bacteria | 1185 |
| 320 | Ga0068865_100360153 | 3300006881 | Bacteria | 1181 |
| 321 | Ga0068865_100407493 | 3300006881 | Bacteria | 1115 |
| 322 | Ga0068865_100766538 | 3300006881 | Bacteria | 830 |
| 323 | Ga0097620_100003371 | 3300006931 | Bacteria | 16241 |
| 324 | Ga0097620_100035640 | 3300006931 | Bacteria | 4993 |
| 325 | Ga0097620_100233247 | 3300006931 | Bacteria | 1929 |
| 326 | Ga0097620_100384094 | 3300006931 | Bacteria | 1500 |
| 327 | Ga0099824_1044356 | 3300006942 | Bacteria | 965 |
| 328 | Ga0099823_1000478 | 3300006944 | Bacteria | 26702 |
| 329 | Ga0079104_1000073 | 3300006946 | Bacteria | 152269 |
| 330 | Ga0105240_10238988 | 3300009093 | Bacteria | 2107 |
| 331 | Ga0105240_10316716 | 3300009093 | Bacteria | 1779 |
| 332 | Ga0105240_10406912 | 3300009093 | Bacteria | 1531 |
| 333 | Ga0111539_11204405 | 3300009094 | Bacteria | 880 |
| 334 | Ga0111539_11424277 | 3300009094 | Bacteria | 804 |
| 335 | Ga0105245_10040028 | 3300009098 | Bacteria | 4173 |
| 336 | Ga0105245_10057446 | 3300009098 | Bacteria | 3500 |
| 337 | Ga0105245_10080074 | 3300009098 | Bacteria | 2984 |
| 338 | Ga0105247_10152680 | 3300009101 | Bacteria | 1523 |
| 339 | Ga0114129_10221541 | 3300009147 | Bacteria | 2552 |
| 340 | Ga0114129_10816605 | 3300009147 | Bacteria | 1188 |
| 341 | Ga0105243_10000525 | 3300009148 | Bacteria | 39020 |
| 342 | Ga0105243_10016853 | 3300009148 | Bacteria | 5523 |
| 343 | Ga0105243_10103056 | 3300009148 | Bacteria | 2372 |
| 344 | Ga0105243_10108081 | 3300009148 | Bacteria | 2321 |
| 345 | Ga0105243_10233869 | 3300009148 | Bacteria | 1632 |
| 346 | Ga0105243_10308096 | 3300009148 | Bacteria | 1438 |
| 347 | Ga0105243_10583100 | 3300009148 | Bacteria | 1074 |
| 348 | Ga0105241_10177180 | 3300009174 | Bacteria | 1765 |
| 349 | Ga0105241_10265770 | 3300009174 | Bacteria | 1459 |
| 350 | Ga0105241_10271203 | 3300009174 | Bacteria | 1446 |
| 351 | Ga0105241_11281576 | 3300009174 | Bacteria | 697 |
| 352 | Ga0105242_10201510 | 3300009176 | Bacteria | 1768 |
| 353 | Ga0105242_10227154 | 3300009176 | Bacteria | 1671 |
| 354 | Ga0105242_10402634 | 3300009176 | Bacteria | 1278 |
| 355 | Ga0105242_10954026 | 3300009176 | Bacteria | 862 |
| 356 | Ga0105248_10004278 | 3300009177 | Bacteria | 15797 |
| 357 | Ga0105248_10020342 | 3300009177 | Bacteria | 7353 |
| 358 | Ga0105248_10034541 | 3300009177 | Bacteria | 5655 |
| 359 | Ga0105248_10096649 | 3300009177 | Bacteria | 3327 |
| 360 | Ga0105248_10472538 | 3300009177 | Bacteria | 1413 |
| 361 | Ga0105248_10687688 | 3300009177 | Bacteria | 1154 |
| 362 | Ga0105237_10000293 | 3300009545 | Bacteria | 69295 |
| 363 | Ga0105237_10010430 | 3300009545 | Bacteria | 9881 |
| 364 | Ga0105237_10124824 | 3300009545 | Bacteria | 2569 |
| 365 | Ga0105237_10339544 | 3300009545 | Bacteria | 1507 |
| 366 | Ga0105238_10003562 | 3300009551 | Bacteria | 15522 |
| 367 | Ga0105238_10068232 | 3300009551 | Bacteria | 3557 |
| 368 | Ga0105238_10094092 | 3300009551 | Bacteria | 2984 |
| 369 | Ga0105249_10001432 | 3300009553 | Bacteria | 20917 |
| 370 | Ga0105249_10012730 | 3300009553 | Bacteria | 7414 |
| 371 | Ga0105249_10020599 | 3300009553 | Bacteria | 5896 |
| 372 | Ga0105249_10720438 | 3300009553 | Bacteria | 1059 |
| 373 | Ga0105239_10002857 | 3300010375 | Bacteria | 21611 |
| 374 | Ga0105239_10075916 | 3300010375 | Bacteria | 3696 |
| 375 | Ga0105239_10092418 | 3300010375 | Bacteria | 3340 |
| 376 | Ga0105246_10509203 | 3300011119 | Bacteria | 1024 |
| 377 | Ga0157327_1002776 | 3300012512 | Bacteria | 1238 |
| 378 | Ga0157326_1035709 | 3300012513 | Bacteria | 677 |
| 379 | Ga0157371_10075565 | 3300013102 | Bacteria | 2386 |
| 380 | Ga0157371_10107401 | 3300013102 | Bacteria | 1981 |
| 381 | Ga0157371_10235021 | 3300013102 | Bacteria | 1318 |
| 382 | Ga0157371_10277075 | 3300013102 | Bacteria | 1211 |
| 383 | Ga0157369_10097256 | 3300013105 | Bacteria | 3140 |
| 384 | Ga0157369_10097287 | 3300013105 | Bacteria | 3140 |
| 385 | Ga0157374_10012660 | 3300013296 | Bacteria | 7347 |
| 386 | Ga0157374_10023686 | 3300013296 | Bacteria | 5495 |
| 387 | Ga0157374_10023909 | 3300013296 | Bacteria | 5473 |
| 388 | Ga0157374_10139538 | 3300013296 | Bacteria | 2352 |
| 389 | Ga0157374_10802172 | 3300013296 | Bacteria | 957 |
| 390 | Ga0157374_10989530 | 3300013296 | Bacteria | 860 |
| 391 | Ga0157378_10002431 | 3300013297 | Bacteria | 16564 |
| 392 | Ga0157378_10058929 | 3300013297 | Bacteria | 3425 |
| 393 | Ga0157378_10071947 | 3300013297 | Bacteria | 3106 |
| 394 | Ga0157378_10102354 | 3300013297 | Bacteria | 2616 |
| 395 | Ga0157378_10225438 | 3300013297 | Bacteria | 1783 |
| 396 | Ga0157378_10352336 | 3300013297 | Bacteria | 1438 |
| 397 | Ga0157378_10554131 | 3300013297 | Bacteria | 1155 |
| 398 | Ga0163162_10001627 | 3300013306 | Bacteria | 21036 |
| 399 | Ga0163162_10019603 | 3300013306 | Bacteria | 6639 |
| 400 | Ga0163162_10244234 | 3300013306 | Bacteria | 1927 |
| 401 | Ga0157372_10030878 | 3300013307 | Bacteria | 5863 |
| 402 | Ga0157372_10201706 | 3300013307 | Bacteria | 2304 |
| 403 | Ga0157372_10321478 | 3300013307 | Bacteria | 1802 |
| 404 | Ga0157375_10008159 | 3300013308 | Bacteria | 9164 |
| 405 | Ga0157375_10016322 | 3300013308 | Bacteria | 6666 |
| 406 | Ga0157375_10056678 | 3300013308 | Bacteria | 3870 |
| 407 | Ga0157375_10063864 | 3300013308 | Bacteria | 3665 |
| 408 | Ga0157375_10066431 | 3300013308 | Bacteria | 3601 |
| 409 | Ga0157375_10126863 | 3300013308 | Bacteria | 2667 |
| 410 | Ga0157375_10191158 | 3300013308 | Bacteria | 2202 |
| 411 | Ga0157375_11167324 | 3300013308 | Bacteria | 902 |
| 412 | Ga0163163_10009402 | 3300014325 | Bacteria | 8727 |
| 413 | Ga0163163_10153059 | 3300014325 | Bacteria | 2349 |
| 414 | Ga0163163_10848203 | 3300014325 | Bacteria | 977 |
| 415 | Ga0157380_10006027 | 3300014326 | Bacteria | 8491 |
| 416 | Ga0157380_10006297 | 3300014326 | Bacteria | 8337 |
| 417 | Ga0157380_10028112 | 3300014326 | Bacteria | 4284 |
| 418 | Ga0157380_10203981 | 3300014326 | Bacteria | 1756 |
| 419 | Ga0157380_10221352 | 3300014326 | Bacteria | 1693 |
| 420 | Ga0157380_10509047 | 3300014326 | Bacteria | 1171 |
| 421 | Ga0157377_10000038 | 3300014745 | Bacteria | 113777 |
| 422 | Ga0157377_10000784 | 3300014745 | Bacteria | 13139 |
| 423 | Ga0157379_10001736 | 3300014968 | Bacteria | 18030 |
| 424 | Ga0157379_10002470 | 3300014968 | Bacteria | 15473 |
| 425 | Ga0157379_10015679 | 3300014968 | Bacteria | 6659 |
| 426 | Ga0157379_10018191 | 3300014968 | Bacteria | 6192 |
| 427 | Ga0157379_10038599 | 3300014968 | Bacteria | 4260 |
| 428 | Ga0157379_10047186 | 3300014968 | Bacteria | 3842 |
| 429 | Ga0157379_10055645 | 3300014968 | Bacteria | 3534 |
| 430 | Ga0157379_10263463 | 3300014968 | Bacteria | 1566 |
| 431 | Ga0157379_10318507 | 3300014968 | Bacteria | 1420 |
| 432 | Ga0157379_10339058 | 3300014968 | Bacteria | 1375 |
| 433 | Ga0157379_10539603 | 3300014968 | Bacteria | 1084 |
| 434 | Ga0157376_10023720 | 3300014969 | Bacteria | 4807 |
| 435 | Ga0157376_10061547 | 3300014969 | Bacteria | 3156 |
| 436 | Ga0157376_10092091 | 3300014969 | Bacteria | 2627 |
| 437 | Ga0157376_10179041 | 3300014969 | Bacteria | 1936 |
| 438 | Ga0157376_10360712 | 3300014969 | Bacteria | 1394 |
| 439 | Ga0182006_1121151 | 3300015261 | Bacteria | 908 |
| 440 | Ga0182007_10076658 | 3300015262 | Bacteria | 1096 |
| 441 | Ga0182005_1076329 | 3300015265 | Bacteria | 923 |
| 442 | Ga0163161_10005593 | 3300017792 | Bacteria | 8712 |
| 443 | Ga0163161_10043874 | 3300017792 | Bacteria | 3220 |
| 444 | Ga0163161_10113550 | 3300017792 | Bacteria | 2028 |
| 445 | Ga0213872_10000006 | 3300021361 | Bacteria | 249845 |
| 446 | Ga0213872_10000085 | 3300021361 | Bacteria | 85496 |
| 447 | Ga0213872_10001073 | 3300021361 | Bacteria | 18880 |
| 448 | Ga0213872_10057925 | 3300021361 | Bacteria | 1754 |
| 449 | Ga0209674_100041 | 3300025226 | Bacteria | 396231 |
| 450 | Ga0209672_104503 | 3300025228 | Bacteria | 2576 |
| 451 | Ga0209563_100043 | 3300025230 | Bacteria | 397271 |
| 452 | Ga0209563_100044 | 3300025230 | Bacteria | 396812 |
| 453 | Ga0207427_100341 | 3300025231 | Bacteria | 30455 |
| 454 | Ga0209258_100515 | 3300025242 | Bacteria | 37293 |
| 455 | Ga0209258_100693 | 3300025242 | Bacteria | 23226 |
| 456 | Ga0207425_1000802 | 3300025245 | Bacteria | 15938 |
| 457 | Ga0207425_1018613 | 3300025245 | Bacteria | 1505 |
| 458 | Ga0209646_1000069 | 3300025246 | Bacteria | 230340 |
| 459 | Ga0209026_1000006 | 3300025250 | Bacteria | 677225 |
| 460 | Ga0209677_100077 | 3300025253 | Bacteria | 126245 |
| 461 | Ga0209677_101016 | 3300025253 | Bacteria | 13419 |
| 462 | Ga0209677_104838 | 3300025253 | Bacteria | 3716 |
| 463 | Ga0209759_1000189 | 3300025256 | Bacteria | 98732 |
| 464 | Ga0209759_1002556 | 3300025256 | Bacteria | 7893 |
| 465 | Ga0209759_1005450 | 3300025256 | Bacteria | 4455 |
| 466 | Ga0209759_1006592 | 3300025256 | Bacteria | 3877 |
| 467 | Ga0209129_1000012 | 3300025258 | Bacteria | 541516 |
| 468 | Ga0209565_1024949 | 3300025263 | Bacteria | 1212 |
| 469 | Ga0209455_1000597 | 3300025272 | Bacteria | 23218 |
| 470 | Ga0209673_1001736 | 3300025273 | Bacteria | 18320 |
| 471 | Ga0209673_1005928 | 3300025273 | Bacteria | 6031 |
| 472 | Ga0209673_1007378 | 3300025273 | Bacteria | 5086 |
| 473 | Ga0209673_1014115 | 3300025273 | Bacteria | 3109 |
| 474 | Ga0207673_1020590 | 3300025290 | Bacteria | 890 |
| 475 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 476 | Ga0209564_1000022 | 3300025295 | Bacteria | 555109 |
| 477 | Ga0209758_1000099 | 3300025297 | Bacteria | 230054 |
| 478 | Ga0209758_1000234 | 3300025297 | Bacteria | 116217 |
| 479 | Ga0209050_1000691 | 3300025298 | Bacteria | 50632 |
| 480 | Ga0209050_1002840 | 3300025298 | Bacteria | 13744 |
| 481 | Ga0209050_1012415 | 3300025298 | Bacteria | 3908 |
| 482 | Ga0209050_1015253 | 3300025298 | Bacteria | 3243 |
| 483 | Ga0209256_1000036 | 3300025299 | Bacteria | 386664 |
| 484 | Ga0209256_1002027 | 3300025299 | Bacteria | 18044 |
| 485 | Ga0209256_1022129 | 3300025299 | Bacteria | 1933 |
| 486 | Ga0209051_1000068 | 3300025303 | Bacteria | 220063 |
| 487 | Ga0209051_1001546 | 3300025303 | Bacteria | 19061 |
| 488 | Ga0209051_1004282 | 3300025303 | Bacteria | 8877 |
| 489 | Ga0209051_1011828 | 3300025303 | Bacteria | 4272 |
| 490 | Ga0209051_1044190 | 3300025303 | Bacteria | 1554 |
| 491 | Ga0209257_1000033 | 3300025304 | Bacteria | 671006 |
| 492 | Ga0209257_1000146 | 3300025304 | Bacteria | 194261 |
| 493 | Ga0209257_1018570 | 3300025304 | Bacteria | 2667 |
| 494 | Ga0207697_10082007 | 3300025315 | Bacteria | 1359 |
| 495 | Ga0207656_10037754 | 3300025321 | Bacteria | 2034 |
| 496 | Ga0207656_10253131 | 3300025321 | Bacteria | 863 |
| 497 | Ga0207682_10002764 | 3300025893 | Bacteria | 7775 |
| 498 | Ga0207682_10006249 | 3300025893 | Bacteria | 4811 |
| 499 | Ga0207682_10022286 | 3300025893 | Bacteria | 2495 |
| 500 | Ga0207682_10057601 | 3300025893 | Bacteria | 1620 |
| 501 | Ga0207682_10069461 | 3300025893 | Bacteria | 1490 |
| 502 | Ga0207642_10007749 | 3300025899 | Bacteria | 3640 |
| 503 | Ga0207642_10030199 | 3300025899 | Bacteria | 2255 |
| 504 | Ga0207642_10032222 | 3300025899 | Bacteria | 2204 |
| 505 | Ga0207680_10013435 | 3300025903 | Bacteria | 4206 |
| 506 | Ga0207680_10064225 | 3300025903 | Bacteria | 2250 |
| 507 | Ga0207680_10548713 | 3300025903 | Bacteria | 825 |
| 508 | Ga0207645_10003679 | 3300025907 | Bacteria | 11565 |
| 509 | Ga0207645_10010823 | 3300025907 | Bacteria | 6252 |
| 510 | Ga0207645_10027395 | 3300025907 | Bacteria | 3680 |
| 511 | Ga0207645_10032784 | 3300025907 | Bacteria | 3339 |
| 512 | Ga0207645_10034580 | 3300025907 | Bacteria | 3247 |
| 513 | Ga0207645_10123856 | 3300025907 | Bacteria | 1679 |
| 514 | Ga0207645_10184706 | 3300025907 | Bacteria | 1368 |
| 515 | Ga0207645_10329518 | 3300025907 | Bacteria | 1019 |
| 516 | Ga0207645_10343404 | 3300025907 | Bacteria | 998 |
| 517 | Ga0207643_10009192 | 3300025908 | Bacteria | 5306 |
| 518 | Ga0207643_10106545 | 3300025908 | Bacteria | 1648 |
| 519 | Ga0207705_10031141 | 3300025909 | Bacteria | 3806 |
| 520 | Ga0207705_10074065 | 3300025909 | Bacteria | 2471 |
| 521 | Ga0207705_10100357 | 3300025909 | Bacteria | 2129 |
| 522 | Ga0207705_10158779 | 3300025909 | Bacteria | 1698 |
| 523 | Ga0207684_10002063 | 3300025910 | Bacteria | 20676 |
| 524 | Ga0207707_10117012 | 3300025912 | Bacteria | 2330 |
| 525 | Ga0207707_10137881 | 3300025912 | Bacteria | 2133 |
| 526 | Ga0207695_10054703 | 3300025913 | Bacteria | 4165 |
| 527 | Ga0207695_10110263 | 3300025913 | Bacteria | 2732 |
| 528 | Ga0207671_10002885 | 3300025914 | Bacteria | 17803 |
| 529 | Ga0207671_10056267 | 3300025914 | Bacteria | 2914 |
| 530 | Ga0207671_10289600 | 3300025914 | Bacteria | 1293 |
| 531 | Ga0207660_10018222 | 3300025917 | Bacteria | 4677 |
| 532 | Ga0207662_10010982 | 3300025918 | Bacteria | 5011 |
| 533 | Ga0207662_10051527 | 3300025918 | Bacteria | 2449 |
| 534 | Ga0207657_10119150 | 3300025919 | Bacteria | 2172 |
| 535 | Ga0207657_10165076 | 3300025919 | Bacteria | 1797 |
| 536 | Ga0207657_10213629 | 3300025919 | Bacteria | 1547 |
| 537 | Ga0207657_10326074 | 3300025919 | Bacteria | 1213 |
| 538 | Ga0207657_10331574 | 3300025919 | Bacteria | 1202 |
| 539 | Ga0207649_10001094 | 3300025920 | Bacteria | 16484 |
| 540 | Ga0207649_10051405 | 3300025920 | Bacteria | 2552 |
| 541 | Ga0207649_10312387 | 3300025920 | Bacteria | 1152 |
| 542 | Ga0207649_10384869 | 3300025920 | Bacteria | 1046 |
| 543 | Ga0207652_10013195 | 3300025921 | Bacteria | 6691 |
| 544 | Ga0207681_10015959 | 3300025923 | Bacteria | 4690 |
| 545 | Ga0207681_10028289 | 3300025923 | Bacteria | 3630 |
| 546 | Ga0207681_10096707 | 3300025923 | Bacteria | 2120 |
| 547 | Ga0207681_10126404 | 3300025923 | Bacteria | 1883 |
| 548 | Ga0207681_11176146 | 3300025923 | Bacteria | 644 |
| 549 | Ga0207694_10036898 | 3300025924 | Bacteria | 3751 |
| 550 | Ga0207694_10242241 | 3300025924 | Bacteria | 1474 |
| 551 | Ga0207694_10536374 | 3300025924 | Bacteria | 981 |
| 552 | Ga0207650_10001670 | 3300025925 | Bacteria | 15762 |
| 553 | Ga0207650_10003627 | 3300025925 | Bacteria | 10576 |
| 554 | Ga0207650_10005846 | 3300025925 | Bacteria | 8397 |
| 555 | Ga0207650_10064306 | 3300025925 | Bacteria | 2746 |
| 556 | Ga0207650_10195654 | 3300025925 | Bacteria | 1617 |
| 557 | Ga0207659_10002852 | 3300025926 | Bacteria | 10305 |
| 558 | Ga0207659_10008593 | 3300025926 | Bacteria | 6350 |
| 559 | Ga0207659_10055044 | 3300025926 | Bacteria | 2843 |
| 560 | Ga0207659_10115972 | 3300025926 | Bacteria | 2044 |
| 561 | Ga0207659_10238027 | 3300025926 | Bacteria | 1471 |
| 562 | Ga0207659_10457999 | 3300025926 | Bacteria | 1075 |
| 563 | Ga0207659_10580892 | 3300025926 | Bacteria | 954 |
| 564 | Ga0207687_10062753 | 3300025927 | Bacteria | 2629 |
| 565 | Ga0207687_10088022 | 3300025927 | Bacteria | 2258 |
| 566 | Ga0207687_10092521 | 3300025927 | Bacteria | 2208 |
| 567 | Ga0207687_10246672 | 3300025927 | Bacteria | 1418 |
| 568 | Ga0207644_10014014 | 3300025931 | Bacteria | 5358 |
| 569 | Ga0207644_10024985 | 3300025931 | Bacteria | 4104 |
| 570 | Ga0207644_10048053 | 3300025931 | Bacteria | 3048 |
| 571 | Ga0207644_10130504 | 3300025931 | Bacteria | 1923 |
| 572 | Ga0207644_10347617 | 3300025931 | Bacteria | 1203 |
| 573 | Ga0207644_10519550 | 3300025931 | Bacteria | 983 |
| 574 | Ga0207644_11059510 | 3300025931 | Bacteria | 681 |
| 575 | Ga0207690_10002003 | 3300025932 | Bacteria | 12479 |
| 576 | Ga0207690_10017625 | 3300025932 | Bacteria | 4366 |
| 577 | Ga0207690_10236024 | 3300025932 | Bacteria | 1406 |
| 578 | Ga0207690_10383752 | 3300025932 | Bacteria | 1117 |
| 579 | Ga0207690_10401396 | 3300025932 | Bacteria | 1093 |
| 580 | Ga0207690_11197902 | 3300025932 | Bacteria | 634 |
| 581 | Ga0207706_10003398 | 3300025933 | Bacteria | 15204 |
| 582 | Ga0207706_10003614 | 3300025933 | Bacteria | 14775 |
| 583 | Ga0207706_10057563 | 3300025933 | Bacteria | 3424 |
| 584 | Ga0207706_10105780 | 3300025933 | Bacteria | 2476 |
| 585 | Ga0207706_10185836 | 3300025933 | Bacteria | 1825 |
| 586 | Ga0207686_10160889 | 3300025934 | Bacteria | 1573 |
| 587 | Ga0207686_10262340 | 3300025934 | Bacteria | 1267 |
| 588 | Ga0207686_10328181 | 3300025934 | Bacteria | 1146 |
| 589 | Ga0207686_10342093 | 3300025934 | Bacteria | 1124 |
| 590 | Ga0207709_10001781 | 3300025935 | Bacteria | 14449 |
| 591 | Ga0207709_10006230 | 3300025935 | Bacteria | 6708 |
| 592 | Ga0207709_10339145 | 3300025935 | Bacteria | 1131 |
| 593 | Ga0207670_10280059 | 3300025936 | Bacteria | 1299 |
| 594 | Ga0207669_10007179 | 3300025937 | Bacteria | 5131 |
| 595 | Ga0207669_10066197 | 3300025937 | Bacteria | 2245 |
| 596 | Ga0207669_10205381 | 3300025937 | Bacteria | 1433 |
| 597 | Ga0207669_10420893 | 3300025937 | Bacteria | 1051 |
| 598 | Ga0207704_10000810 | 3300025938 | Bacteria | 13815 |
| 599 | Ga0207704_10026710 | 3300025938 | Bacteria | 3172 |
| 600 | Ga0207704_10031983 | 3300025938 | Bacteria | 2971 |
| 601 | Ga0207704_10035673 | 3300025938 | Bacteria | 2853 |
| 602 | Ga0207704_10313538 | 3300025938 | Bacteria | 1207 |
| 603 | Ga0207665_10101598 | 3300025939 | Bacteria | 2008 |
| 604 | Ga0207691_10002842 | 3300025940 | Bacteria | 16869 |
| 605 | Ga0207691_10003320 | 3300025940 | Bacteria | 15667 |
| 606 | Ga0207691_10012250 | 3300025940 | Bacteria | 8221 |
| 607 | Ga0207691_10031619 | 3300025940 | Bacteria | 4938 |
| 608 | Ga0207691_10037603 | 3300025940 | Bacteria | 4482 |
| 609 | Ga0207691_10087976 | 3300025940 | Bacteria | 2786 |
| 610 | Ga0207691_10128681 | 3300025940 | Bacteria | 2238 |
| 611 | Ga0207711_10024886 | 3300025941 | Bacteria | 5022 |
| 612 | Ga0207711_10033943 | 3300025941 | Bacteria | 4319 |
| 613 | Ga0207711_10046960 | 3300025941 | Bacteria | 3690 |
| 614 | Ga0207711_10058246 | 3300025941 | Bacteria | 3323 |
| 615 | Ga0207711_10067665 | 3300025941 | Bacteria | 3092 |
| 616 | Ga0207711_10261951 | 3300025941 | Bacteria | 1589 |
| 617 | Ga0207711_10645761 | 3300025941 | Bacteria | 987 |
| 618 | Ga0207689_10004129 | 3300025942 | Bacteria | 13196 |
| 619 | Ga0207689_10015115 | 3300025942 | Bacteria | 6544 |
| 620 | Ga0207689_10018115 | 3300025942 | Bacteria | 5947 |
| 621 | Ga0207689_10048816 | 3300025942 | Bacteria | 3492 |
| 622 | Ga0207689_10131531 | 3300025942 | Bacteria | 2059 |
| 623 | Ga0207689_10151649 | 3300025942 | Bacteria | 1911 |
| 624 | Ga0207661_10150790 | 3300025944 | Bacteria | 2009 |
| 625 | Ga0207661_10364047 | 3300025944 | Bacteria | 1306 |
| 626 | Ga0207679_10008499 | 3300025945 | Bacteria | 6542 |
| 627 | Ga0207679_10027429 | 3300025945 | Bacteria | 3938 |
| 628 | Ga0207679_10118822 | 3300025945 | Bacteria | 2100 |
| 629 | Ga0207679_10179239 | 3300025945 | Bacteria | 1751 |
| 630 | Ga0207679_10239298 | 3300025945 | Bacteria | 1537 |
| 631 | Ga0207679_10277212 | 3300025945 | Bacteria | 1437 |
| 632 | Ga0207679_10279880 | 3300025945 | Bacteria | 1430 |
| 633 | Ga0207679_10387234 | 3300025945 | Bacteria | 1227 |
| 634 | Ga0207679_10453038 | 3300025945 | Bacteria | 1138 |
| 635 | Ga0207667_10057801 | 3300025949 | Bacteria | 4070 |
| 636 | Ga0207667_10074299 | 3300025949 | Bacteria | 3531 |
| 637 | Ga0207667_10178337 | 3300025949 | Bacteria | 2182 |
| 638 | Ga0207667_10191020 | 3300025949 | Bacteria | 2101 |
| 639 | Ga0207667_10278911 | 3300025949 | Bacteria | 1708 |
| 640 | Ga0207667_10728589 | 3300025949 | Bacteria | 992 |
| 641 | Ga0207651_10012328 | 3300025960 | Bacteria | 4833 |
| 642 | Ga0207651_10018112 | 3300025960 | Bacteria | 4182 |
| 643 | Ga0207651_10035487 | 3300025960 | Bacteria | 3243 |
| 644 | Ga0207651_10184451 | 3300025960 | Bacteria | 1658 |
| 645 | Ga0207651_10186327 | 3300025960 | Bacteria | 1651 |
| 646 | Ga0207651_10589679 | 3300025960 | Bacteria | 970 |
| 647 | Ga0207712_10004226 | 3300025961 | Bacteria | 9060 |
| 648 | Ga0207712_10006036 | 3300025961 | Bacteria | 7641 |
| 649 | Ga0207712_10123761 | 3300025961 | Bacteria | 1961 |
| 650 | Ga0207712_10375602 | 3300025961 | Bacteria | 1188 |
| 651 | Ga0207668_10013659 | 3300025972 | Bacteria | 5009 |
| 652 | Ga0207668_10028650 | 3300025972 | Bacteria | 3644 |
| 653 | Ga0207668_10240814 | 3300025972 | Bacteria | 1463 |
| 654 | Ga0207668_10419226 | 3300025972 | Bacteria | 1136 |
| 655 | Ga0207640_10003992 | 3300025981 | Bacteria | 7969 |
| 656 | Ga0207640_10072562 | 3300025981 | Bacteria | 2323 |
| 657 | Ga0207640_10073987 | 3300025981 | Bacteria | 2304 |
| 658 | Ga0207640_10262206 | 3300025981 | Bacteria | 1347 |
| 659 | Ga0207658_10003042 | 3300025986 | Bacteria | 11987 |
| 660 | Ga0207658_10005459 | 3300025986 | Bacteria | 8722 |
| 661 | Ga0207658_10016705 | 3300025986 | Bacteria | 5051 |
| 662 | Ga0207658_10172763 | 3300025986 | Bacteria | 1782 |
| 663 | Ga0207658_10246403 | 3300025986 | Bacteria | 1516 |
| 664 | Ga0207658_10464734 | 3300025986 | Bacteria | 1122 |
| 665 | Ga0207658_10570336 | 3300025986 | Bacteria | 1014 |
| 666 | Ga0207658_10624764 | 3300025986 | Bacteria | 969 |
| 667 | Ga0207677_10035383 | 3300026023 | Bacteria | 3243 |
| 668 | Ga0207677_10053941 | 3300026023 | Bacteria | 2740 |
| 669 | Ga0207677_10093173 | 3300026023 | Bacteria | 2195 |
| 670 | Ga0207677_10105233 | 3300026023 | Bacteria | 2088 |
| 671 | Ga0207677_10305150 | 3300026023 | Bacteria | 1316 |
| 672 | Ga0207677_10393288 | 3300026023 | Bacteria | 1173 |
| 673 | Ga0207703_10007785 | 3300026035 | Bacteria | 8479 |
| 674 | Ga0207703_10020766 | 3300026035 | Bacteria | 5139 |
| 675 | Ga0207703_10037216 | 3300026035 | Bacteria | 3876 |
| 676 | Ga0207703_10118229 | 3300026035 | Bacteria | 2272 |
| 677 | Ga0207703_10127660 | 3300026035 | Bacteria | 2192 |
| 678 | Ga0207703_10298809 | 3300026035 | Bacteria | 1468 |
| 679 | Ga0207703_10369466 | 3300026035 | Bacteria | 1325 |
| 680 | Ga0207639_10060943 | 3300026041 | Bacteria | 2912 |
| 681 | Ga0207639_10240583 | 3300026041 | Bacteria | 1573 |
| 682 | Ga0207639_10284363 | 3300026041 | Bacteria | 1456 |
| 683 | Ga0207639_10308364 | 3300026041 | Bacteria | 1401 |
| 684 | Ga0207639_10718561 | 3300026041 | Bacteria | 928 |
| 685 | Ga0207639_10879865 | 3300026041 | Bacteria | 837 |
| 686 | Ga0207678_10004010 | 3300026067 | Bacteria | 13252 |
| 687 | Ga0207678_10048730 | 3300026067 | Bacteria | 3661 |
| 688 | Ga0207678_10101468 | 3300026067 | Bacteria | 2457 |
| 689 | Ga0207678_10166070 | 3300026067 | Bacteria | 1885 |
| 690 | Ga0207678_10188630 | 3300026067 | Bacteria | 1761 |
| 691 | Ga0207678_10381762 | 3300026067 | Bacteria | 1218 |
| 692 | Ga0207678_11358459 | 3300026067 | Bacteria | 628 |
| 693 | Ga0207708_10026826 | 3300026075 | Bacteria | 4361 |
| 694 | Ga0207708_10046076 | 3300026075 | Bacteria | 3322 |
| 695 | Ga0207708_10056463 | 3300026075 | Bacteria | 2995 |
| 696 | Ga0207702_10084197 | 3300026078 | Bacteria | 2768 |
| 697 | Ga0207702_10479534 | 3300026078 | Bacteria | 1210 |
| 698 | Ga0207702_10662444 | 3300026078 | Bacteria | 1027 |
| 699 | Ga0207641_10002465 | 3300026088 | Bacteria | 17092 |
| 700 | Ga0207641_10048522 | 3300026088 | Bacteria | 3583 |
| 701 | Ga0207641_10101777 | 3300026088 | Bacteria | 2532 |
| 702 | Ga0207641_10119819 | 3300026088 | Bacteria | 2346 |
| 703 | Ga0207641_10175133 | 3300026088 | Bacteria | 1961 |
| 704 | Ga0207641_10430282 | 3300026088 | Bacteria | 1272 |
| 705 | Ga0207641_10559951 | 3300026088 | Bacteria | 1115 |
| 706 | Ga0207641_10707034 | 3300026088 | Bacteria | 993 |
| 707 | Ga0207641_10740094 | 3300026088 | Bacteria | 970 |
| 708 | Ga0207648_10000118 | 3300026089 | Bacteria | 77144 |
| 709 | Ga0207648_10000842 | 3300026089 | Bacteria | 34576 |
| 710 | Ga0207648_10005129 | 3300026089 | Bacteria | 13267 |
| 711 | Ga0207648_10006969 | 3300026089 | Bacteria | 11186 |
| 712 | Ga0207648_10024991 | 3300026089 | Bacteria | 5325 |
| 713 | Ga0207648_10048224 | 3300026089 | Bacteria | 3730 |
| 714 | Ga0207648_10096211 | 3300026089 | Bacteria | 2591 |
| 715 | Ga0207648_10344581 | 3300026089 | Bacteria | 1342 |
| 716 | Ga0207648_10401067 | 3300026089 | Bacteria | 1243 |
| 717 | Ga0207676_10058884 | 3300026095 | Bacteria | 3032 |
| 718 | Ga0207676_10070932 | 3300026095 | Bacteria | 2795 |
| 719 | Ga0207676_10099637 | 3300026095 | Bacteria | 2405 |
| 720 | Ga0207676_10148246 | 3300026095 | Bacteria | 2017 |
| 721 | Ga0207676_10317590 | 3300026095 | Bacteria | 1428 |
| 722 | Ga0207676_10535952 | 3300026095 | Bacteria | 1116 |
| 723 | Ga0207674_10021612 | 3300026116 | Bacteria | 6927 |
| 724 | Ga0207674_10069067 | 3300026116 | Bacteria | 3554 |
| 725 | Ga0207674_10102519 | 3300026116 | Bacteria | 2842 |
| 726 | Ga0207674_10235918 | 3300026116 | Bacteria | 1777 |
| 727 | Ga0207674_10385128 | 3300026116 | Bacteria | 1356 |
| 728 | Ga0207675_100001529 | 3300026118 | Bacteria | 23189 |
| 729 | Ga0207675_100017659 | 3300026118 | Bacteria | 6655 |
| 730 | Ga0207675_100033361 | 3300026118 | Bacteria | 4797 |
| 731 | Ga0207675_100033388 | 3300026118 | Bacteria | 4795 |
| 732 | Ga0207675_100052353 | 3300026118 | Bacteria | 3809 |
| 733 | Ga0207675_100164655 | 3300026118 | Bacteria | 2117 |
| 734 | Ga0207675_100284304 | 3300026118 | Bacteria | 1608 |
| 735 | Ga0207675_100584014 | 3300026118 | Bacteria | 1119 |
| 736 | Ga0207675_101081565 | 3300026118 | Bacteria | 821 |
| 737 | Ga0207683_10044884 | 3300026121 | Bacteria | 3864 |
| 738 | Ga0207683_10087739 | 3300026121 | Bacteria | 2767 |
| 739 | Ga0207683_10098615 | 3300026121 | Bacteria | 2607 |
| 740 | Ga0207683_10112711 | 3300026121 | Bacteria | 2436 |
| 741 | Ga0207683_10152584 | 3300026121 | Bacteria | 2085 |
| 742 | Ga0207683_10304377 | 3300026121 | Bacteria | 1458 |
| 743 | Ga0207683_10405959 | 3300026121 | Bacteria | 1254 |
| 744 | Ga0207683_10634584 | 3300026121 | Bacteria | 989 |
| 745 | Ga0207698_10001763 | 3300026142 | Bacteria | 12625 |
| 746 | Ga0207698_10074135 | 3300026142 | Bacteria | 2713 |
| 747 | Ga0207698_10089371 | 3300026142 | Bacteria | 2515 |
| 748 | Ga0207698_10094822 | 3300026142 | Bacteria | 2455 |
| 749 | Ga0207698_10219326 | 3300026142 | Bacteria | 1717 |
| 750 | Ga0207698_10376661 | 3300026142 | Bacteria | 1349 |
| 751 | Ga0207698_10396163 | 3300026142 | Bacteria | 1318 |
| 752 | Ga0207698_10547501 | 3300026142 | Bacteria | 1133 |
| 753 | Ga0207698_11700686 | 3300026142 | Bacteria | 646 |
| 754 | Ga0209281_1000736 | 3300027111 | Bacteria | 32018 |
| 755 | Ga0209389_1020739 | 3300027296 | Bacteria | 5862 |
| 756 | Ga0209995_1005033 | 3300027471 | Bacteria | 2121 |
| 757 | Ga0209968_1001331 | 3300027526 | Bacteria | 3755 |
| 758 | Ga0209971_1008514 | 3300027682 | Bacteria | 2434 |
| 759 | Ga0209966_1000162 | 3300027695 | Bacteria | 28187 |
| 760 | Ga0209813_10005576 | 3300027866 | Bacteria | 3063 |
| 761 | Ga0209813_10181558 | 3300027866 | Bacteria | 770 |
| 762 | Ga0209974_10005095 | 3300027876 | Bacteria | 4638 |
| 763 | Ga0268266_10121172 | 3300028379 | Bacteria | 2328 |
| 764 | Ga0268266_10195518 | 3300028379 | Bacteria | 1848 |
| 765 | Ga0268266_10487036 | 3300028379 | Bacteria | 1176 |
| 766 | Ga0268265_10024537 | 3300028380 | Bacteria | 4267 |
| 767 | Ga0268265_10077830 | 3300028380 | Bacteria | 2606 |
| 768 | Ga0268265_10553223 | 3300028380 | Bacteria | 1093 |
| 769 | Ga0268265_10988912 | 3300028380 | Bacteria | 830 |
| 770 | Ga0268264_10000858 | 3300028381 | Bacteria | 32293 |
| 771 | Ga0268264_10040299 | 3300028381 | Bacteria | 3859 |
| 772 | Ga0268264_10043465 | 3300028381 | Bacteria | 3723 |
| 773 | Ga0268264_10245396 | 3300028381 | Bacteria | 1661 |
| 774 | Ga0268264_10514003 | 3300028381 | Bacteria | 1170 |
| 775 | Ga0268264_10856558 | 3300028381 | Bacteria | 910 |
| 776 | Ga0265336_10000013 | 3300028666 | Bacteria | 252156 |
| 777 | Ga0307517_10000131 | 3300028786 | Bacteria | 113233 |
| 778 | Ga0307517_10139515 | 3300028786 | Bacteria | 1708 |
| 779 | Ga0307517_10216895 | 3300028786 | Bacteria | 1169 |
| 780 | Ga0307517_10458448 | 3300028786 | Bacteria | 658 |
| 781 | Ga0307515_10000011 | 3300028794 | Bacteria | 633903 |
| 782 | Ga0307515_10000138 | 3300028794 | Bacteria | 173220 |
| 783 | Ga0307515_10000382 | 3300028794 | Bacteria | 107907 |
| 784 | Ga0307515_10001206 | 3300028794 | Bacteria | 59045 |
| 785 | Ga0307515_10003938 | 3300028794 | Bacteria | 30997 |
| 786 | Ga0307515_10030322 | 3300028794 | Bacteria | 9088 |
| 787 | Ga0307515_10049807 | 3300028794 | Bacteria | 6289 |
| 788 | Ga0307515_10065551 | 3300028794 | Bacteria | 5051 |
| 789 | Ga0307515_10207397 | 3300028794 | Bacteria | 1815 |
| 790 | Ga0307515_10250785 | 3300028794 | Bacteria | 1523 |
| 791 | Ga0307515_10368899 | 3300028794 | Bacteria | 1073 |
| 792 | Ga0265324_10000432 | 3300029957 | Bacteria | 29768 |
| 793 | Ga0307512_10037633 | 3300030522 | Bacteria | 4083 |
| 794 | Ga0307512_10056737 | 3300030522 | Bacteria | 3071 |
| 795 | Ga0307512_10057621 | 3300030522 | Bacteria | 3036 |
| 796 | Ga0307512_10222233 | 3300030522 | Bacteria | 985 |
| 797 | Ga0265328_10011442 | 3300031239 | Bacteria | 3543 |
| 798 | Ga0265328_10011544 | 3300031239 | Bacteria | 3526 |
| 799 | Ga0265331_10001252 | 3300031250 | Bacteria | 19038 |
| 800 | Ga0265327_10000042 | 3300031251 | Bacteria | 287487 |
| 801 | Ga0265327_10000174 | 3300031251 | Bacteria | 138922 |
| 802 | Ga0307513_10006637 | 3300031456 | Bacteria | 15105 |
| 803 | Ga0307513_10008888 | 3300031456 | Bacteria | 12776 |
| 804 | Ga0307513_10040500 | 3300031456 | Bacteria | 5150 |
| 805 | Ga0307513_10249003 | 3300031456 | Bacteria | 1575 |
| 806 | Ga0307513_10253042 | 3300031456 | Bacteria | 1557 |
| 807 | Ga0307513_10390773 | 3300031456 | Bacteria | 1128 |
| 808 | Ga0307509_10004119 | 3300031507 | Bacteria | 21260 |
| 809 | Ga0307509_10005021 | 3300031507 | Bacteria | 18658 |
| 810 | Ga0307509_10007961 | 3300031507 | Bacteria | 13668 |
| 811 | Ga0307509_10045866 | 3300031507 | Bacteria | 4709 |
| 812 | Ga0307509_10068229 | 3300031507 | Bacteria | 3722 |
| 813 | Ga0307509_10131019 | 3300031507 | Bacteria | 2463 |
| 814 | Ga0307509_10251599 | 3300031507 | Bacteria | 1550 |
| 815 | Ga0307509_10297350 | 3300031507 | Bacteria | 1365 |
| 816 | Ga0307408_100000037 | 3300031548 | Bacteria | 187096 |
| 817 | Ga0307408_100405031 | 3300031548 | Bacteria | 1172 |
| 818 | Ga0307508_10000727 | 3300031616 | Bacteria | 39082 |
| 819 | Ga0307508_10016265 | 3300031616 | Bacteria | 6770 |
| 820 | Ga0307508_10063507 | 3300031616 | Bacteria | 3258 |
| 821 | Ga0307508_10322762 | 3300031616 | Bacteria | 1136 |
| 822 | Ga0307508_10344109 | 3300031616 | Bacteria | 1082 |
| 823 | Ga0307508_10393564 | 3300031616 | Bacteria | 977 |
| 824 | Ga0307514_10000390 | 3300031649 | Bacteria | 99924 |
| 825 | Ga0307514_10002716 | 3300031649 | Bacteria | 17874 |
| 826 | Ga0307514_10065265 | 3300031649 | Bacteria | 2758 |
| 827 | Ga0307516_10000559 | 3300031730 | Bacteria | 50194 |
| 828 | Ga0307516_10001343 | 3300031730 | Bacteria | 34183 |
| 829 | Ga0307516_10006485 | 3300031730 | Bacteria | 13704 |
| 830 | Ga0307516_10335360 | 3300031730 | Bacteria | 1180 |
| 831 | Ga0307516_10475680 | 3300031730 | Bacteria | 904 |
| 832 | Ga0307405_10002935 | 3300031731 | Bacteria | 7692 |
| 833 | Ga0307405_10107459 | 3300031731 | Bacteria | 1884 |
| 834 | Ga0307405_10150554 | 3300031731 | Bacteria | 1635 |
| 835 | Ga0307405_10365846 | 3300031731 | Bacteria | 1118 |
| 836 | Ga0307413_10016247 | 3300031824 | Bacteria | 3839 |
| 837 | Ga0307413_11257263 | 3300031824 | Bacteria | 646 |
| 838 | Ga0307410_10028168 | 3300031852 | Bacteria | 3560 |
| 839 | Ga0307410_10174111 | 3300031852 | Bacteria | 1624 |
| 840 | Ga0307410_10249965 | 3300031852 | Bacteria | 1378 |
| 841 | Ga0307410_10308742 | 3300031852 | Bacteria | 1251 |
| 842 | Ga0307410_10368146 | 3300031852 | Bacteria | 1153 |
| 843 | Ga0307406_10178736 | 3300031901 | Bacteria | 1543 |
| 844 | Ga0307407_10347238 | 3300031903 | Bacteria | 1050 |
| 845 | Ga0307407_10489762 | 3300031903 | Bacteria | 899 |
| 846 | Ga0307412_10023995 | 3300031911 | Bacteria | 3761 |
| 847 | Ga0307412_10127635 | 3300031911 | Bacteria | 1842 |
| 848 | Ga0307409_100014831 | 3300031995 | Bacteria | 5087 |
| 849 | Ga0307409_100015029 | 3300031995 | Bacteria | 5063 |
| 850 | Ga0307409_100350884 | 3300031995 | Bacteria | 1392 |
| 851 | Ga0307416_100001622 | 3300032002 | Bacteria | 12383 |
| 852 | Ga0307416_100074296 | 3300032002 | Bacteria | 2839 |
| 853 | Ga0307416_100079922 | 3300032002 | Bacteria | 2758 |
| 854 | Ga0307416_100092016 | 3300032002 | Bacteria | 2607 |
| 855 | Ga0307416_100409062 | 3300032002 | Bacteria | 1397 |
| 856 | Ga0307416_100715878 | 3300032002 | Bacteria | 1091 |
| 857 | Ga0307416_100864899 | 3300032002 | Bacteria | 1003 |
| 858 | Ga0307416_101147545 | 3300032002 | Bacteria | 882 |
| 859 | Ga0307416_101977863 | 3300032002 | Bacteria | 686 |
| 860 | Ga0307414_10016912 | 3300032004 | Bacteria | 4450 |
| 861 | Ga0307414_10820959 | 3300032004 | Bacteria | 849 |
| 862 | Ga0307411_10000494 | 3300032005 | Bacteria | 13741 |
| 863 | Ga0307411_10027470 | 3300032005 | Bacteria | 3444 |
| 864 | Ga0307415_100002203 | 3300032126 | Bacteria | 9643 |
| 865 | Ga0307415_100034318 | 3300032126 | Bacteria | 3302 |
| 866 | Ga0307507_10029403 | 3300033179 | Bacteria | 5827 |
| 867 | Ga0307507_10151038 | 3300033179 | Bacteria | 1747 |
| 868 | Ga0307510_10007325 | 3300033180 | Bacteria | 13142 |
| 869 | Ga0307510_10047690 | 3300033180 | Bacteria | 4585 |
| 870 | Ga0307510_10178338 | 3300033180 | Bacteria | 1691 |
| 871 | Ga0373930_0040359 | 3300034816 | Bacteria | 992 |
| 872 | Ga0373959_0026677 | 3300034820 | Bacteria | 1143 |
| 873 | Ga0373959_0120729 | 3300034820 | Bacteria | 640 |
| 874 | Ga0373940_0034838 | 3300035088 | Bacteria | 1360 |
| 875 | Ga0373951_0029991 | 3300035091 | Bacteria | 1278 |
| 876 | Ga0373932_0114193 | 3300035112 | Bacteria | 893 |
| 877 | Ga0373936_0030416 | 3300035113 | Bacteria | 2129 |
| 878 | Ga0373936_0114062 | 3300035113 | Bacteria | 1150 |
| 879 | Ga0373939_0000130 | 3300035114 | Bacteria | 22040 |
| 880 | Ga0373939_0034204 | 3300035114 | Bacteria | 1490 |
| 881 | Ga0373939_0196592 | 3300035114 | Bacteria | 760 |
| 882 | Ga0373941_0171835 | 3300035115 | Bacteria | 808 |
| 883 | Ga0373945_0024452 | 3300035116 | Bacteria | 2093 |
| 884 | Ga0373945_0109486 | 3300035116 | Bacteria | 1089 |
| 885 | Ga0373954_0096475 | 3300035118 | Bacteria | 1424 |
| 886 | Ga0373960_0152422 | 3300035121 | Bacteria | 790 |
| 887 | Ga0373943_0031046 | 3300035170 | Bacteria | 2533 |
| 888 | Ga0373946_0132198 | 3300035171 | Bacteria | 1149 |
| 889 | Ga0373955_0026724 | 3300035172 | Bacteria | 2977 |
| 890 | Ga0373961_0016647 | 3300035241 | Bacteria | 1896 |
| 891 | Ga0373962_0083098 | 3300035242 | Bacteria | 975 |
| 892 | Ga0373924_0033543 | 3300035410 | Bacteria | 2073 |
| 893 | Ga0373931_0000077 | 3300035691 | Bacteria | 45225 |
| 894 | Ga0373931_0004391 | 3300035691 | Bacteria | 6440 |
| 895 | Ga0373931_0043713 | 3300035691 | Bacteria | 2360 |
| 896 | Ga0373931_0309889 | 3300035691 | Bacteria | 977 |
| 897 | Ga0373931_0645903 | 3300035691 | Bacteria | 695 |
| 898 | Ga0373937_0029553 | 3300036401 | Bacteria | 4964 |
| 899 | Ga0373937_0553807 | 3300036401 | Bacteria | 1092 |
| 900 | Ga0373925_0037784 | 3300037068 | Bacteria | 3566 |
| 901 | Ga0395900_0000879 | 3300037418 | Bacteria | 39414 |
| 902 | Ga0395900_0414590 | 3300037418 | Bacteria | 1309 |
| 903 | Ga0395898_0001863 | 3300037466 | Bacteria | 27013 |
| 904 | Ga0395905_0003332 | 3300037471 | Bacteria | 17241 |
| 905 | Ga0395905_0007069 | 3300037471 | Bacteria | 11222 |
| 906 | Ga0395905_0019367 | 3300037471 | Bacteria | 6451 |
| 907 | Ga0395905_0504915 | 3300037471 | Bacteria | 1109 |
| 908 | Ga0395901_0001781 | 3300038443 | Bacteria | 22224 |
| 909 | Ga0436361_0019641 | 3300039447 | Bacteria | 127735 |
| 910 | Ga0436361_0085209 | 3300039447 | Bacteria | 38016 |
| 911 | Ga0436361_0255611 | 3300039447 | Bacteria | 10944 |
| 912 | Ga0436361_0463922 | 3300039447 | Bacteria | 6537 |
| 913 | Ga0436361_1020604 | 3300039447 | Bacteria | 2364 |
| 914 | Ga0436361_1048578 | 3300039447 | Bacteria | 2558 |
| 915 | Ga0436361_1181151 | 3300039447 | Bacteria | 5390 |
| 916 | Ga0436363_0491953 | 3300039450 | Bacteria | 788 |
| 917 | Ga0436363_1399792 | 3300039450 | Bacteria | 2141 |
| 918 | Ga0451789_0465154 | 3300041443 | Bacteria | 2628 |
| 919 | Ga0451789_1272523 | 3300041443 | Bacteria | 1044 |
| 920 | Ga0451791_1347236 | 3300041451 | Bacteria | 860 |
| 921 | Ga0451797_1576900 | 3300041453 | Bacteria | 1055 |
| 922 | Ga0451798_0217509 | 3300041458 | Bacteria | 655 |
| 923 | Ga0451798_0867094 | 3300041458 | Bacteria | 1556 |
| 924 | Ga0451807_1959080 | 3300041486 | Bacteria | 1176 |
| 925 | Ga0451833_0958391 | 3300041491 | Bacteria | 919 |
| 926 | Ga0451839_0595639 | 3300041496 | Bacteria | 766 |
| 927 | Ga0451851_0070177 | 3300041507 | Bacteria | 668 |
| 928 | Ga0451843_1230032 | 3300041509 | Bacteria | 1584 |
| 929 | Ga0451853_0407793 | 3300041512 | Bacteria | 1592 |
| 930 | Ga0439431_0010770 | 3300041997 | Bacteria | 2081 |
| 931 | Ga0439433_0112376 | 3300041999 | Bacteria | 682 |
| 932 | Ga0439437_006821 | 3300042000 | Bacteria | 1268 |
| 933 | Ga0439441_037049 | 3300042001 | Bacteria | 966 |
| 934 | Ga0439449_0055644 | 3300042007 | Bacteria | 1461 |
| 935 | Ga0439449_0146662 | 3300042007 | Bacteria | 880 |
| 936 | Ga0439450_004588 | 3300042008 | Bacteria | 2371 |
| 937 | Ga0439457_042981 | 3300042014 | Bacteria | 1008 |
| 938 | Ga0450917_001065 | 3300042120 | Bacteria | 2015 |
| 939 | Ga0450888_000177 | 3300042126 | Bacteria | 5576 |
| 940 | Ga0450890_000922 | 3300042127 | Bacteria | 4247 |
| 941 | Ga0450891_000060 | 3300042129 | Bacteria | 8748 |
| 942 | Ga0450898_015057 | 3300042134 | Bacteria | 1307 |
| 943 | Ga0450899_013185 | 3300042135 | Bacteria | 932 |
| 944 | Ga0450903_013782 | 3300042138 | Bacteria | 1285 |
| 945 | Ga0450889_000922 | 3300042144 | Bacteria | 3132 |
| 946 | Ga0439435_0160003 | 3300042436 | Bacteria | 727 |
| 947 | Ga0439459_0010455 | 3300042438 | Bacteria | 1619 |
| 948 | Ga0439464_0015176 | 3300042439 | Bacteria | 2077 |
| 949 | Ga0450916_001089 | 3300042530 | Bacteria | 2648 |
| 950 | Ga0450918_000326 | 3300042531 | Bacteria | 10718 |
| 951 | Ga0450893_0010581 | 3300042532 | Bacteria | 1517 |
| 952 | Ga0450901_026210 | 3300042533 | Bacteria | 636 |
| 953 | Ga0451577_0001866 | 3300042876 | Bacteria | 26858 |
| 954 | Ga0451577_0032633 | 3300042876 | Bacteria | 4691 |
| 955 | Ga0451577_0127972 | 3300042876 | Bacteria | 2277 |
| 956 | Ga0466969_0000020 | 3300044656 | Bacteria | 101861 |
| 957 | Ga0466969_0101384 | 3300044656 | Bacteria | 1354 |
| 958 | Ga0466965_0000493 | 3300044683 | Bacteria | 14004 |
| 959 | Ga0466965_0011312 | 3300044683 | Bacteria | 4179 |
| 960 | Ga0466965_0038922 | 3300044683 | Bacteria | 2336 |
| 961 | Ga0466965_0109992 | 3300044683 | Bacteria | 1415 |
| 962 | Ga0466966_0001239 | 3300044684 | Bacteria | 16360 |
| 963 | Ga0466966_0011170 | 3300044684 | Bacteria | 5956 |
| 964 | Ga0466961_0013718 | 3300044693 | Bacteria | 5192 |
| 965 | Ga0466961_0037361 | 3300044693 | Bacteria | 3115 |
| 966 | Ga0466963_0039303 | 3300044694 | Bacteria | 3098 |
| 967 | Ga0466963_0077538 | 3300044694 | Bacteria | 2245 |
| 968 | Ga0466963_0101194 | 3300044694 | Bacteria | 1973 |
| 969 | Ga0466964_0000949 | 3300044706 | Bacteria | 9595 |
| 970 | Ga0466964_0014413 | 3300044706 | Bacteria | 3006 |
| 971 | Ga0466964_0062857 | 3300044706 | Bacteria | 1549 |
| 972 | Ga0453684_0042883 | 3300044712 | Bacteria | 6090 |
| 973 | Ga0453684_0066790 | 3300044712 | Bacteria | 4577 |
| 974 | Ga0453684_0410522 | 3300044712 | Bacteria | 1515 |
| 975 | Ga0453684_0591572 | 3300044712 | Bacteria | 1217 |
| 976 | Ga0453684_0687081 | 3300044712 | Bacteria | 1113 |
| 977 | Ga0453684_0875581 | 3300044712 | Bacteria | 963 |
| 978 | Ga0466971_0002813 | 3300044719 | Bacteria | 7367 |
| 979 | Ga0466971_0003163 | 3300044719 | Bacteria | 7020 |
| 980 | Ga0466971_0023819 | 3300044719 | Bacteria | 2728 |
| 981 | Ga0466968_0013862 | 3300044735 | Bacteria | 3175 |
| 982 | Ga0466970_0005378 | 3300044765 | Bacteria | 6352 |
| 983 | Ga0466970_0033153 | 3300044765 | Bacteria | 2730 |
| 984 | Ga0466970_0192540 | 3300044765 | Bacteria | 1133 |
| 985 | Ga0466957_0027220 | 3300044842 | Bacteria | 3396 |
| 986 | Ga0466957_0063458 | 3300044842 | Bacteria | 2271 |
| 987 | Ga0466957_0269486 | 3300044842 | Bacteria | 1136 |
| 988 | Ga0466959_0001531 | 3300045049 | Bacteria | 14217 |
| 989 | Ga0466959_0046516 | 3300045049 | Bacteria | 3192 |
| 990 | Ga0466959_0067872 | 3300045049 | Bacteria | 2584 |
| 991 | Ga0451576_0009077 | 3300045051 | Bacteria | 11576 |
| 992 | Ga0451576_0124243 | 3300045051 | Bacteria | 2688 |
| 993 | Ga0451576_0257121 | 3300045051 | Bacteria | 1825 |
| 994 | Ga0451576_0284685 | 3300045051 | Bacteria | 1728 |
| 995 | Ga0451576_0509554 | 3300045051 | Bacteria | 1264 |
| 996 | Ga0451576_0665852 | 3300045051 | Bacteria | 1094 |
| 997 | Ga0451576_1515972 | 3300045051 | Bacteria | 696 |
| 998 | Ga0466958_0041460 | 3300045836 | Bacteria | 2768 |
| 999 | Ga0466958_0063036 | 3300045836 | Bacteria | 2260 |
| 1000 | Ga0466967_0025052 | 3300045976 | Bacteria | 4913 |
| 1001 | Ga0495592_0000746 | 3300046454 | Bacteria | 22679 |
| 1002 | Ga0495592_0215835 | 3300046454 | Bacteria | 1286 |
| 1003 | Ga0495592_0272189 | 3300046454 | Bacteria | 1111 |
| 1004 | Ga0495603_0078723 | 3300046455 | Bacteria | 1933 |
| 1005 | Ga0495590_0031730 | 3300046457 | Bacteria | 1848 |
| 1006 | Ga0495590_0141131 | 3300046457 | Bacteria | 869 |
| 1007 | Ga0495629_0166233 | 3300046459 | Bacteria | 1532 |
| 1008 | Ga0495638_0031475 | 3300046460 | Bacteria | 3410 |
| 1009 | Ga0495651_0106790 | 3300046462 | Bacteria | 2075 |
| 1010 | Ga0495653_0559191 | 3300046463 | Bacteria | 707 |
| 1011 | Ga0495650_0008561 | 3300046471 | Bacteria | 5947 |
| 1012 | Ga0495650_0029377 | 3300046471 | Bacteria | 2506 |
| 1013 | Ga0495580_0041734 | 3300046472 | Bacteria | 3271 |
| 1014 | Ga0495580_0626935 | 3300046472 | Bacteria | 709 |
| 1015 | Ga0495662_0395224 | 3300046476 | Bacteria | 679 |
| 1016 | Ga0495583_0000034 | 3300046506 | Bacteria | 246856 |
| 1017 | Ga0495583_0079676 | 3300046506 | Bacteria | 1425 |
| 1018 | Ga0495606_0006285 | 3300046507 | Bacteria | 11017 |
| 1019 | Ga0495606_0358723 | 3300046507 | Bacteria | 771 |
| 1020 | Ga0495608_0264507 | 3300046511 | Bacteria | 1070 |
| 1021 | Ga0495610_0024206 | 3300046512 | Bacteria | 3281 |
| 1022 | Ga0495610_0036866 | 3300046512 | Bacteria | 2495 |
| 1023 | Ga0495618_0406174 | 3300046514 | Bacteria | 832 |
| 1024 | Ga0495620_0259601 | 3300046515 | Bacteria | 662 |
| 1025 | Ga0495628_0163090 | 3300046516 | Bacteria | 1693 |
| 1026 | Ga0495630_0040768 | 3300046517 | Bacteria | 3470 |
| 1027 | Ga0495631_0098292 | 3300046518 | Bacteria | 1260 |
| 1028 | Ga0495632_0066020 | 3300046519 | Bacteria | 1746 |
| 1029 | Ga0495632_0095371 | 3300046519 | Bacteria | 1406 |
| 1030 | Ga0495643_0072167 | 3300046522 | Bacteria | 1811 |
| 1031 | Ga0495644_0192133 | 3300046523 | Bacteria | 786 |
| 1032 | Ga0495648_0055873 | 3300046524 | Bacteria | 2378 |
| 1033 | Ga0495648_0064351 | 3300046524 | Bacteria | 2161 |
| 1034 | Ga0495648_0122432 | 3300046524 | Bacteria | 1396 |
| 1035 | Ga0495663_0077585 | 3300046525 | Bacteria | 1066 |
| 1036 | Ga0495640_0292472 | 3300046533 | Bacteria | 1013 |
| 1037 | Ga0495586_0120873 | 3300046535 | Bacteria | 1463 |
| 1038 | Ga0495598_0018950 | 3300046537 | Bacteria | 1796 |
| 1039 | Ga0495609_0167602 | 3300046538 | Bacteria | 929 |
| 1040 | Ga0495621_0021135 | 3300046539 | Bacteria | 2142 |
| 1041 | Ga0495621_0279558 | 3300046539 | Bacteria | 687 |
| 1042 | Ga0495621_0285045 | 3300046539 | Bacteria | 681 |
| 1043 | Ga0495597_0017935 | 3300046542 | Bacteria | 3324 |
| 1044 | Ga0495667_0174150 | 3300046559 | Bacteria | 1382 |
| 1045 | Ga0495656_0129509 | 3300046615 | Bacteria | 1200 |
| 1046 | Ga0495668_0021789 | 3300046616 | Bacteria | 3668 |
| 1047 | Ga0495668_0294669 | 3300046616 | Bacteria | 889 |
| 1048 | Ga0495625_0006159 | 3300046660 | Bacteria | 10745 |
| 1049 | Ga0495625_0020810 | 3300046660 | Bacteria | 5058 |
| 1050 | Ga0495635_0101360 | 3300046663 | Bacteria | 1968 |
| 1051 | Ga0495646_0040454 | 3300046680 | Bacteria | 2871 |
| 1052 | Ga0495646_0157199 | 3300046680 | Bacteria | 1261 |
| 1053 | Ga0495647_0245915 | 3300046681 | Bacteria | 795 |
| 1054 | Ga0495658_0204009 | 3300046683 | Bacteria | 1233 |
| 1055 | Ga0495669_0026759 | 3300046684 | Bacteria | 2521 |
| 1056 | Ga0495669_0317274 | 3300046684 | Bacteria | 752 |
| 1057 | Ga0495613_0152544 | 3300046689 | Bacteria | 1647 |
| 1058 | Ga0495670_0060761 | 3300046691 | Bacteria | 1899 |
| 1059 | Ga0495670_0129903 | 3300046691 | Bacteria | 1313 |
| 1060 | Ga0495671_0097137 | 3300046692 | Bacteria | 1441 |
| 1061 | Ga0495671_0106988 | 3300046692 | Bacteria | 1366 |
| 1062 | Ga0495649_0000728 | 3300046694 | Bacteria | 26762 |
| 1063 | Ga0495649_0029913 | 3300046694 | Bacteria | 3009 |
| 1064 | Ga0495660_0015408 | 3300046810 | Bacteria | 4416 |
| 1065 | Ga0495660_0079409 | 3300046810 | Bacteria | 1723 |
| 1066 | Ga0495674_0289346 | 3300047319 | Bacteria | 1340 |
| 1067 | Ga0495680_0111095 | 3300047322 | Bacteria | 2031 |
| 1068 | Ga0495687_000248 | 3300047443 | Bacteria | 72947 |
| 1069 | Ga0495687_018539 | 3300047443 | Bacteria | 3438 |
| 1070 | Ga0495673_0183303 | 3300047469 | Bacteria | 792 |
| 1071 | Ga0495681_0172549 | 3300047470 | Bacteria | 894 |
| 1072 | Ga0495686_0000739 | 3300047472 | Bacteria | 43610 |
| 1073 | Ga0495686_0039653 | 3300047472 | Bacteria | 3006 |
| 1074 | Ga0495686_0165775 | 3300047472 | Bacteria | 1288 |
| 1075 | Ga0495614_0217942 | 3300048089 | Bacteria | 867 |
| 1076 | Ga0495626_0073934 | 3300048091 | Bacteria | 1526 |
| 1077 | Ga0496100_0035391 | 3300048903 | Bacteria | 3140 |
| 1078 | Ga0496100_0103186 | 3300048903 | Bacteria | 1969 |
| 1079 | Ga0496100_0582321 | 3300048903 | Bacteria | 868 |
| 1080 | Ga0496100_0774405 | 3300048903 | Bacteria | 751 |
| 1081 | Ga0496100_1044664 | 3300048903 | Bacteria | 643 |
| 1082 | Ga0496101_0024303 | 3300048904 | Bacteria | 4193 |
| 1083 | Ga0496102_0006045 | 3300048905 | Bacteria | 10311 |
| 1084 | Ga0496102_0008100 | 3300048905 | Bacteria | 8990 |
| 1085 | Ga0496102_0095541 | 3300048905 | Bacteria | 2755 |
| 1086 | Ga0496103_0378788 | 3300048906 | Bacteria | 909 |
| 1087 | Ga0496104_0087183 | 3300048907 | Bacteria | 2981 |
| 1088 | Ga0496104_0123106 | 3300048907 | Bacteria | 2490 |
| 1089 | Ga0496104_0212089 | 3300048907 | Bacteria | 1848 |
| 1090 | Ga0496104_0994531 | 3300048907 | Bacteria | 743 |
| 1091 | Ga0496105_0218711 | 3300048908 | Bacteria | 1551 |
| 1092 | Ga0496105_0284964 | 3300048908 | Bacteria | 1331 |
| 1093 | Ga0496105_0388177 | 3300048908 | Bacteria | 1110 |
| 1094 | Ga0496106_0023565 | 3300048909 | Bacteria | 4572 |
| 1095 | Ga0496106_0027147 | 3300048909 | Bacteria | 4264 |
| 1096 | Ga0496107_0004099 | 3300048910 | Bacteria | 9815 |
| 1097 | Ga0496108_0112517 | 3300048911 | Bacteria | 2329 |
| 1098 | Ga0496108_0132616 | 3300048911 | Bacteria | 2141 |
| 1099 | Ga0496108_0133591 | 3300048911 | Bacteria | 2133 |
| 1100 | Ga0496109_0042557 | 3300048912 | Bacteria | 4115 |
| 1101 | Ga0496109_0143033 | 3300048912 | Bacteria | 2237 |
| 1102 | Ga0496109_0179034 | 3300048912 | Bacteria | 1991 |
| 1103 | Ga0496109_0195803 | 3300048912 | Bacteria | 1899 |
| 1104 | Ga0496109_0328802 | 3300048912 | Bacteria | 1443 |
| 1105 | Ga0496109_0337113 | 3300048912 | Bacteria | 1424 |
| 1106 | Ga0496110_0069048 | 3300048913 | Bacteria | 3128 |
| 1107 | Ga0496110_0394290 | 3300048913 | Bacteria | 1262 |
| 1108 | Ga0496111_0176869 | 3300048914 | Bacteria | 1586 |
| 1109 | Ga0496111_0477267 | 3300048914 | Bacteria | 919 |
| 1110 | Ga0496112_0061214 | 3300048915 | Bacteria | 3710 |
| 1111 | Ga0496112_0425437 | 3300048915 | Bacteria | 1266 |
| 1112 | Ga0496113_0013003 | 3300048916 | Bacteria | 5617 |
| 1113 | Ga0496113_0241481 | 3300048916 | Bacteria | 1441 |
| 1114 | Ga0496113_0398556 | 3300048916 | Bacteria | 1105 |
| 1115 | Ga0496114_0070435 | 3300048917 | Bacteria | 2937 |
| 1116 | Ga0496114_0599381 | 3300048917 | Bacteria | 971 |
| 1117 | Ga0496121_0026182 | 3300048924 | Bacteria | 5506 |
| 1118 | Ga0496124_0000126 | 3300048927 | Bacteria | 159539 |
| 1119 | Ga0496124_0079515 | 3300048927 | Bacteria | 2700 |
| 1120 | Ga0496125_0003500 | 3300048928 | Bacteria | 18970 |
| 1121 | Ga0501298_011150 | 3300049521 | Bacteria | 1557 |
| 1122 | Ga0501300_009888 | 3300049523 | Bacteria | 1390 |
| 1123 | Ga0501043_0000009 | 3300049579 | Bacteria | 214823 |
| 1124 | Ga0501046_0000022 | 3300049580 | Bacteria | 215451 |
| 1125 | Ga0501047_0000021 | 3300049581 | Bacteria | 254841 |
| 1126 | Ga0501198_000019 | 3300049649 | Bacteria | 83282 |
| 1127 | Ga0501201_001792 | 3300049651 | Bacteria | 1989 |
| 1128 | Ga0501211_000655 | 3300049658 | Bacteria | 3485 |
| 1129 | Ga0501222_000059 | 3300049662 | Bacteria | 34949 |
| 1130 | Ga0501222_002805 | 3300049662 | Bacteria | 2412 |
| 1131 | Ga0501223_012519 | 3300049663 | Bacteria | 1695 |
| 1132 | Ga0501233_008494 | 3300049668 | Bacteria | 1981 |
| 1133 | Ga0501235_002288 | 3300049669 | Bacteria | 4120 |
| 1134 | Ga0501236_019964 | 3300049670 | Bacteria | 982 |
| 1135 | Ga0501249_007648 | 3300049679 | Bacteria | 2237 |
| 1136 | Ga0501253_020996 | 3300049683 | Bacteria | 1145 |
| 1137 | Ga0501253_060348 | 3300049683 | Bacteria | 816 |
| 1138 | Ga0501255_023119 | 3300049684 | Bacteria | 819 |
| 1139 | Ga0501221_004219 | 3300049704 | Bacteria | 2381 |
| 1140 | Ga0501229_000329 | 3300049706 | Bacteria | 5361 |
| 1141 | Ga0501232_007753 | 3300049757 | Bacteria | 1140 |
| 1142 | Ga0501262_001965 | 3300049759 | Bacteria | 2316 |
| 1143 | Ga0501263_040320 | 3300049760 | Bacteria | 685 |
| 1144 | Ga0501265_002920 | 3300049762 | Bacteria | 1940 |
| 1145 | Ga0501266_015299 | 3300049763 | Bacteria | 1012 |
| 1146 | Ga0501267_001228 | 3300049764 | Bacteria | 2158 |
| 1147 | Ga0501271_004112 | 3300049768 | Bacteria | 1368 |
| 1148 | Ga0501272_005415 | 3300049769 | Bacteria | 1342 |
| 1149 | Ga0501283_005530 | 3300049779 | Bacteria | 1741 |
| 1150 | Ga0501035_0304530 | 3300049822 | Bacteria | 1342 |
| 1151 | Ga0501044_0661707 | 3300049823 | Bacteria | 933 |
| 1152 | Ga0501045_0025044 | 3300049824 | Bacteria | 4287 |
| 1153 | nmdc:mga03683_287767_c1 | 3300050489 | Bacteria | 769 |
| 1154 | nmdc:mga03683_439_c1 | 3300050489 | Bacteria | 9088 |
| 1155 | nmdc:mga03683_5178_c1 | 3300050489 | Bacteria | 4384 |
| 1156 | nmdc:mga03n38_361453_c1 | 3300050490 | Bacteria | 792 |
| 1157 | nmdc:mga03n38_70060_c1 | 3300050490 | Bacteria | 1621 |
| 1158 | nmdc:mga03n38_86560_c1 | 3300050490 | Bacteria | 1483 |
| 1159 | nmdc:mga00v17_297159_c1 | 3300050491 | Bacteria | 1049 |
| 1160 | nmdc:mga0yw44_19242_c1 | 3300050492 | Bacteria | 3760 |
| 1161 | nmdc:mga0k408_118638_c1 | 3300050493 | Bacteria | 1566 |
| 1162 | nmdc:mga0k408_127486_c1 | 3300050493 | Bacteria | 1510 |
| 1163 | nmdc:mga0k408_12953_c1 | 3300050493 | Bacteria | 4566 |
| 1164 | nmdc:mga0k408_130339_c1 | 3300050493 | Bacteria | 1493 |
| 1165 | nmdc:mga0k408_146879_c1 | 3300050493 | Bacteria | 1404 |
| 1166 | nmdc:mga0k408_1705_c1 | 3300050493 | Bacteria | 11835 |
| 1167 | nmdc:mga0k408_173373_c1 | 3300050493 | Bacteria | 1286 |
| 1168 | nmdc:mga0k408_19355_c1 | 3300050493 | Bacteria | 3804 |
| 1169 | nmdc:mga0k408_212864_c1 | 3300050493 | Bacteria | 1154 |
| 1170 | nmdc:mga0k408_240212_c1 | 3300050493 | Bacteria | 1082 |
| 1171 | nmdc:mga0k408_259539_c1 | 3300050493 | Bacteria | 1038 |
| 1172 | nmdc:mga0k408_27836_c1 | 3300050493 | Bacteria | 3212 |
| 1173 | nmdc:mga0k408_376315_c1 | 3300050493 | Bacteria | 846 |
| 1174 | nmdc:mga0k408_406_c1 | 3300050493 | Bacteria | 23501 |
| 1175 | nmdc:mga0k408_41032_c1 | 3300050493 | Bacteria | 2664 |
| 1176 | nmdc:mga0k408_42240_c1 | 3300050493 | Bacteria | 2626 |
| 1177 | nmdc:mga0k408_527_c1 | 3300050493 | Bacteria | 11830 |
| 1178 | nmdc:mga0k408_54354_c1 | 3300050493 | Bacteria | 2320 |
| 1179 | nmdc:mga0k408_59264_c1 | 3300050493 | Bacteria | 2224 |
| 1180 | nmdc:mga0k408_85785_c1 | 3300050493 | Bacteria | 1848 |
| 1181 | nmdc:mga0k408_88156_c1 | 3300050493 | Bacteria | 1822 |
| 1182 | nmdc:mga06z11_11864_c1 | 3300050494 | Bacteria | 3771 |
| 1183 | nmdc:mga06z11_258805_c1 | 3300050494 | Bacteria | 1026 |
| 1184 | nmdc:mga06z11_57689_c1 | 3300050494 | Bacteria | 2012 |
| 1185 | nmdc:mga06z11_64211_c1 | 3300050494 | Bacteria | 1923 |
| 1186 | nmdc:mga06z11_76716_c1 | 3300050494 | Bacteria | 1782 |
| 1187 | nmdc:mga04h51_317948_c1 | 3300050495 | Bacteria | 638 |
| 1188 | nmdc:mga04h51_7612_c1 | 3300050495 | Bacteria | 2866 |
| 1189 | nmdc:mga07m45_10360_c1 | 3300050496 | Bacteria | 4867 |
| 1190 | nmdc:mga07m45_103654_c1 | 3300050496 | Bacteria | 1635 |
| 1191 | nmdc:mga07m45_10939_c1 | 3300050496 | Bacteria | 4754 |
| 1192 | nmdc:mga07m45_117_c1 | 3300050496 | Bacteria | 31533 |
| 1193 | nmdc:mga07m45_136154_c1 | 3300050496 | Bacteria | 1422 |
| 1194 | nmdc:mga07m45_1620_c1 | 3300050496 | Bacteria | 10359 |
| 1195 | nmdc:mga07m45_207586_c1 | 3300050496 | Bacteria | 1140 |
| 1196 | nmdc:mga07m45_30645_c1 | 3300050496 | Bacteria | 2980 |
| 1197 | nmdc:mga07m45_4614_c1 | 3300050496 | Bacteria | 6755 |
| 1198 | nmdc:mga07m45_5537_c1 | 3300050496 | Bacteria | 6298 |
| 1199 | nmdc:mga07m45_6725_c1 | 3300050496 | Bacteria | 5835 |
| 1200 | nmdc:mga05p37_109740_c1 | 3300050507 | Bacteria | 3394 |
| 1201 | nmdc:mga09592_53741_c1 | 3300050508 | Bacteria | 3402 |
| 1202 | nmdc:mga0qj67_360672_c1 | 3300050509 | Bacteria | 1174 |
| 1203 | nmdc:mga0qj67_76608_c1 | 3300050509 | Bacteria | 2675 |
| 1204 | nmdc:mga08y16_1178426_c1 | 3300050511 | Bacteria | 738 |
| 1205 | nmdc:mga0sz30_17453_c1 | 3300050516 | Bacteria | 2863 |
| 1206 | nmdc:mga0sz30_191152_c1 | 3300050516 | Bacteria | 909 |
| 1207 | nmdc:mga0sz30_69443_c1 | 3300050516 | Bacteria | 1515 |
| 1208 | Ga0495601_0019457 | 3300053077 | Bacteria | 4140 |
| 1209 | Ga0500635_0000011 | 3300053080 | Bacteria | 144219 |
| 1210 | Ga0495619_0143834 | 3300053085 | Bacteria | 1643 |
| 1211 | Ga0500578_0000673 | 3300053086 | Bacteria | 40901 |
| 1212 | Ga0500578_0174805 | 3300053086 | Bacteria | 1326 |
| 1213 | Ga0500578_0554643 | 3300053086 | Bacteria | 638 |
| 1214 | Ga0500643_032481 | 3300053087 | Bacteria | 1585 |
| 1215 | Ga0500644_0018787 | 3300053088 | Bacteria | 2031 |
| 1216 | Ga0500646_0014486 | 3300053090 | Bacteria | 2047 |
| 1217 | Ga0500583_0054394 | 3300053092 | Bacteria | 1869 |
| 1218 | Ga0500651_0051962 | 3300053093 | Bacteria | 2570 |
| 1219 | Ga0500651_0229625 | 3300053093 | Bacteria | 1086 |
| 1220 | Ga0500648_346063 | 3300053097 | Bacteria | 611 |
| 1221 | Ga0500650_0046653 | 3300053098 | Bacteria | 2007 |
| 1222 | Ga0500555_030106 | 3300053103 | Bacteria | 1541 |
| 1223 | Ga0500562_026334 | 3300053108 | Bacteria | 1524 |
| 1224 | Ga0500562_037530 | 3300053108 | Bacteria | 1286 |
| 1225 | Ga0500569_007978 | 3300053109 | Bacteria | 2403 |
| 1226 | Ga0500593_000680 | 3300053117 | Bacteria | 12914 |
| 1227 | Ga0500594_0000470 | 3300053118 | Bacteria | 8860 |
| 1228 | Ga0500595_073612 | 3300053119 | Bacteria | 1010 |
| 1229 | Ga0500607_118133 | 3300053121 | Bacteria | 1288 |
| 1230 | Ga0500608_246768 | 3300053122 | Bacteria | 700 |
| 1231 | Ga0500623_072496 | 3300053127 | Bacteria | 1666 |
| 1232 | Ga0500628_018338 | 3300053129 | Bacteria | 1378 |
| 1233 | Ga0500628_075548 | 3300053129 | Bacteria | 853 |
| 1234 | Ga0500652_000123 | 3300053131 | Bacteria | 29418 |
| 1235 | Ga0500652_208186 | 3300053131 | Bacteria | 791 |
| 1236 | Ga0500655_004744 | 3300053133 | Bacteria | 2445 |
| 1237 | Ga0500655_017284 | 3300053133 | Bacteria | 1333 |
| 1238 | Ga0500658_0044915 | 3300053134 | Bacteria | 1784 |
| 1239 | Ga0500658_0237260 | 3300053134 | Bacteria | 837 |
| 1240 | Ga0500559_0000407 | 3300053136 | Bacteria | 30942 |
| 1241 | Ga0500559_0153931 | 3300053136 | Bacteria | 1079 |
| 1242 | Ga0500568_0112756 | 3300053139 | Bacteria | 1015 |
| 1243 | Ga0500577_0009622 | 3300053142 | Bacteria | 2813 |
| 1244 | Ga0500590_023408 | 3300053148 | Bacteria | 3207 |
| 1245 | Ga0500604_0007671 | 3300053151 | Bacteria | 2859 |
| 1246 | Ga0500619_000006 | 3300053154 | Bacteria | 77270 |
| 1247 | Ga0500622_0000799 | 3300053156 | Bacteria | 27135 |
| 1248 | Ga0500622_0006741 | 3300053156 | Bacteria | 6616 |
| 1249 | Ga0500622_0095912 | 3300053156 | Bacteria | 1466 |
| 1250 | Ga0500622_0097209 | 3300053156 | Bacteria | 1454 |
| 1251 | Ga0500636_0005079 | 3300053177 | Bacteria | 7470 |
| 1252 | Ga0500645_008009 | 3300053730 | Bacteria | 3640 |
| 1253 | Ga0500645_042335 | 3300053730 | Bacteria | 1344 |
| 1254 | Ga0500661_002023 | 3300055283 | Bacteria | 3827 |
| 1255 | Ga0590071_000174 | 3300059421 | Bacteria | 18568 |
| 1256 | Ga0466962_0004166 | 3300061719 | Bacteria | 6929 |
| 1257 | Ga0466962_0046420 | 3300061719 | Bacteria | 2075 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046472 | Ga0495580_0041734 | Ga0495580_0041734_941_1612 | 162 |
| 2 | 3300039450 | Ga0436363_0491953 | Ga0436363_0491953_87_728 | 163 |
| 3 | 3300025942 | Ga0207689_10131531 | Ga0207689_101315312 | 183 |
| 4 | 3300003316 | rootH1_10010629 | rootH1_100106295 | 184 |
| 5 | 3300003322 | rootL2_10004014 | rootL2_100040144 | 184 |
| 6 | 3300005328 | Ga0070676_10010756 | Ga0070676_100107562 | 184 |
| 7 | 3300005334 | Ga0068869_100019197 | Ga0068869_1000191974 | 184 |
| 8 | 3300005338 | Ga0068868_100148702 | Ga0068868_1001487022 | 184 |
| 9 | 3300005338 | Ga0068868_100235186 | Ga0068868_1002351861 | 184 |
| 10 | 3300005355 | Ga0070671_100023124 | Ga0070671_1000231243 | 184 |
| 11 | 3300005364 | Ga0070673_100019027 | Ga0070673_1000190275 | 184 |
| 12 | 3300005367 | Ga0070667_100003174 | Ga0070667_10000317412 | 184 |
| 13 | 3300005367 | Ga0070667_100065662 | Ga0070667_1000656624 | 184 |
| 14 | 3300005459 | Ga0068867_100002881 | Ga0068867_1000028815 | 184 |
| 15 | 3300005467 | Ga0070706_100003166 | Ga0070706_1000031669 | 184 |
| 16 | 3300005468 | Ga0070707_100072018 | Ga0070707_1000720182 | 184 |
| 17 | 3300005471 | Ga0070698_100072233 | Ga0070698_1000722333 | 184 |
| 18 | 3300005539 | Ga0068853_100294740 | Ga0068853_1002947401 | 184 |
| 19 | 3300005548 | Ga0070665_100158040 | Ga0070665_1001580402 | 184 |
| 20 | 3300005840 | Ga0068870_10007498 | Ga0068870_100074985 | 184 |
| 21 | 3300006042 | Ga0075368_10004618 | Ga0075368_100046182 | 184 |
| 22 | 3300006042 | Ga0075368_10060057 | Ga0075368_100600572 | 184 |
| 23 | 3300006048 | Ga0075363_100023918 | Ga0075363_1000239182 | 184 |
| 24 | 3300006051 | Ga0075364_10243101 | Ga0075364_102431012 | 184 |
| 25 | 3300006058 | Ga0075432_10076876 | Ga0075432_100768762 | 184 |
| 26 | 3300006177 | Ga0075362_10016384 | Ga0075362_100163842 | 184 |
| 27 | 3300006178 | Ga0075367_10003951 | Ga0075367_100039516 | 184 |
| 28 | 3300006178 | Ga0075367_10107393 | Ga0075367_101073932 | 184 |
| 29 | 3300006186 | Ga0075369_10013422 | Ga0075369_100134223 | 184 |
| 30 | 3300006186 | Ga0075369_10091722 | Ga0075369_100917222 | 184 |
| 31 | 3300006186 | Ga0075369_10097041 | Ga0075369_100970412 | 184 |
| 32 | 3300006195 | Ga0075366_10149214 | Ga0075366_101492142 | 184 |
| 33 | 3300006195 | Ga0075366_10194922 | Ga0075366_101949222 | 184 |
| 34 | 3300006353 | Ga0075370_10003547 | Ga0075370_100035472 | 184 |
| 35 | 3300006353 | Ga0075370_10003987 | Ga0075370_100039873 | 184 |
| 36 | 3300006353 | Ga0075370_10116873 | Ga0075370_101168732 | 184 |
| 37 | 3300006353 | Ga0075370_10170466 | Ga0075370_101704662 | 184 |
| 38 | 3300006881 | Ga0068865_100357524 | Ga0068865_1003575242 | 184 |
| 39 | 3300006881 | Ga0068865_100360153 | Ga0068865_1003601532 | 184 |
| 40 | 3300009148 | Ga0105243_10308096 | Ga0105243_103080962 | 184 |
| 41 | 3300009545 | Ga0105237_10000293 | Ga0105237_1000029340 | 184 |
| 42 | 3300009545 | Ga0105237_10010430 | Ga0105237_100104306 | 184 |
| 43 | 3300009551 | Ga0105238_10003562 | Ga0105238_100035623 | 184 |
| 44 | 3300010375 | Ga0105239_10002857 | Ga0105239_100028577 | 184 |
| 45 | 3300014325 | Ga0163163_10153059 | Ga0163163_101530593 | 184 |
| 46 | 3300014968 | Ga0157379_10539603 | Ga0157379_105396032 | 184 |
| 47 | 3300025907 | Ga0207645_10003679 | Ga0207645_100036795 | 184 |
| 48 | 3300025907 | Ga0207645_10123856 | Ga0207645_101238562 | 184 |
| 49 | 3300025908 | Ga0207643_10009192 | Ga0207643_100091925 | 184 |
| 50 | 3300025910 | Ga0207684_10002063 | Ga0207684_1000206314 | 184 |
| 51 | 3300025914 | Ga0207671_10002885 | Ga0207671_1000288514 | 184 |
| 52 | 3300025924 | Ga0207694_10242241 | Ga0207694_102422412 | 184 |
| 53 | 3300025927 | Ga0207687_10062753 | Ga0207687_100627533 | 184 |
| 54 | 3300025933 | Ga0207706_10057563 | Ga0207706_100575632 | 184 |
| 55 | 3300025938 | Ga0207704_10313538 | Ga0207704_103135382 | 184 |
| 56 | 3300025940 | Ga0207691_10037603 | Ga0207691_100376033 | 184 |
| 57 | 3300025942 | Ga0207689_10015115 | Ga0207689_100151155 | 184 |
| 58 | 3300025942 | Ga0207689_10151649 | Ga0207689_101516492 | 184 |
| 59 | 3300025960 | Ga0207651_10012328 | Ga0207651_100123285 | 184 |
| 60 | 3300025986 | Ga0207658_10003042 | Ga0207658_1000304210 | 184 |
| 61 | 3300025986 | Ga0207658_10246403 | Ga0207658_102464032 | 184 |
| 62 | 3300025986 | Ga0207658_10624764 | Ga0207658_106247641 | 184 |
| 63 | 3300026023 | Ga0207677_10105233 | Ga0207677_101052333 | 184 |
| 64 | 3300026041 | Ga0207639_10240583 | Ga0207639_102405831 | 184 |
| 65 | 3300026067 | Ga0207678_10048730 | Ga0207678_100487303 | 184 |
| 66 | 3300026089 | Ga0207648_10006969 | Ga0207648_100069697 | 184 |
| 67 | 3300026116 | Ga0207674_10069067 | Ga0207674_100690674 | 184 |
| 68 | 3300026118 | Ga0207675_100284304 | Ga0207675_1002843042 | 184 |
| 69 | 3300026121 | Ga0207683_10405959 | Ga0207683_104059591 | 184 |
| 70 | 3300026121 | Ga0207683_10634584 | Ga0207683_106345841 | 184 |
| 71 | 3300027866 | Ga0209813_10005576 | Ga0209813_100055762 | 184 |
| 72 | 3300027866 | Ga0209813_10181558 | Ga0209813_101815581 | 184 |
| 73 | 3300028379 | Ga0268266_10121172 | Ga0268266_101211722 | 184 |
| 74 | 3300028381 | Ga0268264_10514003 | Ga0268264_105140032 | 184 |
| 75 | 3300028794 | Ga0307515_10250785 | Ga0307515_102507852 | 184 |
| 76 | 3300031456 | Ga0307513_10040500 | Ga0307513_100405006 | 184 |
| 77 | 3300031456 | Ga0307513_10249003 | Ga0307513_102490034 | 184 |
| 78 | 3300031456 | Ga0307513_10253042 | Ga0307513_102530422 | 184 |
| 79 | 3300031616 | Ga0307508_10322762 | Ga0307508_103227621 | 184 |
| 80 | 3300035691 | Ga0373931_0645903 | Ga0373931_0645903_62_646 | 184 |
| 81 | 3300046457 | Ga0495590_0141131 | Ga0495590_0141131_161_715 | 184 |
| 82 | 3300046506 | Ga0495583_0079676 | Ga0495583_0079676_484_1038 | 184 |
| 83 | 3300046518 | Ga0495631_0098292 | Ga0495631_0098292_587_1141 | 184 |
| 84 | 3300046538 | Ga0495609_0167602 | Ga0495609_0167602_223_777 | 184 |
| 85 | 3300046542 | Ga0495597_0017935 | Ga0495597_0017935_16_570 | 184 |
| 86 | 3300046616 | Ga0495668_0294669 | Ga0495668_0294669_73_627 | 184 |
| 87 | 3300046692 | Ga0495671_0097137 | Ga0495671_0097137_435_989 | 184 |
| 88 | 3300046694 | Ga0495649_0029913 | Ga0495649_0029913_1566_2120 | 184 |
| 89 | 3300046810 | Ga0495660_0015408 | Ga0495660_0015408_1728_2282 | 184 |
| 90 | 3300047443 | Ga0495687_000248 | Ga0495687_000248_6833_7387 | 184 |
| 91 | 3300047443 | Ga0495687_018539 | Ga0495687_018539_1036_1590 | 184 |
| 92 | 3300047469 | Ga0495673_0183303 | Ga0495673_0183303_76_630 | 184 |
| 93 | 3300048091 | Ga0495626_0073934 | Ga0495626_0073934_960_1514 | 184 |
| 94 | 3300050489 | nmdc:mga03683_439_c1 | nmdc:mga03683_439_c1_4660_5214 | 184 |
| 95 | 3300050491 | nmdc:mga00v17_297159_c1 | nmdc:mga00v17_297159_c1_185_739 | 184 |
| 96 | 3300050492 | nmdc:mga0yw44_19242_c1 | nmdc:mga0yw44_19242_c1_2179_2733 | 184 |
| 97 | 3300050493 | nmdc:mga0k408_1705_c1 | nmdc:mga0k408_1705_c1_7196_7750 | 184 |
| 98 | 3300050493 | nmdc:mga0k408_19355_c1 | nmdc:mga0k408_19355_c1_566_1120 | 184 |
| 99 | 3300050493 | nmdc:mga0k408_240212_c1 | nmdc:mga0k408_240212_c1_82_636 | 184 |
| 100 | 3300050493 | nmdc:mga0k408_259539_c1 | nmdc:mga0k408_259539_c1_470_1024 | 184 |
| 101 | 3300050493 | nmdc:mga0k408_41032_c1 | nmdc:mga0k408_41032_c1_87_641 | 184 |
| 102 | 3300050493 | nmdc:mga0k408_527_c1 | nmdc:mga0k408_527_c1_4738_5292 | 184 |
| 103 | 3300050493 | nmdc:mga0k408_54354_c1 | nmdc:mga0k408_54354_c1_657_1241 | 184 |
| 104 | 3300050494 | nmdc:mga06z11_11864_c1 | nmdc:mga06z11_11864_c1_1731_2285 | 184 |
| 105 | 3300050494 | nmdc:mga06z11_57689_c1 | nmdc:mga06z11_57689_c1_534_1088 | 184 |
| 106 | 3300050495 | nmdc:mga04h51_317948_c1 | nmdc:mga04h51_317948_c1_57_611 | 184 |
| 107 | 3300050495 | nmdc:mga04h51_7612_c1 | nmdc:mga04h51_7612_c1_1171_1725 | 184 |
| 108 | 3300050496 | nmdc:mga07m45_10360_c1 | nmdc:mga07m45_10360_c1_275_829 | 184 |
| 109 | 3300050496 | nmdc:mga07m45_10939_c1 | nmdc:mga07m45_10939_c1_3194_3748 | 184 |
| 110 | 3300050496 | nmdc:mga07m45_117_c1 | nmdc:mga07m45_117_c1_7010_7564 | 184 |
| 111 | 3300050496 | nmdc:mga07m45_1620_c1 | nmdc:mga07m45_1620_c1_4401_4955 | 184 |
| 112 | 3300050496 | nmdc:mga07m45_207586_c1 | nmdc:mga07m45_207586_c1_223_777 | 184 |
| 113 | 3300050496 | nmdc:mga07m45_4614_c1 | nmdc:mga07m45_4614_c1_5402_5956 | 184 |
| 114 | 3300050516 | nmdc:mga0sz30_17453_c1 | nmdc:mga0sz30_17453_c1_1466_2020 | 184 |
| 115 | 3300050516 | nmdc:mga0sz30_191152_c1 | nmdc:mga0sz30_191152_c1_39_593 | 184 |
| 116 | 3300050516 | nmdc:mga0sz30_69443_c1 | nmdc:mga0sz30_69443_c1_21_575 | 184 |
| 117 | 3300053086 | Ga0500578_0174805 | Ga0500578_0174805_185_739 | 184 |
| 118 | 3300053134 | Ga0500658_0044915 | Ga0500658_0044915_173_727 | 184 |
| 119 | 3300001979 | JGI24740J21852_10004029 | JGI24740J21852_100040292 | 185 |
| 120 | 3300002077 | JGI24744J21845_10010959 | JGI24744J21845_100109592 | 185 |
| 121 | 3300002705 | JGI25156J39149_1001303 | JGI25156J39149_100130311 | 185 |
| 122 | 3300002705 | JGI25156J39149_1012545 | JGI25156J39149_10125452 | 185 |
| 123 | 3300002738 | JGI25154J39366_1000343 | JGI25154J39366_100034324 | 185 |
| 124 | 3300002741 | JGI25157J39369_1000304 | JGI25157J39369_100030425 | 185 |
| 125 | 3300002773 | JGI25152J39213_1000710 | JGI25152J39213_100071011 | 185 |
| 126 | 3300002774 | JGI25150J39212_1017649 | JGI25150J39212_10176492 | 185 |
| 127 | 3300003215 | JGI25153J46596_10004579 | JGI25153J46596_100045793 | 185 |
| 128 | 3300003215 | JGI25153J46596_10006328 | JGI25153J46596_100063282 | 185 |
| 129 | 3300003316 | rootH1_10000527 | rootH1_100005276 | 185 |
| 130 | 3300003320 | rootH2_10057083 | rootH2_100570839 | 185 |
| 131 | 3300003322 | rootL2_10003309 | rootL2_100033096 | 185 |
| 132 | 3300003322 | rootL2_10056084 | rootL2_100560842 | 185 |
| 133 | 3300003323 | rootH1_10000048 | rootH1_100000483 | 185 |
| 134 | 3300003323 | rootH1_10020306 | rootH1_100203069 | 185 |
| 135 | 3300003323 | rootH1_10021990 | rootH1_100219905 | 185 |
| 136 | 3300003347 | JGI26128J50194_1004871 | JGI26128J50194_10048711 | 185 |
| 137 | 3300003752 | Ga0055539_1002131 | Ga0055539_10021313 | 185 |
| 138 | 3300003752 | Ga0055539_1002241 | Ga0055539_10022413 | 185 |
| 139 | 3300003756 | Ga0055533_1000016 | Ga0055533_1000016259 | 185 |
| 140 | 3300003759 | Ga0055525_1000031 | Ga0055525_1000031105 | 185 |
| 141 | 3300003759 | Ga0055525_1000802 | Ga0055525_10008027 | 185 |
| 142 | 3300003763 | Ga0055529_1000963 | Ga0055529_10009638 | 185 |
| 143 | 3300003775 | Ga0055524_1000052 | Ga0055524_100005221 | 185 |
| 144 | 3300003775 | Ga0055524_1017112 | Ga0055524_10171123 | 185 |
| 145 | 3300003790 | Ga0055528_1051731 | Ga0055528_10517311 | 185 |
| 146 | 3300003791 | Ga0055530_10004973 | Ga0055530_100049735 | 185 |
| 147 | 3300003791 | Ga0055530_10008463 | Ga0055530_100084633 | 185 |
| 148 | 3300003792 | Ga0055540_1000123 | Ga0055540_100012319 | 185 |
| 149 | 3300003792 | Ga0055540_1011833 | Ga0055540_10118332 | 185 |
| 150 | 3300003794 | Ga0055531_10000001 | Ga0055531_1000000148 | 185 |
| 151 | 3300003794 | Ga0055531_10011952 | Ga0055531_100119524 | 185 |
| 152 | 3300005262 | Ga0065165_1000836 | Ga0065165_100083614 | 185 |
| 153 | 3300005262 | Ga0065165_1003047 | Ga0065165_10030475 | 185 |
| 154 | 3300005295 | Ga0065707_10084569 | Ga0065707_100845692 | 185 |
| 155 | 3300005327 | Ga0070658_10216772 | Ga0070658_102167722 | 185 |
| 156 | 3300005327 | Ga0070658_10247639 | Ga0070658_102476392 | 185 |
| 157 | 3300005327 | Ga0070658_10775629 | Ga0070658_107756291 | 185 |
| 158 | 3300005328 | Ga0070676_10008317 | Ga0070676_100083171 | 185 |
| 159 | 3300005328 | Ga0070676_10081103 | Ga0070676_100811032 | 185 |
| 160 | 3300005329 | Ga0070683_100231589 | Ga0070683_1002315893 | 185 |
| 161 | 3300005329 | Ga0070683_100802241 | Ga0070683_1008022411 | 185 |
| 162 | 3300005330 | Ga0070690_100017502 | Ga0070690_1000175024 | 185 |
| 163 | 3300005330 | Ga0070690_100019706 | Ga0070690_1000197063 | 185 |
| 164 | 3300005330 | Ga0070690_100484460 | Ga0070690_1004844601 | 185 |
| 165 | 3300005331 | Ga0070670_100009305 | Ga0070670_1000093055 | 185 |
| 166 | 3300005331 | Ga0070670_100009633 | Ga0070670_1000096336 | 185 |
| 167 | 3300005331 | Ga0070670_100081596 | Ga0070670_1000815962 | 185 |
| 168 | 3300005331 | Ga0070670_100290394 | Ga0070670_1002903942 | 185 |
| 169 | 3300005331 | Ga0070670_100728717 | Ga0070670_1007287171 | 185 |
| 170 | 3300005333 | Ga0070677_10007611 | Ga0070677_100076114 | 185 |
| 171 | 3300005333 | Ga0070677_10019703 | Ga0070677_100197032 | 185 |
| 172 | 3300005333 | Ga0070677_10045673 | Ga0070677_100456733 | 185 |
| 173 | 3300005333 | Ga0070677_10057710 | Ga0070677_100577102 | 185 |
| 174 | 3300005333 | Ga0070677_10061857 | Ga0070677_100618572 | 185 |
| 175 | 3300005333 | Ga0070677_10112427 | Ga0070677_101124272 | 185 |
| 176 | 3300005334 | Ga0068869_100007348 | Ga0068869_1000073486 | 185 |
| 177 | 3300005334 | Ga0068869_100029467 | Ga0068869_1000294672 | 185 |
| 178 | 3300005335 | Ga0070666_10024212 | Ga0070666_100242123 | 185 |
| 179 | 3300005335 | Ga0070666_10259975 | Ga0070666_102599752 | 185 |
| 180 | 3300005336 | Ga0070680_100047155 | Ga0070680_1000471554 | 185 |
| 181 | 3300005338 | Ga0068868_100007149 | Ga0068868_1000071497 | 185 |
| 182 | 3300005338 | Ga0068868_100008040 | Ga0068868_1000080404 | 185 |
| 183 | 3300005338 | Ga0068868_100078021 | Ga0068868_1000780212 | 185 |
| 184 | 3300005338 | Ga0068868_100095120 | Ga0068868_1000951202 | 185 |
| 185 | 3300005338 | Ga0068868_100359980 | Ga0068868_1003599802 | 185 |
| 186 | 3300005338 | Ga0068868_100411011 | Ga0068868_1004110112 | 185 |
| 187 | 3300005339 | Ga0070660_100165433 | Ga0070660_1001654333 | 185 |
| 188 | 3300005339 | Ga0070660_100193201 | Ga0070660_1001932011 | 185 |
| 189 | 3300005340 | Ga0070689_100037388 | Ga0070689_1000373884 | 185 |
| 190 | 3300005340 | Ga0070689_100199233 | Ga0070689_1001992333 | 185 |
| 191 | 3300005343 | Ga0070687_100086448 | Ga0070687_1000864481 | 185 |
| 192 | 3300005344 | Ga0070661_100005819 | Ga0070661_1000058195 | 185 |
| 193 | 3300005344 | Ga0070661_100089480 | Ga0070661_1000894803 | 185 |
| 194 | 3300005344 | Ga0070661_100288126 | Ga0070661_1002881262 | 185 |
| 195 | 3300005344 | Ga0070661_100300894 | Ga0070661_1003008942 | 185 |
| 196 | 3300005347 | Ga0070668_100007635 | Ga0070668_10000763510 | 185 |
| 197 | 3300005347 | Ga0070668_100068725 | Ga0070668_1000687252 | 185 |
| 198 | 3300005347 | Ga0070668_100090366 | Ga0070668_1000903662 | 185 |
| 199 | 3300005347 | Ga0070668_100364257 | Ga0070668_1003642572 | 185 |
| 200 | 3300005353 | Ga0070669_100012068 | Ga0070669_1000120686 | 185 |
| 201 | 3300005353 | Ga0070669_100031165 | Ga0070669_1000311652 | 185 |
| 202 | 3300005353 | Ga0070669_100038839 | Ga0070669_1000388391 | 185 |
| 203 | 3300005353 | Ga0070669_100152211 | Ga0070669_1001522112 | 185 |
| 204 | 3300005353 | Ga0070669_100287569 | Ga0070669_1002875692 | 185 |
| 205 | 3300005354 | Ga0070675_100002907 | Ga0070675_1000029077 | 185 |
| 206 | 3300005354 | Ga0070675_100009944 | Ga0070675_1000099444 | 185 |
| 207 | 3300005354 | Ga0070675_100054029 | Ga0070675_1000540293 | 185 |
| 208 | 3300005354 | Ga0070675_100077116 | Ga0070675_1000771163 | 185 |
| 209 | 3300005354 | Ga0070675_100135095 | Ga0070675_1001350953 | 185 |
| 210 | 3300005354 | Ga0070675_100213751 | Ga0070675_1002137511 | 185 |
| 211 | 3300005354 | Ga0070675_100913163 | Ga0070675_1009131631 | 185 |
| 212 | 3300005355 | Ga0070671_100004848 | Ga0070671_1000048486 | 185 |
| 213 | 3300005355 | Ga0070671_100009961 | Ga0070671_1000099612 | 185 |
| 214 | 3300005355 | Ga0070671_100016969 | Ga0070671_1000169694 | 185 |
| 215 | 3300005355 | Ga0070671_100048071 | Ga0070671_1000480714 | 185 |
| 216 | 3300005355 | Ga0070671_100064228 | Ga0070671_1000642283 | 185 |
| 217 | 3300005355 | Ga0070671_100236517 | Ga0070671_1002365172 | 185 |
| 218 | 3300005355 | Ga0070671_100490293 | Ga0070671_1004902932 | 185 |
| 219 | 3300005356 | Ga0070674_100013025 | Ga0070674_1000130253 | 185 |
| 220 | 3300005356 | Ga0070674_100017473 | Ga0070674_1000174733 | 185 |
| 221 | 3300005356 | Ga0070674_100035720 | Ga0070674_1000357203 | 185 |
| 222 | 3300005356 | Ga0070674_100123792 | Ga0070674_1001237921 | 185 |
| 223 | 3300005356 | Ga0070674_100266210 | Ga0070674_1002662102 | 185 |
| 224 | 3300005356 | Ga0070674_100372436 | Ga0070674_1003724362 | 185 |
| 225 | 3300005356 | Ga0070674_100599488 | Ga0070674_1005994881 | 185 |
| 226 | 3300005364 | Ga0070673_100049839 | Ga0070673_1000498392 | 185 |
| 227 | 3300005364 | Ga0070673_100058470 | Ga0070673_1000584702 | 185 |
| 228 | 3300005364 | Ga0070673_100100373 | Ga0070673_1001003733 | 185 |
| 229 | 3300005364 | Ga0070673_100175085 | Ga0070673_1001750852 | 185 |
| 230 | 3300005364 | Ga0070673_100235304 | Ga0070673_1002353042 | 185 |
| 231 | 3300005364 | Ga0070673_100304247 | Ga0070673_1003042472 | 185 |
| 232 | 3300005364 | Ga0070673_100391149 | Ga0070673_1003911491 | 185 |
| 233 | 3300005365 | Ga0070688_100391523 | Ga0070688_1003915232 | 185 |
| 234 | 3300005366 | Ga0070659_100123684 | Ga0070659_1001236843 | 185 |
| 235 | 3300005366 | Ga0070659_100391202 | Ga0070659_1003912022 | 185 |
| 236 | 3300005367 | Ga0070667_100004063 | Ga0070667_1000040633 | 185 |
| 237 | 3300005367 | Ga0070667_100008844 | Ga0070667_1000088445 | 185 |
| 238 | 3300005367 | Ga0070667_100645831 | Ga0070667_1006458311 | 185 |
| 239 | 3300005441 | Ga0070700_100091680 | Ga0070700_1000916802 | 185 |
| 240 | 3300005441 | Ga0070700_100314714 | Ga0070700_1003147142 | 185 |
| 241 | 3300005445 | Ga0070708_100063311 | Ga0070708_1000633116 | 185 |
| 242 | 3300005455 | Ga0070663_100018301 | Ga0070663_1000183014 | 185 |
| 243 | 3300005455 | Ga0070663_100371537 | Ga0070663_1003715372 | 185 |
| 244 | 3300005456 | Ga0070678_100022312 | Ga0070678_1000223122 | 185 |
| 245 | 3300005456 | Ga0070678_100073203 | Ga0070678_1000732033 | 185 |
| 246 | 3300005456 | Ga0070678_100083403 | Ga0070678_1000834032 | 185 |
| 247 | 3300005456 | Ga0070678_100108578 | Ga0070678_1001085783 | 185 |
| 248 | 3300005456 | Ga0070678_100109497 | Ga0070678_1001094972 | 185 |
| 249 | 3300005456 | Ga0070678_100144742 | Ga0070678_1001447422 | 185 |
| 250 | 3300005456 | Ga0070678_100192744 | Ga0070678_1001927441 | 185 |
| 251 | 3300005456 | Ga0070678_100295525 | Ga0070678_1002955252 | 185 |
| 252 | 3300005457 | Ga0070662_100021790 | Ga0070662_1000217904 | 185 |
| 253 | 3300005457 | Ga0070662_100036702 | Ga0070662_1000367022 | 185 |
| 254 | 3300005457 | Ga0070662_100039945 | Ga0070662_1000399454 | 185 |
| 255 | 3300005457 | Ga0070662_100105156 | Ga0070662_1001051562 | 185 |
| 256 | 3300005457 | Ga0070662_100151308 | Ga0070662_1001513081 | 185 |
| 257 | 3300005458 | Ga0070681_10176795 | Ga0070681_101767953 | 185 |
| 258 | 3300005458 | Ga0070681_10237670 | Ga0070681_102376702 | 185 |
| 259 | 3300005459 | Ga0068867_100000042 | Ga0068867_10000004232 | 185 |
| 260 | 3300005459 | Ga0068867_100005007 | Ga0068867_1000050076 | 185 |
| 261 | 3300005459 | Ga0068867_100010032 | Ga0068867_1000100323 | 185 |
| 262 | 3300005459 | Ga0068867_100027327 | Ga0068867_1000273273 | 185 |
| 263 | 3300005459 | Ga0068867_100045630 | Ga0068867_1000456303 | 185 |
| 264 | 3300005459 | Ga0068867_100078153 | Ga0068867_1000781532 | 185 |
| 265 | 3300005459 | Ga0068867_100080494 | Ga0068867_1000804943 | 185 |
| 266 | 3300005459 | Ga0068867_100171787 | Ga0068867_1001717873 | 185 |
| 267 | 3300005459 | Ga0068867_100290688 | Ga0068867_1002906882 | 185 |
| 268 | 3300005466 | Ga0070685_10191322 | Ga0070685_101913222 | 185 |
| 269 | 3300005468 | Ga0070707_100512976 | Ga0070707_1005129762 | 185 |
| 270 | 3300005530 | Ga0070679_100024208 | Ga0070679_1000242082 | 185 |
| 271 | 3300005535 | Ga0070684_100556718 | Ga0070684_1005567181 | 185 |
| 272 | 3300005539 | Ga0068853_100008284 | Ga0068853_1000082847 | 185 |
| 273 | 3300005539 | Ga0068853_100144732 | Ga0068853_1001447322 | 185 |
| 274 | 3300005539 | Ga0068853_100278576 | Ga0068853_1002785762 | 185 |
| 275 | 3300005539 | Ga0068853_100405931 | Ga0068853_1004059312 | 185 |
| 276 | 3300005539 | Ga0068853_100407871 | Ga0068853_1004078712 | 185 |
| 277 | 3300005539 | Ga0068853_100429041 | Ga0068853_1004290412 | 185 |
| 278 | 3300005543 | Ga0070672_100000214 | Ga0070672_1000002146 | 185 |
| 279 | 3300005543 | Ga0070672_100003206 | Ga0070672_1000032066 | 185 |
| 280 | 3300005543 | Ga0070672_100012364 | Ga0070672_1000123646 | 185 |
| 281 | 3300005543 | Ga0070672_100111789 | Ga0070672_1001117892 | 185 |
| 282 | 3300005543 | Ga0070672_100132610 | Ga0070672_1001326102 | 185 |
| 283 | 3300005543 | Ga0070672_100137980 | Ga0070672_1001379802 | 185 |
| 284 | 3300005543 | Ga0070672_100286236 | Ga0070672_1002862362 | 185 |
| 285 | 3300005543 | Ga0070672_100378726 | Ga0070672_1003787262 | 185 |
| 286 | 3300005547 | Ga0070693_100446755 | Ga0070693_1004467551 | 185 |
| 287 | 3300005548 | Ga0070665_100005964 | Ga0070665_1000059648 | 185 |
| 288 | 3300005548 | Ga0070665_100208289 | Ga0070665_1002082892 | 185 |
| 289 | 3300005548 | Ga0070665_100326872 | Ga0070665_1003268722 | 185 |
| 290 | 3300005563 | Ga0068855_100099856 | Ga0068855_1000998563 | 185 |
| 291 | 3300005563 | Ga0068855_100203891 | Ga0068855_1002038912 | 185 |
| 292 | 3300005564 | Ga0070664_100010180 | Ga0070664_1000101805 | 185 |
| 293 | 3300005564 | Ga0070664_100038998 | Ga0070664_1000389984 | 185 |
| 294 | 3300005564 | Ga0070664_100051636 | Ga0070664_1000516362 | 185 |
| 295 | 3300005564 | Ga0070664_100081876 | Ga0070664_1000818763 | 185 |
| 296 | 3300005564 | Ga0070664_100195387 | Ga0070664_1001953873 | 185 |
| 297 | 3300005577 | Ga0068857_100001367 | Ga0068857_10000136720 | 185 |
| 298 | 3300005577 | Ga0068857_100045914 | Ga0068857_1000459142 | 185 |
| 299 | 3300005577 | Ga0068857_100469934 | Ga0068857_1004699342 | 185 |
| 300 | 3300005578 | Ga0068854_100008084 | Ga0068854_1000080842 | 185 |
| 301 | 3300005578 | Ga0068854_100093052 | Ga0068854_1000930522 | 185 |
| 302 | 3300005578 | Ga0068854_100231763 | Ga0068854_1002317632 | 185 |
| 303 | 3300005614 | Ga0068856_100019461 | Ga0068856_1000194615 | 185 |
| 304 | 3300005614 | Ga0068856_100190462 | Ga0068856_1001904622 | 185 |
| 305 | 3300005614 | Ga0068856_100367005 | Ga0068856_1003670052 | 185 |
| 306 | 3300005615 | Ga0070702_100104818 | Ga0070702_1001048182 | 185 |
| 307 | 3300005616 | Ga0068852_100008019 | Ga0068852_1000080197 | 185 |
| 308 | 3300005616 | Ga0068852_100011640 | Ga0068852_1000116406 | 185 |
| 309 | 3300005616 | Ga0068852_100048307 | Ga0068852_1000483072 | 185 |
| 310 | 3300005616 | Ga0068852_100073257 | Ga0068852_1000732573 | 185 |
| 311 | 3300005616 | Ga0068852_100177745 | Ga0068852_1001777452 | 185 |
| 312 | 3300005616 | Ga0068852_100187534 | Ga0068852_1001875342 | 185 |
| 313 | 3300005616 | Ga0068852_100279862 | Ga0068852_1002798622 | 185 |
| 314 | 3300005616 | Ga0068852_100437440 | Ga0068852_1004374402 | 185 |
| 315 | 3300005616 | Ga0068852_100581796 | Ga0068852_1005817962 | 185 |
| 316 | 3300005617 | Ga0068859_100003371 | Ga0068859_10000337113 | 185 |
| 317 | 3300005617 | Ga0068859_100035640 | Ga0068859_1000356403 | 185 |
| 318 | 3300005617 | Ga0068859_100233270 | Ga0068859_1002332702 | 185 |
| 319 | 3300005617 | Ga0068859_100384114 | Ga0068859_1003841143 | 185 |
| 320 | 3300005618 | Ga0068864_100001559 | Ga0068864_10000155916 | 185 |
| 321 | 3300005618 | Ga0068864_100012414 | Ga0068864_1000124146 | 185 |
| 322 | 3300005618 | Ga0068864_100031702 | Ga0068864_1000317022 | 185 |
| 323 | 3300005618 | Ga0068864_100037258 | Ga0068864_1000372584 | 185 |
| 324 | 3300005618 | Ga0068864_100049747 | Ga0068864_1000497472 | 185 |
| 325 | 3300005618 | Ga0068864_100097230 | Ga0068864_1000972302 | 185 |
| 326 | 3300005618 | Ga0068864_100137810 | Ga0068864_1001378101 | 185 |
| 327 | 3300005618 | Ga0068864_100155641 | Ga0068864_1001556412 | 185 |
| 328 | 3300005618 | Ga0068864_100521484 | Ga0068864_1005214842 | 185 |
| 329 | 3300005618 | Ga0068864_100562440 | Ga0068864_1005624402 | 185 |
| 330 | 3300005718 | Ga0068866_10002006 | Ga0068866_100020068 | 185 |
| 331 | 3300005718 | Ga0068866_10017749 | Ga0068866_100177492 | 185 |
| 332 | 3300005718 | Ga0068866_10072147 | Ga0068866_100721472 | 185 |
| 333 | 3300005719 | Ga0068861_100000532 | Ga0068861_10000053213 | 185 |
| 334 | 3300005719 | Ga0068861_100013654 | Ga0068861_1000136545 | 185 |
| 335 | 3300005719 | Ga0068861_100084254 | Ga0068861_1000842543 | 185 |
| 336 | 3300005719 | Ga0068861_100261087 | Ga0068861_1002610872 | 185 |
| 337 | 3300005719 | Ga0068861_101255109 | Ga0068861_1012551091 | 185 |
| 338 | 3300005834 | Ga0068851_10020913 | Ga0068851_100209133 | 185 |
| 339 | 3300005834 | Ga0068851_10067896 | Ga0068851_100678961 | 185 |
| 340 | 3300005834 | Ga0068851_10159697 | Ga0068851_101596972 | 185 |
| 341 | 3300005834 | Ga0068851_10381614 | Ga0068851_103816141 | 185 |
| 342 | 3300005840 | Ga0068870_10061290 | Ga0068870_100612901 | 185 |
| 343 | 3300005840 | Ga0068870_10602287 | Ga0068870_106022871 | 185 |
| 344 | 3300005840 | Ga0068870_10625302 | Ga0068870_106253021 | 185 |
| 345 | 3300005841 | Ga0068863_100004398 | Ga0068863_1000043982 | 185 |
| 346 | 3300005841 | Ga0068863_100021795 | Ga0068863_1000217954 | 185 |
| 347 | 3300005841 | Ga0068863_100154370 | Ga0068863_1001543702 | 185 |
| 348 | 3300005841 | Ga0068863_100170460 | Ga0068863_1001704602 | 185 |
| 349 | 3300005841 | Ga0068863_100234480 | Ga0068863_1002344802 | 185 |
| 350 | 3300005842 | Ga0068858_100002862 | Ga0068858_10000286210 | 185 |
| 351 | 3300005842 | Ga0068858_100005186 | Ga0068858_10000518610 | 185 |
| 352 | 3300005842 | Ga0068858_100134191 | Ga0068858_1001341912 | 185 |
| 353 | 3300005842 | Ga0068858_100365770 | Ga0068858_1003657702 | 185 |
| 354 | 3300005842 | Ga0068858_100750717 | Ga0068858_1007507171 | 185 |
| 355 | 3300005843 | Ga0068860_100007631 | Ga0068860_10000763110 | 185 |
| 356 | 3300005843 | Ga0068860_100027719 | Ga0068860_1000277194 | 185 |
| 357 | 3300005843 | Ga0068860_100050579 | Ga0068860_1000505792 | 185 |
| 358 | 3300005843 | Ga0068860_100478826 | Ga0068860_1004788262 | 185 |
| 359 | 3300005843 | Ga0068860_100702461 | Ga0068860_1007024612 | 185 |
| 360 | 3300005844 | Ga0068862_100011630 | Ga0068862_1000116305 | 185 |
| 361 | 3300005844 | Ga0068862_100021891 | Ga0068862_1000218916 | 185 |
| 362 | 3300005844 | Ga0068862_100044354 | Ga0068862_1000443543 | 185 |
| 363 | 3300005844 | Ga0068862_100299030 | Ga0068862_1002990302 | 185 |
| 364 | 3300005844 | Ga0068862_100902779 | Ga0068862_1009027792 | 185 |
| 365 | 3300006042 | Ga0075368_10044832 | Ga0075368_100448322 | 185 |
| 366 | 3300006048 | Ga0075363_100128897 | Ga0075363_1001288972 | 185 |
| 367 | 3300006163 | Ga0070715_10175733 | Ga0070715_101757331 | 185 |
| 368 | 3300006177 | Ga0075362_10051026 | Ga0075362_100510261 | 185 |
| 369 | 3300006177 | Ga0075362_10061016 | Ga0075362_100610162 | 185 |
| 370 | 3300006178 | Ga0075367_10055501 | Ga0075367_100555012 | 185 |
| 371 | 3300006195 | Ga0075366_10001365 | Ga0075366_100013658 | 185 |
| 372 | 3300006195 | Ga0075366_10001515 | Ga0075366_100015156 | 185 |
| 373 | 3300006195 | Ga0075366_10002469 | Ga0075366_1000246912 | 185 |
| 374 | 3300006195 | Ga0075366_10044579 | Ga0075366_100445793 | 185 |
| 375 | 3300006195 | Ga0075366_10056238 | Ga0075366_100562383 | 185 |
| 376 | 3300006195 | Ga0075366_10074701 | Ga0075366_100747012 | 185 |
| 377 | 3300006195 | Ga0075366_10083894 | Ga0075366_100838943 | 185 |
| 378 | 3300006195 | Ga0075366_10111437 | Ga0075366_101114372 | 185 |
| 379 | 3300006195 | Ga0075366_10133817 | Ga0075366_101338172 | 185 |
| 380 | 3300006195 | Ga0075366_10187262 | Ga0075366_101872622 | 185 |
| 381 | 3300006195 | Ga0075366_10222552 | Ga0075366_102225522 | 185 |
| 382 | 3300006195 | Ga0075366_10317254 | Ga0075366_103172541 | 185 |
| 383 | 3300006195 | Ga0075366_10327403 | Ga0075366_103274032 | 185 |
| 384 | 3300006237 | Ga0097621_100014007 | Ga0097621_1000140074 | 185 |
| 385 | 3300006237 | Ga0097621_100044502 | Ga0097621_1000445025 | 185 |
| 386 | 3300006237 | Ga0097621_100321429 | Ga0097621_1003214292 | 185 |
| 387 | 3300006237 | Ga0097621_100352274 | Ga0097621_1003522741 | 185 |
| 388 | 3300006353 | Ga0075370_10005826 | Ga0075370_100058266 | 185 |
| 389 | 3300006353 | Ga0075370_10281879 | Ga0075370_102818791 | 185 |
| 390 | 3300006358 | Ga0068871_100023551 | Ga0068871_1000235512 | 185 |
| 391 | 3300006358 | Ga0068871_100028476 | Ga0068871_1000284764 | 185 |
| 392 | 3300006358 | Ga0068871_100053309 | Ga0068871_1000533092 | 185 |
| 393 | 3300006358 | Ga0068871_100149108 | Ga0068871_1001491084 | 185 |
| 394 | 3300006358 | Ga0068871_100444250 | Ga0068871_1004442501 | 185 |
| 395 | 3300006846 | Ga0075430_100065902 | Ga0075430_1000659023 | 185 |
| 396 | 3300006852 | Ga0075433_10575585 | Ga0075433_105755852 | 185 |
| 397 | 3300006880 | Ga0075429_100229141 | Ga0075429_1002291412 | 185 |
| 398 | 3300006880 | Ga0075429_100949764 | Ga0075429_1009497641 | 185 |
| 399 | 3300006881 | Ga0068865_100017684 | Ga0068865_1000176842 | 185 |
| 400 | 3300006881 | Ga0068865_100023045 | Ga0068865_1000230454 | 185 |
| 401 | 3300006881 | Ga0068865_100074788 | Ga0068865_1000747884 | 185 |
| 402 | 3300006881 | Ga0068865_100188060 | Ga0068865_1001880602 | 185 |
| 403 | 3300006881 | Ga0068865_100407493 | Ga0068865_1004074932 | 185 |
| 404 | 3300006881 | Ga0068865_100766538 | Ga0068865_1007665382 | 185 |
| 405 | 3300006931 | Ga0097620_100003371 | Ga0097620_10000337113 | 185 |
| 406 | 3300006931 | Ga0097620_100035640 | Ga0097620_1000356404 | 185 |
| 407 | 3300006931 | Ga0097620_100233247 | Ga0097620_1002332472 | 185 |
| 408 | 3300006931 | Ga0097620_100384094 | Ga0097620_1003840943 | 185 |
| 409 | 3300006942 | Ga0099824_1044356 | Ga0099824_10443561 | 185 |
| 410 | 3300006944 | Ga0099823_1000478 | Ga0099823_100047822 | 185 |
| 411 | 3300006946 | Ga0079104_1000073 | Ga0079104_1000073119 | 185 |
| 412 | 3300009093 | Ga0105240_10238988 | Ga0105240_102389883 | 185 |
| 413 | 3300009093 | Ga0105240_10316716 | Ga0105240_103167162 | 185 |
| 414 | 3300009093 | Ga0105240_10406912 | Ga0105240_104069121 | 185 |
| 415 | 3300009094 | Ga0111539_11204405 | Ga0111539_112044052 | 185 |
| 416 | 3300009094 | Ga0111539_11424277 | Ga0111539_114242771 | 185 |
| 417 | 3300009098 | Ga0105245_10040028 | Ga0105245_100400284 | 185 |
| 418 | 3300009098 | Ga0105245_10057446 | Ga0105245_100574463 | 185 |
| 419 | 3300009098 | Ga0105245_10080074 | Ga0105245_100800743 | 185 |
| 420 | 3300009101 | Ga0105247_10152680 | Ga0105247_101526802 | 185 |
| 421 | 3300009147 | Ga0114129_10221541 | Ga0114129_102215415 | 185 |
| 422 | 3300009147 | Ga0114129_10816605 | Ga0114129_108166051 | 185 |
| 423 | 3300009148 | Ga0105243_10000525 | Ga0105243_100005257 | 185 |
| 424 | 3300009148 | Ga0105243_10016853 | Ga0105243_100168534 | 185 |
| 425 | 3300009148 | Ga0105243_10103056 | Ga0105243_101030561 | 185 |
| 426 | 3300009148 | Ga0105243_10108081 | Ga0105243_101080815 | 185 |
| 427 | 3300009148 | Ga0105243_10233869 | Ga0105243_102338692 | 185 |
| 428 | 3300009148 | Ga0105243_10583100 | Ga0105243_105831002 | 185 |
| 429 | 3300009174 | Ga0105241_10177180 | Ga0105241_101771802 | 185 |
| 430 | 3300009174 | Ga0105241_10265770 | Ga0105241_102657702 | 185 |
| 431 | 3300009174 | Ga0105241_10271203 | Ga0105241_102712032 | 185 |
| 432 | 3300009174 | Ga0105241_11281576 | Ga0105241_112815762 | 185 |
| 433 | 3300009176 | Ga0105242_10201510 | Ga0105242_102015102 | 185 |
| 434 | 3300009176 | Ga0105242_10227154 | Ga0105242_102271542 | 185 |
| 435 | 3300009176 | Ga0105242_10402634 | Ga0105242_104026342 | 185 |
| 436 | 3300009176 | Ga0105242_10954026 | Ga0105242_109540261 | 185 |
| 437 | 3300009177 | Ga0105248_10004278 | Ga0105248_100042782 | 185 |
| 438 | 3300009177 | Ga0105248_10020342 | Ga0105248_100203424 | 185 |
| 439 | 3300009177 | Ga0105248_10034541 | Ga0105248_100345414 | 185 |
| 440 | 3300009177 | Ga0105248_10096649 | Ga0105248_100966494 | 185 |
| 441 | 3300009177 | Ga0105248_10472538 | Ga0105248_104725382 | 185 |
| 442 | 3300009177 | Ga0105248_10687688 | Ga0105248_106876881 | 185 |
| 443 | 3300009545 | Ga0105237_10124824 | Ga0105237_101248243 | 185 |
| 444 | 3300009545 | Ga0105237_10339544 | Ga0105237_103395441 | 185 |
| 445 | 3300009551 | Ga0105238_10068232 | Ga0105238_100682324 | 185 |
| 446 | 3300009551 | Ga0105238_10094092 | Ga0105238_100940924 | 185 |
| 447 | 3300009553 | Ga0105249_10001432 | Ga0105249_100014327 | 185 |
| 448 | 3300009553 | Ga0105249_10012730 | Ga0105249_100127305 | 185 |
| 449 | 3300009553 | Ga0105249_10020599 | Ga0105249_100205994 | 185 |
| 450 | 3300009553 | Ga0105249_10720438 | Ga0105249_107204381 | 185 |
| 451 | 3300010375 | Ga0105239_10075916 | Ga0105239_100759161 | 185 |
| 452 | 3300010375 | Ga0105239_10092418 | Ga0105239_100924184 | 185 |
| 453 | 3300011119 | Ga0105246_10509203 | Ga0105246_105092032 | 185 |
| 454 | 3300012512 | Ga0157327_1002776 | Ga0157327_10027761 | 185 |
| 455 | 3300012513 | Ga0157326_1035709 | Ga0157326_10357091 | 185 |
| 456 | 3300013102 | Ga0157371_10075565 | Ga0157371_100755654 | 185 |
| 457 | 3300013102 | Ga0157371_10107401 | Ga0157371_101074012 | 185 |
| 458 | 3300013102 | Ga0157371_10235021 | Ga0157371_102350211 | 185 |
| 459 | 3300013102 | Ga0157371_10277075 | Ga0157371_102770752 | 185 |
| 460 | 3300013105 | Ga0157369_10097256 | Ga0157369_100972562 | 185 |
| 461 | 3300013105 | Ga0157369_10097287 | Ga0157369_100972873 | 185 |
| 462 | 3300013296 | Ga0157374_10012660 | Ga0157374_100126606 | 185 |
| 463 | 3300013296 | Ga0157374_10023686 | Ga0157374_100236864 | 185 |
| 464 | 3300013296 | Ga0157374_10023909 | Ga0157374_100239093 | 185 |
| 465 | 3300013296 | Ga0157374_10139538 | Ga0157374_101395383 | 185 |
| 466 | 3300013296 | Ga0157374_10802172 | Ga0157374_108021721 | 185 |
| 467 | 3300013296 | Ga0157374_10989530 | Ga0157374_109895301 | 185 |
| 468 | 3300013297 | Ga0157378_10002431 | Ga0157378_100024315 | 185 |
| 469 | 3300013297 | Ga0157378_10058929 | Ga0157378_100589292 | 185 |
| 470 | 3300013297 | Ga0157378_10071947 | Ga0157378_100719473 | 185 |
| 471 | 3300013297 | Ga0157378_10102354 | Ga0157378_101023543 | 185 |
| 472 | 3300013297 | Ga0157378_10225438 | Ga0157378_102254383 | 185 |
| 473 | 3300013297 | Ga0157378_10352336 | Ga0157378_103523361 | 185 |
| 474 | 3300013297 | Ga0157378_10554131 | Ga0157378_105541312 | 185 |
| 475 | 3300013306 | Ga0163162_10001627 | Ga0163162_1000162711 | 185 |
| 476 | 3300013306 | Ga0163162_10019603 | Ga0163162_100196033 | 185 |
| 477 | 3300013306 | Ga0163162_10244234 | Ga0163162_102442343 | 185 |
| 478 | 3300013307 | Ga0157372_10030878 | Ga0157372_100308785 | 185 |
| 479 | 3300013307 | Ga0157372_10201706 | Ga0157372_102017063 | 185 |
| 480 | 3300013307 | Ga0157372_10321478 | Ga0157372_103214782 | 185 |
| 481 | 3300013308 | Ga0157375_10008159 | Ga0157375_100081592 | 185 |
| 482 | 3300013308 | Ga0157375_10016322 | Ga0157375_100163224 | 185 |
| 483 | 3300013308 | Ga0157375_10056678 | Ga0157375_100566784 | 185 |
| 484 | 3300013308 | Ga0157375_10063864 | Ga0157375_100638643 | 185 |
| 485 | 3300013308 | Ga0157375_10066431 | Ga0157375_100664313 | 185 |
| 486 | 3300013308 | Ga0157375_10126863 | Ga0157375_101268632 | 185 |
| 487 | 3300013308 | Ga0157375_10191158 | Ga0157375_101911583 | 185 |
| 488 | 3300013308 | Ga0157375_11167324 | Ga0157375_111673241 | 185 |
| 489 | 3300014325 | Ga0163163_10009402 | Ga0163163_100094027 | 185 |
| 490 | 3300014325 | Ga0163163_10848203 | Ga0163163_108482032 | 185 |
| 491 | 3300014326 | Ga0157380_10006027 | Ga0157380_100060274 | 185 |
| 492 | 3300014326 | Ga0157380_10006297 | Ga0157380_100062975 | 185 |
| 493 | 3300014326 | Ga0157380_10028112 | Ga0157380_100281124 | 185 |
| 494 | 3300014326 | Ga0157380_10203981 | Ga0157380_102039812 | 185 |
| 495 | 3300014326 | Ga0157380_10221352 | Ga0157380_102213522 | 185 |
| 496 | 3300014326 | Ga0157380_10509047 | Ga0157380_105090472 | 185 |
| 497 | 3300014745 | Ga0157377_10000038 | Ga0157377_1000003831 | 185 |
| 498 | 3300014745 | Ga0157377_10000784 | Ga0157377_1000078410 | 185 |
| 499 | 3300014968 | Ga0157379_10001736 | Ga0157379_100017366 | 185 |
| 500 | 3300014968 | Ga0157379_10002470 | Ga0157379_100024705 | 185 |
| 501 | 3300014968 | Ga0157379_10015679 | Ga0157379_100156792 | 185 |
| 502 | 3300014968 | Ga0157379_10018191 | Ga0157379_100181912 | 185 |
| 503 | 3300014968 | Ga0157379_10038599 | Ga0157379_100385991 | 185 |
| 504 | 3300014968 | Ga0157379_10047186 | Ga0157379_100471864 | 185 |
| 505 | 3300014968 | Ga0157379_10055645 | Ga0157379_100556453 | 185 |
| 506 | 3300014968 | Ga0157379_10263463 | Ga0157379_102634631 | 185 |
| 507 | 3300014968 | Ga0157379_10318507 | Ga0157379_103185072 | 185 |
| 508 | 3300014968 | Ga0157379_10339058 | Ga0157379_103390582 | 185 |
| 509 | 3300014969 | Ga0157376_10023720 | Ga0157376_100237205 | 185 |
| 510 | 3300014969 | Ga0157376_10061547 | Ga0157376_100615472 | 185 |
| 511 | 3300014969 | Ga0157376_10092091 | Ga0157376_100920912 | 185 |
| 512 | 3300014969 | Ga0157376_10179041 | Ga0157376_101790411 | 185 |
| 513 | 3300014969 | Ga0157376_10360712 | Ga0157376_103607122 | 185 |
| 514 | 3300015261 | Ga0182006_1121151 | Ga0182006_11211512 | 185 |
| 515 | 3300015262 | Ga0182007_10076658 | Ga0182007_100766582 | 185 |
| 516 | 3300015265 | Ga0182005_1076329 | Ga0182005_10763292 | 185 |
| 517 | 3300017792 | Ga0163161_10005593 | Ga0163161_100055938 | 185 |
| 518 | 3300017792 | Ga0163161_10043874 | Ga0163161_100438742 | 185 |
| 519 | 3300017792 | Ga0163161_10113550 | Ga0163161_101135502 | 185 |
| 520 | 3300021361 | Ga0213872_10000006 | Ga0213872_1000000628 | 185 |
| 521 | 3300021361 | Ga0213872_10000085 | Ga0213872_1000008567 | 185 |
| 522 | 3300021361 | Ga0213872_10001073 | Ga0213872_1000107314 | 185 |
| 523 | 3300021361 | Ga0213872_10057925 | Ga0213872_100579251 | 185 |
| 524 | 3300025226 | Ga0209674_100041 | Ga0209674_100041125 | 185 |
| 525 | 3300025228 | Ga0209672_104503 | Ga0209672_1045032 | 185 |
| 526 | 3300025230 | Ga0209563_100043 | Ga0209563_100043125 | 185 |
| 527 | 3300025230 | Ga0209563_100044 | Ga0209563_100044174 | 185 |
| 528 | 3300025231 | Ga0207427_100341 | Ga0207427_10034111 | 185 |
| 529 | 3300025242 | Ga0209258_100515 | Ga0209258_10051533 | 185 |
| 530 | 3300025242 | Ga0209258_100693 | Ga0209258_1006938 | 185 |
| 531 | 3300025245 | Ga0207425_1000802 | Ga0207425_10008026 | 185 |
| 532 | 3300025245 | Ga0207425_1018613 | Ga0207425_10186132 | 185 |
| 533 | 3300025246 | Ga0209646_1000069 | Ga0209646_1000069167 | 185 |
| 534 | 3300025250 | Ga0209026_1000006 | Ga0209026_1000006262 | 185 |
| 535 | 3300025253 | Ga0209677_100077 | Ga0209677_100077125 | 185 |
| 536 | 3300025253 | Ga0209677_101016 | Ga0209677_10101613 | 185 |
| 537 | 3300025253 | Ga0209677_104838 | Ga0209677_1048383 | 185 |
| 538 | 3300025256 | Ga0209759_1000189 | Ga0209759_10001893 | 185 |
| 539 | 3300025256 | Ga0209759_1002556 | Ga0209759_10025568 | 185 |
| 540 | 3300025256 | Ga0209759_1005450 | Ga0209759_10054503 | 185 |
| 541 | 3300025256 | Ga0209759_1006592 | Ga0209759_10065923 | 185 |
| 542 | 3300025258 | Ga0209129_1000012 | Ga0209129_1000012272 | 185 |
| 543 | 3300025263 | Ga0209565_1024949 | Ga0209565_10249491 | 185 |
| 544 | 3300025272 | Ga0209455_1000597 | Ga0209455_10005978 | 185 |
| 545 | 3300025273 | Ga0209673_1001736 | Ga0209673_100173618 | 185 |
| 546 | 3300025273 | Ga0209673_1005928 | Ga0209673_10059286 | 185 |
| 547 | 3300025273 | Ga0209673_1007378 | Ga0209673_10073782 | 185 |
| 548 | 3300025273 | Ga0209673_1014115 | Ga0209673_10141153 | 185 |
| 549 | 3300025290 | Ga0207673_1020590 | Ga0207673_10205902 | 185 |
| 550 | 3300025295 | Ga0209564_1000008 | Ga0209564_1000008581 | 185 |
| 551 | 3300025295 | Ga0209564_1000022 | Ga0209564_1000022242 | 185 |
| 552 | 3300025297 | Ga0209758_1000099 | Ga0209758_10000997 | 185 |
| 553 | 3300025297 | Ga0209758_1000234 | Ga0209758_1000234117 | 185 |
| 554 | 3300025298 | Ga0209050_1000691 | Ga0209050_10006915 | 185 |
| 555 | 3300025298 | Ga0209050_1002840 | Ga0209050_10028407 | 185 |
| 556 | 3300025298 | Ga0209050_1012415 | Ga0209050_10124152 | 185 |
| 557 | 3300025298 | Ga0209050_1015253 | Ga0209050_10152532 | 185 |
| 558 | 3300025299 | Ga0209256_1000036 | Ga0209256_1000036152 | 185 |
| 559 | 3300025299 | Ga0209256_1002027 | Ga0209256_10020278 | 185 |
| 560 | 3300025299 | Ga0209256_1022129 | Ga0209256_10221292 | 185 |
| 561 | 3300025303 | Ga0209051_1000068 | Ga0209051_100006859 | 185 |
| 562 | 3300025303 | Ga0209051_1001546 | Ga0209051_100154614 | 185 |
| 563 | 3300025303 | Ga0209051_1004282 | Ga0209051_10042825 | 185 |
| 564 | 3300025303 | Ga0209051_1011828 | Ga0209051_10118283 | 185 |
| 565 | 3300025303 | Ga0209051_1044190 | Ga0209051_10441902 | 185 |
| 566 | 3300025304 | Ga0209257_1000033 | Ga0209257_1000033135 | 185 |
| 567 | 3300025304 | Ga0209257_1000146 | Ga0209257_100014633 | 185 |
| 568 | 3300025304 | Ga0209257_1018570 | Ga0209257_10185702 | 185 |
| 569 | 3300025315 | Ga0207697_10082007 | Ga0207697_100820072 | 185 |
| 570 | 3300025321 | Ga0207656_10037754 | Ga0207656_100377542 | 185 |
| 571 | 3300025321 | Ga0207656_10253131 | Ga0207656_102531312 | 185 |
| 572 | 3300025893 | Ga0207682_10002764 | Ga0207682_100027642 | 185 |
| 573 | 3300025893 | Ga0207682_10006249 | Ga0207682_100062494 | 185 |
| 574 | 3300025893 | Ga0207682_10022286 | Ga0207682_100222863 | 185 |
| 575 | 3300025893 | Ga0207682_10057601 | Ga0207682_100576012 | 185 |
| 576 | 3300025893 | Ga0207682_10069461 | Ga0207682_100694612 | 185 |
| 577 | 3300025899 | Ga0207642_10007749 | Ga0207642_100077492 | 185 |
| 578 | 3300025899 | Ga0207642_10030199 | Ga0207642_100301993 | 185 |
| 579 | 3300025899 | Ga0207642_10032222 | Ga0207642_100322222 | 185 |
| 580 | 3300025903 | Ga0207680_10013435 | Ga0207680_100134355 | 185 |
| 581 | 3300025903 | Ga0207680_10064225 | Ga0207680_100642251 | 185 |
| 582 | 3300025903 | Ga0207680_10548713 | Ga0207680_105487132 | 185 |
| 583 | 3300025907 | Ga0207645_10010823 | Ga0207645_100108236 | 185 |
| 584 | 3300025907 | Ga0207645_10027395 | Ga0207645_100273954 | 185 |
| 585 | 3300025907 | Ga0207645_10032784 | Ga0207645_100327842 | 185 |
| 586 | 3300025907 | Ga0207645_10034580 | Ga0207645_100345803 | 185 |
| 587 | 3300025907 | Ga0207645_10184706 | Ga0207645_101847062 | 185 |
| 588 | 3300025907 | Ga0207645_10329518 | Ga0207645_103295182 | 185 |
| 589 | 3300025907 | Ga0207645_10343404 | Ga0207645_103434042 | 185 |
| 590 | 3300025908 | Ga0207643_10106545 | Ga0207643_101065452 | 185 |
| 591 | 3300025909 | Ga0207705_10031141 | Ga0207705_100311412 | 185 |
| 592 | 3300025909 | Ga0207705_10074065 | Ga0207705_100740653 | 185 |
| 593 | 3300025909 | Ga0207705_10100357 | Ga0207705_101003572 | 185 |
| 594 | 3300025909 | Ga0207705_10158779 | Ga0207705_101587792 | 185 |
| 595 | 3300025912 | Ga0207707_10117012 | Ga0207707_101170122 | 185 |
| 596 | 3300025912 | Ga0207707_10137881 | Ga0207707_101378813 | 185 |
| 597 | 3300025913 | Ga0207695_10054703 | Ga0207695_100547033 | 185 |
| 598 | 3300025913 | Ga0207695_10110263 | Ga0207695_101102633 | 185 |
| 599 | 3300025914 | Ga0207671_10056267 | Ga0207671_100562672 | 185 |
| 600 | 3300025914 | Ga0207671_10289600 | Ga0207671_102896002 | 185 |
| 601 | 3300025917 | Ga0207660_10018222 | Ga0207660_100182225 | 185 |
| 602 | 3300025918 | Ga0207662_10010982 | Ga0207662_100109821 | 185 |
| 603 | 3300025918 | Ga0207662_10051527 | Ga0207662_100515272 | 185 |
| 604 | 3300025919 | Ga0207657_10119150 | Ga0207657_101191501 | 185 |
| 605 | 3300025919 | Ga0207657_10165076 | Ga0207657_101650763 | 185 |
| 606 | 3300025919 | Ga0207657_10213629 | Ga0207657_102136292 | 185 |
| 607 | 3300025919 | Ga0207657_10326074 | Ga0207657_103260741 | 185 |
| 608 | 3300025919 | Ga0207657_10331574 | Ga0207657_103315742 | 185 |
| 609 | 3300025920 | Ga0207649_10001094 | Ga0207649_100010942 | 185 |
| 610 | 3300025920 | Ga0207649_10051405 | Ga0207649_100514053 | 185 |
| 611 | 3300025920 | Ga0207649_10312387 | Ga0207649_103123872 | 185 |
| 612 | 3300025920 | Ga0207649_10384869 | Ga0207649_103848691 | 185 |
| 613 | 3300025921 | Ga0207652_10013195 | Ga0207652_100131952 | 185 |
| 614 | 3300025923 | Ga0207681_10015959 | Ga0207681_100159593 | 185 |
| 615 | 3300025923 | Ga0207681_10028289 | Ga0207681_100282894 | 185 |
| 616 | 3300025923 | Ga0207681_10096707 | Ga0207681_100967072 | 185 |
| 617 | 3300025923 | Ga0207681_10126404 | Ga0207681_101264042 | 185 |
| 618 | 3300025923 | Ga0207681_11176146 | Ga0207681_111761461 | 185 |
| 619 | 3300025924 | Ga0207694_10036898 | Ga0207694_100368984 | 185 |
| 620 | 3300025924 | Ga0207694_10536374 | Ga0207694_105363741 | 185 |
| 621 | 3300025925 | Ga0207650_10001670 | Ga0207650_100016702 | 185 |
| 622 | 3300025925 | Ga0207650_10003627 | Ga0207650_100036277 | 185 |
| 623 | 3300025925 | Ga0207650_10005846 | Ga0207650_100058463 | 185 |
| 624 | 3300025925 | Ga0207650_10064306 | Ga0207650_100643064 | 185 |
| 625 | 3300025925 | Ga0207650_10195654 | Ga0207650_101956543 | 185 |
| 626 | 3300025926 | Ga0207659_10002852 | Ga0207659_100028523 | 185 |
| 627 | 3300025926 | Ga0207659_10008593 | Ga0207659_100085936 | 185 |
| 628 | 3300025926 | Ga0207659_10055044 | Ga0207659_100550444 | 185 |
| 629 | 3300025926 | Ga0207659_10115972 | Ga0207659_101159723 | 185 |
| 630 | 3300025926 | Ga0207659_10238027 | Ga0207659_102380272 | 185 |
| 631 | 3300025926 | Ga0207659_10457999 | Ga0207659_104579991 | 185 |
| 632 | 3300025926 | Ga0207659_10580892 | Ga0207659_105808921 | 185 |
| 633 | 3300025927 | Ga0207687_10088022 | Ga0207687_100880222 | 185 |
| 634 | 3300025927 | Ga0207687_10092521 | Ga0207687_100925212 | 185 |
| 635 | 3300025927 | Ga0207687_10246672 | Ga0207687_102466723 | 185 |
| 636 | 3300025931 | Ga0207644_10014014 | Ga0207644_100140143 | 185 |
| 637 | 3300025931 | Ga0207644_10024985 | Ga0207644_100249852 | 185 |
| 638 | 3300025931 | Ga0207644_10048053 | Ga0207644_100480533 | 185 |
| 639 | 3300025931 | Ga0207644_10130504 | Ga0207644_101305043 | 185 |
| 640 | 3300025931 | Ga0207644_10347617 | Ga0207644_103476172 | 185 |
| 641 | 3300025931 | Ga0207644_10519550 | Ga0207644_105195502 | 185 |
| 642 | 3300025931 | Ga0207644_11059510 | Ga0207644_110595101 | 185 |
| 643 | 3300025932 | Ga0207690_10002003 | Ga0207690_100020035 | 185 |
| 644 | 3300025932 | Ga0207690_10017625 | Ga0207690_100176253 | 185 |
| 645 | 3300025932 | Ga0207690_10236024 | Ga0207690_102360242 | 185 |
| 646 | 3300025932 | Ga0207690_10383752 | Ga0207690_103837521 | 185 |
| 647 | 3300025932 | Ga0207690_10401396 | Ga0207690_104013962 | 185 |
| 648 | 3300025932 | Ga0207690_11197902 | Ga0207690_111979021 | 185 |
| 649 | 3300025933 | Ga0207706_10003398 | Ga0207706_100033984 | 185 |
| 650 | 3300025933 | Ga0207706_10003614 | Ga0207706_100036145 | 185 |
| 651 | 3300025933 | Ga0207706_10105780 | Ga0207706_101057802 | 185 |
| 652 | 3300025933 | Ga0207706_10185836 | Ga0207706_101858362 | 185 |
| 653 | 3300025934 | Ga0207686_10160889 | Ga0207686_101608892 | 185 |
| 654 | 3300025934 | Ga0207686_10262340 | Ga0207686_102623401 | 185 |
| 655 | 3300025934 | Ga0207686_10328181 | Ga0207686_103281811 | 185 |
| 656 | 3300025934 | Ga0207686_10342093 | Ga0207686_103420932 | 185 |
| 657 | 3300025935 | Ga0207709_10001781 | Ga0207709_100017817 | 185 |
| 658 | 3300025935 | Ga0207709_10006230 | Ga0207709_100062309 | 185 |
| 659 | 3300025935 | Ga0207709_10339145 | Ga0207709_103391452 | 185 |
| 660 | 3300025936 | Ga0207670_10280059 | Ga0207670_102800592 | 185 |
| 661 | 3300025937 | Ga0207669_10007179 | Ga0207669_100071796 | 185 |
| 662 | 3300025937 | Ga0207669_10066197 | Ga0207669_100661973 | 185 |
| 663 | 3300025937 | Ga0207669_10205381 | Ga0207669_102053811 | 185 |
| 664 | 3300025937 | Ga0207669_10420893 | Ga0207669_104208931 | 185 |
| 665 | 3300025938 | Ga0207704_10000810 | Ga0207704_100008103 | 185 |
| 666 | 3300025938 | Ga0207704_10026710 | Ga0207704_100267102 | 185 |
| 667 | 3300025938 | Ga0207704_10031983 | Ga0207704_100319834 | 185 |
| 668 | 3300025938 | Ga0207704_10035673 | Ga0207704_100356734 | 185 |
| 669 | 3300025939 | Ga0207665_10101598 | Ga0207665_101015982 | 185 |
| 670 | 3300025940 | Ga0207691_10002842 | Ga0207691_100028426 | 185 |
| 671 | 3300025940 | Ga0207691_10003320 | Ga0207691_100033206 | 185 |
| 672 | 3300025940 | Ga0207691_10012250 | Ga0207691_100122504 | 185 |
| 673 | 3300025940 | Ga0207691_10031619 | Ga0207691_100316194 | 185 |
| 674 | 3300025940 | Ga0207691_10087976 | Ga0207691_100879763 | 185 |
| 675 | 3300025940 | Ga0207691_10128681 | Ga0207691_101286812 | 185 |
| 676 | 3300025941 | Ga0207711_10024886 | Ga0207711_100248866 | 185 |
| 677 | 3300025941 | Ga0207711_10033943 | Ga0207711_100339432 | 185 |
| 678 | 3300025941 | Ga0207711_10046960 | Ga0207711_100469602 | 185 |
| 679 | 3300025941 | Ga0207711_10058246 | Ga0207711_100582462 | 185 |
| 680 | 3300025941 | Ga0207711_10067665 | Ga0207711_100676653 | 185 |
| 681 | 3300025941 | Ga0207711_10261951 | Ga0207711_102619512 | 185 |
| 682 | 3300025941 | Ga0207711_10645761 | Ga0207711_106457612 | 185 |
| 683 | 3300025942 | Ga0207689_10004129 | Ga0207689_1000412910 | 185 |
| 684 | 3300025942 | Ga0207689_10018115 | Ga0207689_100181157 | 185 |
| 685 | 3300025942 | Ga0207689_10048816 | Ga0207689_100488162 | 185 |
| 686 | 3300025944 | Ga0207661_10150790 | Ga0207661_101507902 | 185 |
| 687 | 3300025944 | Ga0207661_10364047 | Ga0207661_103640472 | 185 |
| 688 | 3300025945 | Ga0207679_10008499 | Ga0207679_100084994 | 185 |
| 689 | 3300025945 | Ga0207679_10027429 | Ga0207679_100274293 | 185 |
| 690 | 3300025945 | Ga0207679_10118822 | Ga0207679_101188223 | 185 |
| 691 | 3300025945 | Ga0207679_10179239 | Ga0207679_101792392 | 185 |
| 692 | 3300025945 | Ga0207679_10239298 | Ga0207679_102392982 | 185 |
| 693 | 3300025945 | Ga0207679_10277212 | Ga0207679_102772122 | 185 |
| 694 | 3300025945 | Ga0207679_10279880 | Ga0207679_102798802 | 185 |
| 695 | 3300025945 | Ga0207679_10387234 | Ga0207679_103872342 | 185 |
| 696 | 3300025945 | Ga0207679_10453038 | Ga0207679_104530381 | 185 |
| 697 | 3300025949 | Ga0207667_10057801 | Ga0207667_100578013 | 185 |
| 698 | 3300025949 | Ga0207667_10074299 | Ga0207667_100742993 | 185 |
| 699 | 3300025949 | Ga0207667_10178337 | Ga0207667_101783371 | 185 |
| 700 | 3300025949 | Ga0207667_10191020 | Ga0207667_101910202 | 185 |
| 701 | 3300025949 | Ga0207667_10278911 | Ga0207667_102789112 | 185 |
| 702 | 3300025949 | Ga0207667_10728589 | Ga0207667_107285892 | 185 |
| 703 | 3300025960 | Ga0207651_10018112 | Ga0207651_100181123 | 185 |
| 704 | 3300025960 | Ga0207651_10035487 | Ga0207651_100354872 | 185 |
| 705 | 3300025960 | Ga0207651_10184451 | Ga0207651_101844513 | 185 |
| 706 | 3300025960 | Ga0207651_10186327 | Ga0207651_101863272 | 185 |
| 707 | 3300025960 | Ga0207651_10589679 | Ga0207651_105896792 | 185 |
| 708 | 3300025961 | Ga0207712_10004226 | Ga0207712_100042267 | 185 |
| 709 | 3300025961 | Ga0207712_10006036 | Ga0207712_100060363 | 185 |
| 710 | 3300025961 | Ga0207712_10123761 | Ga0207712_101237611 | 185 |
| 711 | 3300025961 | Ga0207712_10375602 | Ga0207712_103756022 | 185 |
| 712 | 3300025972 | Ga0207668_10013659 | Ga0207668_100136596 | 185 |
| 713 | 3300025972 | Ga0207668_10028650 | Ga0207668_100286504 | 185 |
| 714 | 3300025972 | Ga0207668_10240814 | Ga0207668_102408142 | 185 |
| 715 | 3300025972 | Ga0207668_10419226 | Ga0207668_104192262 | 185 |
| 716 | 3300025981 | Ga0207640_10003992 | Ga0207640_100039926 | 185 |
| 717 | 3300025981 | Ga0207640_10072562 | Ga0207640_100725622 | 185 |
| 718 | 3300025981 | Ga0207640_10073987 | Ga0207640_100739871 | 185 |
| 719 | 3300025981 | Ga0207640_10262206 | Ga0207640_102622062 | 185 |
| 720 | 3300025986 | Ga0207658_10005459 | Ga0207658_100054593 | 185 |
| 721 | 3300025986 | Ga0207658_10016705 | Ga0207658_100167054 | 185 |
| 722 | 3300025986 | Ga0207658_10172763 | Ga0207658_101727631 | 185 |
| 723 | 3300025986 | Ga0207658_10464734 | Ga0207658_104647342 | 185 |
| 724 | 3300025986 | Ga0207658_10570336 | Ga0207658_105703361 | 185 |
| 725 | 3300026023 | Ga0207677_10035383 | Ga0207677_100353833 | 185 |
| 726 | 3300026023 | Ga0207677_10053941 | Ga0207677_100539412 | 185 |
| 727 | 3300026023 | Ga0207677_10093173 | Ga0207677_100931731 | 185 |
| 728 | 3300026023 | Ga0207677_10305150 | Ga0207677_103051502 | 185 |
| 729 | 3300026023 | Ga0207677_10393288 | Ga0207677_103932882 | 185 |
| 730 | 3300026035 | Ga0207703_10007785 | Ga0207703_100077854 | 185 |
| 731 | 3300026035 | Ga0207703_10020766 | Ga0207703_100207663 | 185 |
| 732 | 3300026035 | Ga0207703_10037216 | Ga0207703_100372164 | 185 |
| 733 | 3300026035 | Ga0207703_10118229 | Ga0207703_101182293 | 185 |
| 734 | 3300026035 | Ga0207703_10127660 | Ga0207703_101276603 | 185 |
| 735 | 3300026035 | Ga0207703_10298809 | Ga0207703_102988092 | 185 |
| 736 | 3300026035 | Ga0207703_10369466 | Ga0207703_103694662 | 185 |
| 737 | 3300026041 | Ga0207639_10060943 | Ga0207639_100609432 | 185 |
| 738 | 3300026041 | Ga0207639_10284363 | Ga0207639_102843632 | 185 |
| 739 | 3300026041 | Ga0207639_10308364 | Ga0207639_103083642 | 185 |
| 740 | 3300026041 | Ga0207639_10718561 | Ga0207639_107185611 | 185 |
| 741 | 3300026041 | Ga0207639_10879865 | Ga0207639_108798651 | 185 |
| 742 | 3300026067 | Ga0207678_10004010 | Ga0207678_100040103 | 185 |
| 743 | 3300026067 | Ga0207678_10101468 | Ga0207678_101014684 | 185 |
| 744 | 3300026067 | Ga0207678_10166070 | Ga0207678_101660702 | 185 |
| 745 | 3300026067 | Ga0207678_10188630 | Ga0207678_101886302 | 185 |
| 746 | 3300026067 | Ga0207678_10381762 | Ga0207678_103817622 | 185 |
| 747 | 3300026067 | Ga0207678_11358459 | Ga0207678_113584591 | 185 |
| 748 | 3300026075 | Ga0207708_10026826 | Ga0207708_100268263 | 185 |
| 749 | 3300026075 | Ga0207708_10046076 | Ga0207708_100460764 | 185 |
| 750 | 3300026075 | Ga0207708_10056463 | Ga0207708_100564632 | 185 |
| 751 | 3300026078 | Ga0207702_10084197 | Ga0207702_100841972 | 185 |
| 752 | 3300026078 | Ga0207702_10479534 | Ga0207702_104795342 | 185 |
| 753 | 3300026078 | Ga0207702_10662444 | Ga0207702_106624441 | 185 |
| 754 | 3300026088 | Ga0207641_10002465 | Ga0207641_100024653 | 185 |
| 755 | 3300026088 | Ga0207641_10048522 | Ga0207641_100485223 | 185 |
| 756 | 3300026088 | Ga0207641_10101777 | Ga0207641_101017774 | 185 |
| 757 | 3300026088 | Ga0207641_10119819 | Ga0207641_101198193 | 185 |
| 758 | 3300026088 | Ga0207641_10175133 | Ga0207641_101751332 | 185 |
| 759 | 3300026088 | Ga0207641_10430282 | Ga0207641_104302822 | 185 |
| 760 | 3300026088 | Ga0207641_10559951 | Ga0207641_105599512 | 185 |
| 761 | 3300026088 | Ga0207641_10707034 | Ga0207641_107070341 | 185 |
| 762 | 3300026088 | Ga0207641_10740094 | Ga0207641_107400942 | 185 |
| 763 | 3300026089 | Ga0207648_10000118 | Ga0207648_1000011831 | 185 |
| 764 | 3300026089 | Ga0207648_10000842 | Ga0207648_1000084230 | 185 |
| 765 | 3300026089 | Ga0207648_10005129 | Ga0207648_100051291 | 185 |
| 766 | 3300026089 | Ga0207648_10024991 | Ga0207648_100249913 | 185 |
| 767 | 3300026089 | Ga0207648_10048224 | Ga0207648_100482244 | 185 |
| 768 | 3300026089 | Ga0207648_10096211 | Ga0207648_100962113 | 185 |
| 769 | 3300026089 | Ga0207648_10344581 | Ga0207648_103445811 | 185 |
| 770 | 3300026089 | Ga0207648_10401067 | Ga0207648_104010672 | 185 |
| 771 | 3300026095 | Ga0207676_10058884 | Ga0207676_100588842 | 185 |
| 772 | 3300026095 | Ga0207676_10070932 | Ga0207676_100709322 | 185 |
| 773 | 3300026095 | Ga0207676_10099637 | Ga0207676_100996372 | 185 |
| 774 | 3300026095 | Ga0207676_10148246 | Ga0207676_101482462 | 185 |
| 775 | 3300026095 | Ga0207676_10317590 | Ga0207676_103175902 | 185 |
| 776 | 3300026095 | Ga0207676_10535952 | Ga0207676_105359522 | 185 |
| 777 | 3300026116 | Ga0207674_10021612 | Ga0207674_100216129 | 185 |
| 778 | 3300026116 | Ga0207674_10102519 | Ga0207674_101025193 | 185 |
| 779 | 3300026116 | Ga0207674_10235918 | Ga0207674_102359182 | 185 |
| 780 | 3300026116 | Ga0207674_10385128 | Ga0207674_103851282 | 185 |
| 781 | 3300026118 | Ga0207675_100001529 | Ga0207675_1000015296 | 185 |
| 782 | 3300026118 | Ga0207675_100017659 | Ga0207675_1000176595 | 185 |
| 783 | 3300026118 | Ga0207675_100033361 | Ga0207675_1000333615 | 185 |
| 784 | 3300026118 | Ga0207675_100033388 | Ga0207675_1000333883 | 185 |
| 785 | 3300026118 | Ga0207675_100052353 | Ga0207675_1000523532 | 185 |
| 786 | 3300026118 | Ga0207675_100164655 | Ga0207675_1001646552 | 185 |
| 787 | 3300026118 | Ga0207675_100584014 | Ga0207675_1005840142 | 185 |
| 788 | 3300026118 | Ga0207675_101081565 | Ga0207675_1010815651 | 185 |
| 789 | 3300026121 | Ga0207683_10044884 | Ga0207683_100448844 | 185 |
| 790 | 3300026121 | Ga0207683_10087739 | Ga0207683_100877393 | 185 |
| 791 | 3300026121 | Ga0207683_10098615 | Ga0207683_100986153 | 185 |
| 792 | 3300026121 | Ga0207683_10112711 | Ga0207683_101127112 | 185 |
| 793 | 3300026121 | Ga0207683_10152584 | Ga0207683_101525842 | 185 |
| 794 | 3300026121 | Ga0207683_10304377 | Ga0207683_103043772 | 185 |
| 795 | 3300026142 | Ga0207698_10001763 | Ga0207698_1000176313 | 185 |
| 796 | 3300026142 | Ga0207698_10074135 | Ga0207698_100741353 | 185 |
| 797 | 3300026142 | Ga0207698_10089371 | Ga0207698_100893711 | 185 |
| 798 | 3300026142 | Ga0207698_10094822 | Ga0207698_100948222 | 185 |
| 799 | 3300026142 | Ga0207698_10219326 | Ga0207698_102193262 | 185 |
| 800 | 3300026142 | Ga0207698_10376661 | Ga0207698_103766611 | 185 |
| 801 | 3300026142 | Ga0207698_10396163 | Ga0207698_103961632 | 185 |
| 802 | 3300026142 | Ga0207698_10547501 | Ga0207698_105475012 | 185 |
| 803 | 3300026142 | Ga0207698_11700686 | Ga0207698_117006861 | 185 |
| 804 | 3300027111 | Ga0209281_1000736 | Ga0209281_10007366 | 185 |
| 805 | 3300027296 | Ga0209389_1020739 | Ga0209389_10207393 | 185 |
| 806 | 3300027471 | Ga0209995_1005033 | Ga0209995_10050331 | 185 |
| 807 | 3300027526 | Ga0209968_1001331 | Ga0209968_10013314 | 185 |
| 808 | 3300027682 | Ga0209971_1008514 | Ga0209971_10085143 | 185 |
| 809 | 3300027695 | Ga0209966_1000162 | Ga0209966_100016218 | 185 |
| 810 | 3300027876 | Ga0209974_10005095 | Ga0209974_100050953 | 185 |
| 811 | 3300028379 | Ga0268266_10195518 | Ga0268266_101955182 | 185 |
| 812 | 3300028379 | Ga0268266_10487036 | Ga0268266_104870362 | 185 |
| 813 | 3300028380 | Ga0268265_10024537 | Ga0268265_100245373 | 185 |
| 814 | 3300028380 | Ga0268265_10077830 | Ga0268265_100778302 | 185 |
| 815 | 3300028380 | Ga0268265_10553223 | Ga0268265_105532232 | 185 |
| 816 | 3300028380 | Ga0268265_10988912 | Ga0268265_109889121 | 185 |
| 817 | 3300028381 | Ga0268264_10000858 | Ga0268264_1000085825 | 185 |
| 818 | 3300028381 | Ga0268264_10040299 | Ga0268264_100402994 | 185 |
| 819 | 3300028381 | Ga0268264_10043465 | Ga0268264_100434653 | 185 |
| 820 | 3300028381 | Ga0268264_10245396 | Ga0268264_102453962 | 185 |
| 821 | 3300028381 | Ga0268264_10856558 | Ga0268264_108565582 | 185 |
| 822 | 3300028666 | Ga0265336_10000013 | Ga0265336_10000013140 | 185 |
| 823 | 3300028786 | Ga0307517_10000131 | Ga0307517_1000013176 | 185 |
| 824 | 3300028786 | Ga0307517_10139515 | Ga0307517_101395153 | 185 |
| 825 | 3300028786 | Ga0307517_10216895 | Ga0307517_102168952 | 185 |
| 826 | 3300028786 | Ga0307517_10458448 | Ga0307517_104584481 | 185 |
| 827 | 3300028794 | Ga0307515_10000011 | Ga0307515_10000011202 | 185 |
| 828 | 3300028794 | Ga0307515_10000138 | Ga0307515_1000013854 | 185 |
| 829 | 3300028794 | Ga0307515_10000382 | Ga0307515_1000038262 | 185 |
| 830 | 3300028794 | Ga0307515_10001206 | Ga0307515_1000120615 | 185 |
| 831 | 3300028794 | Ga0307515_10003938 | Ga0307515_100039381 | 185 |
| 832 | 3300028794 | Ga0307515_10030322 | Ga0307515_100303226 | 185 |
| 833 | 3300028794 | Ga0307515_10049807 | Ga0307515_100498074 | 185 |
| 834 | 3300028794 | Ga0307515_10065551 | Ga0307515_100655513 | 185 |
| 835 | 3300028794 | Ga0307515_10207397 | Ga0307515_102073973 | 185 |
| 836 | 3300028794 | Ga0307515_10368899 | Ga0307515_103688992 | 185 |
| 837 | 3300029957 | Ga0265324_10000432 | Ga0265324_1000043228 | 185 |
| 838 | 3300030522 | Ga0307512_10037633 | Ga0307512_100376332 | 185 |
| 839 | 3300030522 | Ga0307512_10056737 | Ga0307512_100567373 | 185 |
| 840 | 3300030522 | Ga0307512_10057621 | Ga0307512_100576212 | 185 |
| 841 | 3300030522 | Ga0307512_10222233 | Ga0307512_102222331 | 185 |
| 842 | 3300031239 | Ga0265328_10011442 | Ga0265328_100114422 | 185 |
| 843 | 3300031239 | Ga0265328_10011544 | Ga0265328_100115442 | 185 |
| 844 | 3300031250 | Ga0265331_10001252 | Ga0265331_1000125215 | 185 |
| 845 | 3300031251 | Ga0265327_10000042 | Ga0265327_10000042210 | 185 |
| 846 | 3300031251 | Ga0265327_10000174 | Ga0265327_1000017426 | 185 |
| 847 | 3300031456 | Ga0307513_10006637 | Ga0307513_100066378 | 185 |
| 848 | 3300031456 | Ga0307513_10008888 | Ga0307513_1000888811 | 185 |
| 849 | 3300031456 | Ga0307513_10390773 | Ga0307513_103907732 | 185 |
| 850 | 3300031507 | Ga0307509_10004119 | Ga0307509_1000411916 | 185 |
| 851 | 3300031507 | Ga0307509_10005021 | Ga0307509_100050219 | 185 |
| 852 | 3300031507 | Ga0307509_10007961 | Ga0307509_100079616 | 185 |
| 853 | 3300031507 | Ga0307509_10045866 | Ga0307509_100458665 | 185 |
| 854 | 3300031507 | Ga0307509_10068229 | Ga0307509_100682293 | 185 |
| 855 | 3300031507 | Ga0307509_10131019 | Ga0307509_101310193 | 185 |
| 856 | 3300031507 | Ga0307509_10251599 | Ga0307509_102515992 | 185 |
| 857 | 3300031507 | Ga0307509_10297350 | Ga0307509_102973501 | 185 |
| 858 | 3300031548 | Ga0307408_100000037 | Ga0307408_10000003763 | 185 |
| 859 | 3300031548 | Ga0307408_100405031 | Ga0307408_1004050312 | 185 |
| 860 | 3300031616 | Ga0307508_10000727 | Ga0307508_1000072722 | 185 |
| 861 | 3300031616 | Ga0307508_10016265 | Ga0307508_100162652 | 185 |
| 862 | 3300031616 | Ga0307508_10063507 | Ga0307508_100635073 | 185 |
| 863 | 3300031616 | Ga0307508_10344109 | Ga0307508_103441091 | 185 |
| 864 | 3300031616 | Ga0307508_10393564 | Ga0307508_103935642 | 185 |
| 865 | 3300031649 | Ga0307514_10000390 | Ga0307514_1000039075 | 185 |
| 866 | 3300031649 | Ga0307514_10002716 | Ga0307514_1000271616 | 185 |
| 867 | 3300031649 | Ga0307514_10065265 | Ga0307514_100652653 | 185 |
| 868 | 3300031730 | Ga0307516_10000559 | Ga0307516_1000055940 | 185 |
| 869 | 3300031730 | Ga0307516_10001343 | Ga0307516_1000134334 | 185 |
| 870 | 3300031730 | Ga0307516_10006485 | Ga0307516_100064855 | 185 |
| 871 | 3300031730 | Ga0307516_10335360 | Ga0307516_103353602 | 185 |
| 872 | 3300031730 | Ga0307516_10475680 | Ga0307516_104756802 | 185 |
| 873 | 3300031731 | Ga0307405_10002935 | Ga0307405_100029356 | 185 |
| 874 | 3300031731 | Ga0307405_10107459 | Ga0307405_101074592 | 185 |
| 875 | 3300031731 | Ga0307405_10150554 | Ga0307405_101505542 | 185 |
| 876 | 3300031731 | Ga0307405_10365846 | Ga0307405_103658462 | 185 |
| 877 | 3300031824 | Ga0307413_10016247 | Ga0307413_100162474 | 185 |
| 878 | 3300031824 | Ga0307413_11257263 | Ga0307413_112572631 | 185 |
| 879 | 3300031852 | Ga0307410_10028168 | Ga0307410_100281684 | 185 |
| 880 | 3300031852 | Ga0307410_10174111 | Ga0307410_101741112 | 185 |
| 881 | 3300031852 | Ga0307410_10249965 | Ga0307410_102499652 | 185 |
| 882 | 3300031852 | Ga0307410_10308742 | Ga0307410_103087421 | 185 |
| 883 | 3300031852 | Ga0307410_10368146 | Ga0307410_103681462 | 185 |
| 884 | 3300031901 | Ga0307406_10178736 | Ga0307406_101787362 | 185 |
| 885 | 3300031903 | Ga0307407_10347238 | Ga0307407_103472381 | 185 |
| 886 | 3300031903 | Ga0307407_10489762 | Ga0307407_104897621 | 185 |
| 887 | 3300031911 | Ga0307412_10023995 | Ga0307412_100239954 | 185 |
| 888 | 3300031911 | Ga0307412_10127635 | Ga0307412_101276352 | 185 |
| 889 | 3300031995 | Ga0307409_100014831 | Ga0307409_1000148315 | 185 |
| 890 | 3300031995 | Ga0307409_100015029 | Ga0307409_1000150294 | 185 |
| 891 | 3300031995 | Ga0307409_100350884 | Ga0307409_1003508842 | 185 |
| 892 | 3300032002 | Ga0307416_100001622 | Ga0307416_1000016226 | 185 |
| 893 | 3300032002 | Ga0307416_100074296 | Ga0307416_1000742963 | 185 |
| 894 | 3300032002 | Ga0307416_100079922 | Ga0307416_1000799222 | 185 |
| 895 | 3300032002 | Ga0307416_100092016 | Ga0307416_1000920162 | 185 |
| 896 | 3300032002 | Ga0307416_100409062 | Ga0307416_1004090622 | 185 |
| 897 | 3300032002 | Ga0307416_100715878 | Ga0307416_1007158782 | 185 |
| 898 | 3300032002 | Ga0307416_100864899 | Ga0307416_1008648992 | 185 |
| 899 | 3300032002 | Ga0307416_101147545 | Ga0307416_1011475452 | 185 |
| 900 | 3300032002 | Ga0307416_101977863 | Ga0307416_1019778631 | 185 |
| 901 | 3300032004 | Ga0307414_10016912 | Ga0307414_100169124 | 185 |
| 902 | 3300032004 | Ga0307414_10820959 | Ga0307414_108209591 | 185 |
| 903 | 3300032005 | Ga0307411_10000494 | Ga0307411_100004947 | 185 |
| 904 | 3300032005 | Ga0307411_10027470 | Ga0307411_100274703 | 185 |
| 905 | 3300032126 | Ga0307415_100002203 | Ga0307415_1000022032 | 185 |
| 906 | 3300032126 | Ga0307415_100034318 | Ga0307415_1000343182 | 185 |
| 907 | 3300033179 | Ga0307507_10029403 | Ga0307507_100294036 | 185 |
| 908 | 3300033179 | Ga0307507_10151038 | Ga0307507_101510381 | 185 |
| 909 | 3300033180 | Ga0307510_10007325 | Ga0307510_100073254 | 185 |
| 910 | 3300033180 | Ga0307510_10047690 | Ga0307510_100476902 | 185 |
| 911 | 3300033180 | Ga0307510_10178338 | Ga0307510_101783381 | 185 |
| 912 | 3300034816 | Ga0373930_0040359 | Ga0373930_0040359_203_760 | 185 |
| 913 | 3300034820 | Ga0373959_0026677 | Ga0373959_0026677_296_853 | 185 |
| 914 | 3300034820 | Ga0373959_0120729 | Ga0373959_0120729_33_590 | 185 |
| 915 | 3300035088 | Ga0373940_0034838 | Ga0373940_0034838_744_1301 | 185 |
| 916 | 3300035091 | Ga0373951_0029991 | Ga0373951_0029991_119_676 | 185 |
| 917 | 3300035112 | Ga0373932_0114193 | Ga0373932_0114193_38_595 | 185 |
| 918 | 3300035113 | Ga0373936_0030416 | Ga0373936_0030416_1560_2117 | 185 |
| 919 | 3300035113 | Ga0373936_0114062 | Ga0373936_0114062_102_659 | 185 |
| 920 | 3300035114 | Ga0373939_0000130 | Ga0373939_0000130_17620_18177 | 185 |
| 921 | 3300035114 | Ga0373939_0034204 | Ga0373939_0034204_187_744 | 185 |
| 922 | 3300035114 | Ga0373939_0196592 | Ga0373939_0196592_101_658 | 185 |
| 923 | 3300035115 | Ga0373941_0171835 | Ga0373941_0171835_115_672 | 185 |
| 924 | 3300035116 | Ga0373945_0024452 | Ga0373945_0024452_1244_1801 | 185 |
| 925 | 3300035116 | Ga0373945_0109486 | Ga0373945_0109486_478_1035 | 185 |
| 926 | 3300035118 | Ga0373954_0096475 | Ga0373954_0096475_812_1369 | 185 |
| 927 | 3300035121 | Ga0373960_0152422 | Ga0373960_0152422_204_761 | 185 |
| 928 | 3300035170 | Ga0373943_0031046 | Ga0373943_0031046_1040_1618 | 185 |
| 929 | 3300035171 | Ga0373946_0132198 | Ga0373946_0132198_414_971 | 185 |
| 930 | 3300035172 | Ga0373955_0026724 | Ga0373955_0026724_1780_2337 | 185 |
| 931 | 3300035241 | Ga0373961_0016647 | Ga0373961_0016647_123_680 | 185 |
| 932 | 3300035242 | Ga0373962_0083098 | Ga0373962_0083098_56_613 | 185 |
| 933 | 3300035410 | Ga0373924_0033543 | Ga0373924_0033543_1038_1595 | 185 |
| 934 | 3300035691 | Ga0373931_0000077 | Ga0373931_0000077_15781_16338 | 185 |
| 935 | 3300035691 | Ga0373931_0004391 | Ga0373931_0004391_3780_4337 | 185 |
| 936 | 3300035691 | Ga0373931_0043713 | Ga0373931_0043713_820_1377 | 185 |
| 937 | 3300035691 | Ga0373931_0309889 | Ga0373931_0309889_317_874 | 185 |
| 938 | 3300036401 | Ga0373937_0029553 | Ga0373937_0029553_3013_3570 | 185 |
| 939 | 3300036401 | Ga0373937_0553807 | Ga0373937_0553807_501_1079 | 185 |
| 940 | 3300037068 | Ga0373925_0037784 | Ga0373925_0037784_1506_2063 | 185 |
| 941 | 3300037418 | Ga0395900_0000879 | Ga0395900_0000879_13482_14108 | 185 |
| 942 | 3300037418 | Ga0395900_0414590 | Ga0395900_0414590_715_1272 | 185 |
| 943 | 3300037466 | Ga0395898_0001863 | Ga0395898_0001863_25145_25702 | 185 |
| 944 | 3300037471 | Ga0395905_0003332 | Ga0395905_0003332_1329_1886 | 185 |
| 945 | 3300037471 | Ga0395905_0007069 | Ga0395905_0007069_6387_6944 | 185 |
| 946 | 3300037471 | Ga0395905_0019367 | Ga0395905_0019367_985_1542 | 185 |
| 947 | 3300037471 | Ga0395905_0504915 | Ga0395905_0504915_526_1083 | 185 |
| 948 | 3300038443 | Ga0395901_0001781 | Ga0395901_0001781_10259_10816 | 185 |
| 949 | 3300039447 | Ga0436361_0019641 | Ga0436361_0019641_36442_36999 | 185 |
| 950 | 3300039447 | Ga0436361_0085209 | Ga0436361_0085209_3972_4529 | 185 |
| 951 | 3300039447 | Ga0436361_0255611 | Ga0436361_0255611_2661_3218 | 185 |
| 952 | 3300039447 | Ga0436361_0463922 | Ga0436361_0463922_1887_2516 | 185 |
| 953 | 3300039447 | Ga0436361_1020604 | Ga0436361_1020604_86_655 | 185 |
| 954 | 3300039447 | Ga0436361_1048578 | Ga0436361_1048578_1857_2507 | 185 |
| 955 | 3300039447 | Ga0436361_1181151 | Ga0436361_1181151_1271_1840 | 185 |
| 956 | 3300039450 | Ga0436363_1399792 | Ga0436363_1399792_1060_1617 | 185 |
| 957 | 3300041443 | Ga0451789_0465154 | Ga0451789_0465154_289_846 | 185 |
| 958 | 3300041443 | Ga0451789_1272523 | Ga0451789_1272523_447_1004 | 185 |
| 959 | 3300041451 | Ga0451791_1347236 | Ga0451791_1347236_178_735 | 185 |
| 960 | 3300041453 | Ga0451797_1576900 | Ga0451797_1576900_321_878 | 185 |
| 961 | 3300041458 | Ga0451798_0217509 | Ga0451798_0217509_82_639 | 185 |
| 962 | 3300041458 | Ga0451798_0867094 | Ga0451798_0867094_677_1234 | 185 |
| 963 | 3300041486 | Ga0451807_1959080 | Ga0451807_1959080_361_918 | 185 |
| 964 | 3300041491 | Ga0451833_0958391 | Ga0451833_0958391_66_623 | 185 |
| 965 | 3300041496 | Ga0451839_0595639 | Ga0451839_0595639_172_729 | 185 |
| 966 | 3300041507 | Ga0451851_0070177 | Ga0451851_0070177_101_658 | 185 |
| 967 | 3300041509 | Ga0451843_1230032 | Ga0451843_1230032_114_671 | 185 |
| 968 | 3300041512 | Ga0451853_0407793 | Ga0451853_0407793_478_1035 | 185 |
| 969 | 3300041997 | Ga0439431_0010770 | Ga0439431_0010770_447_1010 | 185 |
| 970 | 3300041999 | Ga0439433_0112376 | Ga0439433_0112376_56_613 | 185 |
| 971 | 3300042000 | Ga0439437_006821 | Ga0439437_006821_220_777 | 185 |
| 972 | 3300042001 | Ga0439441_037049 | Ga0439441_037049_74_631 | 185 |
| 973 | 3300042007 | Ga0439449_0055644 | Ga0439449_0055644_217_774 | 185 |
| 974 | 3300042007 | Ga0439449_0146662 | Ga0439449_0146662_297_860 | 185 |
| 975 | 3300042008 | Ga0439450_004588 | Ga0439450_004588_1422_1979 | 185 |
| 976 | 3300042014 | Ga0439457_042981 | Ga0439457_042981_207_764 | 185 |
| 977 | 3300042120 | Ga0450917_001065 | Ga0450917_001065_802_1359 | 185 |
| 978 | 3300042126 | Ga0450888_000177 | Ga0450888_000177_572_1129 | 185 |
| 979 | 3300042127 | Ga0450890_000922 | Ga0450890_000922_169_726 | 185 |
| 980 | 3300042129 | Ga0450891_000060 | Ga0450891_000060_3668_4225 | 185 |
| 981 | 3300042134 | Ga0450898_015057 | Ga0450898_015057_251_808 | 185 |
| 982 | 3300042135 | Ga0450899_013185 | Ga0450899_013185_318_875 | 185 |
| 983 | 3300042138 | Ga0450903_013782 | Ga0450903_013782_492_1049 | 185 |
| 984 | 3300042144 | Ga0450889_000922 | Ga0450889_000922_1666_2223 | 185 |
| 985 | 3300042436 | Ga0439435_0160003 | Ga0439435_0160003_61_618 | 185 |
| 986 | 3300042438 | Ga0439459_0010455 | Ga0439459_0010455_10_567 | 185 |
| 987 | 3300042439 | Ga0439464_0015176 | Ga0439464_0015176_638_1195 | 185 |
| 988 | 3300042530 | Ga0450916_001089 | Ga0450916_001089_816_1373 | 185 |
| 989 | 3300042531 | Ga0450918_000326 | Ga0450918_000326_9016_9573 | 185 |
| 990 | 3300042532 | Ga0450893_0010581 | Ga0450893_0010581_792_1349 | 185 |
| 991 | 3300042533 | Ga0450901_026210 | Ga0450901_026210_22_579 | 185 |
| 992 | 3300042876 | Ga0451577_0001866 | Ga0451577_0001866_22519_23076 | 185 |
| 993 | 3300042876 | Ga0451577_0032633 | Ga0451577_0032633_3657_4214 | 185 |
| 994 | 3300042876 | Ga0451577_0127972 | Ga0451577_0127972_1017_1574 | 185 |
| 995 | 3300044656 | Ga0466969_0000020 | Ga0466969_0000020_97393_97950 | 185 |
| 996 | 3300044656 | Ga0466969_0101384 | Ga0466969_0101384_133_690 | 185 |
| 997 | 3300044683 | Ga0466965_0000493 | Ga0466965_0000493_11040_11636 | 185 |
| 998 | 3300044683 | Ga0466965_0011312 | Ga0466965_0011312_2695_3252 | 185 |
| 999 | 3300044683 | Ga0466965_0038922 | Ga0466965_0038922_857_1414 | 185 |
| 1000 | 3300044683 | Ga0466965_0109992 | Ga0466965_0109992_452_1009 | 185 |
| 1001 | 3300044684 | Ga0466966_0001239 | Ga0466966_0001239_8283_8840 | 185 |
| 1002 | 3300044684 | Ga0466966_0011170 | Ga0466966_0011170_3802_4398 | 185 |
| 1003 | 3300044693 | Ga0466961_0013718 | Ga0466961_0013718_4359_4916 | 185 |
| 1004 | 3300044693 | Ga0466961_0037361 | Ga0466961_0037361_1774_2331 | 185 |
| 1005 | 3300044694 | Ga0466963_0039303 | Ga0466963_0039303_1764_2360 | 185 |
| 1006 | 3300044694 | Ga0466963_0077538 | Ga0466963_0077538_1228_1785 | 185 |
| 1007 | 3300044694 | Ga0466963_0101194 | Ga0466963_0101194_239_796 | 185 |
| 1008 | 3300044706 | Ga0466964_0000949 | Ga0466964_0000949_6374_6970 | 185 |
| 1009 | 3300044706 | Ga0466964_0014413 | Ga0466964_0014413_1355_1912 | 185 |
| 1010 | 3300044706 | Ga0466964_0062857 | Ga0466964_0062857_627_1187 | 185 |
| 1011 | 3300044712 | Ga0453684_0042883 | Ga0453684_0042883_5012_5581 | 185 |
| 1012 | 3300044712 | Ga0453684_0066790 | Ga0453684_0066790_3545_4102 | 185 |
| 1013 | 3300044712 | Ga0453684_0410522 | Ga0453684_0410522_159_716 | 185 |
| 1014 | 3300044712 | Ga0453684_0591572 | Ga0453684_0591572_46_603 | 185 |
| 1015 | 3300044712 | Ga0453684_0687081 | Ga0453684_0687081_483_1040 | 185 |
| 1016 | 3300044712 | Ga0453684_0875581 | Ga0453684_0875581_159_716 | 185 |
| 1017 | 3300044719 | Ga0466971_0002813 | Ga0466971_0002813_1430_2026 | 185 |
| 1018 | 3300044719 | Ga0466971_0003163 | Ga0466971_0003163_3425_4078 | 185 |
| 1019 | 3300044719 | Ga0466971_0023819 | Ga0466971_0023819_132_689 | 185 |
| 1020 | 3300044735 | Ga0466968_0013862 | Ga0466968_0013862_769_1365 | 185 |
| 1021 | 3300044765 | Ga0466970_0005378 | Ga0466970_0005378_5133_5690 | 185 |
| 1022 | 3300044765 | Ga0466970_0033153 | Ga0466970_0033153_615_1211 | 185 |
| 1023 | 3300044765 | Ga0466970_0192540 | Ga0466970_0192540_359_916 | 185 |
| 1024 | 3300044842 | Ga0466957_0027220 | Ga0466957_0027220_852_1448 | 185 |
| 1025 | 3300044842 | Ga0466957_0063458 | Ga0466957_0063458_315_968 | 185 |
| 1026 | 3300044842 | Ga0466957_0269486 | Ga0466957_0269486_211_768 | 185 |
| 1027 | 3300045049 | Ga0466959_0001531 | Ga0466959_0001531_8061_8618 | 185 |
| 1028 | 3300045049 | Ga0466959_0046516 | Ga0466959_0046516_2461_3018 | 185 |
| 1029 | 3300045049 | Ga0466959_0067872 | Ga0466959_0067872_1783_2379 | 185 |
| 1030 | 3300045051 | Ga0451576_0009077 | Ga0451576_0009077_933_1490 | 185 |
| 1031 | 3300045051 | Ga0451576_0124243 | Ga0451576_0124243_1067_1624 | 185 |
| 1032 | 3300045051 | Ga0451576_0257121 | Ga0451576_0257121_548_1186 | 185 |
| 1033 | 3300045051 | Ga0451576_0284685 | Ga0451576_0284685_491_1048 | 185 |
| 1034 | 3300045051 | Ga0451576_0509554 | Ga0451576_0509554_383_940 | 185 |
| 1035 | 3300045051 | Ga0451576_0665852 | Ga0451576_0665852_153_710 | 185 |
| 1036 | 3300045051 | Ga0451576_1515972 | Ga0451576_1515972_23_580 | 185 |
| 1037 | 3300045836 | Ga0466958_0041460 | Ga0466958_0041460_711_1268 | 185 |
| 1038 | 3300045836 | Ga0466958_0063036 | Ga0466958_0063036_748_1344 | 185 |
| 1039 | 3300045976 | Ga0466967_0025052 | Ga0466967_0025052_4241_4798 | 185 |
| 1040 | 3300046454 | Ga0495592_0000746 | Ga0495592_0000746_4738_5295 | 185 |
| 1041 | 3300046454 | Ga0495592_0215835 | Ga0495592_0215835_296_853 | 185 |
| 1042 | 3300046454 | Ga0495592_0272189 | Ga0495592_0272189_363_920 | 185 |
| 1043 | 3300046455 | Ga0495603_0078723 | Ga0495603_0078723_579_1205 | 185 |
| 1044 | 3300046457 | Ga0495590_0031730 | Ga0495590_0031730_656_1213 | 185 |
| 1045 | 3300046459 | Ga0495629_0166233 | Ga0495629_0166233_778_1335 | 185 |
| 1046 | 3300046460 | Ga0495638_0031475 | Ga0495638_0031475_2497_3054 | 185 |
| 1047 | 3300046462 | Ga0495651_0106790 | Ga0495651_0106790_1157_1714 | 185 |
| 1048 | 3300046463 | Ga0495653_0559191 | Ga0495653_0559191_59_616 | 185 |
| 1049 | 3300046471 | Ga0495650_0008561 | Ga0495650_0008561_4929_5486 | 185 |
| 1050 | 3300046471 | Ga0495650_0029377 | Ga0495650_0029377_359_916 | 185 |
| 1051 | 3300046472 | Ga0495580_0626935 | Ga0495580_0626935_51_608 | 185 |
| 1052 | 3300046476 | Ga0495662_0395224 | Ga0495662_0395224_112_669 | 185 |
| 1053 | 3300046506 | Ga0495583_0000034 | Ga0495583_0000034_244637_245194 | 185 |
| 1054 | 3300046507 | Ga0495606_0006285 | Ga0495606_0006285_2147_2704 | 185 |
| 1055 | 3300046507 | Ga0495606_0358723 | Ga0495606_0358723_19_576 | 185 |
| 1056 | 3300046511 | Ga0495608_0264507 | Ga0495608_0264507_206_763 | 185 |
| 1057 | 3300046512 | Ga0495610_0024206 | Ga0495610_0024206_2191_2748 | 185 |
| 1058 | 3300046512 | Ga0495610_0036866 | Ga0495610_0036866_328_885 | 185 |
| 1059 | 3300046514 | Ga0495618_0406174 | Ga0495618_0406174_83_640 | 185 |
| 1060 | 3300046515 | Ga0495620_0259601 | Ga0495620_0259601_17_643 | 185 |
| 1061 | 3300046516 | Ga0495628_0163090 | Ga0495628_0163090_443_1000 | 185 |
| 1062 | 3300046517 | Ga0495630_0040768 | Ga0495630_0040768_2505_3062 | 185 |
| 1063 | 3300046519 | Ga0495632_0066020 | Ga0495632_0066020_48_605 | 185 |
| 1064 | 3300046519 | Ga0495632_0095371 | Ga0495632_0095371_564_1121 | 185 |
| 1065 | 3300046522 | Ga0495643_0072167 | Ga0495643_0072167_743_1300 | 185 |
| 1066 | 3300046523 | Ga0495644_0192133 | Ga0495644_0192133_126_683 | 185 |
| 1067 | 3300046524 | Ga0495648_0055873 | Ga0495648_0055873_1609_2166 | 185 |
| 1068 | 3300046524 | Ga0495648_0064351 | Ga0495648_0064351_102_659 | 185 |
| 1069 | 3300046524 | Ga0495648_0122432 | Ga0495648_0122432_105_662 | 185 |
| 1070 | 3300046525 | Ga0495663_0077585 | Ga0495663_0077585_252_830 | 185 |
| 1071 | 3300046533 | Ga0495640_0292472 | Ga0495640_0292472_14_571 | 185 |
| 1072 | 3300046535 | Ga0495586_0120873 | Ga0495586_0120873_412_969 | 185 |
| 1073 | 3300046537 | Ga0495598_0018950 | Ga0495598_0018950_971_1528 | 185 |
| 1074 | 3300046539 | Ga0495621_0021135 | Ga0495621_0021135_1328_1885 | 185 |
| 1075 | 3300046539 | Ga0495621_0279558 | Ga0495621_0279558_72_629 | 185 |
| 1076 | 3300046539 | Ga0495621_0285045 | Ga0495621_0285045_55_612 | 185 |
| 1077 | 3300046559 | Ga0495667_0174150 | Ga0495667_0174150_146_703 | 185 |
| 1078 | 3300046615 | Ga0495656_0129509 | Ga0495656_0129509_531_1175 | 185 |
| 1079 | 3300046616 | Ga0495668_0021789 | Ga0495668_0021789_1028_1585 | 185 |
| 1080 | 3300046660 | Ga0495625_0006159 | Ga0495625_0006159_2463_3020 | 185 |
| 1081 | 3300046660 | Ga0495625_0020810 | Ga0495625_0020810_1852_2409 | 185 |
| 1082 | 3300046663 | Ga0495635_0101360 | Ga0495635_0101360_570_1127 | 185 |
| 1083 | 3300046680 | Ga0495646_0040454 | Ga0495646_0040454_35_592 | 185 |
| 1084 | 3300046680 | Ga0495646_0157199 | Ga0495646_0157199_600_1157 | 185 |
| 1085 | 3300046681 | Ga0495647_0245915 | Ga0495647_0245915_171_728 | 185 |
| 1086 | 3300046683 | Ga0495658_0204009 | Ga0495658_0204009_632_1189 | 185 |
| 1087 | 3300046684 | Ga0495669_0026759 | Ga0495669_0026759_202_759 | 185 |
| 1088 | 3300046684 | Ga0495669_0317274 | Ga0495669_0317274_42_668 | 185 |
| 1089 | 3300046689 | Ga0495613_0152544 | Ga0495613_0152544_463_1020 | 185 |
| 1090 | 3300046691 | Ga0495670_0060761 | Ga0495670_0060761_1244_1804 | 185 |
| 1091 | 3300046691 | Ga0495670_0129903 | Ga0495670_0129903_731_1288 | 185 |
| 1092 | 3300046692 | Ga0495671_0106988 | Ga0495671_0106988_742_1299 | 185 |
| 1093 | 3300046694 | Ga0495649_0000728 | Ga0495649_0000728_24166_24723 | 185 |
| 1094 | 3300046810 | Ga0495660_0079409 | Ga0495660_0079409_302_859 | 185 |
| 1095 | 3300047319 | Ga0495674_0289346 | Ga0495674_0289346_657_1214 | 185 |
| 1096 | 3300047322 | Ga0495680_0111095 | Ga0495680_0111095_78_635 | 185 |
| 1097 | 3300047470 | Ga0495681_0172549 | Ga0495681_0172549_17_595 | 185 |
| 1098 | 3300047472 | Ga0495686_0000739 | Ga0495686_0000739_41080_41637 | 185 |
| 1099 | 3300047472 | Ga0495686_0039653 | Ga0495686_0039653_1291_1848 | 185 |
| 1100 | 3300047472 | Ga0495686_0165775 | Ga0495686_0165775_262_819 | 185 |
| 1101 | 3300048089 | Ga0495614_0217942 | Ga0495614_0217942_242_799 | 185 |
| 1102 | 3300048903 | Ga0496100_0035391 | Ga0496100_0035391_2236_2793 | 185 |
| 1103 | 3300048903 | Ga0496100_0103186 | Ga0496100_0103186_911_1468 | 185 |
| 1104 | 3300048903 | Ga0496100_0582321 | Ga0496100_0582321_142_699 | 185 |
| 1105 | 3300048903 | Ga0496100_0774405 | Ga0496100_0774405_118_675 | 185 |
| 1106 | 3300048903 | Ga0496100_1044664 | Ga0496100_1044664_72_629 | 185 |
| 1107 | 3300048904 | Ga0496101_0024303 | Ga0496101_0024303_1313_1870 | 185 |
| 1108 | 3300048905 | Ga0496102_0006045 | Ga0496102_0006045_8182_8742 | 185 |
| 1109 | 3300048905 | Ga0496102_0008100 | Ga0496102_0008100_5371_5928 | 185 |
| 1110 | 3300048905 | Ga0496102_0095541 | Ga0496102_0095541_799_1356 | 185 |
| 1111 | 3300048906 | Ga0496103_0378788 | Ga0496103_0378788_156_713 | 185 |
| 1112 | 3300048907 | Ga0496104_0087183 | Ga0496104_0087183_648_1205 | 185 |
| 1113 | 3300048907 | Ga0496104_0123106 | Ga0496104_0123106_1316_1942 | 185 |
| 1114 | 3300048907 | Ga0496104_0212089 | Ga0496104_0212089_798_1355 | 185 |
| 1115 | 3300048907 | Ga0496104_0994531 | Ga0496104_0994531_20_577 | 185 |
| 1116 | 3300048908 | Ga0496105_0218711 | Ga0496105_0218711_851_1408 | 185 |
| 1117 | 3300048908 | Ga0496105_0284964 | Ga0496105_0284964_182_739 | 185 |
| 1118 | 3300048908 | Ga0496105_0388177 | Ga0496105_0388177_240_797 | 185 |
| 1119 | 3300048909 | Ga0496106_0023565 | Ga0496106_0023565_1389_1946 | 185 |
| 1120 | 3300048909 | Ga0496106_0027147 | Ga0496106_0027147_3285_3842 | 185 |
| 1121 | 3300048910 | Ga0496107_0004099 | Ga0496107_0004099_6084_6641 | 185 |
| 1122 | 3300048911 | Ga0496108_0112517 | Ga0496108_0112517_1343_1900 | 185 |
| 1123 | 3300048911 | Ga0496108_0132616 | Ga0496108_0132616_800_1357 | 185 |
| 1124 | 3300048911 | Ga0496108_0133591 | Ga0496108_0133591_860_1417 | 185 |
| 1125 | 3300048912 | Ga0496109_0042557 | Ga0496109_0042557_1049_1606 | 185 |
| 1126 | 3300048912 | Ga0496109_0143033 | Ga0496109_0143033_125_682 | 185 |
| 1127 | 3300048912 | Ga0496109_0179034 | Ga0496109_0179034_852_1433 | 185 |
| 1128 | 3300048912 | Ga0496109_0195803 | Ga0496109_0195803_623_1180 | 185 |
| 1129 | 3300048912 | Ga0496109_0328802 | Ga0496109_0328802_120_677 | 185 |
| 1130 | 3300048912 | Ga0496109_0337113 | Ga0496109_0337113_610_1167 | 185 |
| 1131 | 3300048913 | Ga0496110_0069048 | Ga0496110_0069048_1046_1603 | 185 |
| 1132 | 3300048913 | Ga0496110_0394290 | Ga0496110_0394290_456_1013 | 185 |
| 1133 | 3300048914 | Ga0496111_0176869 | Ga0496111_0176869_914_1474 | 185 |
| 1134 | 3300048914 | Ga0496111_0477267 | Ga0496111_0477267_19_576 | 185 |
| 1135 | 3300048915 | Ga0496112_0061214 | Ga0496112_0061214_2933_3490 | 185 |
| 1136 | 3300048915 | Ga0496112_0425437 | Ga0496112_0425437_138_695 | 185 |
| 1137 | 3300048916 | Ga0496113_0013003 | Ga0496113_0013003_2798_3355 | 185 |
| 1138 | 3300048916 | Ga0496113_0241481 | Ga0496113_0241481_185_742 | 185 |
| 1139 | 3300048916 | Ga0496113_0398556 | Ga0496113_0398556_211_768 | 185 |
| 1140 | 3300048917 | Ga0496114_0070435 | Ga0496114_0070435_797_1423 | 185 |
| 1141 | 3300048917 | Ga0496114_0599381 | Ga0496114_0599381_365_922 | 185 |
| 1142 | 3300048924 | Ga0496121_0026182 | Ga0496121_0026182_630_1247 | 185 |
| 1143 | 3300048927 | Ga0496124_0000126 | Ga0496124_0000126_86402_87019 | 185 |
| 1144 | 3300048927 | Ga0496124_0079515 | Ga0496124_0079515_1806_2363 | 185 |
| 1145 | 3300048928 | Ga0496125_0003500 | Ga0496125_0003500_3047_3664 | 185 |
| 1146 | 3300049521 | Ga0501298_011150 | Ga0501298_011150_495_1052 | 185 |
| 1147 | 3300049523 | Ga0501300_009888 | Ga0501300_009888_586_1143 | 185 |
| 1148 | 3300049579 | Ga0501043_0000009 | Ga0501043_0000009_109079_109636 | 185 |
| 1149 | 3300049580 | Ga0501046_0000022 | Ga0501046_0000022_109068_109625 | 185 |
| 1150 | 3300049581 | Ga0501047_0000021 | Ga0501047_0000021_109126_109683 | 185 |
| 1151 | 3300049649 | Ga0501198_000019 | Ga0501198_000019_69301_69873 | 185 |
| 1152 | 3300049651 | Ga0501201_001792 | Ga0501201_001792_177_734 | 185 |
| 1153 | 3300049658 | Ga0501211_000655 | Ga0501211_000655_1224_1781 | 185 |
| 1154 | 3300049662 | Ga0501222_000059 | Ga0501222_000059_20966_21538 | 185 |
| 1155 | 3300049662 | Ga0501222_002805 | Ga0501222_002805_607_1164 | 185 |
| 1156 | 3300049663 | Ga0501223_012519 | Ga0501223_012519_86_643 | 185 |
| 1157 | 3300049668 | Ga0501233_008494 | Ga0501233_008494_497_1054 | 185 |
| 1158 | 3300049669 | Ga0501235_002288 | Ga0501235_002288_1490_2047 | 185 |
| 1159 | 3300049670 | Ga0501236_019964 | Ga0501236_019964_403_960 | 185 |
| 1160 | 3300049679 | Ga0501249_007648 | Ga0501249_007648_218_775 | 185 |
| 1161 | 3300049683 | Ga0501253_020996 | Ga0501253_020996_508_1065 | 185 |
| 1162 | 3300049683 | Ga0501253_060348 | Ga0501253_060348_247_804 | 185 |
| 1163 | 3300049684 | Ga0501255_023119 | Ga0501255_023119_124_681 | 185 |
| 1164 | 3300049704 | Ga0501221_004219 | Ga0501221_004219_303_860 | 185 |
| 1165 | 3300049706 | Ga0501229_000329 | Ga0501229_000329_4482_5039 | 185 |
| 1166 | 3300049757 | Ga0501232_007753 | Ga0501232_007753_329_886 | 185 |
| 1167 | 3300049759 | Ga0501262_001965 | Ga0501262_001965_510_1067 | 185 |
| 1168 | 3300049760 | Ga0501263_040320 | Ga0501263_040320_26_586 | 185 |
| 1169 | 3300049762 | Ga0501265_002920 | Ga0501265_002920_39_728 | 185 |
| 1170 | 3300049763 | Ga0501266_015299 | Ga0501266_015299_36_593 | 185 |
| 1171 | 3300049764 | Ga0501267_001228 | Ga0501267_001228_158_715 | 185 |
| 1172 | 3300049768 | Ga0501271_004112 | Ga0501271_004112_19_576 | 185 |
| 1173 | 3300049769 | Ga0501272_005415 | Ga0501272_005415_269_826 | 185 |
| 1174 | 3300049779 | Ga0501283_005530 | Ga0501283_005530_234_791 | 185 |
| 1175 | 3300049822 | Ga0501035_0304530 | Ga0501035_0304530_268_825 | 185 |
| 1176 | 3300049823 | Ga0501044_0661707 | Ga0501044_0661707_122_679 | 185 |
| 1177 | 3300049824 | Ga0501045_0025044 | Ga0501045_0025044_1790_2347 | 185 |
| 1178 | 3300050489 | nmdc:mga03683_287767_c1 | nmdc:mga03683_287767_c1_112_690 | 185 |
| 1179 | 3300050489 | nmdc:mga03683_5178_c1 | nmdc:mga03683_5178_c1_2187_2753 | 185 |
| 1180 | 3300050490 | nmdc:mga03n38_361453_c1 | nmdc:mga03n38_361453_c1_177_755 | 185 |
| 1181 | 3300050490 | nmdc:mga03n38_70060_c1 | nmdc:mga03n38_70060_c1_100_657 | 185 |
| 1182 | 3300050490 | nmdc:mga03n38_86560_c1 | nmdc:mga03n38_86560_c1_381_947 | 185 |
| 1183 | 3300050493 | nmdc:mga0k408_118638_c1 | nmdc:mga0k408_118638_c1_776_1333 | 185 |
| 1184 | 3300050493 | nmdc:mga0k408_127486_c1 | nmdc:mga0k408_127486_c1_598_1155 | 185 |
| 1185 | 3300050493 | nmdc:mga0k408_12953_c1 | nmdc:mga0k408_12953_c1_2912_3469 | 185 |
| 1186 | 3300050493 | nmdc:mga0k408_130339_c1 | nmdc:mga0k408_130339_c1_496_1059 | 185 |
| 1187 | 3300050493 | nmdc:mga0k408_146879_c1 | nmdc:mga0k408_146879_c1_428_985 | 185 |
| 1188 | 3300050493 | nmdc:mga0k408_173373_c1 | nmdc:mga0k408_173373_c1_424_981 | 185 |
| 1189 | 3300050493 | nmdc:mga0k408_212864_c1 | nmdc:mga0k408_212864_c1_400_978 | 185 |
| 1190 | 3300050493 | nmdc:mga0k408_27836_c1 | nmdc:mga0k408_27836_c1_2219_2785 | 185 |
| 1191 | 3300050493 | nmdc:mga0k408_376315_c1 | nmdc:mga0k408_376315_c1_218_775 | 185 |
| 1192 | 3300050493 | nmdc:mga0k408_406_c1 | nmdc:mga0k408_406_c1_16959_17537 | 185 |
| 1193 | 3300050493 | nmdc:mga0k408_42240_c1 | nmdc:mga0k408_42240_c1_476_1033 | 185 |
| 1194 | 3300050493 | nmdc:mga0k408_59264_c1 | nmdc:mga0k408_59264_c1_609_1166 | 185 |
| 1195 | 3300050493 | nmdc:mga0k408_85785_c1 | nmdc:mga0k408_85785_c1_884_1441 | 185 |
| 1196 | 3300050493 | nmdc:mga0k408_88156_c1 | nmdc:mga0k408_88156_c1_659_1216 | 185 |
| 1197 | 3300050494 | nmdc:mga06z11_258805_c1 | nmdc:mga06z11_258805_c1_19_585 | 185 |
| 1198 | 3300050494 | nmdc:mga06z11_64211_c1 | nmdc:mga06z11_64211_c1_1352_1909 | 185 |
| 1199 | 3300050494 | nmdc:mga06z11_76716_c1 | nmdc:mga06z11_76716_c1_222_800 | 185 |
| 1200 | 3300050496 | nmdc:mga07m45_103654_c1 | nmdc:mga07m45_103654_c1_253_810 | 185 |
| 1201 | 3300050496 | nmdc:mga07m45_136154_c1 | nmdc:mga07m45_136154_c1_296_853 | 185 |
| 1202 | 3300050496 | nmdc:mga07m45_30645_c1 | nmdc:mga07m45_30645_c1_1886_2443 | 185 |
| 1203 | 3300050496 | nmdc:mga07m45_5537_c1 | nmdc:mga07m45_5537_c1_1521_2078 | 185 |
| 1204 | 3300050496 | nmdc:mga07m45_6725_c1 | nmdc:mga07m45_6725_c1_2114_2671 | 185 |
| 1205 | 3300050507 | nmdc:mga05p37_109740_c1 | nmdc:mga05p37_109740_c1_17_574 | 185 |
| 1206 | 3300050508 | nmdc:mga09592_53741_c1 | nmdc:mga09592_53741_c1_644_1201 | 185 |
| 1207 | 3300050509 | nmdc:mga0qj67_360672_c1 | nmdc:mga0qj67_360672_c1_508_1074 | 185 |
| 1208 | 3300050509 | nmdc:mga0qj67_76608_c1 | nmdc:mga0qj67_76608_c1_1362_1919 | 185 |
| 1209 | 3300050511 | nmdc:mga08y16_1178426_c1 | nmdc:mga08y16_1178426_c1_42_668 | 185 |
| 1210 | 3300053077 | Ga0495601_0019457 | Ga0495601_0019457_793_1350 | 185 |
| 1211 | 3300053080 | Ga0500635_0000011 | Ga0500635_0000011_141055_141612 | 185 |
| 1212 | 3300053085 | Ga0495619_0143834 | Ga0495619_0143834_507_1064 | 185 |
| 1213 | 3300053086 | Ga0500578_0000673 | Ga0500578_0000673_17717_18274 | 185 |
| 1214 | 3300053086 | Ga0500578_0554643 | Ga0500578_0554643_13_570 | 185 |
| 1215 | 3300053087 | Ga0500643_032481 | Ga0500643_032481_292_849 | 185 |
| 1216 | 3300053088 | Ga0500644_0018787 | Ga0500644_0018787_128_685 | 185 |
| 1217 | 3300053090 | Ga0500646_0014486 | Ga0500646_0014486_168_725 | 185 |
| 1218 | 3300053092 | Ga0500583_0054394 | Ga0500583_0054394_744_1301 | 185 |
| 1219 | 3300053093 | Ga0500651_0051962 | Ga0500651_0051962_1773_2330 | 185 |
| 1220 | 3300053093 | Ga0500651_0229625 | Ga0500651_0229625_294_851 | 185 |
| 1221 | 3300053097 | Ga0500648_346063 | Ga0500648_346063_39_596 | 185 |
| 1222 | 3300053098 | Ga0500650_0046653 | Ga0500650_0046653_128_685 | 185 |
| 1223 | 3300053103 | Ga0500555_030106 | Ga0500555_030106_246_803 | 185 |
| 1224 | 3300053108 | Ga0500562_026334 | Ga0500562_026334_291_848 | 185 |
| 1225 | 3300053108 | Ga0500562_037530 | Ga0500562_037530_449_1006 | 185 |
| 1226 | 3300053109 | Ga0500569_007978 | Ga0500569_007978_587_1144 | 185 |
| 1227 | 3300053117 | Ga0500593_000680 | Ga0500593_000680_8571_9128 | 185 |
| 1228 | 3300053118 | Ga0500594_0000470 | Ga0500594_0000470_6774_7331 | 185 |
| 1229 | 3300053119 | Ga0500595_073612 | Ga0500595_073612_310_867 | 185 |
| 1230 | 3300053121 | Ga0500607_118133 | Ga0500607_118133_60_617 | 185 |
| 1231 | 3300053122 | Ga0500608_246768 | Ga0500608_246768_124_681 | 185 |
| 1232 | 3300053127 | Ga0500623_072496 | Ga0500623_072496_783_1340 | 185 |
| 1233 | 3300053129 | Ga0500628_018338 | Ga0500628_018338_161_718 | 185 |
| 1234 | 3300053129 | Ga0500628_075548 | Ga0500628_075548_180_737 | 185 |
| 1235 | 3300053131 | Ga0500652_000123 | Ga0500652_000123_3677_4234 | 185 |
| 1236 | 3300053131 | Ga0500652_208186 | Ga0500652_208186_64_621 | 185 |
| 1237 | 3300053133 | Ga0500655_004744 | Ga0500655_004744_1290_1847 | 185 |
| 1238 | 3300053133 | Ga0500655_017284 | Ga0500655_017284_443_1000 | 185 |
| 1239 | 3300053134 | Ga0500658_0237260 | Ga0500658_0237260_236_793 | 185 |
| 1240 | 3300053136 | Ga0500559_0000407 | Ga0500559_0000407_27088_27645 | 185 |
| 1241 | 3300053136 | Ga0500559_0153931 | Ga0500559_0153931_232_789 | 185 |
| 1242 | 3300053139 | Ga0500568_0112756 | Ga0500568_0112756_363_920 | 185 |
| 1243 | 3300053142 | Ga0500577_0009622 | Ga0500577_0009622_1291_1848 | 185 |
| 1244 | 3300053148 | Ga0500590_023408 | Ga0500590_023408_296_853 | 185 |
| 1245 | 3300053151 | Ga0500604_0007671 | Ga0500604_0007671_601_1158 | 185 |
| 1246 | 3300053154 | Ga0500619_000006 | Ga0500619_000006_6654_7211 | 185 |
| 1247 | 3300053156 | Ga0500622_0000799 | Ga0500622_0000799_4665_5222 | 185 |
| 1248 | 3300053156 | Ga0500622_0006741 | Ga0500622_0006741_1343_1900 | 185 |
| 1249 | 3300053156 | Ga0500622_0095912 | Ga0500622_0095912_245_802 | 185 |
| 1250 | 3300053156 | Ga0500622_0097209 | Ga0500622_0097209_400_960 | 185 |
| 1251 | 3300053177 | Ga0500636_0005079 | Ga0500636_0005079_5270_5827 | 185 |
| 1252 | 3300053730 | Ga0500645_008009 | Ga0500645_008009_2956_3513 | 185 |
| 1253 | 3300053730 | Ga0500645_042335 | Ga0500645_042335_431_988 | 185 |
| 1254 | 3300055283 | Ga0500661_002023 | Ga0500661_002023_1811_2368 | 185 |
| 1255 | 3300059421 | Ga0590071_000174 | Ga0590071_000174_3982_4539 | 185 |
| 1256 | 3300061719 | Ga0466962_0004166 | Ga0466962_0004166_1947_2543 | 185 |
| 1257 | 3300061719 | Ga0466962_0046420 | Ga0466962_0046420_737_1294 | 185 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar