F491190

General Info

Members Datasets Scaffolds Average Seq Length
1172 606 1088 368

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0307818|Ga0501047_0307818_146_1414
Length 422
Sequence MVWMWRAGTLQPAMNIRSIAPTSGLKASAERVREASKVFTDRDNARKRGVSMSRLFEPLQLGNLQLANRIVVAPMCQYSAEEGSATDWHMIHLGHLALSGAGLLVTEATAVSAIGRISPTDLGLYSDDNERALARVLAAIRKYSPIPVAIQLAHAGRKGSSRAPWDGGLQIPPGDAQGWVAEAPSAIPHGNGEVPPAALDAAGLARVREEFALAARRAARAGFDGIELHLAHGYLLHEFLSPLANQRTDAYGGSLENRMRFPLEVFDAVRAAFPADKPVWVRVSASDWVPGGWDVPDTIALGLALKSRGCAAMHVSSGGVSPQQKIALGPGYQVPFAASVKRETGMTTIAVGLITEPQQAEHIVASGEADAVALARAMLYDPRWPWHAAAALGAQVDVPPQYWRSQPREFKDLFRGAAFGQR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
6 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
7 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
8 2547132181 Kosakonia sacchari SP1 Isolate Stem
9 2561511199 Enterobacter sp. R4-368 Isolate Nodule
10 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
11 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
12 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
13 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
14 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
15 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
16 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
17 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
18 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
19 2643221672 Variovorax sp. Root434 Isolate Unclassified
20 2643221736 Bosea sp. Root483D1 Isolate Unclassified
21 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
22 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
23 2738541277 Variovorax sp. GV051 Isolate Unclassified
24 2738541307 Variovorax sp. GV008 Isolate Unclassified
25 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
26 2738543019 Variovorax sp. GV040 Isolate Unclassified
27 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
28 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
29 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
30 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
31 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
32 2818991446 Variovorax sp. 1180 Isolate Unclassified
33 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
34 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
35 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
36 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
37 2841760612 Bosea sp. Tri-49 Isolate Nodule
38 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
39 2844104063 Bosea sp. Tri-39 Isolate Nodule
40 2851182111 Bosea sp. Tri-44 Isolate Nodule
41 2851246043 Bosea sp. Tri-54 Isolate Nodule
42 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
43 2855730933 Achromobacter sp. HZ28 Isolate Nodule
44 2855767633 Achromobacter sp. HZ34 Isolate Nodule
45 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
46 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
47 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
48 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
49 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
50 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
51 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
52 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
53 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
54 2899924645 Variovorax sp. 369 Isolate Unclassified
55 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
56 2904424332 Duganella sp. 1411 Isolate Rhizosphere
57 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
58 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
59 2904504865 Serratia marcescens 1822 Isolate Unclassified
60 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
61 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
62 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
63 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
64 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
65 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
66 2919150387 Rahnella aceris 1817 Isolate Unclassified
67 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
68 2927143783 Rahnella sp. 2050 Isolate Unclassified
69 2928037797 Variovorax sp. 1126 Isolate Unclassified
70 2928044640 Variovorax sp. 1128 Isolate Unclassified
71 2928051484 Variovorax sp. 1133 Isolate Unclassified
72 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
73 2928070936 Variovorax gossypii 1167 Isolate Unclassified
74 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
75 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
76 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
77 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
78 2952252522 Salinicola sp. DM10 Isolate Unclassified
79 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
80 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
81 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
82 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
83 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
84 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
85 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
86 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
87 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
88 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
89 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
90 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
91 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
92 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
93 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
94 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
95 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
96 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
97 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
98 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
99 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
100 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
101 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
102 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
103 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
104 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
105 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
106 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
107 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
108 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
109 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
110 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
111 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
112 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
113 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
114 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
115 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
116 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
117 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
118 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
119 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
120 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
121 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
122 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
123 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
124 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
125 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
126 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
127 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
128 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
129 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
130 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
131 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
132 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
133 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
134 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
135 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
136 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
137 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
138 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
139 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
140 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
141 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
142 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
143 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
144 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
145 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
146 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
147 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
148 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
149 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
150 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
151 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
152 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
153 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
154 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
155 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
156 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
157 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
158 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
159 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
160 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
161 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
162 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
163 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
164 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
165 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
166 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
167 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
168 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
169 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
170 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
171 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
172 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
173 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
174 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
175 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
176 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
177 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
178 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
179 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
180 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
181 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
182 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
183 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
184 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
185 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
186 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
187 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
188 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
189 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
190 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
191 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
192 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
193 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
194 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
195 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
196 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
197 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
198 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
199 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
200 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
201 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
202 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
203 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
204 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
205 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
206 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
207 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
208 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
209 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
210 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
211 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
212 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
213 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
214 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
215 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
216 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
217 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
218 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
219 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
220 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
221 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
222 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
223 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
224 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
225 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
226 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
227 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
228 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
229 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
230 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
231 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
232 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
233 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
234 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
235 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
236 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
237 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
238 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
239 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
240 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
241 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
242 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
243 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
244 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
245 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
246 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
247 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
248 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
249 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
250 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
251 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
252 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
253 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
254 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
255 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
261 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
262 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
264 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
267 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
268 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
269 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
271 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
272 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
273 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
274 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
275 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
276 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
277 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
278 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
279 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
348 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
349 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
350 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
351 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
352 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
353 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
354 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
355 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
359 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
360 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
361 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
362 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
363 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
364 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
365 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
366 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
367 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
368 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
369 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
370 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
371 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
372 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
373 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
374 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
375 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
376 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
377 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
378 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
379 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
380 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
381 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
382 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
383 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
384 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
385 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
386 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
387 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
388 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
389 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
390 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
391 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
392 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
393 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
394 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
395 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
396 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
397 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
398 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
399 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
400 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
401 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
402 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
403 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
404 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
405 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
406 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
407 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
408 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
409 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
410 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
411 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
412 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
413 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
414 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
415 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
416 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
417 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
418 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
419 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
420 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
421 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
422 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
423 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
424 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
425 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
426 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
427 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
428 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
429 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
430 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
431 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
432 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
433 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
434 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
435 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
436 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
437 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
438 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
439 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
440 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
441 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
442 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
443 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
444 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
445 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
446 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
447 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
448 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
449 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
450 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
451 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
452 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
453 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
454 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
455 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
456 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
457 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
458 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
459 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
460 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
461 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
462 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
463 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
464 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
465 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
466 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
467 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
468 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
469 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
470 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
471 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
472 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
473 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
474 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
475 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
476 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
477 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
478 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
479 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
480 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
481 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
482 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
483 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
484 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
485 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
486 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
487 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
488 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
489 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
490 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
491 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
492 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
493 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
494 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
495 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
496 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
497 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
498 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
499 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
500 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
501 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
502 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
503 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
504 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
505 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
506 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
507 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
508 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
509 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
510 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
511 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
512 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
513 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
514 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
515 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
516 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
517 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
518 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
519 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
520 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
521 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
522 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
523 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
524 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
525 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
526 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
527 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
528 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
529 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
530 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
531 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
532 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
533 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
534 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
535 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
536 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
537 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
538 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
539 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
540 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
541 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
542 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
543 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
544 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
545 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
546 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
547 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
548 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
549 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
550 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
551 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
552 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
553 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
554 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
555 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
556 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
557 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
558 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
559 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
560 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
561 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
562 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
563 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
564 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
565 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
566 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
567 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
568 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
569 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
570 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
571 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
572 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
573 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
574 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
575 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
576 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
577 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
578 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
579 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
580 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
581 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
582 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
583 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
584 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
585 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
586 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
587 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
588 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
589 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
590 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
591 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
592 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
593 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
594 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
595 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
596 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
597 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
598 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
599 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
600 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
601 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
602 641522639 Methylobacterium sp. 4-46 Isolate Nodule
603 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
604 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
605 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
606 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.75
Metatranscriptomes 0.09
Isolates 7.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.87
Nodule 1.28
Rhizoplane 6.06
Rhizosphere 74.4
Stem 0.09
Stem Tuber 0.43
Unclassified 8.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_179494 2162886007 Bacteria 2379
2 2214772996 2209111006 Bacteria 11536
3 ARSoilYngRDRAFT_c00480 3300000042 Bacteria 4764
4 ARcpr5yngRDRAFT_c000101 3300000043 Bacteria 13551
5 ARSoilOldRDRAFT_c000111 3300000044 Bacteria 14542
6 ARCol0yngRDRAFT_1000021 3300000652 Bacteria 30221
7 JGI24752J21851_1000948 3300001976 Bacteria 3964
8 JGI24746J21847_1000005 3300001977 Bacteria 23312
9 JGI24739J22299_10000902 3300001989 Bacteria 10985
10 JGI24739J22299_10004819 3300001989 Bacteria 5143
11 JGI24750J21931_1000059 3300002070 Bacteria 15603
12 JGI24748J21848_1000644 3300002074 Bacteria 3744
13 JGI24738J21930_10000278 3300002075 Bacteria 14037
14 JGI24744J21845_10000309 3300002077 Bacteria 8188
15 JGI24035J26624_1000329 3300002126 Bacteria 4420
16 JGI24033J26618_1003778 3300002155 Bacteria 1610
17 JGI24742J22300_10000270 3300002244 Bacteria 7778
18 JGI24751J29686_10009481 3300002459 Bacteria 2002
19 JGI25162J39368_1000084 3300002737 Bacteria 108880
20 JGI25162J39368_1004064 3300002737 Bacteria 3647
21 JGI25163J39215_1000245 3300002771 Bacteria 19957
22 JGI25164J39214_1000062 3300002772 Bacteria 108882
23 JGI25152J39213_1000198 3300002773 Bacteria 40131
24 JGI25152J39213_1004385 3300002773 Bacteria 4456
25 JGI25151J46595_10001308 3300003187 Bacteria 17444
26 JGI25151J46595_10009962 3300003187 Bacteria 4456
27 JGI25151J46595_10022380 3300003187 Bacteria 2626
28 JGI25153J46596_10009634 3300003215 Bacteria 4456
29 rootH2_10196814 3300003320 Bacteria 3648
30 rootL2_10089387 3300003322 Bacteria 2633
31 rootH1_10264660 3300003323 Bacteria 3568
32 JGI25160J50197_1007031 3300003354 Bacteria 4456
33 JGI25404J52841_10000234 3300003659 Bacteria 6922
34 Ga0055538_1000060 3300003751 Bacteria 108880
35 Ga0055539_1000092 3300003752 Bacteria 108880
36 Ga0055533_1000101 3300003756 Bacteria 108880
37 Ga0055525_1000134 3300003759 Bacteria 108880
38 Ga0055535_1000069 3300003761 Bacteria 115207
39 Ga0055542_1000084 3300003762 Bacteria 125518
40 Ga0055526_1008447 3300003771 Bacteria 5136
41 Ga0055537_1003177 3300003773 Bacteria 5136
42 Ga0055537_1005002 3300003773 Bacteria 3638
43 Ga0055524_1006091 3300003775 Bacteria 5280
44 Ga0055524_1007575 3300003775 Bacteria 4592
45 Ga0055534_1003969 3300003784 Bacteria 4456
46 Ga0055534_1005085 3300003784 Bacteria 3622
47 Ga0055528_1006817 3300003790 Bacteria 5136
48 Ga0055540_1008808 3300003792 Bacteria 3577
49 Ga0055531_10002481 3300003794 Bacteria 12305
50 Ga0055531_10015966 3300003794 Bacteria 3270
51 Ga0055541_1000062 3300003841 Bacteria 108880
52 Ga0058692_1000043 3300003856 Bacteria 119173
53 Ga0058692_1000047 3300003856 Bacteria 112440
54 Ga0058692_1000055 3300003856 Bacteria 105550
55 Ga0058692_1005227 3300003856 Bacteria 3730
56 Ga0058692_1011006 3300003856 Bacteria 2209
57 JGI25405J52794_10005502 3300003911 Bacteria 2286
58 Ga0055543_1002903 3300004625 Bacteria 5373
59 Ga0055543_1008619 3300004625 Bacteria 2247
60 Ga0065165_1000150 3300005262 Bacteria 121992
61 Ga0065165_1007537 3300005262 Bacteria 5318
62 Ga0065714_10014552 3300005288 Bacteria 1781
63 Ga0065704_10000664 3300005289 Bacteria 46630
64 Ga0065712_10071326 3300005290 Bacteria 5337
65 Ga0065715_10000270 3300005293 Bacteria 17149
66 Ga0070658_10006794 3300005327 Bacteria 9255
67 Ga0070658_10011263 3300005327 Bacteria 7168
68 Ga0070658_10072861 3300005327 Bacteria 2816
69 Ga0070658_10353495 3300005327 Bacteria 1258
70 Ga0070676_10000194 3300005328 Bacteria 25376
71 Ga0070683_100001461 3300005329 Bacteria 18165
72 Ga0070683_100103922 3300005329 Bacteria 2677
73 Ga0070690_100002052 3300005330 Bacteria 10748
74 Ga0070690_100018916 3300005330 Bacteria 4170
75 Ga0070690_100057349 3300005330 Bacteria 2499
76 Ga0070670_100023270 3300005331 Bacteria 5333
77 Ga0070670_100123214 3300005331 Bacteria 2236
78 Ga0070677_10000223 3300005333 Bacteria 19560
79 Ga0068869_100000910 3300005334 Bacteria 17020
80 Ga0070666_10020841 3300005335 Bacteria 4242
81 Ga0070666_10278561 3300005335 Bacteria 1188
82 Ga0070680_100011303 3300005336 Bacteria 6903
83 Ga0070680_100013453 3300005336 Bacteria 6374
84 Ga0070680_100062133 3300005336 Bacteria 3058
85 Ga0070680_100090091 3300005336 Bacteria 2539
86 Ga0070680_100126842 3300005336 Bacteria 2132
87 Ga0070682_100000411 3300005337 Bacteria 27934
88 Ga0070682_100044608 3300005337 Bacteria 2746
89 Ga0068868_100002658 3300005338 Bacteria 12396
90 Ga0070660_100001846 3300005339 Bacteria 14572
91 Ga0070660_100004007 3300005339 Bacteria 10167
92 Ga0070660_100027146 3300005339 Bacteria 4271
93 Ga0070660_100068030 3300005339 Bacteria 2775
94 Ga0070660_100093718 3300005339 Bacteria 2372
95 Ga0070660_100123565 3300005339 Bacteria 2067
96 Ga0070689_100001606 3300005340 Bacteria 14434
97 Ga0070691_10001869 3300005341 Bacteria 9200
98 Ga0070691_10025121 3300005341 Bacteria 2773
99 Ga0070687_100000727 3300005343 Bacteria 10925
100 Ga0070661_100001236 3300005344 Bacteria 17965
101 Ga0070661_100028883 3300005344 Bacteria 4002
102 Ga0070692_10002603 3300005345 Bacteria 7037
103 Ga0070668_100002586 3300005347 Bacteria 13300
104 Ga0070668_100051079 3300005347 Bacteria 3185
105 Ga0070668_100051503 3300005347 Bacteria 3172
106 Ga0070668_100065655 3300005347 Bacteria 2815
107 Ga0070669_100002152 3300005353 Bacteria 14248
108 Ga0070675_100002725 3300005354 Bacteria 13279
109 Ga0070675_100016211 3300005354 Bacteria 5911
110 Ga0070675_100069193 3300005354 Bacteria 2924
111 Ga0070671_100000024 3300005355 Bacteria 122109
112 Ga0070671_100000400 3300005355 Bacteria 29909
113 Ga0070671_100012085 3300005355 Bacteria 6946
114 Ga0070671_100153813 3300005355 Bacteria 1943
115 Ga0070671_100165420 3300005355 Bacteria 1870
116 Ga0070674_100001765 3300005356 Bacteria 11732
117 Ga0070674_100086083 3300005356 Bacteria 2257
118 Ga0070673_100000169 3300005364 Bacteria 31478
119 Ga0070673_100116828 3300005364 Bacteria 2220
120 Ga0070688_100000757 3300005365 Bacteria 15949
121 Ga0070688_100002817 3300005365 Bacteria 8852
122 Ga0070688_100003731 3300005365 Bacteria 7883
123 Ga0070659_100000655 3300005366 Bacteria 25206
124 Ga0070659_100001586 3300005366 Bacteria 16387
125 Ga0070659_100061921 3300005366 Bacteria 2957
126 Ga0070667_100000018 3300005367 Bacteria 226033
127 Ga0070667_100001596 3300005367 Bacteria 20275
128 Ga0070667_100022988 3300005367 Bacteria 5169
129 Ga0070667_100027904 3300005367 Bacteria 4697
130 Ga0070703_10005976 3300005406 Bacteria 3406
131 Ga0070709_10215533 3300005434 Bacteria 1367
132 Ga0070714_100019824 3300005435 Bacteria 5485
133 Ga0070713_100014412 3300005436 Bacteria 5872
134 Ga0070713_100040260 3300005436 Bacteria 3798
135 Ga0070710_10021998 3300005437 Bacteria 3330
136 Ga0070701_10000774 3300005438 Bacteria 11424
137 Ga0070705_100001954 3300005440 Bacteria 10554
138 Ga0070705_100262542 3300005440 Bacteria 1219
139 Ga0070700_100001821 3300005441 Bacteria 10759
140 Ga0070700_100205305 3300005441 Bacteria 1387
141 Ga0070694_100001416 3300005444 Bacteria 14051
142 Ga0070663_100000593 3300005455 Bacteria 19280
143 Ga0070663_100107879 3300005455 Bacteria 2088
144 Ga0070678_100000301 3300005456 Bacteria 22947
145 Ga0070678_100004800 3300005456 Bacteria 7714
146 Ga0070662_100001940 3300005457 Bacteria 12717
147 Ga0070662_100005709 3300005457 Bacteria 7968
148 Ga0070662_100142926 3300005457 Bacteria 1856
149 Ga0070681_10014859 3300005458 Bacteria 7740
150 Ga0070681_10024101 3300005458 Bacteria 6126
151 Ga0070681_10030328 3300005458 Bacteria 5426
152 Ga0070681_10051355 3300005458 Bacteria 4112
153 Ga0070681_10339905 3300005458 Bacteria 1411
154 Ga0068867_100002072 3300005459 Bacteria 14049
155 Ga0068867_100042681 3300005459 Bacteria 3319
156 Ga0068867_100069950 3300005459 Bacteria 2622
157 Ga0070685_10000001 3300005466 Bacteria 349867
158 Ga0070685_10008779 3300005466 Bacteria 5204
159 Ga0070698_100223529 3300005471 Bacteria 1816
160 Ga0070679_100012097 3300005530 Bacteria 8243
161 Ga0070679_100022903 3300005530 Bacteria 6109
162 Ga0070679_100068424 3300005530 Bacteria 3542
163 Ga0070679_100093531 3300005530 Bacteria 2993
164 Ga0070679_100300950 3300005530 Bacteria 1554
165 Ga0070684_100005903 3300005535 Bacteria 9430
166 Ga0070684_100018107 3300005535 Bacteria 5794
167 Ga0070684_100041105 3300005535 Bacteria 3985
168 Ga0070684_100361084 3300005535 Bacteria 1337
169 Ga0070697_100130535 3300005536 Bacteria 2107
170 Ga0068853_100000049 3300005539 Bacteria 90347
171 Ga0068853_100009652 3300005539 Bacteria 7778
172 Ga0068853_100363998 3300005539 Bacteria 1348
173 Ga0070672_100000611 3300005543 Bacteria 21001
174 Ga0070686_100001276 3300005544 Bacteria 14248
175 Ga0070695_100002211 3300005545 Bacteria 11155
176 Ga0070695_100002233 3300005545 Bacteria 11088
177 Ga0070695_100002508 3300005545 Bacteria 10579
178 Ga0070696_100038028 3300005546 Bacteria 3320
179 Ga0070696_100087462 3300005546 Bacteria 2214
180 Ga0070693_100001538 3300005547 Bacteria 10416
181 Ga0070665_100031263 3300005548 Bacteria 5358
182 Ga0070665_100036747 3300005548 Bacteria 4925
183 Ga0070665_100146475 3300005548 Bacteria 2364
184 Ga0070665_100211083 3300005548 Bacteria 1942
185 Ga0070704_100001853 3300005549 Bacteria 11658
186 Ga0068855_100002375 3300005563 Bacteria 23200
187 Ga0068855_100011650 3300005563 Bacteria 10627
188 Ga0068855_100065238 3300005563 Bacteria 4245
189 Ga0068855_100074018 3300005563 Bacteria 3956
190 Ga0068855_100126773 3300005563 Bacteria 2918
191 Ga0068855_100147182 3300005563 Bacteria 2680
192 Ga0068855_100147794 3300005563 Bacteria 2674
193 Ga0070664_100024208 3300005564 Bacteria 5021
194 Ga0070664_100105013 3300005564 Bacteria 2460
195 Ga0070664_100119986 3300005564 Bacteria 2301
196 Ga0068857_100003420 3300005577 Bacteria 13238
197 Ga0068857_100185896 3300005577 Bacteria 1892
198 Ga0068854_100000129 3300005578 Bacteria 52076
199 Ga0068854_100001082 3300005578 Bacteria 16400
200 Ga0068854_100175138 3300005578 Bacteria 1672
201 Ga0068856_100006654 3300005614 Bacteria 11325
202 Ga0068856_100157768 3300005614 Bacteria 2279
203 Ga0068856_100169222 3300005614 Bacteria 2197
204 Ga0068856_100226520 3300005614 Bacteria 1885
205 Ga0068856_100259546 3300005614 Bacteria 1753
206 Ga0068852_100003054 3300005616 Bacteria 11648
207 Ga0068852_100015790 3300005616 Bacteria 5871
208 Ga0068852_100058996 3300005616 Bacteria 3327
209 Ga0068859_100006509 3300005617 Bacteria 11858
210 Ga0068859_100079116 3300005617 Bacteria 3327
211 Ga0068859_100164577 3300005617 Bacteria 2297
212 Ga0068859_100357221 3300005617 Bacteria 1556
213 Ga0068864_100000003 3300005618 Bacteria 568775
214 Ga0068864_100001244 3300005618 Bacteria 21163
215 Ga0068864_100024235 3300005618 Bacteria 5103
216 Ga0068866_10000500 3300005718 Bacteria 18096
217 Ga0068861_100003449 3300005719 Bacteria 10495
218 Ga0068851_10004471 3300005834 Bacteria 6310
219 Ga0068870_10000015 3300005840 Bacteria 63346
220 Ga0068870_10093499 3300005840 Bacteria 1686
221 Ga0068863_100003914 3300005841 Bacteria 14708
222 Ga0068863_100043836 3300005841 Bacteria 4247
223 Ga0068863_100105141 3300005841 Bacteria 2686
224 Ga0068858_100002760 3300005842 Bacteria 17647
225 Ga0068858_100004772 3300005842 Bacteria 13275
226 Ga0068858_100113326 3300005842 Bacteria 2533
227 Ga0068858_100160152 3300005842 Bacteria 2119
228 Ga0068858_100317014 3300005842 Bacteria 1490
229 Ga0068860_100000478 3300005843 Bacteria 49822
230 Ga0068860_100003116 3300005843 Bacteria 17138
231 Ga0068862_100001424 3300005844 Bacteria 22164
232 Ga0068862_100003903 3300005844 Bacteria 12673
233 Ga0068862_100176586 3300005844 Bacteria 1915
234 Ga0081455_10000081 3300005937 Bacteria 103752
235 Ga0081455_10000341 3300005937 Bacteria 61041
236 Ga0081540_1000195 3300005983 Bacteria 62863
237 Ga0081540_1000493 3300005983 Bacteria 38816
238 Ga0081540_1011092 3300005983 Bacteria 6050
239 Ga0081540_1055753 3300005983 Bacteria 1923
240 Ga0070717_10014273 3300006028 Bacteria 6110
241 Ga0075364_10027418 3300006051 Bacteria 3639
242 Ga0070715_10014818 3300006163 Bacteria 2896
243 Ga0070712_100016368 3300006175 Bacteria 4789
244 Ga0070712_100126903 3300006175 Bacteria 1928
245 Ga0075367_10022567 3300006178 Bacteria 3532
246 Ga0075367_10031602 3300006178 Bacteria 3041
247 Ga0075366_10018799 3300006195 Bacteria 3993
248 Ga0097621_100001400 3300006237 Bacteria 16606
249 Ga0097621_100075291 3300006237 Bacteria 2797
250 Ga0075370_10034075 3300006353 Bacteria 2854
251 Ga0068871_100000359 3300006358 Bacteria 31822
252 Ga0068871_100003972 3300006358 Bacteria 10218
253 Ga0068871_100009090 3300006358 Bacteria 7179
254 Ga0075433_10001122 3300006852 Bacteria 19376
255 Ga0075433_10009420 3300006852 Bacteria 7806
256 Ga0075434_100000760 3300006871 Bacteria 25464
257 Ga0075434_100001564 3300006871 Bacteria 19411
258 Ga0075434_100058075 3300006871 Bacteria 3846
259 Ga0075434_100310236 3300006871 Bacteria 1598
260 Ga0075434_100492441 3300006871 Bacteria 1247
261 Ga0068865_100000439 3300006881 Bacteria 23089
262 Ga0068865_100019171 3300006881 Bacteria 4425
263 Ga0075436_100139744 3300006914 Bacteria 1702
264 Ga0097620_100006509 3300006931 Bacteria 11858
265 Ga0097620_100079117 3300006931 Bacteria 3327
266 Ga0097620_100164584 3300006931 Bacteria 2297
267 Ga0097620_100357160 3300006931 Bacteria 1556
268 Ga0079104_1001697 3300006946 Bacteria 14081
269 Ga0099795_10002598 3300007788 Bacteria 4288
270 Ga0105251_10025058 3300009011 Bacteria 3056
271 Ga0105244_10000418 3300009036 Bacteria 39533
272 Ga0105244_10000748 3300009036 Bacteria 27805
273 Ga0105244_10011426 3300009036 Bacteria 5327
274 Ga0105250_10000039 3300009092 Bacteria 136696
275 Ga0105250_10000743 3300009092 Bacteria 19865
276 Ga0105240_10003634 3300009093 Bacteria 23891
277 Ga0105240_10006246 3300009093 Bacteria 17532
278 Ga0105240_10391429 3300009093 Bacteria 1567
279 Ga0105240_10514829 3300009093 Bacteria 1329
280 Ga0111539_10007371 3300009094 Bacteria 14093
281 Ga0111539_10007413 3300009094 Bacteria 14057
282 Ga0111539_10041772 3300009094 Bacteria 5511
283 Ga0111539_10345350 3300009094 Bacteria 1732
284 Ga0105245_10001227 3300009098 Bacteria 23145
285 Ga0105245_10005335 3300009098 Bacteria 11293
286 Ga0105245_10145284 3300009098 Bacteria 2237
287 Ga0105245_10201582 3300009098 Bacteria 1911
288 Ga0105245_10361338 3300009098 Bacteria 1441
289 Ga0105247_10007195 3300009101 Bacteria 6832
290 Ga0105247_10056412 3300009101 Bacteria 2426
291 Ga0114129_10157084 3300009147 Bacteria 3109
292 Ga0105243_10001341 3300009148 Bacteria 21936
293 Ga0105243_10006861 3300009148 Bacteria 8778
294 Ga0105243_10018182 3300009148 Bacteria 5321
295 Ga0105243_10055695 3300009148 Bacteria 3142
296 Ga0105241_10061679 3300009174 Bacteria 2888
297 Ga0105242_10000411 3300009176 Bacteria 34068
298 Ga0105242_10023552 3300009176 Bacteria 4852
299 Ga0105242_10119562 3300009176 Bacteria 2258
300 Ga0105242_10200728 3300009176 Bacteria 1771
301 Ga0105248_10009088 3300009177 Bacteria 10930
302 Ga0105248_10010917 3300009177 Bacteria 10021
303 Ga0105248_10081678 3300009177 Bacteria 3633
304 Ga0105248_10341972 3300009177 Bacteria 1684
305 Ga0105248_10344196 3300009177 Bacteria 1678
306 Ga0105237_10012158 3300009545 Bacteria 9081
307 Ga0105237_10016890 3300009545 Bacteria 7574
308 Ga0105237_10068141 3300009545 Bacteria 3553
309 Ga0105237_10269459 3300009545 Bacteria 1706
310 Ga0105238_10032313 3300009551 Bacteria 5325
311 Ga0105238_10106443 3300009551 Bacteria 2786
312 Ga0105238_10248464 3300009551 Bacteria 1757
313 Ga0105249_10003261 3300009553 Bacteria 14057
314 Ga0105249_10007504 3300009553 Bacteria 9514
315 Ga0105249_10081191 3300009553 Bacteria 3014
316 Ga0105249_10337878 3300009553 Bacteria 1522
317 Ga0105239_10006472 3300010375 Bacteria 13584
318 Ga0105239_10008469 3300010375 Bacteria 11691
319 Ga0105239_10092269 3300010375 Bacteria 3343
320 Ga0105239_10406010 3300010375 Bacteria 1542
321 Ga0105246_10000384 3300011119 Bacteria 23571
322 Ga0105246_10097438 3300011119 Bacteria 2134
323 Ga0157320_1000177 3300012481 Bacteria 2096
324 Ga0157341_1001479 3300012494 Bacteria 1429
325 Ga0157373_10166355 3300013100 Bacteria 1552
326 Ga0157371_10000101 3300013102 Bacteria 129981
327 Ga0157371_10009572 3300013102 Bacteria 7620
328 Ga0157370_10023716 3300013104 Bacteria 6089
329 Ga0157370_10209952 3300013104 Bacteria 1805
330 Ga0157369_10002439 3300013105 Bacteria 22344
331 Ga0157369_10090925 3300013105 Bacteria 3259
332 Ga0157378_10005961 3300013297 Bacteria 10682
333 Ga0157378_10087636 3300013297 Bacteria 2824
334 Ga0157378_10119504 3300013297 Bacteria 2427
335 Ga0157378_10521053 3300013297 Bacteria 1190
336 Ga0163162_10001455 3300013306 Bacteria 22021
337 Ga0163162_10005169 3300013306 Bacteria 12585
338 Ga0157372_10001000 3300013307 Bacteria 30877
339 Ga0157372_10035365 3300013307 Bacteria 5499
340 Ga0157372_10059126 3300013307 Bacteria 4286
341 Ga0157372_10127126 3300013307 Bacteria 2931
342 Ga0157375_10005043 3300013308 Bacteria 11469
343 Ga0157375_10032741 3300013308 Bacteria 4932
344 Ga0163163_10011894 3300014325 Bacteria 7916
345 Ga0163163_10066143 3300014325 Bacteria 3589
346 Ga0163163_10170586 3300014325 Bacteria 2222
347 Ga0163163_10242690 3300014325 Bacteria 1851
348 Ga0157380_10003014 3300014326 Bacteria 11472
349 Ga0157377_10000224 3300014745 Bacteria 29648
350 Ga0157379_10002183 3300014968 Bacteria 16272
351 Ga0157379_10024465 3300014968 Bacteria 5360
352 Ga0157379_10042697 3300014968 Bacteria 4049
353 Ga0157379_10063592 3300014968 Bacteria 3299
354 Ga0157376_10001879 3300014969 Bacteria 14015
355 Ga0157376_10004001 3300014969 Bacteria 10191
356 Ga0163161_10000471 3300017792 Bacteria 33465
357 Ga0163161_10018737 3300017792 Bacteria 4852
358 Ga0163161_10035790 3300017792 Bacteria 3555
359 Ga0206356_10495441 3300020070 Bacteria 2899
360 Ga0213872_10035362 3300021361 Bacteria 2285
361 Ga0213876_10048152 3300021384 Bacteria 2253
362 Ga0209760_100001 3300025207 Bacteria 348781
363 Ga0209436_106393 3300025208 Bacteria 2585
364 Ga0209784_100001 3300025224 Bacteria 3600592
365 Ga0209566_100001 3300025225 Bacteria 3600765
366 Ga0209674_100002 3300025226 Bacteria 3600592
367 Ga0209672_101496 3300025228 Bacteria 8164
368 Ga0209563_100008 3300025230 Bacteria 1554545
369 Ga0207427_100002 3300025231 Bacteria 1355321
370 Ga0209437_100007 3300025233 Bacteria 938377
371 Ga0209258_100093 3300025242 Bacteria 223559
372 Ga0207425_1002336 3300025245 Bacteria 6779
373 Ga0209677_100004 3300025253 Bacteria 1554545
374 Ga0209148_1000007 3300025254 Bacteria 1592273
375 Ga0209129_1000015 3300025258 Bacteria 487967
376 Ga0209129_1000147 3300025258 Bacteria 115120
377 Ga0209233_1005667 3300025261 Bacteria 4120
378 Ga0209565_1000109 3300025263 Bacteria 120345
379 Ga0209565_1000534 3300025263 Bacteria 26749
380 Ga0207666_1000074 3300025271 Bacteria 16511
381 Ga0207666_1000672 3300025271 Bacteria 4096
382 Ga0209673_1010944 3300025273 Bacteria 3783
383 Ga0209673_1045579 3300025273 Bacteria 1204
384 Ga0209130_1000916 3300025284 Bacteria 23720
385 Ga0209130_1001086 3300025284 Bacteria 20315
386 Ga0207673_1000705 3300025290 Bacteria 3571
387 Ga0209675_1000379 3300025291 Bacteria 36995
388 Ga0209675_1002300 3300025291 Bacteria 9913
389 Ga0209025_1000057 3300025294 Bacteria 314601
390 Ga0209025_1000194 3300025294 Bacteria 148593
391 Ga0209025_1000307 3300025294 Bacteria 108704
392 Ga0209025_1001123 3300025294 Bacteria 38329
393 Ga0209025_1003590 3300025294 Bacteria 14484
394 Ga0209025_1032840 3300025294 Bacteria 2416
395 Ga0209564_1000327 3300025295 Bacteria 92740
396 Ga0209564_1003792 3300025295 Bacteria 9828
397 Ga0209758_1000199 3300025297 Bacteria 133164
398 Ga0209758_1029495 3300025297 Bacteria 2292
399 Ga0209256_1000151 3300025299 Bacteria 145299
400 Ga0209256_1002908 3300025299 Bacteria 12916
401 Ga0207426_1000049 3300025302 Bacteria 401954
402 Ga0207426_1016136 3300025302 Bacteria 2691
403 Ga0209051_1000301 3300025303 Bacteria 77933
404 Ga0209051_1000354 3300025303 Bacteria 68119
405 Ga0209051_1009720 3300025303 Bacteria 4929
406 Ga0209257_1000022 3300025304 Bacteria 765258
407 Ga0207697_10001234 3300025315 Bacteria 14009
408 Ga0207656_10008685 3300025321 Bacteria 3748
409 Ga0207696_1000026 3300025711 Bacteria 418166
410 Ga0207696_1000625 3300025711 Bacteria 25945
411 Ga0207655_1000894 3300025728 Bacteria 31361
412 Ga0207655_1001329 3300025728 Bacteria 23332
413 Ga0207655_1010887 3300025728 Bacteria 5469
414 Ga0207653_10010869 3300025885 Bacteria 2840
415 Ga0207682_10000169 3300025893 Bacteria 30010
416 Ga0207642_10001573 3300025899 Bacteria 7032
417 Ga0207710_10002213 3300025900 Bacteria 9144
418 Ga0207710_10003166 3300025900 Bacteria 7368
419 Ga0207688_10000157 3300025901 Bacteria 29271
420 Ga0207680_10004108 3300025903 Bacteria 6885
421 Ga0207680_10018417 3300025903 Bacteria 3711
422 Ga0207680_10086011 3300025903 Bacteria 1987
423 Ga0207647_10000205 3300025904 Bacteria 48382
424 Ga0207647_10001770 3300025904 Bacteria 16576
425 Ga0207699_10145371 3300025906 Bacteria 1563
426 Ga0207645_10003164 3300025907 Bacteria 12604
427 Ga0207643_10000004 3300025908 Bacteria 187006
428 Ga0207705_10212602 3300025909 Bacteria 1467
429 Ga0207654_10001412 3300025911 Bacteria 12738
430 Ga0207654_10005887 3300025911 Bacteria 6177
431 Ga0207707_10000992 3300025912 Bacteria 27254
432 Ga0207707_10027076 3300025912 Bacteria 5012
433 Ga0207707_10031970 3300025912 Bacteria 4607
434 Ga0207707_10062197 3300025912 Bacteria 3248
435 Ga0207707_10153007 3300025912 Bacteria 2017
436 Ga0207695_10027245 3300025913 Bacteria 6366
437 Ga0207695_10048660 3300025913 Bacteria 4476
438 Ga0207695_10056865 3300025913 Bacteria 4068
439 Ga0207671_10005808 3300025914 Bacteria 11222
440 Ga0207671_10012511 3300025914 Bacteria 6815
441 Ga0207671_10110335 3300025914 Bacteria 2093
442 Ga0207693_10001228 3300025915 Bacteria 22855
443 Ga0207693_10082116 3300025915 Bacteria 2524
444 Ga0207663_10057725 3300025916 Bacteria 2446
445 Ga0207660_10000307 3300025917 Bacteria 32222
446 Ga0207660_10044506 3300025917 Bacteria 3123
447 Ga0207660_10057522 3300025917 Bacteria 2785
448 Ga0207662_10000850 3300025918 Bacteria 14080
449 Ga0207657_10001379 3300025919 Bacteria 25926
450 Ga0207657_10002203 3300025919 Bacteria 21123
451 Ga0207657_10008189 3300025919 Bacteria 10651
452 Ga0207657_10029120 3300025919 Bacteria 5031
453 Ga0207657_10041021 3300025919 Bacteria 4096
454 Ga0207657_10175869 3300025919 Bacteria 1732
455 Ga0207649_10001352 3300025920 Bacteria 14567
456 Ga0207652_10002958 3300025921 Bacteria 14201
457 Ga0207652_10055916 3300025921 Bacteria 3396
458 Ga0207652_10064427 3300025921 Bacteria 3171
459 Ga0207646_10198128 3300025922 Bacteria 1814
460 Ga0207681_10001165 3300025923 Bacteria 16949
461 Ga0207681_10059100 3300025923 Bacteria 2627
462 Ga0207694_10002672 3300025924 Bacteria 14432
463 Ga0207694_10168088 3300025924 Bacteria 1774
464 Ga0207650_10000003 3300025925 Bacteria 1123235
465 Ga0207650_10007784 3300025925 Bacteria 7304
466 Ga0207659_10000038 3300025926 Bacteria 93848
467 Ga0207659_10078264 3300025926 Bacteria 2436
468 Ga0207687_10000966 3300025927 Bacteria 19517
469 Ga0207687_10005917 3300025927 Bacteria 8089
470 Ga0207687_10059041 3300025927 Bacteria 2701
471 Ga0207664_10147467 3300025929 Bacteria 1996
472 Ga0207664_10160249 3300025929 Bacteria 1918
473 Ga0207644_10000013 3300025931 Bacteria 185370
474 Ga0207644_10000785 3300025931 Bacteria 20137
475 Ga0207644_10081528 3300025931 Bacteria 2391
476 Ga0207644_10159425 3300025931 Bacteria 1753
477 Ga0207690_10000805 3300025932 Bacteria 20116
478 Ga0207690_10001643 3300025932 Bacteria 13827
479 Ga0207690_10063829 3300025932 Bacteria 2513
480 Ga0207706_10003945 3300025933 Bacteria 14055
481 Ga0207706_10004195 3300025933 Bacteria 13568
482 Ga0207706_10126173 3300025933 Bacteria 2251
483 Ga0207686_10001021 3300025934 Bacteria 16572
484 Ga0207686_10009204 3300025934 Bacteria 5357
485 Ga0207709_10000645 3300025935 Bacteria 28329
486 Ga0207709_10010819 3300025935 Bacteria 5025
487 Ga0207709_10023439 3300025935 Bacteria 3512
488 Ga0207670_10001354 3300025936 Bacteria 12918
489 Ga0207670_10029551 3300025936 Bacteria 3493
490 Ga0207669_10000063 3300025937 Bacteria 53494
491 Ga0207669_10037738 3300025937 Bacteria 2775
492 Ga0207669_10063360 3300025937 Bacteria 2282
493 Ga0207704_10000540 3300025938 Bacteria 16845
494 Ga0207704_10119975 3300025938 Bacteria 1797
495 Ga0207704_10172593 3300025938 Bacteria 1553
496 Ga0207665_10002733 3300025939 Bacteria 11833
497 Ga0207665_10012974 3300025939 Bacteria 5478
498 Ga0207691_10004163 3300025940 Bacteria 14055
499 Ga0207711_10000822 3300025941 Bacteria 30335
500 Ga0207711_10002693 3300025941 Bacteria 15699
501 Ga0207711_10010594 3300025941 Bacteria 7665
502 Ga0207711_10011422 3300025941 Bacteria 7383
503 Ga0207711_10020036 3300025941 Bacteria 5574
504 Ga0207689_10001269 3300025942 Bacteria 24346
505 Ga0207689_10001462 3300025942 Bacteria 22616
506 Ga0207689_10008666 3300025942 Bacteria 8853
507 Ga0207661_10001037 3300025944 Bacteria 18451
508 Ga0207661_10172123 3300025944 Bacteria 1885
509 Ga0207679_10000673 3300025945 Bacteria 22925
510 Ga0207679_10107168 3300025945 Bacteria 2198
511 Ga0207667_10020248 3300025949 Bacteria 7403
512 Ga0207667_10022346 3300025949 Bacteria 6990
513 Ga0207667_10044826 3300025949 Bacteria 4685
514 Ga0207667_10127128 3300025949 Bacteria 2626
515 Ga0207667_10372545 3300025949 Bacteria 1455
516 Ga0207651_10000116 3300025960 Bacteria 33936
517 Ga0207651_10169104 3300025960 Bacteria 1722
518 Ga0207651_10307417 3300025960 Bacteria 1321
519 Ga0207712_10002012 3300025961 Bacteria 13339
520 Ga0207712_10004960 3300025961 Bacteria 8417
521 Ga0207668_10000300 3300025972 Bacteria 32440
522 Ga0207668_10043709 3300025972 Bacteria 3043
523 Ga0207668_10076618 3300025972 Bacteria 2409
524 Ga0207640_10000011 3300025981 Bacteria 252283
525 Ga0207640_10000435 3300025981 Bacteria 25481
526 Ga0207640_10119935 3300025981 Bacteria 1882
527 Ga0207658_10000004 3300025986 Bacteria 569357
528 Ga0207658_10002963 3300025986 Bacteria 12149
529 Ga0207658_10022657 3300025986 Bacteria 4375
530 Ga0207658_10128470 3300025986 Bacteria 2032
531 Ga0207677_10000587 3300026023 Bacteria 22685
532 Ga0207703_10002543 3300026035 Bacteria 15752
533 Ga0207703_10015006 3300026035 Bacteria 6046
534 Ga0207703_10041348 3300026035 Bacteria 3692
535 Ga0207703_10103258 3300026035 Bacteria 2420
536 Ga0207703_10104050 3300026035 Bacteria 2411
537 Ga0207639_10000025 3300026041 Bacteria 207451
538 Ga0207639_10002760 3300026041 Bacteria 11797
539 Ga0207639_10032120 3300026041 Bacteria 3863
540 Ga0207639_10034881 3300026041 Bacteria 3721
541 Ga0207678_10001349 3300026067 Bacteria 22608
542 Ga0207678_10022212 3300026067 Bacteria 5559
543 Ga0207678_10049471 3300026067 Bacteria 3633
544 Ga0207678_10126730 3300026067 Bacteria 2178
545 Ga0207708_10002313 3300026075 Bacteria 14009
546 Ga0207708_10021050 3300026075 Bacteria 4921
547 Ga0207702_10004678 3300026078 Bacteria 12098
548 Ga0207702_10005132 3300026078 Bacteria 11518
549 Ga0207702_10067598 3300026078 Bacteria 3068
550 Ga0207702_10104329 3300026078 Bacteria 2509
551 Ga0207702_10280800 3300026078 Bacteria 1574
552 Ga0207702_10428487 3300026078 Bacteria 1280
553 Ga0207641_10002690 3300026088 Bacteria 16219
554 Ga0207641_10024972 3300026088 Bacteria 4927
555 Ga0207641_10042050 3300026088 Bacteria 3833
556 Ga0207641_10193884 3300026088 Bacteria 1869
557 Ga0207648_10004670 3300026089 Bacteria 14009
558 Ga0207648_10020639 3300026089 Bacteria 5932
559 Ga0207676_10000003 3300026095 Bacteria 1123235
560 Ga0207676_10001465 3300026095 Bacteria 17525
561 Ga0207676_10005579 3300026095 Bacteria 8902
562 Ga0207674_10005769 3300026116 Bacteria 14687
563 Ga0207674_10015586 3300026116 Bacteria 8346
564 Ga0207675_100004143 3300026118 Bacteria 14034
565 Ga0207675_100064784 3300026118 Bacteria 3416
566 Ga0207675_100073055 3300026118 Bacteria 3209
567 Ga0207683_10000138 3300026121 Bacteria 60113
568 Ga0207683_10005177 3300026121 Bacteria 11195
569 Ga0207698_10000568 3300026142 Bacteria 21530
570 Ga0207698_10033839 3300026142 Bacteria 3718
571 Ga0209281_1000114 3300027111 Bacteria 210536
572 Ga0209371_1000026 3300027312 Bacteria 449205
573 Ga0209371_1000050 3300027312 Bacteria 278645
574 Ga0209371_1000148 3300027312 Bacteria 112568
575 Ga0209371_1001597 3300027312 Bacteria 14753
576 Ga0209371_1002855 3300027312 Bacteria 9105
577 Ga0209371_1014433 3300027312 Bacteria 2166
578 Ga0209371_1020333 3300027312 Bacteria 1636
579 Ga0209970_1006170 3300027614 Bacteria 1966
580 Ga0210002_1000723 3300027617 Bacteria 4469
581 Ga0209971_1001690 3300027682 Bacteria 5436
582 Ga0209966_1001187 3300027695 Bacteria 4652
583 Ga0209966_1002127 3300027695 Bacteria 3304
584 Ga0209813_10000121 3300027866 Bacteria 28181
585 Ga0207428_10000501 3300027907 Bacteria 46798
586 Ga0207428_10001016 3300027907 Bacteria 31079
587 Ga0207428_10005810 3300027907 Bacteria 11441
588 Ga0268266_10001262 3300028379 Bacteria 30924
589 Ga0268266_10041769 3300028379 Bacteria 3914
590 Ga0268266_10051613 3300028379 Bacteria 3530
591 Ga0268265_10001134 3300028380 Bacteria 23524
592 Ga0268265_10001141 3300028380 Bacteria 23422
593 Ga0268265_10110556 3300028380 Bacteria 2242
594 Ga0268265_10126649 3300028380 Bacteria 2115
595 Ga0268264_10000009 3300028381 Bacteria 724972
596 Ga0268264_10001321 3300028381 Bacteria 23341
597 Ga0268264_10171002 3300028381 Bacteria 1965
598 Ga0265326_10002676 3300028558 Bacteria 5971
599 Ga0265334_10011858 3300028573 Bacteria 3661
600 Ga0265334_10026845 3300028573 Bacteria 2322
601 Ga0265318_10000647 3300028577 Bacteria 23825
602 Ga0307517_10004912 3300028786 Bacteria 20370
603 Ga0307517_10065343 3300028786 Bacteria 3367
604 Ga0307515_10000138 3300028794 Bacteria 173220
605 Ga0307515_10005581 3300028794 Bacteria 25423
606 Ga0265338_10006098 3300028800 Bacteria 15476
607 Ga0265338_10015318 3300028800 Bacteria 8436
608 Ga0268256_1000003 3300030500 Bacteria 1289401
609 Ga0268256_1000017 3300030500 Bacteria 600718
610 Ga0268256_1000122 3300030500 Bacteria 112568
611 Ga0268256_1002561 3300030500 Bacteria 9105
612 Ga0268256_1008519 3300030500 Bacteria 3502
613 Ga0268256_1015984 3300030500 Bacteria 2166
614 Ga0268256_1022800 3300030500 Bacteria 1636
615 Ga0307512_10010075 3300030522 Bacteria 9047
616 Ga0265330_10003117 3300031235 Bacteria 8781
617 Ga0265332_10006961 3300031238 Bacteria 5122
618 Ga0265328_10007481 3300031239 Bacteria 4549
619 Ga0265328_10023002 3300031239 Bacteria 2366
620 Ga0265320_10002935 3300031240 Bacteria 11686
621 Ga0265320_10034312 3300031240 Bacteria 2582
622 Ga0265325_10003130 3300031241 Bacteria 10907
623 Ga0265329_10003338 3300031242 Bacteria 7021
624 Ga0265340_10021885 3300031247 Bacteria 3274
625 Ga0265339_10021781 3300031249 Bacteria 3722
626 Ga0265339_10032015 3300031249 Bacteria 2968
627 Ga0265331_10024664 3300031250 Bacteria 3040
628 Ga0265327_10000142 3300031251 Bacteria 157436
629 Ga0265327_10042591 3300031251 Unclassified 2436
630 Ga0265316_10007577 3300031344 Bacteria 10212
631 Ga0265316_10066188 3300031344 Bacteria 2797
632 Ga0307513_10023661 3300031456 Bacteria 7171
633 Ga0307513_10051472 3300031456 Bacteria 4443
634 Ga0307509_10004147 3300031507 Bacteria 21173
635 Ga0307509_10004183 3300031507 Bacteria 21075
636 Ga0307509_10004884 3300031507 Bacteria 19006
637 Ga0307509_10061981 3300031507 Bacteria 3945
638 Ga0307408_100002313 3300031548 Bacteria 13517
639 Ga0307408_100081580 3300031548 Bacteria 2418
640 Ga0307408_100186313 3300031548 Bacteria 1669
641 Ga0265313_10000716 3300031595 Bacteria 34149
642 Ga0265313_10003101 3300031595 Bacteria 13760
643 Ga0307508_10011794 3300031616 Bacteria 7987
644 Ga0307508_10012983 3300031616 Bacteria 7616
645 Ga0265314_10002259 3300031711 Bacteria 19948
646 Ga0265314_10006251 3300031711 Bacteria 10575
647 Ga0265314_10010751 3300031711 Bacteria 7613
648 Ga0265342_10000940 3300031712 Bacteria 28973
649 Ga0265342_10048027 3300031712 Bacteria 2560
650 Ga0307405_10194860 3300031731 Bacteria 1466
651 Ga0307413_10003432 3300031824 Bacteria 6666
652 Ga0307410_10007603 3300031852 Bacteria 5946
653 Ga0307410_10099345 3300031852 Bacteria 2083
654 Ga0307406_10016613 3300031901 Bacteria 4281
655 Ga0307407_10005458 3300031903 Bacteria 5520
656 Ga0307409_100023384 3300031995 Bacteria 4281
657 Ga0307416_100017717 3300032002 Bacteria 4993
658 Ga0307416_100132002 3300032002 Bacteria 2250
659 Ga0307416_100159804 3300032002 Bacteria 2081
660 Ga0307414_10031414 3300032004 Bacteria 3483
661 Ga0307414_10301550 3300032004 Bacteria 1355
662 Ga0307411_10059818 3300032005 Bacteria 2527
663 Ga0307411_10106387 3300032005 Bacteria 1997
664 Ga0307415_100016117 3300032126 Bacteria 4445
665 Ga0307510_10012162 3300033180 Bacteria 10204
666 Ga0307510_10044259 3300033180 Bacteria 4824
667 Ga0373930_0000459 3300034816 Bacteria 5482
668 Ga0373948_0001319 3300034817 Bacteria 3408
669 Ga0373950_0000303 3300034818 Bacteria 6211
670 Ga0373950_0007719 3300034818 Bacteria 1676
671 Ga0373958_0000662 3300034819 Bacteria 4344
672 Ga0373959_0006385 3300034820 Bacteria 1955
673 Ga0373928_0000229 3300035084 Bacteria 10971
674 Ga0373928_0016457 3300035084 Bacteria 1514
675 Ga0373929_0007109 3300035085 Bacteria 2037
676 Ga0373934_0040745 3300035086 Bacteria 1833
677 Ga0373940_0000108 3300035088 Bacteria 10198
678 Ga0373949_0000806 3300035090 Bacteria 9999
679 Ga0373949_0001128 3300035090 Bacteria 8080
680 Ga0373951_0005691 3300035091 Bacteria 2885
681 Ga0373952_0000394 3300035092 Bacteria 7470
682 Ga0373952_0001150 3300035092 Bacteria 4826
683 Ga0373952_0004895 3300035092 Bacteria 2434
684 Ga0373952_0023074 3300035092 Bacteria 1327
685 Ga0373923_0050991 3300035111 Bacteria 1735
686 Ga0373932_0000362 3300035112 Bacteria 13995
687 Ga0373932_0000365 3300035112 Bacteria 13963
688 Ga0373932_0008571 3300035112 Bacteria 2445
689 Ga0373939_0000233 3300035114 Bacteria 15177
690 Ga0373939_0006850 3300035114 Bacteria 2755
691 Ga0373939_0008047 3300035114 Bacteria 2576
692 Ga0373939_0014739 3300035114 Bacteria 2034
693 Ga0373939_0038319 3300035114 Bacteria 1429
694 Ga0373941_0000133 3300035115 Bacteria 13100
695 Ga0373941_0000375 3300035115 Bacteria 8926
696 Ga0373941_0003492 3300035115 Bacteria 3565
697 Ga0373941_0041413 3300035115 Bacteria 1425
698 Ga0373953_0071495 3300035117 Bacteria 1432
699 Ga0373954_0004727 3300035118 Bacteria 5870
700 Ga0373957_0010497 3300035120 Bacteria 3064
701 Ga0373960_0000182 3300035121 Bacteria 11201
702 Ga0373960_0001762 3300035121 Bacteria 4851
703 Ga0373960_0011866 3300035121 Bacteria 2155
704 Ga0373946_0021326 3300035171 Bacteria 2511
705 Ga0373942_0001391 3300035207 Bacteria 6256
706 Ga0373942_0004221 3300035207 Bacteria 3345
707 Ga0373961_0001666 3300035241 Bacteria 6201
708 Ga0373961_0015346 3300035241 Bacteria 1957
709 Ga0373962_0000986 3300035242 Bacteria 6572
710 Ga0373962_0001963 3300035242 Bacteria 4906
711 Ga0373962_0003879 3300035242 Bacteria 3600
712 Ga0373931_0000201 3300035691 Bacteria 25484
713 Ga0373931_0000330 3300035691 Bacteria 19735
714 Ga0373931_0005034 3300035691 Bacteria 6078
715 Ga0373935_0027106 3300035692 Bacteria 3542
716 Ga0373935_0080452 3300035692 Bacteria 2117
717 Ga0373927_0083536 3300035695 Bacteria 2070
718 Ga0373947_0001864 3300035725 Bacteria 12846
719 Ga0373937_0027561 3300036401 Bacteria 5138
720 Ga0373937_0363920 3300036401 Bacteria 1371
721 Ga0316584_0141204 3300036712 Bacteria 1796
722 Ga0373925_0001650 3300037068 Bacteria 18812
723 Ga0373925_0003098 3300037068 Bacteria 13050
724 Ga0395899_0003487 3300037312 Bacteria 12463
725 Ga0395899_0008070 3300037312 Bacteria 8107
726 Ga0395899_0011883 3300037312 Bacteria 6666
727 Ga0395899_0012727 3300037312 Bacteria 6445
728 Ga0395899_0016707 3300037312 Bacteria 5595
729 Ga0395899_0119134 3300037312 Bacteria 1893
730 Ga0395900_0009953 3300037418 Bacteria 9735
731 Ga0395900_0075223 3300037418 Bacteria 3471
732 Ga0395900_0158406 3300037418 Bacteria 2311
733 Ga0395898_0001449 3300037466 Bacteria 33602
734 Ga0395898_0004361 3300037466 Bacteria 15481
735 Ga0395898_0011214 3300037466 Bacteria 9329
736 Ga0395898_0036029 3300037466 Bacteria 4916
737 Ga0395898_0048833 3300037466 Bacteria 4148
738 Ga0395898_0071002 3300037466 Bacteria 3365
739 Ga0395898_0091125 3300037466 Bacteria 2933
740 Ga0395905_0000431 3300037471 Bacteria 58717
741 Ga0395905_0002347 3300037471 Bacteria 21113
742 Ga0395905_0029909 3300037471 Bacteria 5134
743 Ga0395905_0119283 3300037471 Bacteria 2479
744 Ga0395901_0002566 3300038443 Bacteria 18407
745 Ga0395901_0007051 3300038443 Bacteria 11358
746 Ga0395901_0020806 3300038443 Bacteria 6716
747 Ga0395901_0024103 3300038443 Bacteria 6242
748 Ga0395901_0073003 3300038443 Bacteria 3578
749 Ga0395901_0181993 3300038443 Bacteria 2204
750 Ga0395901_0268068 3300038443 Bacteria 1776
751 Ga0237819_00544 3300038705 Bacteria 12694
752 Ga0400484_36850 3300038725 Bacteria 4809
753 Ga0400490_02226 3300038726 Bacteria 1576
754 Ga0400490_54525 3300038726 Bacteria 4867
755 Ga0400491_18916 3300038727 Bacteria 5529
756 Ga0400485_06758 3300038735 Bacteria 13442
757 Ga0400488_11060 3300038741 Bacteria 4028
758 Ga0400488_37986 3300038741 Bacteria 2724
759 Ga0400488_47107 3300038741 Bacteria 4646
760 Ga0400488_60527 3300038741 Bacteria 6289
761 Ga0400486_07908 3300038742 Bacteria 8783
762 Ga0400486_14585 3300038742 Bacteria 1604
763 Ga0400486_24540 3300038742 Bacteria 7804
764 Ga0242420_006282 3300038996 Bacteria 1874
765 Ga0400483_111901 3300039062 Bacteria 5636
766 Ga0400483_191143 3300039062 Bacteria 6524
767 Ga0400483_265139 3300039062 Bacteria 4394
768 Ga0400487_00901 3300039110 Bacteria 2878
769 Ga0400487_12331 3300039110 Bacteria 40945
770 Ga0400487_29781 3300039110 Bacteria 4195
771 Ga0436365_0511988 3300039437 Bacteria 1854
772 Ga0436361_0639952 3300039447 Bacteria 4594
773 Ga0436361_1049346 3300039447 Bacteria 11760
774 Ga0439465_0026623 3300041413 Bacteria 1830
775 Ga0439452_000027 3300042010 Bacteria 206086
776 Ga0439455_0024547 3300042012 Bacteria 1459
777 Ga0451577_0000093 3300042876 Bacteria 196838
778 Ga0451577_0079877 3300042876 Bacteria 2916
779 Ga0451577_0146809 3300042876 Bacteria 2121
780 Ga0466981_0000028 3300044669 Bacteria 71382
781 Ga0453683_0002217 3300044673 Bacteria 15386
782 Ga0453683_0105955 3300044673 Bacteria 1767
783 Ga0466966_0221144 3300044684 Bacteria 1143
784 Ga0466963_0044773 3300044694 Bacteria 2913
785 Ga0466963_0050584 3300044694 Bacteria 2750
786 Ga0453684_0000450 3300044712 Bacteria 166110
787 Ga0453684_0424549 3300044712 Bacteria 1484
788 Ga0466957_0059843 3300044842 Bacteria 2335
789 Ga0466959_0232475 3300045049 Bacteria 1276
790 Ga0451576_0001995 3300045051 Bacteria 32320
791 Ga0451576_0005476 3300045051 Bacteria 15900
792 Ga0451576_0007546 3300045051 Bacteria 12960
793 Ga0495592_0000250 3300046454 Bacteria 46017
794 Ga0495592_0025423 3300046454 Bacteria 4495
795 Ga0495592_0107591 3300046454 Bacteria 1977
796 Ga0495603_0048103 3300046455 Bacteria 2539
797 Ga0495590_0000194 3300046457 Bacteria 34520
798 Ga0495591_003951 3300046458 Bacteria 7432
799 Ga0495591_046760 3300046458 Bacteria 1201
800 Ga0495629_0000753 3300046459 Bacteria 26186
801 Ga0495638_0173392 3300046460 Bacteria 1236
802 Ga0495641_0072722 3300046461 Bacteria 1542
803 Ga0495651_0001426 3300046462 Bacteria 18541
804 Ga0495651_0031279 3300046462 Bacteria 4151
805 Ga0495653_0007689 3300046463 Bacteria 8821
806 Ga0495653_0020780 3300046463 Bacteria 5318
807 Ga0495653_0052995 3300046463 Bacteria 3106
808 Ga0495650_0000016 3300046471 Bacteria 554693
809 Ga0495580_0000875 3300046472 Bacteria 26065
810 Ga0495580_0082792 3300046472 Bacteria 2236
811 Ga0495582_0001659 3300046473 Bacteria 12550
812 Ga0495582_0015740 3300046473 Bacteria 4148
813 Ga0495582_0089400 3300046473 Bacteria 1716
814 Ga0495582_0131603 3300046473 Bacteria 1413
815 Ga0495605_0068699 3300046474 Bacteria 1678
816 Ga0495605_0070831 3300046474 Bacteria 1648
817 Ga0495639_0030825 3300046475 Bacteria 2385
818 Ga0495662_0112075 3300046476 Bacteria 1337
819 Ga0495584_0043774 3300046491 Bacteria 2260
820 Ga0495596_0002323 3300046500 Bacteria 10332
821 Ga0495596_0006771 3300046500 Bacteria 5235
822 Ga0495607_0000187 3300046501 Bacteria 66043
823 Ga0495607_0019573 3300046501 Bacteria 4297
824 Ga0495607_0075961 3300046501 Bacteria 1860
825 Ga0495583_0000149 3300046506 Bacteria 117980
826 Ga0495606_0000165 3300046507 Bacteria 116607
827 Ga0495606_0003759 3300046507 Bacteria 15784
828 Ga0495606_0048104 3300046507 Bacteria 2808
829 Ga0495606_0123709 3300046507 Bacteria 1545
830 Ga0495608_0001990 3300046511 Bacteria 14648
831 Ga0495610_0013250 3300046512 Bacteria 4906
832 Ga0495610_0060500 3300046512 Bacteria 1803
833 Ga0495618_0002569 3300046514 Bacteria 11628
834 Ga0495620_0043614 3300046515 Bacteria 1953
835 Ga0495630_0004025 3300046517 Bacteria 10290
836 Ga0495630_0044652 3300046517 Bacteria 3311
837 Ga0495630_0076160 3300046517 Bacteria 2528
838 Ga0495630_0138706 3300046517 Bacteria 1848
839 Ga0495643_0063271 3300046522 Bacteria 1957
840 Ga0495644_0037635 3300046523 Bacteria 1825
841 Ga0495648_0000775 3300046524 Bacteria 34064
842 Ga0495648_0060719 3300046524 Bacteria 2248
843 Ga0495666_0007275 3300046526 Bacteria 5554
844 Ga0495666_0029609 3300046526 Bacteria 2693
845 Ga0495652_0049824 3300046529 Bacteria 3583
846 Ga0495665_0033100 3300046531 Bacteria 2765
847 Ga0495587_0005444 3300046536 Bacteria 8302
848 Ga0495609_0009954 3300046538 Bacteria 4579
849 Ga0495597_0001190 3300046542 Bacteria 19496
850 Ga0495597_0049130 3300046542 Bacteria 1865
851 Ga0495645_0017249 3300046543 Bacteria 5172
852 Ga0495645_0049903 3300046543 Bacteria 3047
853 Ga0495622_0055241 3300046557 Bacteria 1842
854 Ga0495622_0063627 3300046557 Bacteria 1706
855 Ga0495622_0064014 3300046557 Bacteria 1701
856 Ga0495633_0000065 3300046558 Bacteria 139197
857 Ga0495667_0015367 3300046559 Bacteria 5172
858 Ga0495668_0002416 3300046616 Bacteria 15427
859 Ga0495634_0047634 3300046642 Bacteria 2887
860 Ga0495625_0001637 3300046660 Bacteria 26325
861 Ga0495625_0005161 3300046660 Bacteria 12051
862 Ga0495625_0014089 3300046660 Bacteria 6398
863 Ga0495635_0058027 3300046663 Bacteria 2663
864 Ga0495661_0037140 3300046665 Bacteria 3043
865 Ga0495661_0072174 3300046665 Bacteria 2014
866 Ga0495588_0026815 3300046674 Bacteria 2877
867 Ga0495588_0099986 3300046674 Bacteria 1523
868 Ga0495599_0091824 3300046678 Bacteria 1894
869 Ga0495623_0034053 3300046679 Bacteria 3267
870 Ga0495646_0017562 3300046680 Bacteria 4536
871 Ga0495646_0061535 3300046680 Bacteria 2235
872 Ga0495647_0066535 3300046681 Bacteria 1433
873 Ga0495658_0006858 3300046683 Bacteria 5612
874 Ga0495658_0048860 3300046683 Bacteria 2387
875 Ga0495669_0000075 3300046684 Bacteria 65812
876 Ga0495613_0004700 3300046689 Bacteria 10246
877 Ga0495613_0019456 3300046689 Bacteria 5060
878 Ga0495624_0255052 3300046690 Bacteria 1060
879 Ga0495671_0003075 3300046692 Bacteria 10366
880 Ga0495671_0018007 3300046692 Bacteria 3756
881 Ga0495649_0000396 3300046694 Bacteria 37744
882 Ga0495649_0117197 3300046694 Bacteria 1410
883 Ga0495589_0028828 3300046794 Bacteria 2800
884 Ga0495600_0006772 3300046809 Bacteria 6988
885 Ga0495600_0041087 3300046809 Bacteria 3013
886 Ga0495600_0092904 3300046809 Bacteria 1968
887 Ga0495660_0000189 3300046810 Bacteria 64823
888 Ga0495581_0025513 3300047315 Bacteria 3427
889 Ga0495604_0041622 3300047317 Bacteria 3603
890 Ga0495604_0048640 3300047317 Bacteria 3298
891 Ga0495604_0066259 3300047317 Bacteria 2747
892 Ga0495674_0022419 3300047319 Bacteria 5824
893 Ga0495674_0113184 3300047319 Bacteria 2298
894 Ga0495676_0017396 3300047321 Bacteria 6359
895 Ga0495680_0007465 3300047322 Bacteria 10018
896 Ga0495680_0012454 3300047322 Bacteria 7485
897 Ga0495675_0017062 3300047444 Bacteria 4597
898 Ga0495675_0037133 3300047444 Bacteria 3103
899 Ga0495677_0000154 3300047445 Bacteria 32847
900 Ga0495677_0006061 3300047445 Bacteria 4571
901 Ga0495677_0034044 3300047445 Bacteria 1858
902 Ga0495679_003908 3300047446 Bacteria 7047
903 Ga0495673_0017136 3300047469 Bacteria 3686
904 Ga0495673_0062758 3300047469 Bacteria 1586
905 Ga0495684_0168055 3300047471 Bacteria 1633
906 Ga0495684_0192923 3300047471 Bacteria 1505
907 Ga0495686_0000923 3300047472 Bacteria 36619
908 Ga0495686_0013528 3300047472 Bacteria 5660
909 Ga0495686_0035130 3300047472 Bacteria 3224
910 Ga0495593_0163204 3300047673 Bacteria 1124
911 Ga0495602_0002022 3300048088 Bacteria 20408
912 Ga0495602_0137293 3300048088 Bacteria 1940
913 Ga0495614_0024919 3300048089 Bacteria 2581
914 Ga0495626_0019885 3300048091 Bacteria 3351
915 Ga0496100_0000326 3300048903 Bacteria 23445
916 Ga0496100_0034458 3300048903 Bacteria 3177
917 Ga0496100_0110257 3300048903 Bacteria 1910
918 Ga0496100_0190820 3300048903 Bacteria 1487
919 Ga0496101_0010563 3300048904 Bacteria 6098
920 Ga0496101_0022406 3300048904 Bacteria 4348
921 Ga0496101_0088222 3300048904 Bacteria 2303
922 Ga0496102_0001315 3300048905 Bacteria 22296
923 Ga0496102_0018733 3300048905 Bacteria 6088
924 Ga0496102_0098408 3300048905 Bacteria 2714
925 Ga0496102_0108357 3300048905 Bacteria 2587
926 Ga0496102_0179780 3300048905 Bacteria 1993
927 Ga0496102_0180372 3300048905 Bacteria 1989
928 Ga0496102_0248324 3300048905 Bacteria 1677
929 Ga0496103_0002237 3300048906 Bacteria 12250
930 Ga0496103_0014193 3300048906 Bacteria 4729
931 Ga0496103_0054276 3300048906 Bacteria 2484
932 Ga0496103_0281029 3300048906 Bacteria 1070
933 Ga0496104_0000484 3300048907 Bacteria 34244
934 Ga0496104_0046429 3300048907 Bacteria 4091
935 Ga0496104_0109955 3300048907 Bacteria 2641
936 Ga0496104_0121431 3300048907 Bacteria 2508
937 Ga0496104_0187429 3300048907 Bacteria 1979
938 Ga0496105_0078047 3300048908 Bacteria 2734
939 Ga0496105_0227485 3300048908 Bacteria 1516
940 Ga0496106_0000003 3300048909 Bacteria 305293
941 Ga0496106_0005158 3300048909 Bacteria 9679
942 Ga0496106_0011103 3300048909 Bacteria 6662
943 Ga0496106_0025179 3300048909 Bacteria 4426
944 Ga0496107_0002339 3300048910 Bacteria 12240
945 Ga0496107_0004092 3300048910 Bacteria 9822
946 Ga0496107_0013737 3300048910 Bacteria 5663
947 Ga0496107_0131800 3300048910 Bacteria 1845
948 Ga0496108_0002892 3300048911 Bacteria 13786
949 Ga0496108_0114234 3300048911 Bacteria 2311
950 Ga0496108_0191912 3300048911 Bacteria 1770
951 Ga0496109_0000409 3300048912 Bacteria 38172
952 Ga0496109_0012061 3300048912 Bacteria 7445
953 Ga0496109_0121411 3300048912 Bacteria 2434
954 Ga0496109_0121798 3300048912 Bacteria 2430
955 Ga0496109_0473650 3300048912 Bacteria 1182
956 Ga0496110_0014970 3300048913 Bacteria 6448
957 Ga0496110_0037454 3300048913 Bacteria 4216
958 Ga0496110_0228384 3300048913 Bacteria 1692
959 Ga0496111_0009332 3300048914 Bacteria 6542
960 Ga0496111_0022054 3300048914 Bacteria 4454
961 Ga0496111_0048862 3300048914 Bacteria 3049
962 Ga0496111_0093566 3300048914 Bacteria 2203
963 Ga0496112_0004892 3300048915 Bacteria 11458
964 Ga0496112_0082579 3300048915 Bacteria 3177
965 Ga0496113_0001989 3300048916 Bacteria 11709
966 Ga0496113_0084543 3300048916 Bacteria 2436
967 Ga0496113_0094777 3300048916 Bacteria 2306
968 Ga0496113_0100258 3300048916 Bacteria 2244
969 Ga0496114_0002505 3300048917 Bacteria 14023
970 Ga0496114_0024049 3300048917 Bacteria 4971
971 Ga0496114_0026459 3300048917 Bacteria 4750
972 Ga0496114_0040268 3300048917 Bacteria 3867
973 Ga0496114_0045021 3300048917 Bacteria 3664
974 Ga0496115_0010920 3300048918 Bacteria 6798
975 Ga0496115_0047311 3300048918 Bacteria 3439
976 Ga0496115_0089318 3300048918 Bacteria 2516
977 Ga0496116_0000158 3300048919 Bacteria 140604
978 Ga0496117_0006542 3300048920 Bacteria 11734
979 Ga0496117_0024182 3300048920 Bacteria 4812
980 Ga0496117_0070630 3300048920 Bacteria 2344
981 Ga0496118_0001553 3300048921 Bacteria 34122
982 Ga0496118_0001836 3300048921 Bacteria 30415
983 Ga0496118_0002524 3300048921 Bacteria 24564
984 Ga0496119_0000045 3300048922 Bacteria 191361
985 Ga0496119_0001580 3300048922 Bacteria 27109
986 Ga0496119_0015558 3300048922 Bacteria 5844
987 Ga0496120_0003713 3300048923 Bacteria 13580
988 Ga0496120_0009620 3300048923 Bacteria 6830
989 Ga0496120_0038301 3300048923 Bacteria 2837
990 Ga0496121_0000289 3300048924 Bacteria 104434
991 Ga0496121_0022502 3300048924 Bacteria 6113
992 Ga0496122_0000013 3300048925 Bacteria 501039
993 Ga0496122_0009784 3300048925 Bacteria 10012
994 Ga0496122_0116103 3300048925 Bacteria 1742
995 Ga0496123_0000010 3300048926 Bacteria 501039
996 Ga0496123_0019345 3300048926 Bacteria 5372
997 Ga0496124_0000152 3300048927 Bacteria 140118
998 Ga0496124_0000361 3300048927 Bacteria 82908
999 Ga0496124_0017932 3300048927 Bacteria 6652
1000 Ga0496125_0000546 3300048928 Bacteria 64890
1001 Ga0496125_0025778 3300048928 Bacteria 5376
1002 Ga0496125_0041595 3300048928 Bacteria 3927
1003 Ga0496125_0044541 3300048928 Bacteria 3750
1004 Ga0496125_0070082 3300048928 Bacteria 2747
1005 Ga0496126_0000284 3300048929 Bacteria 107119
1006 Ga0496126_0000455 3300048929 Bacteria 81622
1007 Ga0496126_0106670 3300048929 Bacteria 2445
1008 Ga0501032_0068908 3300049569 Bacteria 2361
1009 Ga0501032_0079502 3300049569 Bacteria 2183
1010 Ga0501033_0158379 3300049570 Bacteria 1631
1011 Ga0501033_0163129 3300049570 Bacteria 1603
1012 Ga0501034_0000458 3300049571 Bacteria 67394
1013 Ga0501034_0050214 3300049571 Bacteria 4207
1014 Ga0501034_0060215 3300049571 Bacteria 3814
1015 Ga0501034_0086257 3300049571 Bacteria 3140
1016 Ga0501034_0155004 3300049571 Bacteria 2265
1017 Ga0501038_0229608 3300049574 Bacteria 1477
1018 Ga0501043_0146263 3300049579 Bacteria 1850
1019 Ga0501047_0101366 3300049581 Bacteria 2758
1020 Ga0501047_0121680 3300049581 Bacteria 2491
1021 Ga0501047_0307818 3300049581 Bacteria 1425
1022 Ga0501048_0230265 3300049582 Bacteria 1315
1023 Ga0501070_0013624 3300049586 Bacteria 6853
1024 Ga0501071_0188453 3300049587 Bacteria 1546
1025 Ga0501072_0003117 3300049588 Bacteria 12472
1026 Ga0501072_0326551 3300049588 Bacteria 1219
1027 Ga0501074_0110721 3300049590 Bacteria 1965
1028 Ga0501211_005745 3300049658 Bacteria 1234
1029 Ga0501249_000706 3300049679 Bacteria 7565
1030 Ga0501080_0048161 3300049742 Bacteria 3967
1031 Ga0501080_0236751 3300049742 Bacteria 1668
1032 Ga0501083_0054588 3300049744 Bacteria 2681
1033 Ga0501083_0063330 3300049744 Bacteria 2466
1034 Ga0501269_000265 3300049766 Bacteria 14848
1035 Ga0501035_0156072 3300049822 Bacteria 1978
1036 Ga0501035_0205178 3300049822 Bacteria 1689
1037 Ga0501044_0025708 3300049823 Bacteria 6241
1038 Ga0501044_0040799 3300049823 Bacteria 4836
1039 Ga0501044_0150185 3300049823 Bacteria 2313
1040 nmdc:mga00v17_67664_c1 3300050491 Bacteria 2207
1041 nmdc:mga00v17_8062_c1 3300050491 Bacteria 5654
1042 nmdc:mga0yw44_15676_c1 3300050492 Bacteria 4068
1043 nmdc:mga0yw44_187670_c1 3300050492 Bacteria 1362
1044 nmdc:mga06z11_14548_c1 3300050494 Bacteria 3488
1045 nmdc:mga06z11_36_c1 3300050494 Bacteria 55905
1046 nmdc:mga04h51_119_c1 3300050495 Bacteria 23185
1047 nmdc:mga09592_326667_c1 3300050508 Bacteria 1328
1048 nmdc:mga08y16_865_c1 3300050511 Bacteria 29154
1049 nmdc:mga08y16_992_c1 3300050511 Bacteria 27676
1050 nmdc:mga0n895_1104_c1 3300050512 Bacteria 19751
1051 nmdc:mga0n895_169339_c1 3300050512 Bacteria 2216
1052 nmdc:mga0n895_175793_c1 3300050512 Bacteria 2172
1053 nmdc:mga0n895_7653_c1 3300050512 Bacteria 9289
1054 nmdc:mga0rr50_112212_c1 3300050513 Bacteria 2159
1055 nmdc:mga08x19_142521_c1 3300050514 Bacteria 1619
1056 nmdc:mga0a205_44463_c1 3300050515 Bacteria 4281
1057 nmdc:mga0a205_5198_c1 3300050515 Bacteria 11710
1058 nmdc:mga0a205_970_c1 3300050515 Bacteria 23704
1059 Ga0495601_0001428 3300053077 Bacteria 13162
1060 Ga0495601_0001780 3300053077 Bacteria 11947
1061 Ga0495601_0020505 3300053077 Bacteria 4038
1062 Ga0495612_0005327 3300053078 Bacteria 5313
1063 Ga0495612_0010028 3300053078 Bacteria 3835
1064 Ga0495595_0001527 3300053084 Bacteria 9022
1065 Ga0495595_0014275 3300053084 Bacteria 3367
1066 Ga0495595_0023364 3300053084 Bacteria 2721
1067 Ga0495619_0000045 3300053085 Bacteria 108543
1068 Ga0495619_0000388 3300053085 Bacteria 30051
1069 Ga0495619_0060004 3300053085 Bacteria 2527
1070 Ga0495619_0316957 3300053085 Bacteria 1080
1071 Ga0500643_005413 3300053087 Bacteria 5503
1072 Ga0500644_0001370 3300053088 Bacteria 6493
1073 Ga0500651_0001796 3300053093 Bacteria 10995
1074 Ga0500566_0046447 3300053094 Bacteria 2496
1075 Ga0500641_0016992 3300053096 Bacteria 2714
1076 Ga0500595_000002 3300053119 Bacteria 1074388
1077 Ga0500618_000240 3300053125 Bacteria 43528
1078 Ga0500618_003648 3300053125 Bacteria 5209
1079 Ga0500652_018059 3300053131 Bacteria 2597
1080 Ga0500559_0000076 3300053136 Bacteria 76510
1081 Ga0500559_0087499 3300053136 Bacteria 1423
1082 Ga0500568_0004495 3300053139 Bacteria 7432
1083 Ga0500588_0010191 3300053146 Bacteria 2261
1084 Ga0500616_0000002 3300053153 Bacteria 1611257
1085 Ga0500636_0013888 3300053177 Bacteria 4734
1086 Ga0500645_000324 3300053730 Bacteria 33824
1087 Ga0501084_0446089 3300054114 Bacteria 1094
1088 Ga0530510_0099539 3300061734 Bacteria 2126

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009176 Ga0105242_10200728 Ga0105242_102007281 291
2 3300027614 Ga0209970_1006170 Ga0209970_10061703 292
3 3300044684 Ga0466966_0221144 Ga0466966_0221144_50_964 299
4 3300045049 Ga0466959_0232475 Ga0466959_0232475_91_1005 299
5 3300009098 Ga0105245_10361338 Ga0105245_103613382 312
6 3300048914 Ga0496111_0093566 Ga0496111_0093566_1228_2178 312
7 3300053085 Ga0495619_0316957 Ga0495619_0316957_10_963 312
8 3300035084 Ga0373928_0016457 Ga0373928_0016457_17_985 313
9 3300046507 Ga0495606_0123709 Ga0495606_0123709_553_1497 313
10 3300039437 Ga0436365_0511988 Ga0436365_0511988_841_1833 326
11 3300046690 Ga0495624_0255052 Ga0495624_0255052_48_1043 326
12 3300048906 Ga0496103_0281029 Ga0496103_0281029_60_1055 326
13 3300003322 rootL2_10089387 rootL2_100893872 328
14 3300003323 rootH1_10264660 rootH1_102646602 328
15 3300037312 Ga0395899_0016707 Ga0395899_0016707_1301_2317 330
16 3300038443 Ga0395901_0024103 Ga0395901_0024103_955_1971 330
17 3300005327 Ga0070658_10011263 Ga0070658_100112636 332
18 3300005339 Ga0070660_100001846 Ga0070660_1000018466 332
19 3300005339 Ga0070660_100027146 Ga0070660_1000271465 332
20 3300005366 Ga0070659_100000655 Ga0070659_10000065519 332
21 3300005455 Ga0070663_100107879 Ga0070663_1001078792 332
22 3300005539 Ga0068853_100000049 Ga0068853_10000004917 332
23 3300005563 Ga0068855_100126773 Ga0068855_1001267733 332
24 3300005578 Ga0068854_100000129 Ga0068854_1000001295 332
25 3300005614 Ga0068856_100169222 Ga0068856_1001692221 332
26 3300009093 Ga0105240_10003634 Ga0105240_1000363420 332
27 3300013104 Ga0157370_10023716 Ga0157370_100237167 332
28 3300013307 Ga0157372_10035365 Ga0157372_100353653 332
29 3300025913 Ga0207695_10048660 Ga0207695_100486606 332
30 3300025919 Ga0207657_10001379 Ga0207657_1000137914 332
31 3300025932 Ga0207690_10001643 Ga0207690_100016437 332
32 3300025949 Ga0207667_10022346 Ga0207667_100223466 332
33 3300025981 Ga0207640_10000011 Ga0207640_1000001196 332
34 3300026041 Ga0207639_10000025 Ga0207639_100000259 332
35 3300026067 Ga0207678_10126730 Ga0207678_101267302 332
36 3300046543 Ga0495645_0017249 Ga0495645_0017249_3357_4457 332
37 3300048917 Ga0496114_0026459 Ga0496114_0026459_29_1129 332
38 3300025935 Ga0207709_10023439 Ga0207709_100234394 337
39 3300005441 Ga0070700_100205305 Ga0070700_1002053051 338
40 3300044673 Ga0453683_0002217 Ga0453683_0002217_1124_2239 338
41 3300050514 nmdc:mga08x19_142521_c1 nmdc:mga08x19_142521_c1_408_1433 339
42 3300009147 Ga0114129_10157084 Ga0114129_101570842 340
43 3300038725 Ga0400484_36850 Ga0400484_36850_29_1069 341
44 3300039062 Ga0400483_111901 Ga0400483_111901_21_1052 341
45 3300046454 Ga0495592_0025423 Ga0495592_0025423_14_1057 341
46 3300046507 Ga0495606_0048104 Ga0495606_0048104_614_1684 341
47 3300046665 Ga0495661_0037140 Ga0495661_0037140_1536_2579 341
48 3300047469 Ga0495673_0017136 Ga0495673_0017136_2489_3532 341
49 3300047469 Ga0495673_0062758 Ga0495673_0062758_17_1060 341
50 3300048905 Ga0496102_0098408 Ga0496102_0098408_1659_2702 341
51 3300048913 Ga0496110_0037454 Ga0496110_0037454_2837_3880 341
52 3300048925 Ga0496122_0116103 Ga0496122_0116103_684_1727 341
53 3300048927 Ga0496124_0017932 Ga0496124_0017932_5369_6412 341
54 3300007788 Ga0099795_10002598 Ga0099795_100025981 342
55 3300035117 Ga0373953_0071495 Ga0373953_0071495_358_1404 342
56 3300036401 Ga0373937_0027561 Ga0373937_0027561_160_1206 342
57 3300036712 Ga0316584_0141204 Ga0316584_0141204_29_1072 342
58 3300037466 Ga0395898_0091125 Ga0395898_0091125_18_1055 342
59 3300046454 Ga0495592_0107591 Ga0495592_0107591_533_1579 342
60 3300046458 Ga0495591_046760 Ga0495591_046760_35_1066 342
61 3300046557 Ga0495622_0055241 Ga0495622_0055241_304_1347 342
62 3300046559 Ga0495667_0015367 Ga0495667_0015367_875_1921 342
63 3300046663 Ga0495635_0058027 Ga0495635_0058027_1423_2469 342
64 3300046809 Ga0495600_0092904 Ga0495600_0092904_171_1217 342
65 3300047317 Ga0495604_0041622 Ga0495604_0041622_1738_2784 342
66 3300047322 Ga0495680_0007465 Ga0495680_0007465_4203_5249 342
67 3300047471 Ga0495684_0168055 Ga0495684_0168055_64_1110 342
68 3300047673 Ga0495593_0163204 Ga0495593_0163204_17_1060 342
69 3300048912 Ga0496109_0473650 Ga0496109_0473650_99_1142 342
70 3300053077 Ga0495601_0001780 Ga0495601_0001780_3980_5026 342
71 3300053078 Ga0495612_0010028 Ga0495612_0010028_661_1707 342
72 3300053084 Ga0495595_0001527 Ga0495595_0001527_4944_5990 342
73 3300053085 Ga0495619_0000045 Ga0495619_0000045_10252_11298 342
74 3300054114 Ga0501084_0446089 Ga0501084_0446089_23_1066 342
75 3300028573 Ga0265334_10026845 Ga0265334_100268452 345
76 iso_pu_bacteria 2643221635 2644198434 345
77 iso_pu_bacteria 2862993130 2862995421 348
78 iso_pu_bacteria 2896344016 2896344106 348
79 3300048922 Ga0496119_0001580 Ga0496119_0001580_7357_8433 350
80 3300048923 Ga0496120_0009620 Ga0496120_0009620_4336_5412 350
81 3300005539 Ga0068853_100363998 Ga0068853_1003639982 351
82 3300005563 Ga0068855_100147794 Ga0068855_1001477942 351
83 3300032004 Ga0307414_10031414 Ga0307414_100314141 351
84 3300032004 Ga0307414_10301550 Ga0307414_103015501 351
85 3300032005 Ga0307411_10106387 Ga0307411_101063872 351
86 3300048924 Ga0496121_0000289 Ga0496121_0000289_16273_17352 351
87 3300050508 nmdc:mga09592_326667_c1 nmdc:mga09592_326667_c1_14_1129 351
88 3300005288 Ga0065714_10014552 Ga0065714_100145522 352
89 3300005548 Ga0070665_100211083 Ga0070665_1002110832 352
90 3300031251 Ga0265327_10000142 Ga0265327_1000014270 352
91 3300031251 Ga0265327_10042591 Ga0265327_100425913 352
92 3300037466 Ga0395898_0048833 Ga0395898_0048833_1329_2414 352
93 3300053146 Ga0500588_0010191 Ga0500588_0010191_415_1482 353
94 3300046694 Ga0495649_0117197 Ga0495649_0117197_56_1126 354
95 3300053125 Ga0500618_003648 Ga0500618_003648_2050_3180 354
96 3300006195 Ga0075366_10018799 Ga0075366_100187992 355
97 3300025294 Ga0209025_1032840 Ga0209025_10328402 355
98 3300025919 Ga0207657_10029120 Ga0207657_100291205 355
99 3300031344 Ga0265316_10066188 Ga0265316_100661883 355
100 3300048907 Ga0496104_0187429 Ga0496104_0187429_270_1343 355
101 3300003856 Ga0058692_1000047 Ga0058692_1000047110 356
102 3300006871 Ga0075434_100492441 Ga0075434_1004924411 356
103 3300009093 Ga0105240_10391429 Ga0105240_103914292 356
104 3300009094 Ga0111539_10007371 Ga0111539_100073717 356
105 3300009094 Ga0111539_10345350 Ga0111539_103453502 356
106 3300009148 Ga0105243_10018182 Ga0105243_100181823 356
107 3300009177 Ga0105248_10009088 Ga0105248_100090887 356
108 3300009553 Ga0105249_10007504 Ga0105249_100075043 356
109 3300010375 Ga0105239_10008469 Ga0105239_100084698 356
110 3300012481 Ga0157320_1000177 Ga0157320_10001772 356
111 3300012494 Ga0157341_1001479 Ga0157341_10014792 356
112 3300013306 Ga0163162_10005169 Ga0163162_1000516910 356
113 3300014325 Ga0163163_10011894 Ga0163163_100118946 356
114 3300014968 Ga0157379_10042697 Ga0157379_100426974 356
115 3300027312 Ga0209371_1000148 Ga0209371_100014812 356
116 3300030500 Ga0268256_1000122 Ga0268256_100012274 356
117 3300034816 Ga0373930_0000459 Ga0373930_0000459_1798_2883 356
118 3300034817 Ga0373948_0001319 Ga0373948_0001319_544_1629 356
119 3300034818 Ga0373950_0000303 Ga0373950_0000303_2753_3838 356
120 3300034820 Ga0373959_0006385 Ga0373959_0006385_524_1609 356
121 3300035084 Ga0373928_0000229 Ga0373928_0000229_8256_9341 356
122 3300035085 Ga0373929_0007109 Ga0373929_0007109_480_1565 356
123 3300035088 Ga0373940_0000108 Ga0373940_0000108_4562_5647 356
124 3300035090 Ga0373949_0001128 Ga0373949_0001128_6591_7676 356
125 3300035092 Ga0373952_0000394 Ga0373952_0000394_5697_6782 356
126 3300035112 Ga0373932_0000365 Ga0373932_0000365_4257_5342 356
127 3300035114 Ga0373939_0006850 Ga0373939_0006850_531_1616 356
128 3300035115 Ga0373941_0000375 Ga0373941_0000375_1284_2369 356
129 3300035121 Ga0373960_0001762 Ga0373960_0001762_2223_3308 356
130 3300035207 Ga0373942_0001391 Ga0373942_0001391_2289_3374 356
131 3300035241 Ga0373961_0001666 Ga0373961_0001666_2989_4074 356
132 3300035242 Ga0373962_0000986 Ga0373962_0000986_2838_3923 356
133 3300038996 Ga0242420_006282 Ga0242420_006282_234_1319 356
134 3300042012 Ga0439455_0024547 Ga0439455_0024547_11_1096 356
135 3300042876 Ga0451577_0146809 Ga0451577_0146809_472_1557 356
136 3300044673 Ga0453683_0105955 Ga0453683_0105955_110_1195 356
137 3300045051 Ga0451576_0005476 Ga0451576_0005476_14770_15855 356
138 3300048905 Ga0496102_0018733 Ga0496102_0018733_2117_3202 356
139 3300048907 Ga0496104_0046429 Ga0496104_0046429_1812_2897 356
140 3300048908 Ga0496105_0227485 Ga0496105_0227485_411_1493 356
141 3300048909 Ga0496106_0011103 Ga0496106_0011103_4899_5984 356
142 3300048910 Ga0496107_0013737 Ga0496107_0013737_33_1118 356
143 3300048910 Ga0496107_0131800 Ga0496107_0131800_679_1764 356
144 3300048911 Ga0496108_0114234 Ga0496108_0114234_915_2000 356
145 3300048912 Ga0496109_0012061 Ga0496109_0012061_6197_7282 356
146 3300048914 Ga0496111_0009332 Ga0496111_0009332_1832_2917 356
147 3300048915 Ga0496112_0004892 Ga0496112_0004892_3698_4783 356
148 3300048916 Ga0496113_0001989 Ga0496113_0001989_3933_5018 356
149 3300049588 Ga0501072_0326551 Ga0501072_0326551_20_1105 356
150 3300050511 nmdc:mga08y16_865_c1 nmdc:mga08y16_865_c1_879_1964 356
151 3300050515 nmdc:mga0a205_44463_c1 nmdc:mga0a205_44463_c1_2296_3381 356
152 3300053084 Ga0495595_0023364 Ga0495595_0023364_1607_2695 356
153 3300053087 Ga0500643_005413 Ga0500643_005413_1623_2708 356
154 3300053093 Ga0500651_0001796 Ga0500651_0001796_9874_10962 356
155 3300053094 Ga0500566_0046447 Ga0500566_0046447_1208_2293 356
156 3300053096 Ga0500641_0016992 Ga0500641_0016992_16_1089 356
157 3300053119 Ga0500595_000002 Ga0500595_000002_1016635_1017720 356
158 iso_pu_bacteria 2711768156 2712469935 356
159 3300037312 Ga0395899_0003487 Ga0395899_0003487_1397_2515 357
160 3300037418 Ga0395900_0158406 Ga0395900_0158406_539_1657 357
161 3300037466 Ga0395898_0001449 Ga0395898_0001449_12348_13466 357
162 3300038443 Ga0395901_0002566 Ga0395901_0002566_5833_6951 357
163 3300048906 Ga0496103_0014193 Ga0496103_0014193_178_1254 357
164 3300048917 Ga0496114_0045021 Ga0496114_0045021_2256_3332 357
165 3300005330 Ga0070690_100057349 Ga0070690_1000573492 359
166 3300005331 Ga0070670_100123214 Ga0070670_1001232142 359
167 3300005354 Ga0070675_100069193 Ga0070675_1000691933 359
168 3300005459 Ga0068867_100069950 Ga0068867_1000699502 359
169 3300005617 Ga0068859_100079116 Ga0068859_1000791163 359
170 3300005840 Ga0068870_10093499 Ga0068870_100934992 359
171 3300005841 Ga0068863_100105141 Ga0068863_1001051413 359
172 3300006358 Ga0068871_100009090 Ga0068871_1000090902 359
173 3300006931 Ga0097620_100079117 Ga0097620_1000791173 359
174 3300009098 Ga0105245_10201582 Ga0105245_102015822 359
175 3300009174 Ga0105241_10061679 Ga0105241_100616793 359
176 3300009176 Ga0105242_10119562 Ga0105242_101195623 359
177 3300009177 Ga0105248_10081678 Ga0105248_100816783 359
178 3300010375 Ga0105239_10092269 Ga0105239_100922693 359
179 3300013297 Ga0157378_10119504 Ga0157378_101195042 359
180 3300014325 Ga0163163_10066143 Ga0163163_100661433 359
181 3300014969 Ga0157376_10004001 Ga0157376_100040013 359
182 3300025938 Ga0207704_10119975 Ga0207704_101199752 359
183 3300025941 Ga0207711_10011422 Ga0207711_100114226 359
184 3300025942 Ga0207689_10001269 Ga0207689_1000126917 359
185 3300025972 Ga0207668_10076618 Ga0207668_100766182 359
186 3300026035 Ga0207703_10103258 Ga0207703_101032582 359
187 3300026089 Ga0207648_10020639 Ga0207648_100206394 359
188 3300026118 Ga0207675_100073055 Ga0207675_1000730553 359
189 3300049571 Ga0501034_0000458 Ga0501034_0000458_31788_32873 359
190 3300049571 Ga0501034_0050214 Ga0501034_0050214_212_1297 359
191 3300049588 Ga0501072_0003117 Ga0501072_0003117_10667_11752 359
192 3300049742 Ga0501080_0236751 Ga0501080_0236751_91_1176 359
193 3300049744 Ga0501083_0054588 Ga0501083_0054588_339_1424 359
194 iso_pu_bacteria 2547132181 2547694319 359
195 iso_pu_bacteria 2561511199 2562466390 359
196 iso_pu_bacteria 2600255256 2601531884 359
197 iso_pu_bacteria 2600255257 2601537256 359
198 iso_pu_bacteria 2600255310 2601755602 359
199 iso_pu_bacteria 2600255311 2601760970 359
200 iso_pu_bacteria 2602042046 2603639009 359
201 iso_pu_bacteria 2791355010 2792312202 359
202 iso_pu_bacteria 2811995292 2813730068 359
203 iso_pu_bacteria 2814123068 2814697562 359
204 iso_pu_bacteria 2857576091 2857577213 359
205 iso_pu_bacteria 2935625433 2935629259 359
206 iso_pu_bacteria 2939617950 2939621630 359
207 iso_pu_bacteria 2974435778 2974437454 359
208 iso_pu_bacteria 8019504834 8019508228 359
209 3300027312 Ga0209371_1020333 Ga0209371_10203332 360
210 3300030500 Ga0268256_1022800 Ga0268256_10228001 360
211 3300048928 Ga0496125_0070082 Ga0496125_0070082_278_1363 360
212 3300053136 Ga0500559_0087499 Ga0500559_0087499_138_1238 360
213 iso_pu_bacteria 2501025502 2501080743 360
214 iso_pu_bacteria 2510917013 2511086813 360
215 iso_pu_bacteria 2537561728 2538425847 360
216 iso_pu_bacteria 2643221736 2644742557 360
217 iso_pu_bacteria 2738541317 2738944800 360
218 iso_pu_bacteria 2841760612 2841763960 360
219 iso_pu_bacteria 2844104063 2844108585 360
220 iso_pu_bacteria 2851182111 2851185201 360
221 iso_pu_bacteria 2851246043 2851250395 360
222 iso_pu_bacteria 2855195626 2855198152 360
223 iso_pu_bacteria 2858466076 2858469019 360
224 iso_pu_bacteria 2871272651 2871275711 360
225 iso_pu_bacteria 2871282230 2871286402 360
226 iso_pu_bacteria 2900051742 2900052770 360
227 iso_pu_bacteria 2904424332 2904429362 360
228 iso_pu_bacteria 2904434214 2904437426 360
229 iso_pu_bacteria 2913308742 2913309421 360
230 3300038742 Ga0400486_24540 Ga0400486_24540_2617_3711 361
231 iso_pu_bacteria 2511231027 2511388955 361
232 iso_pu_bacteria 2585427591 2585825620 361
233 iso_pu_bacteria 2585427592 2585832242 361
234 iso_pu_bacteria 2602042109 2603866764 361
235 iso_pu_bacteria 2667528173 2671108041 361
236 iso_pu_bacteria 2765235802 2765466889 361
237 iso_pu_bacteria 2839993093 2839997264 361
238 iso_pu_bacteria 2842871566 2842873885 361
239 iso_pu_bacteria 2855730933 2855732543 361
240 iso_pu_bacteria 2855767633 2855769251 361
241 iso_pu_bacteria 2881412998 2881414850 361
242 iso_pu_bacteria 2882456835 2882463164 361
243 iso_pu_bacteria 2904474040 2904475284 361
244 iso_pu_bacteria 2904504865 2904505154 361
245 iso_pu_bacteria 2904578770 2904583562 361
246 iso_pu_bacteria 2908669403 2908670510 361
247 iso_pu_bacteria 2916178963 2916181651 361
248 iso_pu_bacteria 2919119836 2919124518 361
249 iso_pu_bacteria 2919150387 2919151630 361
250 iso_pu_bacteria 2927143783 2927146504 361
251 iso_pu_bacteria 2928115317 2928116133 361
252 iso_pu_bacteria 2928521798 2928522869 361
253 iso_pu_bacteria 2952252522 2952256042 361
254 iso_pu_bacteria 2954011201 2954013765 361
255 iso_pu_bacteria 3002141150 3002145640 361
256 iso_pu_bacteria 8033232454 8033233226 361
257 3300005545 Ga0070695_100002211 Ga0070695_1000022114 362
258 3300005983 Ga0081540_1000493 Ga0081540_100049340 362
259 3300006871 Ga0075434_100310236 Ga0075434_1003102362 362
260 3300009551 Ga0105238_10248464 Ga0105238_102484642 362
261 3300035114 Ga0373939_0038319 Ga0373939_0038319_47_1165 362
262 3300035115 Ga0373941_0003492 Ga0373941_0003492_1748_2866 362
263 3300035691 Ga0373931_0000330 Ga0373931_0000330_275_1393 362
264 3300042876 Ga0451577_0000093 Ga0451577_0000093_52699_53826 362
265 3300044712 Ga0453684_0000450 Ga0453684_0000450_21952_23079 362
266 3300045051 Ga0451576_0007546 Ga0451576_0007546_8350_9477 362
267 3300046501 Ga0495607_0000187 Ga0495607_0000187_151_1245 362
268 3300048091 Ga0495626_0019885 Ga0495626_0019885_2151_3245 362
269 3300048903 Ga0496100_0190820 Ga0496100_0190820_280_1380 362
270 3300048904 Ga0496101_0088222 Ga0496101_0088222_813_1913 362
271 3300048905 Ga0496102_0179780 Ga0496102_0179780_693_1793 362
272 3300048907 Ga0496104_0121431 Ga0496104_0121431_612_1712 362
273 3300048908 Ga0496105_0078047 Ga0496105_0078047_694_1794 362
274 3300048913 Ga0496110_0014970 Ga0496110_0014970_2843_3943 362
275 3300048914 Ga0496111_0022054 Ga0496111_0022054_2957_4057 362
276 3300048916 Ga0496113_0094777 Ga0496113_0094777_400_1500 362
277 3300048918 Ga0496115_0010920 Ga0496115_0010920_4424_5524 362
278 3300050492 nmdc:mga0yw44_187670_c1 nmdc:mga0yw44_187670_c1_231_1322 362
279 3300053139 Ga0500568_0004495 Ga0500568_0004495_3391_4491 362
280 iso_pu_bacteria 2738543032 2739355472 362
281 iso_pu_bacteria 2818991461 2819682794 362
282 iso_pu_bacteria 2894232714 2894236954 362
283 3300001989 JGI24739J22299_10000902 JGI24739J22299_100009027 363
284 3300002773 JGI25152J39213_1000198 JGI25152J39213_100019836 363
285 3300003856 Ga0058692_1000043 Ga0058692_100004314 363
286 3300003856 Ga0058692_1005227 Ga0058692_10052272 363
287 3300003856 Ga0058692_1011006 Ga0058692_10110062 363
288 3300004625 Ga0055543_1008619 Ga0055543_10086192 363
289 3300005262 Ga0065165_1000150 Ga0065165_10001505 363
290 3300005327 Ga0070658_10353495 Ga0070658_103534951 363
291 3300005344 Ga0070661_100028883 Ga0070661_1000288834 363
292 3300005355 Ga0070671_100000024 Ga0070671_10000002453 363
293 3300005367 Ga0070667_100000018 Ga0070667_10000001816 363
294 3300005457 Ga0070662_100142926 Ga0070662_1001429262 363
295 3300005466 Ga0070685_10000001 Ga0070685_10000001235 363
296 3300005548 Ga0070665_100036747 Ga0070665_1000367472 363
297 3300005563 Ga0068855_100065238 Ga0068855_1000652384 363
298 3300005617 Ga0068859_100357221 Ga0068859_1003572212 363
299 3300005618 Ga0068864_100000003 Ga0068864_10000000317 363
300 3300005842 Ga0068858_100160152 Ga0068858_1001601522 363
301 3300005843 Ga0068860_100000478 Ga0068860_10000047839 363
302 3300005844 Ga0068862_100001424 Ga0068862_10000142419 363
303 3300005937 Ga0081455_10000341 Ga0081455_1000034161 363
304 3300005983 Ga0081540_1011092 Ga0081540_10110924 363
305 3300006051 Ga0075364_10027418 Ga0075364_100274184 363
306 3300006931 Ga0097620_100357160 Ga0097620_1003571602 363
307 3300006946 Ga0079104_1001697 Ga0079104_10016977 363
308 3300009098 Ga0105245_10005335 Ga0105245_100053355 363
309 3300009545 Ga0105237_10068141 Ga0105237_100681413 363
310 3300009553 Ga0105249_10081191 Ga0105249_100811913 363
311 3300013105 Ga0157369_10002439 Ga0157369_100024393 363
312 3300013297 Ga0157378_10087636 Ga0157378_100876363 363
313 3300013307 Ga0157372_10001000 Ga0157372_1000100019 363
314 3300025258 Ga0209129_1000015 Ga0209129_1000015261 363
315 3300025284 Ga0209130_1001086 Ga0209130_100108611 363
316 3300025294 Ga0209025_1003590 Ga0209025_100359011 363
317 3300025903 Ga0207680_10086011 Ga0207680_100860113 363
318 3300025904 Ga0207647_10000205 Ga0207647_100002054 363
319 3300025911 Ga0207654_10005887 Ga0207654_100058873 363
320 3300025913 Ga0207695_10056865 Ga0207695_100568654 363
321 3300025914 Ga0207671_10005808 Ga0207671_100058087 363
322 3300025924 Ga0207694_10002672 Ga0207694_100026729 363
323 3300025925 Ga0207650_10000003 Ga0207650_10000003572 363
324 3300025931 Ga0207644_10000013 Ga0207644_10000013109 363
325 3300025941 Ga0207711_10000822 Ga0207711_1000082213 363
326 3300025949 Ga0207667_10044826 Ga0207667_100448263 363
327 3300025949 Ga0207667_10127128 Ga0207667_101271282 363
328 3300025960 Ga0207651_10169104 Ga0207651_101691043 363
329 3300025981 Ga0207640_10119935 Ga0207640_101199352 363
330 3300025986 Ga0207658_10000004 Ga0207658_1000000420 363
331 3300026035 Ga0207703_10041348 Ga0207703_100413483 363
332 3300026067 Ga0207678_10049471 Ga0207678_100494715 363
333 3300026078 Ga0207702_10004678 Ga0207702_100046786 363
334 3300026088 Ga0207641_10024972 Ga0207641_100249722 363
335 3300026095 Ga0207676_10000003 Ga0207676_10000003523 363
336 3300026116 Ga0207674_10015586 Ga0207674_100155866 363
337 3300026142 Ga0207698_10033839 Ga0207698_100338393 363
338 3300027111 Ga0209281_1000114 Ga0209281_100011428 363
339 3300027312 Ga0209371_1000026 Ga0209371_1000026298 363
340 3300027312 Ga0209371_1000050 Ga0209371_100005085 363
341 3300027312 Ga0209371_1001597 Ga0209371_100159715 363
342 3300027312 Ga0209371_1002855 Ga0209371_10028557 363
343 3300027312 Ga0209371_1014433 Ga0209371_10144332 363
344 3300028379 Ga0268266_10041769 Ga0268266_100417692 363
345 3300028380 Ga0268265_10001134 Ga0268265_100011342 363
346 3300028381 Ga0268264_10000009 Ga0268264_1000000994 363
347 3300030500 Ga0268256_1000003 Ga0268256_1000003298 363
348 3300030500 Ga0268256_1000017 Ga0268256_1000017498 363
349 3300030500 Ga0268256_1002561 Ga0268256_10025617 363
350 3300030500 Ga0268256_1008519 Ga0268256_10085194 363
351 3300030500 Ga0268256_1015984 Ga0268256_10159842 363
352 3300031852 Ga0307410_10099345 Ga0307410_100993452 363
353 3300032002 Ga0307416_100132002 Ga0307416_1001320021 363
354 3300038726 Ga0400490_02226 Ga0400490_02226_137_1231 363
355 3300038726 Ga0400490_54525 Ga0400490_54525_590_1729 363
356 3300038727 Ga0400491_18916 Ga0400491_18916_317_1411 363
357 3300038741 Ga0400488_11060 Ga0400488_11060_2602_3741 363
358 3300038741 Ga0400488_37986 Ga0400488_37986_700_1794 363
359 3300038741 Ga0400488_60527 Ga0400488_60527_205_1299 363
360 3300039062 Ga0400483_191143 Ga0400483_191143_3694_4788 363
361 3300039110 Ga0400487_12331 Ga0400487_12331_22427_23521 363
362 3300039110 Ga0400487_29781 Ga0400487_29781_2300_3439 363
363 3300042010 Ga0439452_000027 Ga0439452_000027_12078_13169 363
364 3300046501 Ga0495607_0075961 Ga0495607_0075961_461_1564 363
365 3300046522 Ga0495643_0063271 Ga0495643_0063271_815_1918 363
366 3300046542 Ga0495597_0049130 Ga0495597_0049130_668_1777 363
367 3300048920 Ga0496117_0006542 Ga0496117_0006542_862_1953 363
368 3300048921 Ga0496118_0001553 Ga0496118_0001553_862_1953 363
369 3300048922 Ga0496119_0000045 Ga0496119_0000045_49358_50449 363
370 3300048923 Ga0496120_0038301 Ga0496120_0038301_493_1584 363
371 3300048925 Ga0496122_0009784 Ga0496122_0009784_1749_2840 363
372 3300048926 Ga0496123_0019345 Ga0496123_0019345_1226_2317 363
373 3300048927 Ga0496124_0000361 Ga0496124_0000361_64946_66037 363
374 3300048928 Ga0496125_0044541 Ga0496125_0044541_1718_2809 363
375 3300049822 Ga0501035_0205178 Ga0501035_0205178_545_1657 363
376 3300049823 Ga0501044_0025708 Ga0501044_0025708_3701_4813 363
377 3300050491 nmdc:mga00v17_67664_c1 nmdc:mga00v17_67664_c1_721_1836 363
378 iso_pu_bacteria 2545555834 2545676768 363
379 iso_pu_bacteria 2738541277 2738720614 363
380 iso_pu_bacteria 2738543019 2739279813 363
381 iso_pu_bacteria 2904690495 2904690828 363
382 iso_pu_bacteria 2919709256 2919710466 363
383 iso_pu_bacteria 641522639 641642901 363
384 iso_pu_bacteria 643348564 643599815 363
385 iso_pu_bacteria 8054302542 8054304628 363
386 3300003187 JGI25151J46595_10001308 JGI25151J46595_100013083 364
387 3300003659 JGI25404J52841_10000234 JGI25404J52841_100002344 364
388 3300005336 Ga0070680_100013453 Ga0070680_1000134537 364
389 3300005347 Ga0070668_100065655 Ga0070668_1000656553 364
390 3300005535 Ga0070684_100041105 Ga0070684_1000411053 364
391 3300005983 Ga0081540_1000195 Ga0081540_100019533 364
392 3300005983 Ga0081540_1055753 Ga0081540_10557532 364
393 3300006178 Ga0075367_10031602 Ga0075367_100316022 364
394 3300006353 Ga0075370_10034075 Ga0075370_100340753 364
395 3300006852 Ga0075433_10001122 Ga0075433_1000112210 364
396 3300006871 Ga0075434_100001564 Ga0075434_10000156420 364
397 3300009036 Ga0105244_10000748 Ga0105244_1000074817 364
398 3300009094 Ga0111539_10041772 Ga0111539_100417726 364
399 3300010375 Ga0105239_10406010 Ga0105239_104060102 364
400 3300013297 Ga0157378_10521053 Ga0157378_105210531 364
401 3300025294 Ga0209025_1000057 Ga0209025_1000057181 364
402 3300025302 Ga0207426_1016136 Ga0207426_10161362 364
403 3300025728 Ga0207655_1010887 Ga0207655_10108874 364
404 3300025912 Ga0207707_10062197 Ga0207707_100621974 364
405 3300027866 Ga0209813_10000121 Ga0209813_1000012114 364
406 3300027907 Ga0207428_10005810 Ga0207428_100058103 364
407 3300031239 Ga0265328_10023002 Ga0265328_100230022 364
408 3300031240 Ga0265320_10034312 Ga0265320_100343122 364
409 3300031247 Ga0265340_10021885 Ga0265340_100218853 364
410 3300032002 Ga0307416_100159804 Ga0307416_1001598042 364
411 3300035092 Ga0373952_0004895 Ga0373952_0004895_817_1968 364
412 3300035092 Ga0373952_0023074 Ga0373952_0023074_46_1179 364
413 3300035114 Ga0373939_0008047 Ga0373939_0008047_269_1402 364
414 3300035115 Ga0373941_0041413 Ga0373941_0041413_259_1368 364
415 3300035121 Ga0373960_0011866 Ga0373960_0011866_253_1386 364
416 3300035691 Ga0373931_0005034 Ga0373931_0005034_163_1296 364
417 3300038735 Ga0400485_06758 Ga0400485_06758_427_1524 364
418 3300038741 Ga0400488_47107 Ga0400488_47107_3377_4477 364
419 3300038742 Ga0400486_07908 Ga0400486_07908_7000_8097 364
420 3300038742 Ga0400486_14585 Ga0400486_14585_49_1146 364
421 3300039062 Ga0400483_265139 Ga0400483_265139_1181_2281 364
422 3300039110 Ga0400487_00901 Ga0400487_00901_1358_2455 364
423 3300039447 Ga0436361_0639952 Ga0436361_0639952_876_1982 364
424 3300042876 Ga0451577_0079877 Ga0451577_0079877_501_1622 364
425 3300046458 Ga0495591_003951 Ga0495591_003951_944_2038 364
426 3300046462 Ga0495651_0031279 Ga0495651_0031279_998_2128 364
427 3300046463 Ga0495653_0052995 Ga0495653_0052995_1449_2579 364
428 3300046472 Ga0495580_0000875 Ga0495580_0000875_4864_5994 364
429 3300046474 Ga0495605_0068699 Ga0495605_0068699_443_1537 364
430 3300046507 Ga0495606_0000165 Ga0495606_0000165_573_1670 364
431 3300046512 Ga0495610_0013250 Ga0495610_0013250_1576_2676 364
432 3300046517 Ga0495630_0044652 Ga0495630_0044652_1633_2763 364
433 3300046524 Ga0495648_0000775 Ga0495648_0000775_1421_2536 364
434 3300046524 Ga0495648_0060719 Ga0495648_0060719_214_1329 364
435 3300046526 Ga0495666_0007275 Ga0495666_0007275_3386_4516 364
436 3300046542 Ga0495597_0001190 Ga0495597_0001190_6563_7663 364
437 3300046558 Ga0495633_0000065 Ga0495633_0000065_121285_122385 364
438 3300046660 Ga0495625_0005161 Ga0495625_0005161_3352_4452 364
439 3300046678 Ga0495599_0091824 Ga0495599_0091824_653_1783 364
440 3300046680 Ga0495646_0061535 Ga0495646_0061535_88_1218 364
441 3300047317 Ga0495604_0048640 Ga0495604_0048640_463_1593 364
442 3300047322 Ga0495680_0012454 Ga0495680_0012454_4665_5795 364
443 3300047444 Ga0495675_0037133 Ga0495675_0037133_1807_2937 364
444 3300047446 Ga0495679_003908 Ga0495679_003908_3455_4570 364
445 3300048088 Ga0495602_0137293 Ga0495602_0137293_705_1835 364
446 3300048909 Ga0496106_0000003 Ga0496106_0000003_191241_192434 364
447 3300048924 Ga0496121_0022502 Ga0496121_0022502_1922_3115 364
448 3300048929 Ga0496126_0000455 Ga0496126_0000455_48365_49495 364
449 3300049569 Ga0501032_0068908 Ga0501032_0068908_282_1403 364
450 3300049581 Ga0501047_0101366 Ga0501047_0101366_107_1228 364
451 3300049679 Ga0501249_000706 Ga0501249_000706_3949_5112 364
452 3300049742 Ga0501080_0048161 Ga0501080_0048161_1146_2267 364
453 3300049766 Ga0501269_000265 Ga0501269_000265_10070_11233 364
454 3300049823 Ga0501044_0150185 Ga0501044_0150185_504_1691 364
455 3300050491 nmdc:mga00v17_8062_c1 nmdc:mga00v17_8062_c1_947_2059 364
456 3300050492 nmdc:mga0yw44_15676_c1 nmdc:mga0yw44_15676_c1_1834_2946 364
457 3300050494 nmdc:mga06z11_36_c1 nmdc:mga06z11_36_c1_54730_55842 364
458 3300050495 nmdc:mga04h51_119_c1 nmdc:mga04h51_119_c1_16588_17700 364
459 3300050512 nmdc:mga0n895_7653_c1 nmdc:mga0n895_7653_c1_67_1200 364
460 3300050515 nmdc:mga0a205_5198_c1 nmdc:mga0a205_5198_c1_4238_5371 364
461 3300053125 Ga0500618_000240 Ga0500618_000240_3570_4685 364
462 2162886007 SwRhRL2b_contig_179494 SwRhRL2b_0813.00009960 365
463 2209111006 2214772996 2213793064 365
464 3300000042 ARSoilYngRDRAFT_c00480 ARSoilYngRDRAFT_004802 365
465 3300000043 ARcpr5yngRDRAFT_c000101 ARcpr5yngRDRAFT_0001014 365
466 3300000044 ARSoilOldRDRAFT_c000111 ARSoilOldRDRAFT_0001115 365
467 3300000652 ARCol0yngRDRAFT_1000021 ARCol0yngRDRAFT_100002121 365
468 3300001976 JGI24752J21851_1000948 JGI24752J21851_10009485 365
469 3300001977 JGI24746J21847_1000005 JGI24746J21847_100000514 365
470 3300001989 JGI24739J22299_10004819 JGI24739J22299_100048196 365
471 3300002070 JGI24750J21931_1000059 JGI24750J21931_100005911 365
472 3300002074 JGI24748J21848_1000644 JGI24748J21848_10006443 365
473 3300002075 JGI24738J21930_10000278 JGI24738J21930_1000027811 365
474 3300002077 JGI24744J21845_10000309 JGI24744J21845_100003097 365
475 3300002126 JGI24035J26624_1000329 JGI24035J26624_10003294 365
476 3300002155 JGI24033J26618_1003778 JGI24033J26618_10037782 365
477 3300002244 JGI24742J22300_10000270 JGI24742J22300_100002706 365
478 3300002459 JGI24751J29686_10009481 JGI24751J29686_100094812 365
479 3300002737 JGI25162J39368_1000084 JGI25162J39368_100008449 365
480 3300002737 JGI25162J39368_1004064 JGI25162J39368_10040642 365
481 3300002771 JGI25163J39215_1000245 JGI25163J39215_10002458 365
482 3300002772 JGI25164J39214_1000062 JGI25164J39214_100006261 365
483 3300002773 JGI25152J39213_1004385 JGI25152J39213_10043852 365
484 3300003187 JGI25151J46595_10009962 JGI25151J46595_100099622 365
485 3300003187 JGI25151J46595_10022380 JGI25151J46595_100223802 365
486 3300003215 JGI25153J46596_10009634 JGI25153J46596_100096342 365
487 3300003320 rootH2_10196814 rootH2_101968143 365
488 3300003354 JGI25160J50197_1007031 JGI25160J50197_10070312 365
489 3300003751 Ga0055538_1000060 Ga0055538_100006049 365
490 3300003752 Ga0055539_1000092 Ga0055539_100009249 365
491 3300003756 Ga0055533_1000101 Ga0055533_100010149 365
492 3300003759 Ga0055525_1000134 Ga0055525_100013449 365
493 3300003761 Ga0055535_1000069 Ga0055535_100006932 365
494 3300003762 Ga0055542_1000084 Ga0055542_100008443 365
495 3300003771 Ga0055526_1008447 Ga0055526_10084475 365
496 3300003773 Ga0055537_1003177 Ga0055537_10031775 365
497 3300003773 Ga0055537_1005002 Ga0055537_10050021 365
498 3300003775 Ga0055524_1006091 Ga0055524_10060915 365
499 3300003775 Ga0055524_1007575 Ga0055524_10075751 365
500 3300003784 Ga0055534_1003969 Ga0055534_10039692 365
501 3300003784 Ga0055534_1005085 Ga0055534_10050851 365
502 3300003790 Ga0055528_1006817 Ga0055528_10068175 365
503 3300003792 Ga0055540_1008808 Ga0055540_10088083 365
504 3300003794 Ga0055531_10002481 Ga0055531_100024816 365
505 3300003794 Ga0055531_10015966 Ga0055531_100159662 365
506 3300003841 Ga0055541_1000062 Ga0055541_100006249 365
507 3300003856 Ga0058692_1000055 Ga0058692_100005517 365
508 3300003911 JGI25405J52794_10005502 JGI25405J52794_100055022 365
509 3300004625 Ga0055543_1002903 Ga0055543_10029032 365
510 3300005262 Ga0065165_1007537 Ga0065165_10075375 365
511 3300005289 Ga0065704_10000664 Ga0065704_1000066449 365
512 3300005290 Ga0065712_10071326 Ga0065712_100713262 365
513 3300005293 Ga0065715_10000270 Ga0065715_100002707 365
514 3300005327 Ga0070658_10006794 Ga0070658_100067949 365
515 3300005327 Ga0070658_10072861 Ga0070658_100728612 365
516 3300005328 Ga0070676_10000194 Ga0070676_1000019410 365
517 3300005329 Ga0070683_100001461 Ga0070683_10000146115 365
518 3300005329 Ga0070683_100103922 Ga0070683_1001039222 365
519 3300005330 Ga0070690_100002052 Ga0070690_1000020527 365
520 3300005330 Ga0070690_100018916 Ga0070690_1000189163 365
521 3300005331 Ga0070670_100023270 Ga0070670_1000232702 365
522 3300005333 Ga0070677_10000223 Ga0070677_1000022315 365
523 3300005334 Ga0068869_100000910 Ga0068869_10000091014 365
524 3300005335 Ga0070666_10020841 Ga0070666_100208414 365
525 3300005335 Ga0070666_10278561 Ga0070666_102785611 365
526 3300005336 Ga0070680_100011303 Ga0070680_1000113038 365
527 3300005336 Ga0070680_100062133 Ga0070680_1000621334 365
528 3300005336 Ga0070680_100090091 Ga0070680_1000900912 365
529 3300005336 Ga0070680_100126842 Ga0070680_1001268422 365
530 3300005337 Ga0070682_100000411 Ga0070682_10000041122 365
531 3300005337 Ga0070682_100044608 Ga0070682_1000446083 365
532 3300005338 Ga0068868_100002658 Ga0068868_10000265810 365
533 3300005339 Ga0070660_100004007 Ga0070660_1000040073 365
534 3300005339 Ga0070660_100068030 Ga0070660_1000680303 365
535 3300005339 Ga0070660_100093718 Ga0070660_1000937182 365
536 3300005339 Ga0070660_100123565 Ga0070660_1001235652 365
537 3300005340 Ga0070689_100001606 Ga0070689_1000016067 365
538 3300005341 Ga0070691_10001869 Ga0070691_1000186910 365
539 3300005341 Ga0070691_10025121 Ga0070691_100251213 365
540 3300005343 Ga0070687_100000727 Ga0070687_1000007274 365
541 3300005344 Ga0070661_100001236 Ga0070661_1000012369 365
542 3300005345 Ga0070692_10002603 Ga0070692_100026034 365
543 3300005347 Ga0070668_100002586 Ga0070668_1000025867 365
544 3300005347 Ga0070668_100051079 Ga0070668_1000510794 365
545 3300005347 Ga0070668_100051503 Ga0070668_1000515032 365
546 3300005353 Ga0070669_100002152 Ga0070669_10000215210 365
547 3300005354 Ga0070675_100002725 Ga0070675_1000027259 365
548 3300005354 Ga0070675_100016211 Ga0070675_1000162114 365
549 3300005355 Ga0070671_100000400 Ga0070671_10000040013 365
550 3300005355 Ga0070671_100012085 Ga0070671_1000120855 365
551 3300005355 Ga0070671_100153813 Ga0070671_1001538132 365
552 3300005355 Ga0070671_100165420 Ga0070671_1001654202 365
553 3300005356 Ga0070674_100001765 Ga0070674_1000017654 365
554 3300005356 Ga0070674_100086083 Ga0070674_1000860832 365
555 3300005364 Ga0070673_100000169 Ga0070673_10000016921 365
556 3300005364 Ga0070673_100116828 Ga0070673_1001168281 365
557 3300005365 Ga0070688_100000757 Ga0070688_10000075712 365
558 3300005365 Ga0070688_100002817 Ga0070688_1000028178 365
559 3300005365 Ga0070688_100003731 Ga0070688_1000037314 365
560 3300005366 Ga0070659_100001586 Ga0070659_1000015867 365
561 3300005366 Ga0070659_100061921 Ga0070659_1000619213 365
562 3300005367 Ga0070667_100001596 Ga0070667_10000159610 365
563 3300005367 Ga0070667_100022988 Ga0070667_1000229886 365
564 3300005367 Ga0070667_100027904 Ga0070667_1000279045 365
565 3300005406 Ga0070703_10005976 Ga0070703_100059764 365
566 3300005434 Ga0070709_10215533 Ga0070709_102155332 365
567 3300005435 Ga0070714_100019824 Ga0070714_1000198243 365
568 3300005436 Ga0070713_100014412 Ga0070713_1000144126 365
569 3300005436 Ga0070713_100040260 Ga0070713_1000402602 365
570 3300005437 Ga0070710_10021998 Ga0070710_100219984 365
571 3300005438 Ga0070701_10000774 Ga0070701_100007744 365
572 3300005440 Ga0070705_100001954 Ga0070705_1000019544 365
573 3300005440 Ga0070705_100262542 Ga0070705_1002625421 365
574 3300005441 Ga0070700_100001821 Ga0070700_1000018217 365
575 3300005444 Ga0070694_100001416 Ga0070694_10000141610 365
576 3300005455 Ga0070663_100000593 Ga0070663_10000059313 365
577 3300005456 Ga0070678_100000301 Ga0070678_1000003014 365
578 3300005456 Ga0070678_100004800 Ga0070678_1000048002 365
579 3300005457 Ga0070662_100001940 Ga0070662_1000019409 365
580 3300005457 Ga0070662_100005709 Ga0070662_1000057094 365
581 3300005458 Ga0070681_10014859 Ga0070681_100148594 365
582 3300005458 Ga0070681_10024101 Ga0070681_100241015 365
583 3300005458 Ga0070681_10030328 Ga0070681_100303287 365
584 3300005458 Ga0070681_10051355 Ga0070681_100513554 365
585 3300005458 Ga0070681_10339905 Ga0070681_103399051 365
586 3300005459 Ga0068867_100002072 Ga0068867_10000207210 365
587 3300005459 Ga0068867_100042681 Ga0068867_1000426813 365
588 3300005466 Ga0070685_10008779 Ga0070685_100087796 365
589 3300005471 Ga0070698_100223529 Ga0070698_1002235293 365
590 3300005530 Ga0070679_100012097 Ga0070679_1000120972 365
591 3300005530 Ga0070679_100022903 Ga0070679_1000229036 365
592 3300005530 Ga0070679_100068424 Ga0070679_1000684243 365
593 3300005530 Ga0070679_100093531 Ga0070679_1000935313 365
594 3300005530 Ga0070679_100300950 Ga0070679_1003009502 365
595 3300005535 Ga0070684_100005903 Ga0070684_10000590310 365
596 3300005535 Ga0070684_100018107 Ga0070684_1000181073 365
597 3300005535 Ga0070684_100361084 Ga0070684_1003610842 365
598 3300005536 Ga0070697_100130535 Ga0070697_1001305352 365
599 3300005539 Ga0068853_100009652 Ga0068853_1000096527 365
600 3300005543 Ga0070672_100000611 Ga0070672_10000061110 365
601 3300005544 Ga0070686_100001276 Ga0070686_10000127610 365
602 3300005545 Ga0070695_100002233 Ga0070695_1000022337 365
603 3300005545 Ga0070695_100002508 Ga0070695_10000250810 365
604 3300005546 Ga0070696_100038028 Ga0070696_1000380284 365
605 3300005546 Ga0070696_100087462 Ga0070696_1000874622 365
606 3300005547 Ga0070693_100001538 Ga0070693_1000015387 365
607 3300005548 Ga0070665_100031263 Ga0070665_1000312633 365
608 3300005548 Ga0070665_100146475 Ga0070665_1001464753 365
609 3300005549 Ga0070704_100001853 Ga0070704_1000018535 365
610 3300005563 Ga0068855_100002375 Ga0068855_10000237513 365
611 3300005563 Ga0068855_100011650 Ga0068855_10001165010 365
612 3300005563 Ga0068855_100074018 Ga0068855_1000740183 365
613 3300005563 Ga0068855_100147182 Ga0068855_1001471821 365
614 3300005564 Ga0070664_100024208 Ga0070664_1000242084 365
615 3300005564 Ga0070664_100105013 Ga0070664_1001050132 365
616 3300005564 Ga0070664_100119986 Ga0070664_1001199863 365
617 3300005577 Ga0068857_100003420 Ga0068857_1000034204 365
618 3300005577 Ga0068857_100185896 Ga0068857_1001858961 365
619 3300005578 Ga0068854_100001082 Ga0068854_10000108214 365
620 3300005578 Ga0068854_100175138 Ga0068854_1001751381 365
621 3300005614 Ga0068856_100006654 Ga0068856_10000665411 365
622 3300005614 Ga0068856_100157768 Ga0068856_1001577682 365
623 3300005614 Ga0068856_100226520 Ga0068856_1002265201 365
624 3300005614 Ga0068856_100259546 Ga0068856_1002595462 365
625 3300005616 Ga0068852_100003054 Ga0068852_1000030549 365
626 3300005616 Ga0068852_100015790 Ga0068852_1000157906 365
627 3300005616 Ga0068852_100058996 Ga0068852_1000589961 365
628 3300005617 Ga0068859_100006509 Ga0068859_10000650911 365
629 3300005617 Ga0068859_100164577 Ga0068859_1001645771 365
630 3300005618 Ga0068864_100001244 Ga0068864_10000124415 365
631 3300005618 Ga0068864_100024235 Ga0068864_1000242356 365
632 3300005718 Ga0068866_10000500 Ga0068866_1000050014 365
633 3300005719 Ga0068861_100003449 Ga0068861_10000344910 365
634 3300005834 Ga0068851_10004471 Ga0068851_100044715 365
635 3300005840 Ga0068870_10000015 Ga0068870_1000001559 365
636 3300005841 Ga0068863_100003914 Ga0068863_1000039147 365
637 3300005841 Ga0068863_100043836 Ga0068863_1000438364 365
638 3300005842 Ga0068858_100002760 Ga0068858_10000276015 365
639 3300005842 Ga0068858_100004772 Ga0068858_1000047729 365
640 3300005842 Ga0068858_100113326 Ga0068858_1001133262 365
641 3300005842 Ga0068858_100317014 Ga0068858_1003170142 365
642 3300005843 Ga0068860_100003116 Ga0068860_1000031167 365
643 3300005844 Ga0068862_100003903 Ga0068862_10000390310 365
644 3300005844 Ga0068862_100176586 Ga0068862_1001765863 365
645 3300005937 Ga0081455_10000081 Ga0081455_1000008181 365
646 3300006028 Ga0070717_10014273 Ga0070717_100142732 365
647 3300006163 Ga0070715_10014818 Ga0070715_100148182 365
648 3300006175 Ga0070712_100016368 Ga0070712_1000163685 365
649 3300006175 Ga0070712_100126903 Ga0070712_1001269032 365
650 3300006178 Ga0075367_10022567 Ga0075367_100225674 365
651 3300006237 Ga0097621_100001400 Ga0097621_10000140012 365
652 3300006237 Ga0097621_100075291 Ga0097621_1000752913 365
653 3300006358 Ga0068871_100000359 Ga0068871_10000035914 365
654 3300006358 Ga0068871_100003972 Ga0068871_1000039726 365
655 3300006852 Ga0075433_10009420 Ga0075433_100094207 365
656 3300006871 Ga0075434_100000760 Ga0075434_10000076014 365
657 3300006871 Ga0075434_100058075 Ga0075434_1000580753 365
658 3300006881 Ga0068865_100000439 Ga0068865_1000004399 365
659 3300006881 Ga0068865_100019171 Ga0068865_1000191716 365
660 3300006914 Ga0075436_100139744 Ga0075436_1001397442 365
661 3300006931 Ga0097620_100006509 Ga0097620_10000650911 365
662 3300006931 Ga0097620_100164584 Ga0097620_1001645841 365
663 3300009011 Ga0105251_10025058 Ga0105251_100250581 365
664 3300009036 Ga0105244_10000418 Ga0105244_1000041823 365
665 3300009036 Ga0105244_10011426 Ga0105244_100114262 365
666 3300009092 Ga0105250_10000039 Ga0105250_1000003949 365
667 3300009092 Ga0105250_10000743 Ga0105250_1000074314 365
668 3300009093 Ga0105240_10006246 Ga0105240_1000624610 365
669 3300009093 Ga0105240_10514829 Ga0105240_105148291 365
670 3300009094 Ga0111539_10007413 Ga0111539_100074137 365
671 3300009098 Ga0105245_10001227 Ga0105245_100012277 365
672 3300009098 Ga0105245_10145284 Ga0105245_101452841 365
673 3300009101 Ga0105247_10007195 Ga0105247_100071956 365
674 3300009101 Ga0105247_10056412 Ga0105247_100564121 365
675 3300009148 Ga0105243_10001341 Ga0105243_1000134110 365
676 3300009148 Ga0105243_10006861 Ga0105243_100068615 365
677 3300009148 Ga0105243_10055695 Ga0105243_100556952 365
678 3300009176 Ga0105242_10000411 Ga0105242_1000041129 365
679 3300009176 Ga0105242_10023552 Ga0105242_100235524 365
680 3300009177 Ga0105248_10010917 Ga0105248_100109175 365
681 3300009177 Ga0105248_10341972 Ga0105248_103419721 365
682 3300009177 Ga0105248_10344196 Ga0105248_103441961 365
683 3300009545 Ga0105237_10012158 Ga0105237_100121586 365
684 3300009545 Ga0105237_10016890 Ga0105237_100168903 365
685 3300009545 Ga0105237_10269459 Ga0105237_102694592 365
686 3300009551 Ga0105238_10032313 Ga0105238_100323133 365
687 3300009551 Ga0105238_10106443 Ga0105238_101064432 365
688 3300009553 Ga0105249_10003261 Ga0105249_100032617 365
689 3300009553 Ga0105249_10337878 Ga0105249_103378782 365
690 3300010375 Ga0105239_10006472 Ga0105239_100064727 365
691 3300011119 Ga0105246_10000384 Ga0105246_1000038411 365
692 3300011119 Ga0105246_10097438 Ga0105246_100974382 365
693 3300013100 Ga0157373_10166355 Ga0157373_101663552 365
694 3300013102 Ga0157371_10000101 Ga0157371_10000101140 365
695 3300013102 Ga0157371_10009572 Ga0157371_100095728 365
696 3300013104 Ga0157370_10209952 Ga0157370_102099521 365
697 3300013105 Ga0157369_10090925 Ga0157369_100909253 365
698 3300013297 Ga0157378_10005961 Ga0157378_100059614 365
699 3300013306 Ga0163162_10001455 Ga0163162_1000145510 365
700 3300013307 Ga0157372_10059126 Ga0157372_100591261 365
701 3300013307 Ga0157372_10127126 Ga0157372_101271262 365
702 3300013308 Ga0157375_10005043 Ga0157375_100050438 365
703 3300013308 Ga0157375_10032741 Ga0157375_100327413 365
704 3300014325 Ga0163163_10170586 Ga0163163_101705863 365
705 3300014325 Ga0163163_10242690 Ga0163163_102426901 365
706 3300014326 Ga0157380_10003014 Ga0157380_100030144 365
707 3300014745 Ga0157377_10000224 Ga0157377_1000022422 365
708 3300014968 Ga0157379_10002183 Ga0157379_1000218312 365
709 3300014968 Ga0157379_10024465 Ga0157379_100244655 365
710 3300014968 Ga0157379_10063592 Ga0157379_100635924 365
711 3300014969 Ga0157376_10001879 Ga0157376_1000187912 365
712 3300017792 Ga0163161_10000471 Ga0163161_1000047124 365
713 3300017792 Ga0163161_10018737 Ga0163161_100187375 365
714 3300017792 Ga0163161_10035790 Ga0163161_100357904 365
715 3300020070 Ga0206356_10495441 Ga0206356_104954413 365
716 3300021361 Ga0213872_10035362 Ga0213872_100353622 365
717 3300021384 Ga0213876_10048152 Ga0213876_100481522 365
718 3300025207 Ga0209760_100001 Ga0209760_100001111 365
719 3300025208 Ga0209436_106393 Ga0209436_1063932 365
720 3300025224 Ga0209784_100001 Ga0209784_1000011166 365
721 3300025225 Ga0209566_100001 Ga0209566_1000011166 365
722 3300025226 Ga0209674_100002 Ga0209674_1000021166 365
723 3300025228 Ga0209672_101496 Ga0209672_1014964 365
724 3300025230 Ga0209563_100008 Ga0209563_1000081167 365
725 3300025231 Ga0207427_100002 Ga0207427_100002111 365
726 3300025233 Ga0209437_100007 Ga0209437_100007619 365
727 3300025242 Ga0209258_100093 Ga0209258_100093176 365
728 3300025245 Ga0207425_1002336 Ga0207425_10023364 365
729 3300025253 Ga0209677_100004 Ga0209677_1000041167 365
730 3300025254 Ga0209148_1000007 Ga0209148_10000071143 365
731 3300025258 Ga0209129_1000147 Ga0209129_100014736 365
732 3300025261 Ga0209233_1005667 Ga0209233_10056671 365
733 3300025263 Ga0209565_1000109 Ga0209565_10001091 365
734 3300025263 Ga0209565_1000534 Ga0209565_100053413 365
735 3300025271 Ga0207666_1000074 Ga0207666_100007410 365
736 3300025271 Ga0207666_1000672 Ga0207666_10006725 365
737 3300025273 Ga0209673_1010944 Ga0209673_10109442 365
738 3300025273 Ga0209673_1045579 Ga0209673_10455791 365
739 3300025284 Ga0209130_1000916 Ga0209130_100091616 365
740 3300025290 Ga0207673_1000705 Ga0207673_10007052 365
741 3300025291 Ga0209675_1000379 Ga0209675_100037921 365
742 3300025291 Ga0209675_1002300 Ga0209675_10023001 365
743 3300025294 Ga0209025_1000194 Ga0209025_1000194128 365
744 3300025294 Ga0209025_1000307 Ga0209025_100030781 365
745 3300025294 Ga0209025_1001123 Ga0209025_10011239 365
746 3300025295 Ga0209564_1000327 Ga0209564_100032716 365
747 3300025295 Ga0209564_1003792 Ga0209564_10037921 365
748 3300025297 Ga0209758_1000199 Ga0209758_100019955 365
749 3300025297 Ga0209758_1029495 Ga0209758_10294952 365
750 3300025299 Ga0209256_1000151 Ga0209256_10001519 365
751 3300025299 Ga0209256_1002908 Ga0209256_10029081 365
752 3300025302 Ga0207426_1000049 Ga0207426_1000049248 365
753 3300025303 Ga0209051_1000301 Ga0209051_100030146 365
754 3300025303 Ga0209051_1000354 Ga0209051_100035410 365
755 3300025303 Ga0209051_1009720 Ga0209051_10097205 365
756 3300025304 Ga0209257_1000022 Ga0209257_1000022551 365
757 3300025315 Ga0207697_10001234 Ga0207697_100012347 365
758 3300025321 Ga0207656_10008685 Ga0207656_100086854 365
759 3300025711 Ga0207696_1000026 Ga0207696_1000026361 365
760 3300025711 Ga0207696_1000625 Ga0207696_10006257 365
761 3300025728 Ga0207655_1000894 Ga0207655_100089424 365
762 3300025728 Ga0207655_1001329 Ga0207655_10013299 365
763 3300025885 Ga0207653_10010869 Ga0207653_100108693 365
764 3300025893 Ga0207682_10000169 Ga0207682_1000016915 365
765 3300025899 Ga0207642_10001573 Ga0207642_100015733 365
766 3300025900 Ga0207710_10002213 Ga0207710_1000221310 365
767 3300025900 Ga0207710_10003166 Ga0207710_100031664 365
768 3300025901 Ga0207688_10000157 Ga0207688_1000015711 365
769 3300025903 Ga0207680_10004108 Ga0207680_100041083 365
770 3300025903 Ga0207680_10018417 Ga0207680_100184174 365
771 3300025904 Ga0207647_10001770 Ga0207647_1000177010 365
772 3300025906 Ga0207699_10145371 Ga0207699_101453712 365
773 3300025907 Ga0207645_10003164 Ga0207645_1000316410 365
774 3300025908 Ga0207643_10000004 Ga0207643_10000004103 365
775 3300025909 Ga0207705_10212602 Ga0207705_102126021 365
776 3300025911 Ga0207654_10001412 Ga0207654_100014128 365
777 3300025912 Ga0207707_10000992 Ga0207707_1000099218 365
778 3300025912 Ga0207707_10027076 Ga0207707_100270765 365
779 3300025912 Ga0207707_10031970 Ga0207707_100319705 365
780 3300025912 Ga0207707_10153007 Ga0207707_101530072 365
781 3300025913 Ga0207695_10027245 Ga0207695_100272456 365
782 3300025914 Ga0207671_10012511 Ga0207671_100125113 365
783 3300025914 Ga0207671_10110335 Ga0207671_101103352 365
784 3300025915 Ga0207693_10001228 Ga0207693_1000122816 365
785 3300025915 Ga0207693_10082116 Ga0207693_100821163 365
786 3300025916 Ga0207663_10057725 Ga0207663_100577253 365
787 3300025917 Ga0207660_10000307 Ga0207660_100003074 365
788 3300025917 Ga0207660_10044506 Ga0207660_100445064 365
789 3300025917 Ga0207660_10057522 Ga0207660_100575222 365
790 3300025918 Ga0207662_10000850 Ga0207662_1000085010 365
791 3300025919 Ga0207657_10002203 Ga0207657_100022039 365
792 3300025919 Ga0207657_10008189 Ga0207657_100081898 365
793 3300025919 Ga0207657_10041021 Ga0207657_100410212 365
794 3300025919 Ga0207657_10175869 Ga0207657_101758692 365
795 3300025920 Ga0207649_10001352 Ga0207649_100013524 365
796 3300025921 Ga0207652_10002958 Ga0207652_1000295814 365
797 3300025921 Ga0207652_10055916 Ga0207652_100559162 365
798 3300025921 Ga0207652_10064427 Ga0207652_100644272 365
799 3300025922 Ga0207646_10198128 Ga0207646_101981283 365
800 3300025923 Ga0207681_10001165 Ga0207681_1000116511 365
801 3300025923 Ga0207681_10059100 Ga0207681_100591002 365
802 3300025924 Ga0207694_10168088 Ga0207694_101680881 365
803 3300025925 Ga0207650_10007784 Ga0207650_100077844 365
804 3300025926 Ga0207659_10000038 Ga0207659_1000003892 365
805 3300025926 Ga0207659_10078264 Ga0207659_100782642 365
806 3300025927 Ga0207687_10000966 Ga0207687_1000096611 365
807 3300025927 Ga0207687_10005917 Ga0207687_100059172 365
808 3300025927 Ga0207687_10059041 Ga0207687_100590414 365
809 3300025929 Ga0207664_10147467 Ga0207664_101474672 365
810 3300025929 Ga0207664_10160249 Ga0207664_101602491 365
811 3300025931 Ga0207644_10000785 Ga0207644_100007852 365
812 3300025931 Ga0207644_10081528 Ga0207644_100815283 365
813 3300025931 Ga0207644_10159425 Ga0207644_101594252 365
814 3300025932 Ga0207690_10000805 Ga0207690_100008058 365
815 3300025932 Ga0207690_10063829 Ga0207690_100638291 365
816 3300025933 Ga0207706_10003945 Ga0207706_100039457 365
817 3300025933 Ga0207706_10004195 Ga0207706_1000419510 365
818 3300025933 Ga0207706_10126173 Ga0207706_101261732 365
819 3300025934 Ga0207686_10001021 Ga0207686_100010219 365
820 3300025934 Ga0207686_10009204 Ga0207686_100092045 365
821 3300025935 Ga0207709_10000645 Ga0207709_1000064519 365
822 3300025935 Ga0207709_10010819 Ga0207709_100108192 365
823 3300025936 Ga0207670_10001354 Ga0207670_100013548 365
824 3300025936 Ga0207670_10029551 Ga0207670_100295512 365
825 3300025937 Ga0207669_10000063 Ga0207669_1000006313 365
826 3300025937 Ga0207669_10037738 Ga0207669_100377381 365
827 3300025937 Ga0207669_10063360 Ga0207669_100633603 365
828 3300025938 Ga0207704_10000540 Ga0207704_100005405 365
829 3300025938 Ga0207704_10172593 Ga0207704_101725932 365
830 3300025939 Ga0207665_10002733 Ga0207665_1000273311 365
831 3300025939 Ga0207665_10012974 Ga0207665_100129742 365
832 3300025940 Ga0207691_10004163 Ga0207691_1000416310 365
833 3300025941 Ga0207711_10002693 Ga0207711_1000269313 365
834 3300025941 Ga0207711_10010594 Ga0207711_100105942 365
835 3300025941 Ga0207711_10020036 Ga0207711_100200366 365
836 3300025942 Ga0207689_10001462 Ga0207689_1000146211 365
837 3300025942 Ga0207689_10008666 Ga0207689_100086664 365
838 3300025944 Ga0207661_10001037 Ga0207661_100010376 365
839 3300025944 Ga0207661_10172123 Ga0207661_101721232 365
840 3300025945 Ga0207679_10000673 Ga0207679_1000067319 365
841 3300025945 Ga0207679_10107168 Ga0207679_101071682 365
842 3300025949 Ga0207667_10020248 Ga0207667_100202486 365
843 3300025949 Ga0207667_10372545 Ga0207667_103725451 365
844 3300025960 Ga0207651_10000116 Ga0207651_1000011625 365
845 3300025960 Ga0207651_10307417 Ga0207651_103074171 365
846 3300025961 Ga0207712_10002012 Ga0207712_100020127 365
847 3300025961 Ga0207712_10004960 Ga0207712_100049604 365
848 3300025972 Ga0207668_10000300 Ga0207668_1000030019 365
849 3300025972 Ga0207668_10043709 Ga0207668_100437093 365
850 3300025981 Ga0207640_10000435 Ga0207640_1000043515 365
851 3300025986 Ga0207658_10002963 Ga0207658_100029634 365
852 3300025986 Ga0207658_10022657 Ga0207658_100226575 365
853 3300025986 Ga0207658_10128470 Ga0207658_101284702 365
854 3300026023 Ga0207677_10000587 Ga0207677_1000058711 365
855 3300026035 Ga0207703_10002543 Ga0207703_100025436 365
856 3300026035 Ga0207703_10015006 Ga0207703_100150064 365
857 3300026035 Ga0207703_10104050 Ga0207703_101040503 365
858 3300026041 Ga0207639_10002760 Ga0207639_100027605 365
859 3300026041 Ga0207639_10032120 Ga0207639_100321204 365
860 3300026041 Ga0207639_10034881 Ga0207639_100348814 365
861 3300026067 Ga0207678_10001349 Ga0207678_100013496 365
862 3300026067 Ga0207678_10022212 Ga0207678_100222122 365
863 3300026075 Ga0207708_10002313 Ga0207708_100023137 365
864 3300026075 Ga0207708_10021050 Ga0207708_100210506 365
865 3300026078 Ga0207702_10005132 Ga0207702_100051326 365
866 3300026078 Ga0207702_10067598 Ga0207702_100675982 365
867 3300026078 Ga0207702_10104329 Ga0207702_101043293 365
868 3300026078 Ga0207702_10280800 Ga0207702_102808001 365
869 3300026078 Ga0207702_10428487 Ga0207702_104284871 365
870 3300026088 Ga0207641_10002690 Ga0207641_1000269012 365
871 3300026088 Ga0207641_10042050 Ga0207641_100420502 365
872 3300026088 Ga0207641_10193884 Ga0207641_101938842 365
873 3300026089 Ga0207648_10004670 Ga0207648_1000467010 365
874 3300026095 Ga0207676_10001465 Ga0207676_1000146511 365
875 3300026095 Ga0207676_10005579 Ga0207676_100055795 365
876 3300026116 Ga0207674_10005769 Ga0207674_1000576911 365
877 3300026118 Ga0207675_100004143 Ga0207675_10000414310 365
878 3300026118 Ga0207675_100064784 Ga0207675_1000647842 365
879 3300026121 Ga0207683_10000138 Ga0207683_1000013847 365
880 3300026121 Ga0207683_10005177 Ga0207683_100051776 365
881 3300026142 Ga0207698_10000568 Ga0207698_1000056811 365
882 3300027617 Ga0210002_1000723 Ga0210002_10007233 365
883 3300027682 Ga0209971_1001690 Ga0209971_10016904 365
884 3300027695 Ga0209966_1001187 Ga0209966_10011875 365
885 3300027695 Ga0209966_1002127 Ga0209966_10021274 365
886 3300027907 Ga0207428_10000501 Ga0207428_1000050122 365
887 3300027907 Ga0207428_10001016 Ga0207428_1000101623 365
888 3300028379 Ga0268266_10001262 Ga0268266_100012629 365
889 3300028379 Ga0268266_10051613 Ga0268266_100516134 365
890 3300028380 Ga0268265_10001141 Ga0268265_100011419 365
891 3300028380 Ga0268265_10110556 Ga0268265_101105563 365
892 3300028380 Ga0268265_10126649 Ga0268265_101266491 365
893 3300028381 Ga0268264_10001321 Ga0268264_100013219 365
894 3300028381 Ga0268264_10171002 Ga0268264_101710022 365
895 3300028558 Ga0265326_10002676 Ga0265326_100026765 365
896 3300028573 Ga0265334_10011858 Ga0265334_100118584 365
897 3300028577 Ga0265318_10000647 Ga0265318_100006476 365
898 3300028786 Ga0307517_10004912 Ga0307517_100049128 365
899 3300028786 Ga0307517_10065343 Ga0307517_100653432 365
900 3300028794 Ga0307515_10000138 Ga0307515_10000138151 365
901 3300028794 Ga0307515_10005581 Ga0307515_100055813 365
902 3300028800 Ga0265338_10006098 Ga0265338_100060989 365
903 3300028800 Ga0265338_10015318 Ga0265338_100153185 365
904 3300030522 Ga0307512_10010075 Ga0307512_100100753 365
905 3300031235 Ga0265330_10003117 Ga0265330_100031177 365
906 3300031238 Ga0265332_10006961 Ga0265332_100069615 365
907 3300031239 Ga0265328_10007481 Ga0265328_100074815 365
908 3300031240 Ga0265320_10002935 Ga0265320_100029358 365
909 3300031241 Ga0265325_10003130 Ga0265325_100031305 365
910 3300031242 Ga0265329_10003338 Ga0265329_100033385 365
911 3300031249 Ga0265339_10021781 Ga0265339_100217811 365
912 3300031249 Ga0265339_10032015 Ga0265339_100320153 365
913 3300031250 Ga0265331_10024664 Ga0265331_100246643 365
914 3300031344 Ga0265316_10007577 Ga0265316_100075777 365
915 3300031456 Ga0307513_10023661 Ga0307513_100236614 365
916 3300031456 Ga0307513_10051472 Ga0307513_100514722 365
917 3300031507 Ga0307509_10004147 Ga0307509_1000414718 365
918 3300031507 Ga0307509_10004183 Ga0307509_1000418310 365
919 3300031507 Ga0307509_10004884 Ga0307509_1000488421 365
920 3300031507 Ga0307509_10061981 Ga0307509_100619812 365
921 3300031548 Ga0307408_100002313 Ga0307408_1000023138 365
922 3300031548 Ga0307408_100081580 Ga0307408_1000815801 365
923 3300031548 Ga0307408_100186313 Ga0307408_1001863132 365
924 3300031595 Ga0265313_10000716 Ga0265313_100007167 365
925 3300031595 Ga0265313_10003101 Ga0265313_100031016 365
926 3300031616 Ga0307508_10011794 Ga0307508_100117943 365
927 3300031616 Ga0307508_10012983 Ga0307508_100129836 365
928 3300031711 Ga0265314_10002259 Ga0265314_1000225918 365
929 3300031711 Ga0265314_10006251 Ga0265314_100062515 365
930 3300031711 Ga0265314_10010751 Ga0265314_100107513 365
931 3300031712 Ga0265342_10000940 Ga0265342_100009408 365
932 3300031712 Ga0265342_10048027 Ga0265342_100480272 365
933 3300031731 Ga0307405_10194860 Ga0307405_101948601 365
934 3300031824 Ga0307413_10003432 Ga0307413_100034323 365
935 3300031852 Ga0307410_10007603 Ga0307410_100076035 365
936 3300031901 Ga0307406_10016613 Ga0307406_100166134 365
937 3300031903 Ga0307407_10005458 Ga0307407_100054585 365
938 3300031995 Ga0307409_100023384 Ga0307409_1000233844 365
939 3300032002 Ga0307416_100017717 Ga0307416_1000177173 365
940 3300032005 Ga0307411_10059818 Ga0307411_100598183 365
941 3300032126 Ga0307415_100016117 Ga0307415_1000161172 365
942 3300033180 Ga0307510_10012162 Ga0307510_100121626 365
943 3300033180 Ga0307510_10044259 Ga0307510_100442593 365
944 3300034818 Ga0373950_0007719 Ga0373950_0007719_500_1615 365
945 3300034819 Ga0373958_0000662 Ga0373958_0000662_1728_2843 365
946 3300035086 Ga0373934_0040745 Ga0373934_0040745_348_1463 365
947 3300035090 Ga0373949_0000806 Ga0373949_0000806_6724_7839 365
948 3300035091 Ga0373951_0005691 Ga0373951_0005691_115_1233 365
949 3300035092 Ga0373952_0001150 Ga0373952_0001150_2856_3971 365
950 3300035111 Ga0373923_0050991 Ga0373923_0050991_398_1513 365
951 3300035112 Ga0373932_0000362 Ga0373932_0000362_728_1843 365
952 3300035112 Ga0373932_0008571 Ga0373932_0008571_793_1911 365
953 3300035114 Ga0373939_0000233 Ga0373939_0000233_5904_7019 365
954 3300035114 Ga0373939_0014739 Ga0373939_0014739_815_1933 365
955 3300035115 Ga0373941_0000133 Ga0373941_0000133_7637_8752 365
956 3300035118 Ga0373954_0004727 Ga0373954_0004727_4359_5474 365
957 3300035120 Ga0373957_0010497 Ga0373957_0010497_258_1373 365
958 3300035121 Ga0373960_0000182 Ga0373960_0000182_7212_8327 365
959 3300035171 Ga0373946_0021326 Ga0373946_0021326_863_1978 365
960 3300035207 Ga0373942_0004221 Ga0373942_0004221_1899_3017 365
961 3300035241 Ga0373961_0015346 Ga0373961_0015346_259_1374 365
962 3300035242 Ga0373962_0001963 Ga0373962_0001963_2162_3277 365
963 3300035242 Ga0373962_0003879 Ga0373962_0003879_205_1323 365
964 3300035691 Ga0373931_0000201 Ga0373931_0000201_9234_10349 365
965 3300035692 Ga0373935_0027106 Ga0373935_0027106_1872_2990 365
966 3300035692 Ga0373935_0080452 Ga0373935_0080452_404_1519 365
967 3300035695 Ga0373927_0083536 Ga0373927_0083536_46_1161 365
968 3300035725 Ga0373947_0001864 Ga0373947_0001864_4500_5618 365
969 3300036401 Ga0373937_0363920 Ga0373937_0363920_67_1182 365
970 3300037068 Ga0373925_0001650 Ga0373925_0001650_9562_10674 365
971 3300037068 Ga0373925_0003098 Ga0373925_0003098_574_1692 365
972 3300037312 Ga0395899_0008070 Ga0395899_0008070_1861_2976 365
973 3300037312 Ga0395899_0011883 Ga0395899_0011883_3939_5054 365
974 3300037312 Ga0395899_0012727 Ga0395899_0012727_2643_3752 365
975 3300037312 Ga0395899_0119134 Ga0395899_0119134_295_1458 365
976 3300037418 Ga0395900_0009953 Ga0395900_0009953_7333_8442 365
977 3300037418 Ga0395900_0075223 Ga0395900_0075223_2224_3339 365
978 3300037466 Ga0395898_0004361 Ga0395898_0004361_14339_15454 365
979 3300037466 Ga0395898_0011214 Ga0395898_0011214_2388_3497 365
980 3300037466 Ga0395898_0036029 Ga0395898_0036029_960_2075 365
981 3300037466 Ga0395898_0071002 Ga0395898_0071002_263_1372 365
982 3300037471 Ga0395905_0000431 Ga0395905_0000431_46729_47844 365
983 3300037471 Ga0395905_0002347 Ga0395905_0002347_2486_3622 365
984 3300037471 Ga0395905_0029909 Ga0395905_0029909_2224_3333 365
985 3300037471 Ga0395905_0119283 Ga0395905_0119283_937_2052 365
986 3300038443 Ga0395901_0007051 Ga0395901_0007051_3489_4604 365
987 3300038443 Ga0395901_0020806 Ga0395901_0020806_1415_2530 365
988 3300038443 Ga0395901_0073003 Ga0395901_0073003_688_1851 365
989 3300038443 Ga0395901_0181993 Ga0395901_0181993_1020_2129 365
990 3300038443 Ga0395901_0268068 Ga0395901_0268068_311_1426 365
991 3300038705 Ga0237819_00544 Ga0237819_00544_10239_11345 365
992 3300039447 Ga0436361_1049346 Ga0436361_1049346_4628_5743 365
993 3300041413 Ga0439465_0026623 Ga0439465_0026623_534_1673 365
994 3300044669 Ga0466981_0000028 Ga0466981_0000028_18555_19655 365
995 3300044694 Ga0466963_0044773 Ga0466963_0044773_1652_2779 365
996 3300044694 Ga0466963_0050584 Ga0466963_0050584_830_1993 365
997 3300044712 Ga0453684_0424549 Ga0453684_0424549_127_1257 365
998 3300044842 Ga0466957_0059843 Ga0466957_0059843_69_1178 365
999 3300045051 Ga0451576_0001995 Ga0451576_0001995_18949_20079 365
1000 3300046454 Ga0495592_0000250 Ga0495592_0000250_29908_31023 365
1001 3300046455 Ga0495603_0048103 Ga0495603_0048103_1168_2286 365
1002 3300046457 Ga0495590_0000194 Ga0495590_0000194_25527_26642 365
1003 3300046459 Ga0495629_0000753 Ga0495629_0000753_18063_19181 365
1004 3300046460 Ga0495638_0173392 Ga0495638_0173392_19_1137 365
1005 3300046461 Ga0495641_0072722 Ga0495641_0072722_313_1428 365
1006 3300046462 Ga0495651_0001426 Ga0495651_0001426_1328_2443 365
1007 3300046463 Ga0495653_0007689 Ga0495653_0007689_5347_6462 365
1008 3300046463 Ga0495653_0020780 Ga0495653_0020780_4157_5272 365
1009 3300046471 Ga0495650_0000016 Ga0495650_0000016_31714_32811 365
1010 3300046472 Ga0495580_0082792 Ga0495580_0082792_788_1903 365
1011 3300046473 Ga0495582_0001659 Ga0495582_0001659_6587_7702 365
1012 3300046473 Ga0495582_0015740 Ga0495582_0015740_1498_2616 365
1013 3300046473 Ga0495582_0089400 Ga0495582_0089400_567_1682 365
1014 3300046473 Ga0495582_0131603 Ga0495582_0131603_92_1207 365
1015 3300046474 Ga0495605_0070831 Ga0495605_0070831_161_1285 365
1016 3300046475 Ga0495639_0030825 Ga0495639_0030825_1200_2315 365
1017 3300046476 Ga0495662_0112075 Ga0495662_0112075_22_1137 365
1018 3300046491 Ga0495584_0043774 Ga0495584_0043774_559_1674 365
1019 3300046500 Ga0495596_0002323 Ga0495596_0002323_1240_2355 365
1020 3300046500 Ga0495596_0006771 Ga0495596_0006771_3477_4580 365
1021 3300046501 Ga0495607_0019573 Ga0495607_0019573_329_1483 365
1022 3300046506 Ga0495583_0000149 Ga0495583_0000149_93359_94474 365
1023 3300046507 Ga0495606_0003759 Ga0495606_0003759_9477_10592 365
1024 3300046511 Ga0495608_0001990 Ga0495608_0001990_13427_14542 365
1025 3300046512 Ga0495610_0060500 Ga0495610_0060500_557_1672 365
1026 3300046514 Ga0495618_0002569 Ga0495618_0002569_6841_7956 365
1027 3300046515 Ga0495620_0043614 Ga0495620_0043614_304_1419 365
1028 3300046517 Ga0495630_0004025 Ga0495630_0004025_7669_8784 365
1029 3300046517 Ga0495630_0076160 Ga0495630_0076160_639_1754 365
1030 3300046517 Ga0495630_0138706 Ga0495630_0138706_699_1814 365
1031 3300046523 Ga0495644_0037635 Ga0495644_0037635_299_1414 365
1032 3300046526 Ga0495666_0029609 Ga0495666_0029609_1372_2487 365
1033 3300046529 Ga0495652_0049824 Ga0495652_0049824_1122_2237 365
1034 3300046531 Ga0495665_0033100 Ga0495665_0033100_518_1633 365
1035 3300046536 Ga0495587_0005444 Ga0495587_0005444_2639_3754 365
1036 3300046538 Ga0495609_0009954 Ga0495609_0009954_1033_2148 365
1037 3300046543 Ga0495645_0049903 Ga0495645_0049903_166_1281 365
1038 3300046557 Ga0495622_0063627 Ga0495622_0063627_180_1295 365
1039 3300046557 Ga0495622_0064014 Ga0495622_0064014_558_1676 365
1040 3300046616 Ga0495668_0002416 Ga0495668_0002416_10839_11954 365
1041 3300046642 Ga0495634_0047634 Ga0495634_0047634_1654_2769 365
1042 3300046660 Ga0495625_0001637 Ga0495625_0001637_825_1940 365
1043 3300046660 Ga0495625_0014089 Ga0495625_0014089_2623_3738 365
1044 3300046665 Ga0495661_0072174 Ga0495661_0072174_473_1588 365
1045 3300046674 Ga0495588_0026815 Ga0495588_0026815_719_1834 365
1046 3300046674 Ga0495588_0099986 Ga0495588_0099986_110_1225 365
1047 3300046679 Ga0495623_0034053 Ga0495623_0034053_1574_2689 365
1048 3300046680 Ga0495646_0017562 Ga0495646_0017562_3274_4389 365
1049 3300046681 Ga0495647_0066535 Ga0495647_0066535_53_1168 365
1050 3300046683 Ga0495658_0006858 Ga0495658_0006858_2124_3242 365
1051 3300046683 Ga0495658_0048860 Ga0495658_0048860_798_1913 365
1052 3300046684 Ga0495669_0000075 Ga0495669_0000075_14978_16093 365
1053 3300046689 Ga0495613_0004700 Ga0495613_0004700_2578_3732 365
1054 3300046689 Ga0495613_0019456 Ga0495613_0019456_1254_2372 365
1055 3300046692 Ga0495671_0003075 Ga0495671_0003075_5739_6854 365
1056 3300046692 Ga0495671_0018007 Ga0495671_0018007_1354_2469 365
1057 3300046694 Ga0495649_0000396 Ga0495649_0000396_32797_33912 365
1058 3300046794 Ga0495589_0028828 Ga0495589_0028828_482_1597 365
1059 3300046809 Ga0495600_0006772 Ga0495600_0006772_4091_5206 365
1060 3300046809 Ga0495600_0041087 Ga0495600_0041087_604_1719 365
1061 3300046810 Ga0495660_0000189 Ga0495660_0000189_11266_12363 365
1062 3300047315 Ga0495581_0025513 Ga0495581_0025513_60_1175 365
1063 3300047317 Ga0495604_0066259 Ga0495604_0066259_645_1760 365
1064 3300047319 Ga0495674_0022419 Ga0495674_0022419_4076_5191 365
1065 3300047319 Ga0495674_0113184 Ga0495674_0113184_259_1374 365
1066 3300047321 Ga0495676_0017396 Ga0495676_0017396_2059_3177 365
1067 3300047444 Ga0495675_0017062 Ga0495675_0017062_2730_3845 365
1068 3300047445 Ga0495677_0000154 Ga0495677_0000154_9172_10287 365
1069 3300047445 Ga0495677_0006061 Ga0495677_0006061_1979_3094 365
1070 3300047445 Ga0495677_0034044 Ga0495677_0034044_155_1435 365
1071 3300047471 Ga0495684_0192923 Ga0495684_0192923_109_1224 365
1072 3300047472 Ga0495686_0000923 Ga0495686_0000923_12578_13693 365
1073 3300047472 Ga0495686_0013528 Ga0495686_0013528_3675_4790 365
1074 3300047472 Ga0495686_0035130 Ga0495686_0035130_1008_2114 365
1075 3300048088 Ga0495602_0002022 Ga0495602_0002022_4832_5947 365
1076 3300048089 Ga0495614_0024919 Ga0495614_0024919_1068_2183 365
1077 3300048903 Ga0496100_0000326 Ga0496100_0000326_7191_8306 365
1078 3300048903 Ga0496100_0034458 Ga0496100_0034458_1997_3115 365
1079 3300048903 Ga0496100_0110257 Ga0496100_0110257_257_1372 365
1080 3300048904 Ga0496101_0010563 Ga0496101_0010563_2445_3560 365
1081 3300048904 Ga0496101_0022406 Ga0496101_0022406_63_1181 365
1082 3300048905 Ga0496102_0001315 Ga0496102_0001315_12151_13266 365
1083 3300048905 Ga0496102_0108357 Ga0496102_0108357_63_1175 365
1084 3300048905 Ga0496102_0180372 Ga0496102_0180372_205_1323 365
1085 3300048905 Ga0496102_0248324 Ga0496102_0248324_497_1615 365
1086 3300048906 Ga0496103_0002237 Ga0496103_0002237_8469_9584 365
1087 3300048906 Ga0496103_0054276 Ga0496103_0054276_354_1472 365
1088 3300048907 Ga0496104_0000484 Ga0496104_0000484_31225_32322 365
1089 3300048907 Ga0496104_0109955 Ga0496104_0109955_1461_2579 365
1090 3300048909 Ga0496106_0005158 Ga0496106_0005158_2667_3782 365
1091 3300048909 Ga0496106_0025179 Ga0496106_0025179_215_1333 365
1092 3300048910 Ga0496107_0002339 Ga0496107_0002339_7370_8485 365
1093 3300048910 Ga0496107_0004092 Ga0496107_0004092_1256_2374 365
1094 3300048911 Ga0496108_0002892 Ga0496108_0002892_12573_13688 365
1095 3300048911 Ga0496108_0191912 Ga0496108_0191912_590_1708 365
1096 3300048912 Ga0496109_0000409 Ga0496109_0000409_8210_9325 365
1097 3300048912 Ga0496109_0121411 Ga0496109_0121411_63_1181 365
1098 3300048912 Ga0496109_0121798 Ga0496109_0121798_63_1175 365
1099 3300048913 Ga0496110_0228384 Ga0496110_0228384_63_1181 365
1100 3300048914 Ga0496111_0048862 Ga0496111_0048862_63_1181 365
1101 3300048915 Ga0496112_0082579 Ga0496112_0082579_63_1181 365
1102 3300048916 Ga0496113_0084543 Ga0496113_0084543_1256_2374 365
1103 3300048916 Ga0496113_0100258 Ga0496113_0100258_1017_2132 365
1104 3300048917 Ga0496114_0002505 Ga0496114_0002505_9212_10327 365
1105 3300048917 Ga0496114_0024049 Ga0496114_0024049_2622_3740 365
1106 3300048917 Ga0496114_0040268 Ga0496114_0040268_2522_3637 365
1107 3300048918 Ga0496115_0047311 Ga0496115_0047311_188_1303 365
1108 3300048918 Ga0496115_0089318 Ga0496115_0089318_305_1423 365
1109 3300048919 Ga0496116_0000158 Ga0496116_0000158_11267_12364 365
1110 3300048920 Ga0496117_0024182 Ga0496117_0024182_552_1649 365
1111 3300048920 Ga0496117_0070630 Ga0496117_0070630_959_2098 365
1112 3300048921 Ga0496118_0001836 Ga0496118_0001836_20206_21303 365
1113 3300048921 Ga0496118_0002524 Ga0496118_0002524_12841_13980 365
1114 3300048922 Ga0496119_0015558 Ga0496119_0015558_2405_3502 365
1115 3300048923 Ga0496120_0003713 Ga0496120_0003713_11683_12780 365
1116 3300048925 Ga0496122_0000013 Ga0496122_0000013_31712_32809 365
1117 3300048926 Ga0496123_0000010 Ga0496123_0000010_468231_469328 365
1118 3300048927 Ga0496124_0000152 Ga0496124_0000152_50969_52066 365
1119 3300048928 Ga0496125_0000546 Ga0496125_0000546_16556_17653 365
1120 3300048928 Ga0496125_0025778 Ga0496125_0025778_631_1770 365
1121 3300048928 Ga0496125_0041595 Ga0496125_0041595_1787_2911 365
1122 3300048929 Ga0496126_0000284 Ga0496126_0000284_11353_12450 365
1123 3300048929 Ga0496126_0106670 Ga0496126_0106670_423_1544 365
1124 3300049569 Ga0501032_0079502 Ga0501032_0079502_896_2008 365
1125 3300049570 Ga0501033_0158379 Ga0501033_0158379_368_1483 365
1126 3300049570 Ga0501033_0163129 Ga0501033_0163129_44_1156 365
1127 3300049571 Ga0501034_0060215 Ga0501034_0060215_427_1539 365
1128 3300049571 Ga0501034_0086257 Ga0501034_0086257_551_1663 365
1129 3300049571 Ga0501034_0155004 Ga0501034_0155004_1047_2162 365
1130 3300049574 Ga0501038_0229608 Ga0501038_0229608_11_1123 365
1131 3300049579 Ga0501043_0146263 Ga0501043_0146263_504_1616 365
1132 3300049581 Ga0501047_0121680 Ga0501047_0121680_278_1390 365
1133 3300049581 Ga0501047_0307818 Ga0501047_0307818_146_1414 365
1134 3300049582 Ga0501048_0230265 Ga0501048_0230265_26_1138 365
1135 3300049586 Ga0501070_0013624 Ga0501070_0013624_2404_3516 365
1136 3300049587 Ga0501071_0188453 Ga0501071_0188453_354_1466 365
1137 3300049590 Ga0501074_0110721 Ga0501074_0110721_38_1144 365
1138 3300049658 Ga0501211_005745 Ga0501211_005745_20_1135 365
1139 3300049744 Ga0501083_0063330 Ga0501083_0063330_976_2088 365
1140 3300049822 Ga0501035_0156072 Ga0501035_0156072_342_1457 365
1141 3300049823 Ga0501044_0040799 Ga0501044_0040799_150_1265 365
1142 3300050494 nmdc:mga06z11_14548_c1 nmdc:mga06z11_14548_c1_441_1556 365
1143 3300050511 nmdc:mga08y16_992_c1 nmdc:mga08y16_992_c1_19850_20965 365
1144 3300050512 nmdc:mga0n895_1104_c1 nmdc:mga0n895_1104_c1_12969_14084 365
1145 3300050512 nmdc:mga0n895_169339_c1 nmdc:mga0n895_169339_c1_1077_2195 365
1146 3300050512 nmdc:mga0n895_175793_c1 nmdc:mga0n895_175793_c1_872_1990 365
1147 3300050513 nmdc:mga0rr50_112212_c1 nmdc:mga0rr50_112212_c1_379_1497 365
1148 3300050515 nmdc:mga0a205_970_c1 nmdc:mga0a205_970_c1_12387_13502 365
1149 3300053077 Ga0495601_0001428 Ga0495601_0001428_897_2012 365
1150 3300053077 Ga0495601_0020505 Ga0495601_0020505_484_1590 365
1151 3300053078 Ga0495612_0005327 Ga0495612_0005327_1900_3015 365
1152 3300053084 Ga0495595_0014275 Ga0495595_0014275_539_1654 365
1153 3300053085 Ga0495619_0000388 Ga0495619_0000388_7006_8124 365
1154 3300053085 Ga0495619_0060004 Ga0495619_0060004_507_1622 365
1155 3300053088 Ga0500644_0001370 Ga0500644_0001370_4479_5618 365
1156 3300053131 Ga0500652_018059 Ga0500652_018059_113_1231 365
1157 3300053136 Ga0500559_0000076 Ga0500559_0000076_29007_30122 365
1158 3300053153 Ga0500616_0000002 Ga0500616_0000002_1125832_1126950 365
1159 3300053177 Ga0500636_0013888 Ga0500636_0013888_1511_2626 365
1160 3300053730 Ga0500645_000324 Ga0500645_000324_25538_26656 365
1161 3300061734 Ga0530510_0099539 Ga0530510_0099539_710_1825 365
1162 iso_pu_bacteria 2643221672 2644400612 365
1163 iso_pu_bacteria 2738541307 2738884205 365
1164 iso_pu_bacteria 2818991446 2819601303 365
1165 iso_pu_bacteria 2831265667 2831269696 365
1166 iso_pu_bacteria 2838054893 2838055286 365
1167 iso_pu_bacteria 2899924645 2899927349 365
1168 iso_pu_bacteria 2928037797 2928042738 365
1169 iso_pu_bacteria 2928044640 2928048835 365
1170 iso_pu_bacteria 2928051484 2928055168 365
1171 iso_pu_bacteria 2928064002 2928068594 365
1172 iso_pu_bacteria 2928070936 2928073498 365

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00724

Oxidored_FMN

NADH:flavin oxidoreductase / NADH oxidase family

54

395

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8pun-assembly1.cif.gz_D old yellow enzyme from the thermophilic ferrovum sp. ja12 0.9849 2 354
3hf3-assembly1.cif.gz_D old yellow enzyme from thermus scotoductus sa-01 0.9743 2 353
5nux-assembly1.cif.gz_A thermus scotoductus sa-01 ene-reductase double mutant tser_c25d_i67t 0.974 2 353
8pun-assembly1.cif.gz_D old yellow enzyme from the thermophilic ferrovum sp. ja12 0.974 2 354
5ogt-assembly1.cif.gz_A thermus scotoductus sa-01 ene-reductase triple mutant tser_c25d_i67t_a102h 0.9729 2 353
ID Description Score Start End Superfamily
5ocsA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9867 1 365 3.20.20.70
5ocsA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9841 1 365 3.20.20.70
af_O94467_31_394_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.974 2 353 3.20.20.70
af_Q54JW3_30_435_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9664 1 352 3.20.20.70
3gr7A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9651 1 352 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6N8EJW6-F1-model_v4 Oxidoreductase 0.9965 129 338 GO:0003959
GO:0010181
GO:0050661
AF-A0A520IZC7-F1-model_v4 NADH:flavin oxidoreductase/NADH oxidase 0.996 2 324 GO:0003959
GO:0010181
GO:0050661
AF-A0A837FS68-F1-model_v4 deleted 0.995 1 363
AF-A0A2P5ILS7-F1-model_v4 deleted 0.9946 1 363
AF-A0A0D6JGB1-F1-model_v4 NADPH dehydrogenase (EC 1.6.99.1) 0.9939 1 364 GO:0003959
GO:0010181
GO:0050661

Feature Viewer

pLDDT pTM Quality
96.88 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map