F491190
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1172 | 606 | 1088 | 368 |
Family's Representative Sequence
| Representative Sequence | 3300049581|Ga0501047_0307818|Ga0501047_0307818_146_1414 |
| Length | 422 |
| Sequence | MVWMWRAGTLQPAMNIRSIAPTSGLKASAERVREASKVFTDRDNARKRGVSMSRLFEPLQLGNLQLANRIVVAPMCQYSAEEGSATDWHMIHLGHLALSGAGLLVTEATAVSAIGRISPTDLGLYSDDNERALARVLAAIRKYSPIPVAIQLAHAGRKGSSRAPWDGGLQIPPGDAQGWVAEAPSAIPHGNGEVPPAALDAAGLARVREEFALAARRAARAGFDGIELHLAHGYLLHEFLSPLANQRTDAYGGSLENRMRFPLEVFDAVRAAFPADKPVWVRVSASDWVPGGWDVPDTIALGLALKSRGCAAMHVSSGGVSPQQKIALGPGYQVPFAASVKRETGMTTIAVGLITEPQQAEHIVASGEADAVALARAMLYDPRWPWHAAAALGAQVDVPPQYWRSQPREFKDLFRGAAFGQR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 4 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 5 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 6 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 7 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 8 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 9 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 10 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 11 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 12 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 13 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 14 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 15 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 16 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 17 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 18 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 19 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 20 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 21 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 22 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 23 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 24 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 25 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 26 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 27 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 28 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 29 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 30 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 31 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 32 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 33 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 34 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 35 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 36 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 37 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 38 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 39 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 40 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 41 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 42 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 43 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 44 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 45 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 46 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 47 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 48 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 49 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 50 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 51 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 52 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 53 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 54 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 55 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 56 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 57 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 58 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 59 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 60 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 61 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 62 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 63 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 64 | 2916178963 | Pseudoalteromonas rhizosphaerae RA15 | Isolate | Rhizosphere |
| 65 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 66 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 67 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 68 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 69 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 70 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 71 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 72 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 73 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 74 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 75 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 76 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 77 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 78 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 79 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 80 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 81 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 82 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 83 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 85 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 86 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 87 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 88 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 89 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 90 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 91 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 92 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 93 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 94 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 95 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 96 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 97 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 98 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 99 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 100 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 101 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 102 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 103 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 104 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 105 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 106 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 107 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 108 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 109 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 110 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 111 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 112 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 113 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 114 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 115 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 116 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 117 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 118 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 119 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 120 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 121 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 122 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 123 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 124 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 125 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 126 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 127 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 128 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 129 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 130 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 133 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 134 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 137 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 139 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 140 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 141 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 143 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 144 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 145 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 147 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 154 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 157 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 158 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 160 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 161 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 162 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 164 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 165 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 169 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 170 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 171 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 172 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 173 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 174 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 175 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 176 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 178 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 179 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 183 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 184 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 186 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 187 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 188 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 189 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 190 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 191 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 192 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 193 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 194 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 195 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 196 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 197 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 198 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 199 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 200 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 201 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 203 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 204 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 205 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 206 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 207 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 209 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 210 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 211 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 212 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 213 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 214 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 216 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 217 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 218 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 219 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 220 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 221 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 223 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 224 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 226 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 227 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 228 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 235 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 236 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 237 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 238 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 239 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 240 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 241 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 243 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 251 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 252 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 253 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 254 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 255 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 256 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 264 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 267 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 269 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 271 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 274 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 276 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 278 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 279 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 281 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 348 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 354 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 355 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 359 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 360 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 361 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 362 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 363 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 364 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 365 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 366 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 367 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 368 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 369 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 370 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 371 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 372 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 373 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 374 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 375 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 376 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 377 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 378 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 379 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 380 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 381 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 382 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 383 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 384 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 385 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 386 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 387 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 388 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 389 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 390 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 391 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 392 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 393 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 394 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 395 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 396 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 397 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 398 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 399 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 400 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 401 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 402 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 403 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 404 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 405 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 406 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 407 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 408 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 409 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 410 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 411 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 412 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 413 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 414 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 415 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 416 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 417 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 418 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 419 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 420 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 421 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 422 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 423 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 424 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 425 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 426 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 427 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 428 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 429 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 430 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 431 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 432 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 433 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 434 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 435 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 436 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 437 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 438 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 439 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 440 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 441 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 442 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 443 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 444 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 445 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 446 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 447 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 448 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 449 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 450 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 451 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 452 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 453 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 454 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 455 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 528 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 529 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 530 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 531 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 532 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 533 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 534 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 535 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 536 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 537 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 538 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 539 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 540 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 541 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 542 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 543 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 544 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 545 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 546 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 547 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 548 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 549 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 550 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 551 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 552 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 553 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 554 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 555 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 556 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 557 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 558 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 559 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 560 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 561 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 562 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 563 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 564 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 565 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 566 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 567 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 568 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 569 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 570 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 571 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 572 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 573 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 574 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 575 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 576 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 577 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 578 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 579 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 580 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 581 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 582 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 587 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 588 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 589 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 590 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 591 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 592 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 593 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 594 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 595 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 596 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 597 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 598 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 599 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 600 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 601 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 602 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 603 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 604 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 605 | 8033232454 | Acinetobacter radioresistens SA188 | Isolate | Unclassified |
| 606 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.75 |
| Metatranscriptomes | 0.09 |
| Isolates | 7.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.87 |
| Nodule | 1.28 |
| Rhizoplane | 6.06 |
| Rhizosphere | 74.4 |
| Stem | 0.09 |
| Stem Tuber | 0.43 |
| Unclassified | 8.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_179494 | 2162886007 | Bacteria | 2379 |
| 2 | 2214772996 | 2209111006 | Bacteria | 11536 |
| 3 | ARSoilYngRDRAFT_c00480 | 3300000042 | Bacteria | 4764 |
| 4 | ARcpr5yngRDRAFT_c000101 | 3300000043 | Bacteria | 13551 |
| 5 | ARSoilOldRDRAFT_c000111 | 3300000044 | Bacteria | 14542 |
| 6 | ARCol0yngRDRAFT_1000021 | 3300000652 | Bacteria | 30221 |
| 7 | JGI24752J21851_1000948 | 3300001976 | Bacteria | 3964 |
| 8 | JGI24746J21847_1000005 | 3300001977 | Bacteria | 23312 |
| 9 | JGI24739J22299_10000902 | 3300001989 | Bacteria | 10985 |
| 10 | JGI24739J22299_10004819 | 3300001989 | Bacteria | 5143 |
| 11 | JGI24750J21931_1000059 | 3300002070 | Bacteria | 15603 |
| 12 | JGI24748J21848_1000644 | 3300002074 | Bacteria | 3744 |
| 13 | JGI24738J21930_10000278 | 3300002075 | Bacteria | 14037 |
| 14 | JGI24744J21845_10000309 | 3300002077 | Bacteria | 8188 |
| 15 | JGI24035J26624_1000329 | 3300002126 | Bacteria | 4420 |
| 16 | JGI24033J26618_1003778 | 3300002155 | Bacteria | 1610 |
| 17 | JGI24742J22300_10000270 | 3300002244 | Bacteria | 7778 |
| 18 | JGI24751J29686_10009481 | 3300002459 | Bacteria | 2002 |
| 19 | JGI25162J39368_1000084 | 3300002737 | Bacteria | 108880 |
| 20 | JGI25162J39368_1004064 | 3300002737 | Bacteria | 3647 |
| 21 | JGI25163J39215_1000245 | 3300002771 | Bacteria | 19957 |
| 22 | JGI25164J39214_1000062 | 3300002772 | Bacteria | 108882 |
| 23 | JGI25152J39213_1000198 | 3300002773 | Bacteria | 40131 |
| 24 | JGI25152J39213_1004385 | 3300002773 | Bacteria | 4456 |
| 25 | JGI25151J46595_10001308 | 3300003187 | Bacteria | 17444 |
| 26 | JGI25151J46595_10009962 | 3300003187 | Bacteria | 4456 |
| 27 | JGI25151J46595_10022380 | 3300003187 | Bacteria | 2626 |
| 28 | JGI25153J46596_10009634 | 3300003215 | Bacteria | 4456 |
| 29 | rootH2_10196814 | 3300003320 | Bacteria | 3648 |
| 30 | rootL2_10089387 | 3300003322 | Bacteria | 2633 |
| 31 | rootH1_10264660 | 3300003323 | Bacteria | 3568 |
| 32 | JGI25160J50197_1007031 | 3300003354 | Bacteria | 4456 |
| 33 | JGI25404J52841_10000234 | 3300003659 | Bacteria | 6922 |
| 34 | Ga0055538_1000060 | 3300003751 | Bacteria | 108880 |
| 35 | Ga0055539_1000092 | 3300003752 | Bacteria | 108880 |
| 36 | Ga0055533_1000101 | 3300003756 | Bacteria | 108880 |
| 37 | Ga0055525_1000134 | 3300003759 | Bacteria | 108880 |
| 38 | Ga0055535_1000069 | 3300003761 | Bacteria | 115207 |
| 39 | Ga0055542_1000084 | 3300003762 | Bacteria | 125518 |
| 40 | Ga0055526_1008447 | 3300003771 | Bacteria | 5136 |
| 41 | Ga0055537_1003177 | 3300003773 | Bacteria | 5136 |
| 42 | Ga0055537_1005002 | 3300003773 | Bacteria | 3638 |
| 43 | Ga0055524_1006091 | 3300003775 | Bacteria | 5280 |
| 44 | Ga0055524_1007575 | 3300003775 | Bacteria | 4592 |
| 45 | Ga0055534_1003969 | 3300003784 | Bacteria | 4456 |
| 46 | Ga0055534_1005085 | 3300003784 | Bacteria | 3622 |
| 47 | Ga0055528_1006817 | 3300003790 | Bacteria | 5136 |
| 48 | Ga0055540_1008808 | 3300003792 | Bacteria | 3577 |
| 49 | Ga0055531_10002481 | 3300003794 | Bacteria | 12305 |
| 50 | Ga0055531_10015966 | 3300003794 | Bacteria | 3270 |
| 51 | Ga0055541_1000062 | 3300003841 | Bacteria | 108880 |
| 52 | Ga0058692_1000043 | 3300003856 | Bacteria | 119173 |
| 53 | Ga0058692_1000047 | 3300003856 | Bacteria | 112440 |
| 54 | Ga0058692_1000055 | 3300003856 | Bacteria | 105550 |
| 55 | Ga0058692_1005227 | 3300003856 | Bacteria | 3730 |
| 56 | Ga0058692_1011006 | 3300003856 | Bacteria | 2209 |
| 57 | JGI25405J52794_10005502 | 3300003911 | Bacteria | 2286 |
| 58 | Ga0055543_1002903 | 3300004625 | Bacteria | 5373 |
| 59 | Ga0055543_1008619 | 3300004625 | Bacteria | 2247 |
| 60 | Ga0065165_1000150 | 3300005262 | Bacteria | 121992 |
| 61 | Ga0065165_1007537 | 3300005262 | Bacteria | 5318 |
| 62 | Ga0065714_10014552 | 3300005288 | Bacteria | 1781 |
| 63 | Ga0065704_10000664 | 3300005289 | Bacteria | 46630 |
| 64 | Ga0065712_10071326 | 3300005290 | Bacteria | 5337 |
| 65 | Ga0065715_10000270 | 3300005293 | Bacteria | 17149 |
| 66 | Ga0070658_10006794 | 3300005327 | Bacteria | 9255 |
| 67 | Ga0070658_10011263 | 3300005327 | Bacteria | 7168 |
| 68 | Ga0070658_10072861 | 3300005327 | Bacteria | 2816 |
| 69 | Ga0070658_10353495 | 3300005327 | Bacteria | 1258 |
| 70 | Ga0070676_10000194 | 3300005328 | Bacteria | 25376 |
| 71 | Ga0070683_100001461 | 3300005329 | Bacteria | 18165 |
| 72 | Ga0070683_100103922 | 3300005329 | Bacteria | 2677 |
| 73 | Ga0070690_100002052 | 3300005330 | Bacteria | 10748 |
| 74 | Ga0070690_100018916 | 3300005330 | Bacteria | 4170 |
| 75 | Ga0070690_100057349 | 3300005330 | Bacteria | 2499 |
| 76 | Ga0070670_100023270 | 3300005331 | Bacteria | 5333 |
| 77 | Ga0070670_100123214 | 3300005331 | Bacteria | 2236 |
| 78 | Ga0070677_10000223 | 3300005333 | Bacteria | 19560 |
| 79 | Ga0068869_100000910 | 3300005334 | Bacteria | 17020 |
| 80 | Ga0070666_10020841 | 3300005335 | Bacteria | 4242 |
| 81 | Ga0070666_10278561 | 3300005335 | Bacteria | 1188 |
| 82 | Ga0070680_100011303 | 3300005336 | Bacteria | 6903 |
| 83 | Ga0070680_100013453 | 3300005336 | Bacteria | 6374 |
| 84 | Ga0070680_100062133 | 3300005336 | Bacteria | 3058 |
| 85 | Ga0070680_100090091 | 3300005336 | Bacteria | 2539 |
| 86 | Ga0070680_100126842 | 3300005336 | Bacteria | 2132 |
| 87 | Ga0070682_100000411 | 3300005337 | Bacteria | 27934 |
| 88 | Ga0070682_100044608 | 3300005337 | Bacteria | 2746 |
| 89 | Ga0068868_100002658 | 3300005338 | Bacteria | 12396 |
| 90 | Ga0070660_100001846 | 3300005339 | Bacteria | 14572 |
| 91 | Ga0070660_100004007 | 3300005339 | Bacteria | 10167 |
| 92 | Ga0070660_100027146 | 3300005339 | Bacteria | 4271 |
| 93 | Ga0070660_100068030 | 3300005339 | Bacteria | 2775 |
| 94 | Ga0070660_100093718 | 3300005339 | Bacteria | 2372 |
| 95 | Ga0070660_100123565 | 3300005339 | Bacteria | 2067 |
| 96 | Ga0070689_100001606 | 3300005340 | Bacteria | 14434 |
| 97 | Ga0070691_10001869 | 3300005341 | Bacteria | 9200 |
| 98 | Ga0070691_10025121 | 3300005341 | Bacteria | 2773 |
| 99 | Ga0070687_100000727 | 3300005343 | Bacteria | 10925 |
| 100 | Ga0070661_100001236 | 3300005344 | Bacteria | 17965 |
| 101 | Ga0070661_100028883 | 3300005344 | Bacteria | 4002 |
| 102 | Ga0070692_10002603 | 3300005345 | Bacteria | 7037 |
| 103 | Ga0070668_100002586 | 3300005347 | Bacteria | 13300 |
| 104 | Ga0070668_100051079 | 3300005347 | Bacteria | 3185 |
| 105 | Ga0070668_100051503 | 3300005347 | Bacteria | 3172 |
| 106 | Ga0070668_100065655 | 3300005347 | Bacteria | 2815 |
| 107 | Ga0070669_100002152 | 3300005353 | Bacteria | 14248 |
| 108 | Ga0070675_100002725 | 3300005354 | Bacteria | 13279 |
| 109 | Ga0070675_100016211 | 3300005354 | Bacteria | 5911 |
| 110 | Ga0070675_100069193 | 3300005354 | Bacteria | 2924 |
| 111 | Ga0070671_100000024 | 3300005355 | Bacteria | 122109 |
| 112 | Ga0070671_100000400 | 3300005355 | Bacteria | 29909 |
| 113 | Ga0070671_100012085 | 3300005355 | Bacteria | 6946 |
| 114 | Ga0070671_100153813 | 3300005355 | Bacteria | 1943 |
| 115 | Ga0070671_100165420 | 3300005355 | Bacteria | 1870 |
| 116 | Ga0070674_100001765 | 3300005356 | Bacteria | 11732 |
| 117 | Ga0070674_100086083 | 3300005356 | Bacteria | 2257 |
| 118 | Ga0070673_100000169 | 3300005364 | Bacteria | 31478 |
| 119 | Ga0070673_100116828 | 3300005364 | Bacteria | 2220 |
| 120 | Ga0070688_100000757 | 3300005365 | Bacteria | 15949 |
| 121 | Ga0070688_100002817 | 3300005365 | Bacteria | 8852 |
| 122 | Ga0070688_100003731 | 3300005365 | Bacteria | 7883 |
| 123 | Ga0070659_100000655 | 3300005366 | Bacteria | 25206 |
| 124 | Ga0070659_100001586 | 3300005366 | Bacteria | 16387 |
| 125 | Ga0070659_100061921 | 3300005366 | Bacteria | 2957 |
| 126 | Ga0070667_100000018 | 3300005367 | Bacteria | 226033 |
| 127 | Ga0070667_100001596 | 3300005367 | Bacteria | 20275 |
| 128 | Ga0070667_100022988 | 3300005367 | Bacteria | 5169 |
| 129 | Ga0070667_100027904 | 3300005367 | Bacteria | 4697 |
| 130 | Ga0070703_10005976 | 3300005406 | Bacteria | 3406 |
| 131 | Ga0070709_10215533 | 3300005434 | Bacteria | 1367 |
| 132 | Ga0070714_100019824 | 3300005435 | Bacteria | 5485 |
| 133 | Ga0070713_100014412 | 3300005436 | Bacteria | 5872 |
| 134 | Ga0070713_100040260 | 3300005436 | Bacteria | 3798 |
| 135 | Ga0070710_10021998 | 3300005437 | Bacteria | 3330 |
| 136 | Ga0070701_10000774 | 3300005438 | Bacteria | 11424 |
| 137 | Ga0070705_100001954 | 3300005440 | Bacteria | 10554 |
| 138 | Ga0070705_100262542 | 3300005440 | Bacteria | 1219 |
| 139 | Ga0070700_100001821 | 3300005441 | Bacteria | 10759 |
| 140 | Ga0070700_100205305 | 3300005441 | Bacteria | 1387 |
| 141 | Ga0070694_100001416 | 3300005444 | Bacteria | 14051 |
| 142 | Ga0070663_100000593 | 3300005455 | Bacteria | 19280 |
| 143 | Ga0070663_100107879 | 3300005455 | Bacteria | 2088 |
| 144 | Ga0070678_100000301 | 3300005456 | Bacteria | 22947 |
| 145 | Ga0070678_100004800 | 3300005456 | Bacteria | 7714 |
| 146 | Ga0070662_100001940 | 3300005457 | Bacteria | 12717 |
| 147 | Ga0070662_100005709 | 3300005457 | Bacteria | 7968 |
| 148 | Ga0070662_100142926 | 3300005457 | Bacteria | 1856 |
| 149 | Ga0070681_10014859 | 3300005458 | Bacteria | 7740 |
| 150 | Ga0070681_10024101 | 3300005458 | Bacteria | 6126 |
| 151 | Ga0070681_10030328 | 3300005458 | Bacteria | 5426 |
| 152 | Ga0070681_10051355 | 3300005458 | Bacteria | 4112 |
| 153 | Ga0070681_10339905 | 3300005458 | Bacteria | 1411 |
| 154 | Ga0068867_100002072 | 3300005459 | Bacteria | 14049 |
| 155 | Ga0068867_100042681 | 3300005459 | Bacteria | 3319 |
| 156 | Ga0068867_100069950 | 3300005459 | Bacteria | 2622 |
| 157 | Ga0070685_10000001 | 3300005466 | Bacteria | 349867 |
| 158 | Ga0070685_10008779 | 3300005466 | Bacteria | 5204 |
| 159 | Ga0070698_100223529 | 3300005471 | Bacteria | 1816 |
| 160 | Ga0070679_100012097 | 3300005530 | Bacteria | 8243 |
| 161 | Ga0070679_100022903 | 3300005530 | Bacteria | 6109 |
| 162 | Ga0070679_100068424 | 3300005530 | Bacteria | 3542 |
| 163 | Ga0070679_100093531 | 3300005530 | Bacteria | 2993 |
| 164 | Ga0070679_100300950 | 3300005530 | Bacteria | 1554 |
| 165 | Ga0070684_100005903 | 3300005535 | Bacteria | 9430 |
| 166 | Ga0070684_100018107 | 3300005535 | Bacteria | 5794 |
| 167 | Ga0070684_100041105 | 3300005535 | Bacteria | 3985 |
| 168 | Ga0070684_100361084 | 3300005535 | Bacteria | 1337 |
| 169 | Ga0070697_100130535 | 3300005536 | Bacteria | 2107 |
| 170 | Ga0068853_100000049 | 3300005539 | Bacteria | 90347 |
| 171 | Ga0068853_100009652 | 3300005539 | Bacteria | 7778 |
| 172 | Ga0068853_100363998 | 3300005539 | Bacteria | 1348 |
| 173 | Ga0070672_100000611 | 3300005543 | Bacteria | 21001 |
| 174 | Ga0070686_100001276 | 3300005544 | Bacteria | 14248 |
| 175 | Ga0070695_100002211 | 3300005545 | Bacteria | 11155 |
| 176 | Ga0070695_100002233 | 3300005545 | Bacteria | 11088 |
| 177 | Ga0070695_100002508 | 3300005545 | Bacteria | 10579 |
| 178 | Ga0070696_100038028 | 3300005546 | Bacteria | 3320 |
| 179 | Ga0070696_100087462 | 3300005546 | Bacteria | 2214 |
| 180 | Ga0070693_100001538 | 3300005547 | Bacteria | 10416 |
| 181 | Ga0070665_100031263 | 3300005548 | Bacteria | 5358 |
| 182 | Ga0070665_100036747 | 3300005548 | Bacteria | 4925 |
| 183 | Ga0070665_100146475 | 3300005548 | Bacteria | 2364 |
| 184 | Ga0070665_100211083 | 3300005548 | Bacteria | 1942 |
| 185 | Ga0070704_100001853 | 3300005549 | Bacteria | 11658 |
| 186 | Ga0068855_100002375 | 3300005563 | Bacteria | 23200 |
| 187 | Ga0068855_100011650 | 3300005563 | Bacteria | 10627 |
| 188 | Ga0068855_100065238 | 3300005563 | Bacteria | 4245 |
| 189 | Ga0068855_100074018 | 3300005563 | Bacteria | 3956 |
| 190 | Ga0068855_100126773 | 3300005563 | Bacteria | 2918 |
| 191 | Ga0068855_100147182 | 3300005563 | Bacteria | 2680 |
| 192 | Ga0068855_100147794 | 3300005563 | Bacteria | 2674 |
| 193 | Ga0070664_100024208 | 3300005564 | Bacteria | 5021 |
| 194 | Ga0070664_100105013 | 3300005564 | Bacteria | 2460 |
| 195 | Ga0070664_100119986 | 3300005564 | Bacteria | 2301 |
| 196 | Ga0068857_100003420 | 3300005577 | Bacteria | 13238 |
| 197 | Ga0068857_100185896 | 3300005577 | Bacteria | 1892 |
| 198 | Ga0068854_100000129 | 3300005578 | Bacteria | 52076 |
| 199 | Ga0068854_100001082 | 3300005578 | Bacteria | 16400 |
| 200 | Ga0068854_100175138 | 3300005578 | Bacteria | 1672 |
| 201 | Ga0068856_100006654 | 3300005614 | Bacteria | 11325 |
| 202 | Ga0068856_100157768 | 3300005614 | Bacteria | 2279 |
| 203 | Ga0068856_100169222 | 3300005614 | Bacteria | 2197 |
| 204 | Ga0068856_100226520 | 3300005614 | Bacteria | 1885 |
| 205 | Ga0068856_100259546 | 3300005614 | Bacteria | 1753 |
| 206 | Ga0068852_100003054 | 3300005616 | Bacteria | 11648 |
| 207 | Ga0068852_100015790 | 3300005616 | Bacteria | 5871 |
| 208 | Ga0068852_100058996 | 3300005616 | Bacteria | 3327 |
| 209 | Ga0068859_100006509 | 3300005617 | Bacteria | 11858 |
| 210 | Ga0068859_100079116 | 3300005617 | Bacteria | 3327 |
| 211 | Ga0068859_100164577 | 3300005617 | Bacteria | 2297 |
| 212 | Ga0068859_100357221 | 3300005617 | Bacteria | 1556 |
| 213 | Ga0068864_100000003 | 3300005618 | Bacteria | 568775 |
| 214 | Ga0068864_100001244 | 3300005618 | Bacteria | 21163 |
| 215 | Ga0068864_100024235 | 3300005618 | Bacteria | 5103 |
| 216 | Ga0068866_10000500 | 3300005718 | Bacteria | 18096 |
| 217 | Ga0068861_100003449 | 3300005719 | Bacteria | 10495 |
| 218 | Ga0068851_10004471 | 3300005834 | Bacteria | 6310 |
| 219 | Ga0068870_10000015 | 3300005840 | Bacteria | 63346 |
| 220 | Ga0068870_10093499 | 3300005840 | Bacteria | 1686 |
| 221 | Ga0068863_100003914 | 3300005841 | Bacteria | 14708 |
| 222 | Ga0068863_100043836 | 3300005841 | Bacteria | 4247 |
| 223 | Ga0068863_100105141 | 3300005841 | Bacteria | 2686 |
| 224 | Ga0068858_100002760 | 3300005842 | Bacteria | 17647 |
| 225 | Ga0068858_100004772 | 3300005842 | Bacteria | 13275 |
| 226 | Ga0068858_100113326 | 3300005842 | Bacteria | 2533 |
| 227 | Ga0068858_100160152 | 3300005842 | Bacteria | 2119 |
| 228 | Ga0068858_100317014 | 3300005842 | Bacteria | 1490 |
| 229 | Ga0068860_100000478 | 3300005843 | Bacteria | 49822 |
| 230 | Ga0068860_100003116 | 3300005843 | Bacteria | 17138 |
| 231 | Ga0068862_100001424 | 3300005844 | Bacteria | 22164 |
| 232 | Ga0068862_100003903 | 3300005844 | Bacteria | 12673 |
| 233 | Ga0068862_100176586 | 3300005844 | Bacteria | 1915 |
| 234 | Ga0081455_10000081 | 3300005937 | Bacteria | 103752 |
| 235 | Ga0081455_10000341 | 3300005937 | Bacteria | 61041 |
| 236 | Ga0081540_1000195 | 3300005983 | Bacteria | 62863 |
| 237 | Ga0081540_1000493 | 3300005983 | Bacteria | 38816 |
| 238 | Ga0081540_1011092 | 3300005983 | Bacteria | 6050 |
| 239 | Ga0081540_1055753 | 3300005983 | Bacteria | 1923 |
| 240 | Ga0070717_10014273 | 3300006028 | Bacteria | 6110 |
| 241 | Ga0075364_10027418 | 3300006051 | Bacteria | 3639 |
| 242 | Ga0070715_10014818 | 3300006163 | Bacteria | 2896 |
| 243 | Ga0070712_100016368 | 3300006175 | Bacteria | 4789 |
| 244 | Ga0070712_100126903 | 3300006175 | Bacteria | 1928 |
| 245 | Ga0075367_10022567 | 3300006178 | Bacteria | 3532 |
| 246 | Ga0075367_10031602 | 3300006178 | Bacteria | 3041 |
| 247 | Ga0075366_10018799 | 3300006195 | Bacteria | 3993 |
| 248 | Ga0097621_100001400 | 3300006237 | Bacteria | 16606 |
| 249 | Ga0097621_100075291 | 3300006237 | Bacteria | 2797 |
| 250 | Ga0075370_10034075 | 3300006353 | Bacteria | 2854 |
| 251 | Ga0068871_100000359 | 3300006358 | Bacteria | 31822 |
| 252 | Ga0068871_100003972 | 3300006358 | Bacteria | 10218 |
| 253 | Ga0068871_100009090 | 3300006358 | Bacteria | 7179 |
| 254 | Ga0075433_10001122 | 3300006852 | Bacteria | 19376 |
| 255 | Ga0075433_10009420 | 3300006852 | Bacteria | 7806 |
| 256 | Ga0075434_100000760 | 3300006871 | Bacteria | 25464 |
| 257 | Ga0075434_100001564 | 3300006871 | Bacteria | 19411 |
| 258 | Ga0075434_100058075 | 3300006871 | Bacteria | 3846 |
| 259 | Ga0075434_100310236 | 3300006871 | Bacteria | 1598 |
| 260 | Ga0075434_100492441 | 3300006871 | Bacteria | 1247 |
| 261 | Ga0068865_100000439 | 3300006881 | Bacteria | 23089 |
| 262 | Ga0068865_100019171 | 3300006881 | Bacteria | 4425 |
| 263 | Ga0075436_100139744 | 3300006914 | Bacteria | 1702 |
| 264 | Ga0097620_100006509 | 3300006931 | Bacteria | 11858 |
| 265 | Ga0097620_100079117 | 3300006931 | Bacteria | 3327 |
| 266 | Ga0097620_100164584 | 3300006931 | Bacteria | 2297 |
| 267 | Ga0097620_100357160 | 3300006931 | Bacteria | 1556 |
| 268 | Ga0079104_1001697 | 3300006946 | Bacteria | 14081 |
| 269 | Ga0099795_10002598 | 3300007788 | Bacteria | 4288 |
| 270 | Ga0105251_10025058 | 3300009011 | Bacteria | 3056 |
| 271 | Ga0105244_10000418 | 3300009036 | Bacteria | 39533 |
| 272 | Ga0105244_10000748 | 3300009036 | Bacteria | 27805 |
| 273 | Ga0105244_10011426 | 3300009036 | Bacteria | 5327 |
| 274 | Ga0105250_10000039 | 3300009092 | Bacteria | 136696 |
| 275 | Ga0105250_10000743 | 3300009092 | Bacteria | 19865 |
| 276 | Ga0105240_10003634 | 3300009093 | Bacteria | 23891 |
| 277 | Ga0105240_10006246 | 3300009093 | Bacteria | 17532 |
| 278 | Ga0105240_10391429 | 3300009093 | Bacteria | 1567 |
| 279 | Ga0105240_10514829 | 3300009093 | Bacteria | 1329 |
| 280 | Ga0111539_10007371 | 3300009094 | Bacteria | 14093 |
| 281 | Ga0111539_10007413 | 3300009094 | Bacteria | 14057 |
| 282 | Ga0111539_10041772 | 3300009094 | Bacteria | 5511 |
| 283 | Ga0111539_10345350 | 3300009094 | Bacteria | 1732 |
| 284 | Ga0105245_10001227 | 3300009098 | Bacteria | 23145 |
| 285 | Ga0105245_10005335 | 3300009098 | Bacteria | 11293 |
| 286 | Ga0105245_10145284 | 3300009098 | Bacteria | 2237 |
| 287 | Ga0105245_10201582 | 3300009098 | Bacteria | 1911 |
| 288 | Ga0105245_10361338 | 3300009098 | Bacteria | 1441 |
| 289 | Ga0105247_10007195 | 3300009101 | Bacteria | 6832 |
| 290 | Ga0105247_10056412 | 3300009101 | Bacteria | 2426 |
| 291 | Ga0114129_10157084 | 3300009147 | Bacteria | 3109 |
| 292 | Ga0105243_10001341 | 3300009148 | Bacteria | 21936 |
| 293 | Ga0105243_10006861 | 3300009148 | Bacteria | 8778 |
| 294 | Ga0105243_10018182 | 3300009148 | Bacteria | 5321 |
| 295 | Ga0105243_10055695 | 3300009148 | Bacteria | 3142 |
| 296 | Ga0105241_10061679 | 3300009174 | Bacteria | 2888 |
| 297 | Ga0105242_10000411 | 3300009176 | Bacteria | 34068 |
| 298 | Ga0105242_10023552 | 3300009176 | Bacteria | 4852 |
| 299 | Ga0105242_10119562 | 3300009176 | Bacteria | 2258 |
| 300 | Ga0105242_10200728 | 3300009176 | Bacteria | 1771 |
| 301 | Ga0105248_10009088 | 3300009177 | Bacteria | 10930 |
| 302 | Ga0105248_10010917 | 3300009177 | Bacteria | 10021 |
| 303 | Ga0105248_10081678 | 3300009177 | Bacteria | 3633 |
| 304 | Ga0105248_10341972 | 3300009177 | Bacteria | 1684 |
| 305 | Ga0105248_10344196 | 3300009177 | Bacteria | 1678 |
| 306 | Ga0105237_10012158 | 3300009545 | Bacteria | 9081 |
| 307 | Ga0105237_10016890 | 3300009545 | Bacteria | 7574 |
| 308 | Ga0105237_10068141 | 3300009545 | Bacteria | 3553 |
| 309 | Ga0105237_10269459 | 3300009545 | Bacteria | 1706 |
| 310 | Ga0105238_10032313 | 3300009551 | Bacteria | 5325 |
| 311 | Ga0105238_10106443 | 3300009551 | Bacteria | 2786 |
| 312 | Ga0105238_10248464 | 3300009551 | Bacteria | 1757 |
| 313 | Ga0105249_10003261 | 3300009553 | Bacteria | 14057 |
| 314 | Ga0105249_10007504 | 3300009553 | Bacteria | 9514 |
| 315 | Ga0105249_10081191 | 3300009553 | Bacteria | 3014 |
| 316 | Ga0105249_10337878 | 3300009553 | Bacteria | 1522 |
| 317 | Ga0105239_10006472 | 3300010375 | Bacteria | 13584 |
| 318 | Ga0105239_10008469 | 3300010375 | Bacteria | 11691 |
| 319 | Ga0105239_10092269 | 3300010375 | Bacteria | 3343 |
| 320 | Ga0105239_10406010 | 3300010375 | Bacteria | 1542 |
| 321 | Ga0105246_10000384 | 3300011119 | Bacteria | 23571 |
| 322 | Ga0105246_10097438 | 3300011119 | Bacteria | 2134 |
| 323 | Ga0157320_1000177 | 3300012481 | Bacteria | 2096 |
| 324 | Ga0157341_1001479 | 3300012494 | Bacteria | 1429 |
| 325 | Ga0157373_10166355 | 3300013100 | Bacteria | 1552 |
| 326 | Ga0157371_10000101 | 3300013102 | Bacteria | 129981 |
| 327 | Ga0157371_10009572 | 3300013102 | Bacteria | 7620 |
| 328 | Ga0157370_10023716 | 3300013104 | Bacteria | 6089 |
| 329 | Ga0157370_10209952 | 3300013104 | Bacteria | 1805 |
| 330 | Ga0157369_10002439 | 3300013105 | Bacteria | 22344 |
| 331 | Ga0157369_10090925 | 3300013105 | Bacteria | 3259 |
| 332 | Ga0157378_10005961 | 3300013297 | Bacteria | 10682 |
| 333 | Ga0157378_10087636 | 3300013297 | Bacteria | 2824 |
| 334 | Ga0157378_10119504 | 3300013297 | Bacteria | 2427 |
| 335 | Ga0157378_10521053 | 3300013297 | Bacteria | 1190 |
| 336 | Ga0163162_10001455 | 3300013306 | Bacteria | 22021 |
| 337 | Ga0163162_10005169 | 3300013306 | Bacteria | 12585 |
| 338 | Ga0157372_10001000 | 3300013307 | Bacteria | 30877 |
| 339 | Ga0157372_10035365 | 3300013307 | Bacteria | 5499 |
| 340 | Ga0157372_10059126 | 3300013307 | Bacteria | 4286 |
| 341 | Ga0157372_10127126 | 3300013307 | Bacteria | 2931 |
| 342 | Ga0157375_10005043 | 3300013308 | Bacteria | 11469 |
| 343 | Ga0157375_10032741 | 3300013308 | Bacteria | 4932 |
| 344 | Ga0163163_10011894 | 3300014325 | Bacteria | 7916 |
| 345 | Ga0163163_10066143 | 3300014325 | Bacteria | 3589 |
| 346 | Ga0163163_10170586 | 3300014325 | Bacteria | 2222 |
| 347 | Ga0163163_10242690 | 3300014325 | Bacteria | 1851 |
| 348 | Ga0157380_10003014 | 3300014326 | Bacteria | 11472 |
| 349 | Ga0157377_10000224 | 3300014745 | Bacteria | 29648 |
| 350 | Ga0157379_10002183 | 3300014968 | Bacteria | 16272 |
| 351 | Ga0157379_10024465 | 3300014968 | Bacteria | 5360 |
| 352 | Ga0157379_10042697 | 3300014968 | Bacteria | 4049 |
| 353 | Ga0157379_10063592 | 3300014968 | Bacteria | 3299 |
| 354 | Ga0157376_10001879 | 3300014969 | Bacteria | 14015 |
| 355 | Ga0157376_10004001 | 3300014969 | Bacteria | 10191 |
| 356 | Ga0163161_10000471 | 3300017792 | Bacteria | 33465 |
| 357 | Ga0163161_10018737 | 3300017792 | Bacteria | 4852 |
| 358 | Ga0163161_10035790 | 3300017792 | Bacteria | 3555 |
| 359 | Ga0206356_10495441 | 3300020070 | Bacteria | 2899 |
| 360 | Ga0213872_10035362 | 3300021361 | Bacteria | 2285 |
| 361 | Ga0213876_10048152 | 3300021384 | Bacteria | 2253 |
| 362 | Ga0209760_100001 | 3300025207 | Bacteria | 348781 |
| 363 | Ga0209436_106393 | 3300025208 | Bacteria | 2585 |
| 364 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 365 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 366 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 367 | Ga0209672_101496 | 3300025228 | Bacteria | 8164 |
| 368 | Ga0209563_100008 | 3300025230 | Bacteria | 1554545 |
| 369 | Ga0207427_100002 | 3300025231 | Bacteria | 1355321 |
| 370 | Ga0209437_100007 | 3300025233 | Bacteria | 938377 |
| 371 | Ga0209258_100093 | 3300025242 | Bacteria | 223559 |
| 372 | Ga0207425_1002336 | 3300025245 | Bacteria | 6779 |
| 373 | Ga0209677_100004 | 3300025253 | Bacteria | 1554545 |
| 374 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 375 | Ga0209129_1000015 | 3300025258 | Bacteria | 487967 |
| 376 | Ga0209129_1000147 | 3300025258 | Bacteria | 115120 |
| 377 | Ga0209233_1005667 | 3300025261 | Bacteria | 4120 |
| 378 | Ga0209565_1000109 | 3300025263 | Bacteria | 120345 |
| 379 | Ga0209565_1000534 | 3300025263 | Bacteria | 26749 |
| 380 | Ga0207666_1000074 | 3300025271 | Bacteria | 16511 |
| 381 | Ga0207666_1000672 | 3300025271 | Bacteria | 4096 |
| 382 | Ga0209673_1010944 | 3300025273 | Bacteria | 3783 |
| 383 | Ga0209673_1045579 | 3300025273 | Bacteria | 1204 |
| 384 | Ga0209130_1000916 | 3300025284 | Bacteria | 23720 |
| 385 | Ga0209130_1001086 | 3300025284 | Bacteria | 20315 |
| 386 | Ga0207673_1000705 | 3300025290 | Bacteria | 3571 |
| 387 | Ga0209675_1000379 | 3300025291 | Bacteria | 36995 |
| 388 | Ga0209675_1002300 | 3300025291 | Bacteria | 9913 |
| 389 | Ga0209025_1000057 | 3300025294 | Bacteria | 314601 |
| 390 | Ga0209025_1000194 | 3300025294 | Bacteria | 148593 |
| 391 | Ga0209025_1000307 | 3300025294 | Bacteria | 108704 |
| 392 | Ga0209025_1001123 | 3300025294 | Bacteria | 38329 |
| 393 | Ga0209025_1003590 | 3300025294 | Bacteria | 14484 |
| 394 | Ga0209025_1032840 | 3300025294 | Bacteria | 2416 |
| 395 | Ga0209564_1000327 | 3300025295 | Bacteria | 92740 |
| 396 | Ga0209564_1003792 | 3300025295 | Bacteria | 9828 |
| 397 | Ga0209758_1000199 | 3300025297 | Bacteria | 133164 |
| 398 | Ga0209758_1029495 | 3300025297 | Bacteria | 2292 |
| 399 | Ga0209256_1000151 | 3300025299 | Bacteria | 145299 |
| 400 | Ga0209256_1002908 | 3300025299 | Bacteria | 12916 |
| 401 | Ga0207426_1000049 | 3300025302 | Bacteria | 401954 |
| 402 | Ga0207426_1016136 | 3300025302 | Bacteria | 2691 |
| 403 | Ga0209051_1000301 | 3300025303 | Bacteria | 77933 |
| 404 | Ga0209051_1000354 | 3300025303 | Bacteria | 68119 |
| 405 | Ga0209051_1009720 | 3300025303 | Bacteria | 4929 |
| 406 | Ga0209257_1000022 | 3300025304 | Bacteria | 765258 |
| 407 | Ga0207697_10001234 | 3300025315 | Bacteria | 14009 |
| 408 | Ga0207656_10008685 | 3300025321 | Bacteria | 3748 |
| 409 | Ga0207696_1000026 | 3300025711 | Bacteria | 418166 |
| 410 | Ga0207696_1000625 | 3300025711 | Bacteria | 25945 |
| 411 | Ga0207655_1000894 | 3300025728 | Bacteria | 31361 |
| 412 | Ga0207655_1001329 | 3300025728 | Bacteria | 23332 |
| 413 | Ga0207655_1010887 | 3300025728 | Bacteria | 5469 |
| 414 | Ga0207653_10010869 | 3300025885 | Bacteria | 2840 |
| 415 | Ga0207682_10000169 | 3300025893 | Bacteria | 30010 |
| 416 | Ga0207642_10001573 | 3300025899 | Bacteria | 7032 |
| 417 | Ga0207710_10002213 | 3300025900 | Bacteria | 9144 |
| 418 | Ga0207710_10003166 | 3300025900 | Bacteria | 7368 |
| 419 | Ga0207688_10000157 | 3300025901 | Bacteria | 29271 |
| 420 | Ga0207680_10004108 | 3300025903 | Bacteria | 6885 |
| 421 | Ga0207680_10018417 | 3300025903 | Bacteria | 3711 |
| 422 | Ga0207680_10086011 | 3300025903 | Bacteria | 1987 |
| 423 | Ga0207647_10000205 | 3300025904 | Bacteria | 48382 |
| 424 | Ga0207647_10001770 | 3300025904 | Bacteria | 16576 |
| 425 | Ga0207699_10145371 | 3300025906 | Bacteria | 1563 |
| 426 | Ga0207645_10003164 | 3300025907 | Bacteria | 12604 |
| 427 | Ga0207643_10000004 | 3300025908 | Bacteria | 187006 |
| 428 | Ga0207705_10212602 | 3300025909 | Bacteria | 1467 |
| 429 | Ga0207654_10001412 | 3300025911 | Bacteria | 12738 |
| 430 | Ga0207654_10005887 | 3300025911 | Bacteria | 6177 |
| 431 | Ga0207707_10000992 | 3300025912 | Bacteria | 27254 |
| 432 | Ga0207707_10027076 | 3300025912 | Bacteria | 5012 |
| 433 | Ga0207707_10031970 | 3300025912 | Bacteria | 4607 |
| 434 | Ga0207707_10062197 | 3300025912 | Bacteria | 3248 |
| 435 | Ga0207707_10153007 | 3300025912 | Bacteria | 2017 |
| 436 | Ga0207695_10027245 | 3300025913 | Bacteria | 6366 |
| 437 | Ga0207695_10048660 | 3300025913 | Bacteria | 4476 |
| 438 | Ga0207695_10056865 | 3300025913 | Bacteria | 4068 |
| 439 | Ga0207671_10005808 | 3300025914 | Bacteria | 11222 |
| 440 | Ga0207671_10012511 | 3300025914 | Bacteria | 6815 |
| 441 | Ga0207671_10110335 | 3300025914 | Bacteria | 2093 |
| 442 | Ga0207693_10001228 | 3300025915 | Bacteria | 22855 |
| 443 | Ga0207693_10082116 | 3300025915 | Bacteria | 2524 |
| 444 | Ga0207663_10057725 | 3300025916 | Bacteria | 2446 |
| 445 | Ga0207660_10000307 | 3300025917 | Bacteria | 32222 |
| 446 | Ga0207660_10044506 | 3300025917 | Bacteria | 3123 |
| 447 | Ga0207660_10057522 | 3300025917 | Bacteria | 2785 |
| 448 | Ga0207662_10000850 | 3300025918 | Bacteria | 14080 |
| 449 | Ga0207657_10001379 | 3300025919 | Bacteria | 25926 |
| 450 | Ga0207657_10002203 | 3300025919 | Bacteria | 21123 |
| 451 | Ga0207657_10008189 | 3300025919 | Bacteria | 10651 |
| 452 | Ga0207657_10029120 | 3300025919 | Bacteria | 5031 |
| 453 | Ga0207657_10041021 | 3300025919 | Bacteria | 4096 |
| 454 | Ga0207657_10175869 | 3300025919 | Bacteria | 1732 |
| 455 | Ga0207649_10001352 | 3300025920 | Bacteria | 14567 |
| 456 | Ga0207652_10002958 | 3300025921 | Bacteria | 14201 |
| 457 | Ga0207652_10055916 | 3300025921 | Bacteria | 3396 |
| 458 | Ga0207652_10064427 | 3300025921 | Bacteria | 3171 |
| 459 | Ga0207646_10198128 | 3300025922 | Bacteria | 1814 |
| 460 | Ga0207681_10001165 | 3300025923 | Bacteria | 16949 |
| 461 | Ga0207681_10059100 | 3300025923 | Bacteria | 2627 |
| 462 | Ga0207694_10002672 | 3300025924 | Bacteria | 14432 |
| 463 | Ga0207694_10168088 | 3300025924 | Bacteria | 1774 |
| 464 | Ga0207650_10000003 | 3300025925 | Bacteria | 1123235 |
| 465 | Ga0207650_10007784 | 3300025925 | Bacteria | 7304 |
| 466 | Ga0207659_10000038 | 3300025926 | Bacteria | 93848 |
| 467 | Ga0207659_10078264 | 3300025926 | Bacteria | 2436 |
| 468 | Ga0207687_10000966 | 3300025927 | Bacteria | 19517 |
| 469 | Ga0207687_10005917 | 3300025927 | Bacteria | 8089 |
| 470 | Ga0207687_10059041 | 3300025927 | Bacteria | 2701 |
| 471 | Ga0207664_10147467 | 3300025929 | Bacteria | 1996 |
| 472 | Ga0207664_10160249 | 3300025929 | Bacteria | 1918 |
| 473 | Ga0207644_10000013 | 3300025931 | Bacteria | 185370 |
| 474 | Ga0207644_10000785 | 3300025931 | Bacteria | 20137 |
| 475 | Ga0207644_10081528 | 3300025931 | Bacteria | 2391 |
| 476 | Ga0207644_10159425 | 3300025931 | Bacteria | 1753 |
| 477 | Ga0207690_10000805 | 3300025932 | Bacteria | 20116 |
| 478 | Ga0207690_10001643 | 3300025932 | Bacteria | 13827 |
| 479 | Ga0207690_10063829 | 3300025932 | Bacteria | 2513 |
| 480 | Ga0207706_10003945 | 3300025933 | Bacteria | 14055 |
| 481 | Ga0207706_10004195 | 3300025933 | Bacteria | 13568 |
| 482 | Ga0207706_10126173 | 3300025933 | Bacteria | 2251 |
| 483 | Ga0207686_10001021 | 3300025934 | Bacteria | 16572 |
| 484 | Ga0207686_10009204 | 3300025934 | Bacteria | 5357 |
| 485 | Ga0207709_10000645 | 3300025935 | Bacteria | 28329 |
| 486 | Ga0207709_10010819 | 3300025935 | Bacteria | 5025 |
| 487 | Ga0207709_10023439 | 3300025935 | Bacteria | 3512 |
| 488 | Ga0207670_10001354 | 3300025936 | Bacteria | 12918 |
| 489 | Ga0207670_10029551 | 3300025936 | Bacteria | 3493 |
| 490 | Ga0207669_10000063 | 3300025937 | Bacteria | 53494 |
| 491 | Ga0207669_10037738 | 3300025937 | Bacteria | 2775 |
| 492 | Ga0207669_10063360 | 3300025937 | Bacteria | 2282 |
| 493 | Ga0207704_10000540 | 3300025938 | Bacteria | 16845 |
| 494 | Ga0207704_10119975 | 3300025938 | Bacteria | 1797 |
| 495 | Ga0207704_10172593 | 3300025938 | Bacteria | 1553 |
| 496 | Ga0207665_10002733 | 3300025939 | Bacteria | 11833 |
| 497 | Ga0207665_10012974 | 3300025939 | Bacteria | 5478 |
| 498 | Ga0207691_10004163 | 3300025940 | Bacteria | 14055 |
| 499 | Ga0207711_10000822 | 3300025941 | Bacteria | 30335 |
| 500 | Ga0207711_10002693 | 3300025941 | Bacteria | 15699 |
| 501 | Ga0207711_10010594 | 3300025941 | Bacteria | 7665 |
| 502 | Ga0207711_10011422 | 3300025941 | Bacteria | 7383 |
| 503 | Ga0207711_10020036 | 3300025941 | Bacteria | 5574 |
| 504 | Ga0207689_10001269 | 3300025942 | Bacteria | 24346 |
| 505 | Ga0207689_10001462 | 3300025942 | Bacteria | 22616 |
| 506 | Ga0207689_10008666 | 3300025942 | Bacteria | 8853 |
| 507 | Ga0207661_10001037 | 3300025944 | Bacteria | 18451 |
| 508 | Ga0207661_10172123 | 3300025944 | Bacteria | 1885 |
| 509 | Ga0207679_10000673 | 3300025945 | Bacteria | 22925 |
| 510 | Ga0207679_10107168 | 3300025945 | Bacteria | 2198 |
| 511 | Ga0207667_10020248 | 3300025949 | Bacteria | 7403 |
| 512 | Ga0207667_10022346 | 3300025949 | Bacteria | 6990 |
| 513 | Ga0207667_10044826 | 3300025949 | Bacteria | 4685 |
| 514 | Ga0207667_10127128 | 3300025949 | Bacteria | 2626 |
| 515 | Ga0207667_10372545 | 3300025949 | Bacteria | 1455 |
| 516 | Ga0207651_10000116 | 3300025960 | Bacteria | 33936 |
| 517 | Ga0207651_10169104 | 3300025960 | Bacteria | 1722 |
| 518 | Ga0207651_10307417 | 3300025960 | Bacteria | 1321 |
| 519 | Ga0207712_10002012 | 3300025961 | Bacteria | 13339 |
| 520 | Ga0207712_10004960 | 3300025961 | Bacteria | 8417 |
| 521 | Ga0207668_10000300 | 3300025972 | Bacteria | 32440 |
| 522 | Ga0207668_10043709 | 3300025972 | Bacteria | 3043 |
| 523 | Ga0207668_10076618 | 3300025972 | Bacteria | 2409 |
| 524 | Ga0207640_10000011 | 3300025981 | Bacteria | 252283 |
| 525 | Ga0207640_10000435 | 3300025981 | Bacteria | 25481 |
| 526 | Ga0207640_10119935 | 3300025981 | Bacteria | 1882 |
| 527 | Ga0207658_10000004 | 3300025986 | Bacteria | 569357 |
| 528 | Ga0207658_10002963 | 3300025986 | Bacteria | 12149 |
| 529 | Ga0207658_10022657 | 3300025986 | Bacteria | 4375 |
| 530 | Ga0207658_10128470 | 3300025986 | Bacteria | 2032 |
| 531 | Ga0207677_10000587 | 3300026023 | Bacteria | 22685 |
| 532 | Ga0207703_10002543 | 3300026035 | Bacteria | 15752 |
| 533 | Ga0207703_10015006 | 3300026035 | Bacteria | 6046 |
| 534 | Ga0207703_10041348 | 3300026035 | Bacteria | 3692 |
| 535 | Ga0207703_10103258 | 3300026035 | Bacteria | 2420 |
| 536 | Ga0207703_10104050 | 3300026035 | Bacteria | 2411 |
| 537 | Ga0207639_10000025 | 3300026041 | Bacteria | 207451 |
| 538 | Ga0207639_10002760 | 3300026041 | Bacteria | 11797 |
| 539 | Ga0207639_10032120 | 3300026041 | Bacteria | 3863 |
| 540 | Ga0207639_10034881 | 3300026041 | Bacteria | 3721 |
| 541 | Ga0207678_10001349 | 3300026067 | Bacteria | 22608 |
| 542 | Ga0207678_10022212 | 3300026067 | Bacteria | 5559 |
| 543 | Ga0207678_10049471 | 3300026067 | Bacteria | 3633 |
| 544 | Ga0207678_10126730 | 3300026067 | Bacteria | 2178 |
| 545 | Ga0207708_10002313 | 3300026075 | Bacteria | 14009 |
| 546 | Ga0207708_10021050 | 3300026075 | Bacteria | 4921 |
| 547 | Ga0207702_10004678 | 3300026078 | Bacteria | 12098 |
| 548 | Ga0207702_10005132 | 3300026078 | Bacteria | 11518 |
| 549 | Ga0207702_10067598 | 3300026078 | Bacteria | 3068 |
| 550 | Ga0207702_10104329 | 3300026078 | Bacteria | 2509 |
| 551 | Ga0207702_10280800 | 3300026078 | Bacteria | 1574 |
| 552 | Ga0207702_10428487 | 3300026078 | Bacteria | 1280 |
| 553 | Ga0207641_10002690 | 3300026088 | Bacteria | 16219 |
| 554 | Ga0207641_10024972 | 3300026088 | Bacteria | 4927 |
| 555 | Ga0207641_10042050 | 3300026088 | Bacteria | 3833 |
| 556 | Ga0207641_10193884 | 3300026088 | Bacteria | 1869 |
| 557 | Ga0207648_10004670 | 3300026089 | Bacteria | 14009 |
| 558 | Ga0207648_10020639 | 3300026089 | Bacteria | 5932 |
| 559 | Ga0207676_10000003 | 3300026095 | Bacteria | 1123235 |
| 560 | Ga0207676_10001465 | 3300026095 | Bacteria | 17525 |
| 561 | Ga0207676_10005579 | 3300026095 | Bacteria | 8902 |
| 562 | Ga0207674_10005769 | 3300026116 | Bacteria | 14687 |
| 563 | Ga0207674_10015586 | 3300026116 | Bacteria | 8346 |
| 564 | Ga0207675_100004143 | 3300026118 | Bacteria | 14034 |
| 565 | Ga0207675_100064784 | 3300026118 | Bacteria | 3416 |
| 566 | Ga0207675_100073055 | 3300026118 | Bacteria | 3209 |
| 567 | Ga0207683_10000138 | 3300026121 | Bacteria | 60113 |
| 568 | Ga0207683_10005177 | 3300026121 | Bacteria | 11195 |
| 569 | Ga0207698_10000568 | 3300026142 | Bacteria | 21530 |
| 570 | Ga0207698_10033839 | 3300026142 | Bacteria | 3718 |
| 571 | Ga0209281_1000114 | 3300027111 | Bacteria | 210536 |
| 572 | Ga0209371_1000026 | 3300027312 | Bacteria | 449205 |
| 573 | Ga0209371_1000050 | 3300027312 | Bacteria | 278645 |
| 574 | Ga0209371_1000148 | 3300027312 | Bacteria | 112568 |
| 575 | Ga0209371_1001597 | 3300027312 | Bacteria | 14753 |
| 576 | Ga0209371_1002855 | 3300027312 | Bacteria | 9105 |
| 577 | Ga0209371_1014433 | 3300027312 | Bacteria | 2166 |
| 578 | Ga0209371_1020333 | 3300027312 | Bacteria | 1636 |
| 579 | Ga0209970_1006170 | 3300027614 | Bacteria | 1966 |
| 580 | Ga0210002_1000723 | 3300027617 | Bacteria | 4469 |
| 581 | Ga0209971_1001690 | 3300027682 | Bacteria | 5436 |
| 582 | Ga0209966_1001187 | 3300027695 | Bacteria | 4652 |
| 583 | Ga0209966_1002127 | 3300027695 | Bacteria | 3304 |
| 584 | Ga0209813_10000121 | 3300027866 | Bacteria | 28181 |
| 585 | Ga0207428_10000501 | 3300027907 | Bacteria | 46798 |
| 586 | Ga0207428_10001016 | 3300027907 | Bacteria | 31079 |
| 587 | Ga0207428_10005810 | 3300027907 | Bacteria | 11441 |
| 588 | Ga0268266_10001262 | 3300028379 | Bacteria | 30924 |
| 589 | Ga0268266_10041769 | 3300028379 | Bacteria | 3914 |
| 590 | Ga0268266_10051613 | 3300028379 | Bacteria | 3530 |
| 591 | Ga0268265_10001134 | 3300028380 | Bacteria | 23524 |
| 592 | Ga0268265_10001141 | 3300028380 | Bacteria | 23422 |
| 593 | Ga0268265_10110556 | 3300028380 | Bacteria | 2242 |
| 594 | Ga0268265_10126649 | 3300028380 | Bacteria | 2115 |
| 595 | Ga0268264_10000009 | 3300028381 | Bacteria | 724972 |
| 596 | Ga0268264_10001321 | 3300028381 | Bacteria | 23341 |
| 597 | Ga0268264_10171002 | 3300028381 | Bacteria | 1965 |
| 598 | Ga0265326_10002676 | 3300028558 | Bacteria | 5971 |
| 599 | Ga0265334_10011858 | 3300028573 | Bacteria | 3661 |
| 600 | Ga0265334_10026845 | 3300028573 | Bacteria | 2322 |
| 601 | Ga0265318_10000647 | 3300028577 | Bacteria | 23825 |
| 602 | Ga0307517_10004912 | 3300028786 | Bacteria | 20370 |
| 603 | Ga0307517_10065343 | 3300028786 | Bacteria | 3367 |
| 604 | Ga0307515_10000138 | 3300028794 | Bacteria | 173220 |
| 605 | Ga0307515_10005581 | 3300028794 | Bacteria | 25423 |
| 606 | Ga0265338_10006098 | 3300028800 | Bacteria | 15476 |
| 607 | Ga0265338_10015318 | 3300028800 | Bacteria | 8436 |
| 608 | Ga0268256_1000003 | 3300030500 | Bacteria | 1289401 |
| 609 | Ga0268256_1000017 | 3300030500 | Bacteria | 600718 |
| 610 | Ga0268256_1000122 | 3300030500 | Bacteria | 112568 |
| 611 | Ga0268256_1002561 | 3300030500 | Bacteria | 9105 |
| 612 | Ga0268256_1008519 | 3300030500 | Bacteria | 3502 |
| 613 | Ga0268256_1015984 | 3300030500 | Bacteria | 2166 |
| 614 | Ga0268256_1022800 | 3300030500 | Bacteria | 1636 |
| 615 | Ga0307512_10010075 | 3300030522 | Bacteria | 9047 |
| 616 | Ga0265330_10003117 | 3300031235 | Bacteria | 8781 |
| 617 | Ga0265332_10006961 | 3300031238 | Bacteria | 5122 |
| 618 | Ga0265328_10007481 | 3300031239 | Bacteria | 4549 |
| 619 | Ga0265328_10023002 | 3300031239 | Bacteria | 2366 |
| 620 | Ga0265320_10002935 | 3300031240 | Bacteria | 11686 |
| 621 | Ga0265320_10034312 | 3300031240 | Bacteria | 2582 |
| 622 | Ga0265325_10003130 | 3300031241 | Bacteria | 10907 |
| 623 | Ga0265329_10003338 | 3300031242 | Bacteria | 7021 |
| 624 | Ga0265340_10021885 | 3300031247 | Bacteria | 3274 |
| 625 | Ga0265339_10021781 | 3300031249 | Bacteria | 3722 |
| 626 | Ga0265339_10032015 | 3300031249 | Bacteria | 2968 |
| 627 | Ga0265331_10024664 | 3300031250 | Bacteria | 3040 |
| 628 | Ga0265327_10000142 | 3300031251 | Bacteria | 157436 |
| 629 | Ga0265327_10042591 | 3300031251 | Unclassified | 2436 |
| 630 | Ga0265316_10007577 | 3300031344 | Bacteria | 10212 |
| 631 | Ga0265316_10066188 | 3300031344 | Bacteria | 2797 |
| 632 | Ga0307513_10023661 | 3300031456 | Bacteria | 7171 |
| 633 | Ga0307513_10051472 | 3300031456 | Bacteria | 4443 |
| 634 | Ga0307509_10004147 | 3300031507 | Bacteria | 21173 |
| 635 | Ga0307509_10004183 | 3300031507 | Bacteria | 21075 |
| 636 | Ga0307509_10004884 | 3300031507 | Bacteria | 19006 |
| 637 | Ga0307509_10061981 | 3300031507 | Bacteria | 3945 |
| 638 | Ga0307408_100002313 | 3300031548 | Bacteria | 13517 |
| 639 | Ga0307408_100081580 | 3300031548 | Bacteria | 2418 |
| 640 | Ga0307408_100186313 | 3300031548 | Bacteria | 1669 |
| 641 | Ga0265313_10000716 | 3300031595 | Bacteria | 34149 |
| 642 | Ga0265313_10003101 | 3300031595 | Bacteria | 13760 |
| 643 | Ga0307508_10011794 | 3300031616 | Bacteria | 7987 |
| 644 | Ga0307508_10012983 | 3300031616 | Bacteria | 7616 |
| 645 | Ga0265314_10002259 | 3300031711 | Bacteria | 19948 |
| 646 | Ga0265314_10006251 | 3300031711 | Bacteria | 10575 |
| 647 | Ga0265314_10010751 | 3300031711 | Bacteria | 7613 |
| 648 | Ga0265342_10000940 | 3300031712 | Bacteria | 28973 |
| 649 | Ga0265342_10048027 | 3300031712 | Bacteria | 2560 |
| 650 | Ga0307405_10194860 | 3300031731 | Bacteria | 1466 |
| 651 | Ga0307413_10003432 | 3300031824 | Bacteria | 6666 |
| 652 | Ga0307410_10007603 | 3300031852 | Bacteria | 5946 |
| 653 | Ga0307410_10099345 | 3300031852 | Bacteria | 2083 |
| 654 | Ga0307406_10016613 | 3300031901 | Bacteria | 4281 |
| 655 | Ga0307407_10005458 | 3300031903 | Bacteria | 5520 |
| 656 | Ga0307409_100023384 | 3300031995 | Bacteria | 4281 |
| 657 | Ga0307416_100017717 | 3300032002 | Bacteria | 4993 |
| 658 | Ga0307416_100132002 | 3300032002 | Bacteria | 2250 |
| 659 | Ga0307416_100159804 | 3300032002 | Bacteria | 2081 |
| 660 | Ga0307414_10031414 | 3300032004 | Bacteria | 3483 |
| 661 | Ga0307414_10301550 | 3300032004 | Bacteria | 1355 |
| 662 | Ga0307411_10059818 | 3300032005 | Bacteria | 2527 |
| 663 | Ga0307411_10106387 | 3300032005 | Bacteria | 1997 |
| 664 | Ga0307415_100016117 | 3300032126 | Bacteria | 4445 |
| 665 | Ga0307510_10012162 | 3300033180 | Bacteria | 10204 |
| 666 | Ga0307510_10044259 | 3300033180 | Bacteria | 4824 |
| 667 | Ga0373930_0000459 | 3300034816 | Bacteria | 5482 |
| 668 | Ga0373948_0001319 | 3300034817 | Bacteria | 3408 |
| 669 | Ga0373950_0000303 | 3300034818 | Bacteria | 6211 |
| 670 | Ga0373950_0007719 | 3300034818 | Bacteria | 1676 |
| 671 | Ga0373958_0000662 | 3300034819 | Bacteria | 4344 |
| 672 | Ga0373959_0006385 | 3300034820 | Bacteria | 1955 |
| 673 | Ga0373928_0000229 | 3300035084 | Bacteria | 10971 |
| 674 | Ga0373928_0016457 | 3300035084 | Bacteria | 1514 |
| 675 | Ga0373929_0007109 | 3300035085 | Bacteria | 2037 |
| 676 | Ga0373934_0040745 | 3300035086 | Bacteria | 1833 |
| 677 | Ga0373940_0000108 | 3300035088 | Bacteria | 10198 |
| 678 | Ga0373949_0000806 | 3300035090 | Bacteria | 9999 |
| 679 | Ga0373949_0001128 | 3300035090 | Bacteria | 8080 |
| 680 | Ga0373951_0005691 | 3300035091 | Bacteria | 2885 |
| 681 | Ga0373952_0000394 | 3300035092 | Bacteria | 7470 |
| 682 | Ga0373952_0001150 | 3300035092 | Bacteria | 4826 |
| 683 | Ga0373952_0004895 | 3300035092 | Bacteria | 2434 |
| 684 | Ga0373952_0023074 | 3300035092 | Bacteria | 1327 |
| 685 | Ga0373923_0050991 | 3300035111 | Bacteria | 1735 |
| 686 | Ga0373932_0000362 | 3300035112 | Bacteria | 13995 |
| 687 | Ga0373932_0000365 | 3300035112 | Bacteria | 13963 |
| 688 | Ga0373932_0008571 | 3300035112 | Bacteria | 2445 |
| 689 | Ga0373939_0000233 | 3300035114 | Bacteria | 15177 |
| 690 | Ga0373939_0006850 | 3300035114 | Bacteria | 2755 |
| 691 | Ga0373939_0008047 | 3300035114 | Bacteria | 2576 |
| 692 | Ga0373939_0014739 | 3300035114 | Bacteria | 2034 |
| 693 | Ga0373939_0038319 | 3300035114 | Bacteria | 1429 |
| 694 | Ga0373941_0000133 | 3300035115 | Bacteria | 13100 |
| 695 | Ga0373941_0000375 | 3300035115 | Bacteria | 8926 |
| 696 | Ga0373941_0003492 | 3300035115 | Bacteria | 3565 |
| 697 | Ga0373941_0041413 | 3300035115 | Bacteria | 1425 |
| 698 | Ga0373953_0071495 | 3300035117 | Bacteria | 1432 |
| 699 | Ga0373954_0004727 | 3300035118 | Bacteria | 5870 |
| 700 | Ga0373957_0010497 | 3300035120 | Bacteria | 3064 |
| 701 | Ga0373960_0000182 | 3300035121 | Bacteria | 11201 |
| 702 | Ga0373960_0001762 | 3300035121 | Bacteria | 4851 |
| 703 | Ga0373960_0011866 | 3300035121 | Bacteria | 2155 |
| 704 | Ga0373946_0021326 | 3300035171 | Bacteria | 2511 |
| 705 | Ga0373942_0001391 | 3300035207 | Bacteria | 6256 |
| 706 | Ga0373942_0004221 | 3300035207 | Bacteria | 3345 |
| 707 | Ga0373961_0001666 | 3300035241 | Bacteria | 6201 |
| 708 | Ga0373961_0015346 | 3300035241 | Bacteria | 1957 |
| 709 | Ga0373962_0000986 | 3300035242 | Bacteria | 6572 |
| 710 | Ga0373962_0001963 | 3300035242 | Bacteria | 4906 |
| 711 | Ga0373962_0003879 | 3300035242 | Bacteria | 3600 |
| 712 | Ga0373931_0000201 | 3300035691 | Bacteria | 25484 |
| 713 | Ga0373931_0000330 | 3300035691 | Bacteria | 19735 |
| 714 | Ga0373931_0005034 | 3300035691 | Bacteria | 6078 |
| 715 | Ga0373935_0027106 | 3300035692 | Bacteria | 3542 |
| 716 | Ga0373935_0080452 | 3300035692 | Bacteria | 2117 |
| 717 | Ga0373927_0083536 | 3300035695 | Bacteria | 2070 |
| 718 | Ga0373947_0001864 | 3300035725 | Bacteria | 12846 |
| 719 | Ga0373937_0027561 | 3300036401 | Bacteria | 5138 |
| 720 | Ga0373937_0363920 | 3300036401 | Bacteria | 1371 |
| 721 | Ga0316584_0141204 | 3300036712 | Bacteria | 1796 |
| 722 | Ga0373925_0001650 | 3300037068 | Bacteria | 18812 |
| 723 | Ga0373925_0003098 | 3300037068 | Bacteria | 13050 |
| 724 | Ga0395899_0003487 | 3300037312 | Bacteria | 12463 |
| 725 | Ga0395899_0008070 | 3300037312 | Bacteria | 8107 |
| 726 | Ga0395899_0011883 | 3300037312 | Bacteria | 6666 |
| 727 | Ga0395899_0012727 | 3300037312 | Bacteria | 6445 |
| 728 | Ga0395899_0016707 | 3300037312 | Bacteria | 5595 |
| 729 | Ga0395899_0119134 | 3300037312 | Bacteria | 1893 |
| 730 | Ga0395900_0009953 | 3300037418 | Bacteria | 9735 |
| 731 | Ga0395900_0075223 | 3300037418 | Bacteria | 3471 |
| 732 | Ga0395900_0158406 | 3300037418 | Bacteria | 2311 |
| 733 | Ga0395898_0001449 | 3300037466 | Bacteria | 33602 |
| 734 | Ga0395898_0004361 | 3300037466 | Bacteria | 15481 |
| 735 | Ga0395898_0011214 | 3300037466 | Bacteria | 9329 |
| 736 | Ga0395898_0036029 | 3300037466 | Bacteria | 4916 |
| 737 | Ga0395898_0048833 | 3300037466 | Bacteria | 4148 |
| 738 | Ga0395898_0071002 | 3300037466 | Bacteria | 3365 |
| 739 | Ga0395898_0091125 | 3300037466 | Bacteria | 2933 |
| 740 | Ga0395905_0000431 | 3300037471 | Bacteria | 58717 |
| 741 | Ga0395905_0002347 | 3300037471 | Bacteria | 21113 |
| 742 | Ga0395905_0029909 | 3300037471 | Bacteria | 5134 |
| 743 | Ga0395905_0119283 | 3300037471 | Bacteria | 2479 |
| 744 | Ga0395901_0002566 | 3300038443 | Bacteria | 18407 |
| 745 | Ga0395901_0007051 | 3300038443 | Bacteria | 11358 |
| 746 | Ga0395901_0020806 | 3300038443 | Bacteria | 6716 |
| 747 | Ga0395901_0024103 | 3300038443 | Bacteria | 6242 |
| 748 | Ga0395901_0073003 | 3300038443 | Bacteria | 3578 |
| 749 | Ga0395901_0181993 | 3300038443 | Bacteria | 2204 |
| 750 | Ga0395901_0268068 | 3300038443 | Bacteria | 1776 |
| 751 | Ga0237819_00544 | 3300038705 | Bacteria | 12694 |
| 752 | Ga0400484_36850 | 3300038725 | Bacteria | 4809 |
| 753 | Ga0400490_02226 | 3300038726 | Bacteria | 1576 |
| 754 | Ga0400490_54525 | 3300038726 | Bacteria | 4867 |
| 755 | Ga0400491_18916 | 3300038727 | Bacteria | 5529 |
| 756 | Ga0400485_06758 | 3300038735 | Bacteria | 13442 |
| 757 | Ga0400488_11060 | 3300038741 | Bacteria | 4028 |
| 758 | Ga0400488_37986 | 3300038741 | Bacteria | 2724 |
| 759 | Ga0400488_47107 | 3300038741 | Bacteria | 4646 |
| 760 | Ga0400488_60527 | 3300038741 | Bacteria | 6289 |
| 761 | Ga0400486_07908 | 3300038742 | Bacteria | 8783 |
| 762 | Ga0400486_14585 | 3300038742 | Bacteria | 1604 |
| 763 | Ga0400486_24540 | 3300038742 | Bacteria | 7804 |
| 764 | Ga0242420_006282 | 3300038996 | Bacteria | 1874 |
| 765 | Ga0400483_111901 | 3300039062 | Bacteria | 5636 |
| 766 | Ga0400483_191143 | 3300039062 | Bacteria | 6524 |
| 767 | Ga0400483_265139 | 3300039062 | Bacteria | 4394 |
| 768 | Ga0400487_00901 | 3300039110 | Bacteria | 2878 |
| 769 | Ga0400487_12331 | 3300039110 | Bacteria | 40945 |
| 770 | Ga0400487_29781 | 3300039110 | Bacteria | 4195 |
| 771 | Ga0436365_0511988 | 3300039437 | Bacteria | 1854 |
| 772 | Ga0436361_0639952 | 3300039447 | Bacteria | 4594 |
| 773 | Ga0436361_1049346 | 3300039447 | Bacteria | 11760 |
| 774 | Ga0439465_0026623 | 3300041413 | Bacteria | 1830 |
| 775 | Ga0439452_000027 | 3300042010 | Bacteria | 206086 |
| 776 | Ga0439455_0024547 | 3300042012 | Bacteria | 1459 |
| 777 | Ga0451577_0000093 | 3300042876 | Bacteria | 196838 |
| 778 | Ga0451577_0079877 | 3300042876 | Bacteria | 2916 |
| 779 | Ga0451577_0146809 | 3300042876 | Bacteria | 2121 |
| 780 | Ga0466981_0000028 | 3300044669 | Bacteria | 71382 |
| 781 | Ga0453683_0002217 | 3300044673 | Bacteria | 15386 |
| 782 | Ga0453683_0105955 | 3300044673 | Bacteria | 1767 |
| 783 | Ga0466966_0221144 | 3300044684 | Bacteria | 1143 |
| 784 | Ga0466963_0044773 | 3300044694 | Bacteria | 2913 |
| 785 | Ga0466963_0050584 | 3300044694 | Bacteria | 2750 |
| 786 | Ga0453684_0000450 | 3300044712 | Bacteria | 166110 |
| 787 | Ga0453684_0424549 | 3300044712 | Bacteria | 1484 |
| 788 | Ga0466957_0059843 | 3300044842 | Bacteria | 2335 |
| 789 | Ga0466959_0232475 | 3300045049 | Bacteria | 1276 |
| 790 | Ga0451576_0001995 | 3300045051 | Bacteria | 32320 |
| 791 | Ga0451576_0005476 | 3300045051 | Bacteria | 15900 |
| 792 | Ga0451576_0007546 | 3300045051 | Bacteria | 12960 |
| 793 | Ga0495592_0000250 | 3300046454 | Bacteria | 46017 |
| 794 | Ga0495592_0025423 | 3300046454 | Bacteria | 4495 |
| 795 | Ga0495592_0107591 | 3300046454 | Bacteria | 1977 |
| 796 | Ga0495603_0048103 | 3300046455 | Bacteria | 2539 |
| 797 | Ga0495590_0000194 | 3300046457 | Bacteria | 34520 |
| 798 | Ga0495591_003951 | 3300046458 | Bacteria | 7432 |
| 799 | Ga0495591_046760 | 3300046458 | Bacteria | 1201 |
| 800 | Ga0495629_0000753 | 3300046459 | Bacteria | 26186 |
| 801 | Ga0495638_0173392 | 3300046460 | Bacteria | 1236 |
| 802 | Ga0495641_0072722 | 3300046461 | Bacteria | 1542 |
| 803 | Ga0495651_0001426 | 3300046462 | Bacteria | 18541 |
| 804 | Ga0495651_0031279 | 3300046462 | Bacteria | 4151 |
| 805 | Ga0495653_0007689 | 3300046463 | Bacteria | 8821 |
| 806 | Ga0495653_0020780 | 3300046463 | Bacteria | 5318 |
| 807 | Ga0495653_0052995 | 3300046463 | Bacteria | 3106 |
| 808 | Ga0495650_0000016 | 3300046471 | Bacteria | 554693 |
| 809 | Ga0495580_0000875 | 3300046472 | Bacteria | 26065 |
| 810 | Ga0495580_0082792 | 3300046472 | Bacteria | 2236 |
| 811 | Ga0495582_0001659 | 3300046473 | Bacteria | 12550 |
| 812 | Ga0495582_0015740 | 3300046473 | Bacteria | 4148 |
| 813 | Ga0495582_0089400 | 3300046473 | Bacteria | 1716 |
| 814 | Ga0495582_0131603 | 3300046473 | Bacteria | 1413 |
| 815 | Ga0495605_0068699 | 3300046474 | Bacteria | 1678 |
| 816 | Ga0495605_0070831 | 3300046474 | Bacteria | 1648 |
| 817 | Ga0495639_0030825 | 3300046475 | Bacteria | 2385 |
| 818 | Ga0495662_0112075 | 3300046476 | Bacteria | 1337 |
| 819 | Ga0495584_0043774 | 3300046491 | Bacteria | 2260 |
| 820 | Ga0495596_0002323 | 3300046500 | Bacteria | 10332 |
| 821 | Ga0495596_0006771 | 3300046500 | Bacteria | 5235 |
| 822 | Ga0495607_0000187 | 3300046501 | Bacteria | 66043 |
| 823 | Ga0495607_0019573 | 3300046501 | Bacteria | 4297 |
| 824 | Ga0495607_0075961 | 3300046501 | Bacteria | 1860 |
| 825 | Ga0495583_0000149 | 3300046506 | Bacteria | 117980 |
| 826 | Ga0495606_0000165 | 3300046507 | Bacteria | 116607 |
| 827 | Ga0495606_0003759 | 3300046507 | Bacteria | 15784 |
| 828 | Ga0495606_0048104 | 3300046507 | Bacteria | 2808 |
| 829 | Ga0495606_0123709 | 3300046507 | Bacteria | 1545 |
| 830 | Ga0495608_0001990 | 3300046511 | Bacteria | 14648 |
| 831 | Ga0495610_0013250 | 3300046512 | Bacteria | 4906 |
| 832 | Ga0495610_0060500 | 3300046512 | Bacteria | 1803 |
| 833 | Ga0495618_0002569 | 3300046514 | Bacteria | 11628 |
| 834 | Ga0495620_0043614 | 3300046515 | Bacteria | 1953 |
| 835 | Ga0495630_0004025 | 3300046517 | Bacteria | 10290 |
| 836 | Ga0495630_0044652 | 3300046517 | Bacteria | 3311 |
| 837 | Ga0495630_0076160 | 3300046517 | Bacteria | 2528 |
| 838 | Ga0495630_0138706 | 3300046517 | Bacteria | 1848 |
| 839 | Ga0495643_0063271 | 3300046522 | Bacteria | 1957 |
| 840 | Ga0495644_0037635 | 3300046523 | Bacteria | 1825 |
| 841 | Ga0495648_0000775 | 3300046524 | Bacteria | 34064 |
| 842 | Ga0495648_0060719 | 3300046524 | Bacteria | 2248 |
| 843 | Ga0495666_0007275 | 3300046526 | Bacteria | 5554 |
| 844 | Ga0495666_0029609 | 3300046526 | Bacteria | 2693 |
| 845 | Ga0495652_0049824 | 3300046529 | Bacteria | 3583 |
| 846 | Ga0495665_0033100 | 3300046531 | Bacteria | 2765 |
| 847 | Ga0495587_0005444 | 3300046536 | Bacteria | 8302 |
| 848 | Ga0495609_0009954 | 3300046538 | Bacteria | 4579 |
| 849 | Ga0495597_0001190 | 3300046542 | Bacteria | 19496 |
| 850 | Ga0495597_0049130 | 3300046542 | Bacteria | 1865 |
| 851 | Ga0495645_0017249 | 3300046543 | Bacteria | 5172 |
| 852 | Ga0495645_0049903 | 3300046543 | Bacteria | 3047 |
| 853 | Ga0495622_0055241 | 3300046557 | Bacteria | 1842 |
| 854 | Ga0495622_0063627 | 3300046557 | Bacteria | 1706 |
| 855 | Ga0495622_0064014 | 3300046557 | Bacteria | 1701 |
| 856 | Ga0495633_0000065 | 3300046558 | Bacteria | 139197 |
| 857 | Ga0495667_0015367 | 3300046559 | Bacteria | 5172 |
| 858 | Ga0495668_0002416 | 3300046616 | Bacteria | 15427 |
| 859 | Ga0495634_0047634 | 3300046642 | Bacteria | 2887 |
| 860 | Ga0495625_0001637 | 3300046660 | Bacteria | 26325 |
| 861 | Ga0495625_0005161 | 3300046660 | Bacteria | 12051 |
| 862 | Ga0495625_0014089 | 3300046660 | Bacteria | 6398 |
| 863 | Ga0495635_0058027 | 3300046663 | Bacteria | 2663 |
| 864 | Ga0495661_0037140 | 3300046665 | Bacteria | 3043 |
| 865 | Ga0495661_0072174 | 3300046665 | Bacteria | 2014 |
| 866 | Ga0495588_0026815 | 3300046674 | Bacteria | 2877 |
| 867 | Ga0495588_0099986 | 3300046674 | Bacteria | 1523 |
| 868 | Ga0495599_0091824 | 3300046678 | Bacteria | 1894 |
| 869 | Ga0495623_0034053 | 3300046679 | Bacteria | 3267 |
| 870 | Ga0495646_0017562 | 3300046680 | Bacteria | 4536 |
| 871 | Ga0495646_0061535 | 3300046680 | Bacteria | 2235 |
| 872 | Ga0495647_0066535 | 3300046681 | Bacteria | 1433 |
| 873 | Ga0495658_0006858 | 3300046683 | Bacteria | 5612 |
| 874 | Ga0495658_0048860 | 3300046683 | Bacteria | 2387 |
| 875 | Ga0495669_0000075 | 3300046684 | Bacteria | 65812 |
| 876 | Ga0495613_0004700 | 3300046689 | Bacteria | 10246 |
| 877 | Ga0495613_0019456 | 3300046689 | Bacteria | 5060 |
| 878 | Ga0495624_0255052 | 3300046690 | Bacteria | 1060 |
| 879 | Ga0495671_0003075 | 3300046692 | Bacteria | 10366 |
| 880 | Ga0495671_0018007 | 3300046692 | Bacteria | 3756 |
| 881 | Ga0495649_0000396 | 3300046694 | Bacteria | 37744 |
| 882 | Ga0495649_0117197 | 3300046694 | Bacteria | 1410 |
| 883 | Ga0495589_0028828 | 3300046794 | Bacteria | 2800 |
| 884 | Ga0495600_0006772 | 3300046809 | Bacteria | 6988 |
| 885 | Ga0495600_0041087 | 3300046809 | Bacteria | 3013 |
| 886 | Ga0495600_0092904 | 3300046809 | Bacteria | 1968 |
| 887 | Ga0495660_0000189 | 3300046810 | Bacteria | 64823 |
| 888 | Ga0495581_0025513 | 3300047315 | Bacteria | 3427 |
| 889 | Ga0495604_0041622 | 3300047317 | Bacteria | 3603 |
| 890 | Ga0495604_0048640 | 3300047317 | Bacteria | 3298 |
| 891 | Ga0495604_0066259 | 3300047317 | Bacteria | 2747 |
| 892 | Ga0495674_0022419 | 3300047319 | Bacteria | 5824 |
| 893 | Ga0495674_0113184 | 3300047319 | Bacteria | 2298 |
| 894 | Ga0495676_0017396 | 3300047321 | Bacteria | 6359 |
| 895 | Ga0495680_0007465 | 3300047322 | Bacteria | 10018 |
| 896 | Ga0495680_0012454 | 3300047322 | Bacteria | 7485 |
| 897 | Ga0495675_0017062 | 3300047444 | Bacteria | 4597 |
| 898 | Ga0495675_0037133 | 3300047444 | Bacteria | 3103 |
| 899 | Ga0495677_0000154 | 3300047445 | Bacteria | 32847 |
| 900 | Ga0495677_0006061 | 3300047445 | Bacteria | 4571 |
| 901 | Ga0495677_0034044 | 3300047445 | Bacteria | 1858 |
| 902 | Ga0495679_003908 | 3300047446 | Bacteria | 7047 |
| 903 | Ga0495673_0017136 | 3300047469 | Bacteria | 3686 |
| 904 | Ga0495673_0062758 | 3300047469 | Bacteria | 1586 |
| 905 | Ga0495684_0168055 | 3300047471 | Bacteria | 1633 |
| 906 | Ga0495684_0192923 | 3300047471 | Bacteria | 1505 |
| 907 | Ga0495686_0000923 | 3300047472 | Bacteria | 36619 |
| 908 | Ga0495686_0013528 | 3300047472 | Bacteria | 5660 |
| 909 | Ga0495686_0035130 | 3300047472 | Bacteria | 3224 |
| 910 | Ga0495593_0163204 | 3300047673 | Bacteria | 1124 |
| 911 | Ga0495602_0002022 | 3300048088 | Bacteria | 20408 |
| 912 | Ga0495602_0137293 | 3300048088 | Bacteria | 1940 |
| 913 | Ga0495614_0024919 | 3300048089 | Bacteria | 2581 |
| 914 | Ga0495626_0019885 | 3300048091 | Bacteria | 3351 |
| 915 | Ga0496100_0000326 | 3300048903 | Bacteria | 23445 |
| 916 | Ga0496100_0034458 | 3300048903 | Bacteria | 3177 |
| 917 | Ga0496100_0110257 | 3300048903 | Bacteria | 1910 |
| 918 | Ga0496100_0190820 | 3300048903 | Bacteria | 1487 |
| 919 | Ga0496101_0010563 | 3300048904 | Bacteria | 6098 |
| 920 | Ga0496101_0022406 | 3300048904 | Bacteria | 4348 |
| 921 | Ga0496101_0088222 | 3300048904 | Bacteria | 2303 |
| 922 | Ga0496102_0001315 | 3300048905 | Bacteria | 22296 |
| 923 | Ga0496102_0018733 | 3300048905 | Bacteria | 6088 |
| 924 | Ga0496102_0098408 | 3300048905 | Bacteria | 2714 |
| 925 | Ga0496102_0108357 | 3300048905 | Bacteria | 2587 |
| 926 | Ga0496102_0179780 | 3300048905 | Bacteria | 1993 |
| 927 | Ga0496102_0180372 | 3300048905 | Bacteria | 1989 |
| 928 | Ga0496102_0248324 | 3300048905 | Bacteria | 1677 |
| 929 | Ga0496103_0002237 | 3300048906 | Bacteria | 12250 |
| 930 | Ga0496103_0014193 | 3300048906 | Bacteria | 4729 |
| 931 | Ga0496103_0054276 | 3300048906 | Bacteria | 2484 |
| 932 | Ga0496103_0281029 | 3300048906 | Bacteria | 1070 |
| 933 | Ga0496104_0000484 | 3300048907 | Bacteria | 34244 |
| 934 | Ga0496104_0046429 | 3300048907 | Bacteria | 4091 |
| 935 | Ga0496104_0109955 | 3300048907 | Bacteria | 2641 |
| 936 | Ga0496104_0121431 | 3300048907 | Bacteria | 2508 |
| 937 | Ga0496104_0187429 | 3300048907 | Bacteria | 1979 |
| 938 | Ga0496105_0078047 | 3300048908 | Bacteria | 2734 |
| 939 | Ga0496105_0227485 | 3300048908 | Bacteria | 1516 |
| 940 | Ga0496106_0000003 | 3300048909 | Bacteria | 305293 |
| 941 | Ga0496106_0005158 | 3300048909 | Bacteria | 9679 |
| 942 | Ga0496106_0011103 | 3300048909 | Bacteria | 6662 |
| 943 | Ga0496106_0025179 | 3300048909 | Bacteria | 4426 |
| 944 | Ga0496107_0002339 | 3300048910 | Bacteria | 12240 |
| 945 | Ga0496107_0004092 | 3300048910 | Bacteria | 9822 |
| 946 | Ga0496107_0013737 | 3300048910 | Bacteria | 5663 |
| 947 | Ga0496107_0131800 | 3300048910 | Bacteria | 1845 |
| 948 | Ga0496108_0002892 | 3300048911 | Bacteria | 13786 |
| 949 | Ga0496108_0114234 | 3300048911 | Bacteria | 2311 |
| 950 | Ga0496108_0191912 | 3300048911 | Bacteria | 1770 |
| 951 | Ga0496109_0000409 | 3300048912 | Bacteria | 38172 |
| 952 | Ga0496109_0012061 | 3300048912 | Bacteria | 7445 |
| 953 | Ga0496109_0121411 | 3300048912 | Bacteria | 2434 |
| 954 | Ga0496109_0121798 | 3300048912 | Bacteria | 2430 |
| 955 | Ga0496109_0473650 | 3300048912 | Bacteria | 1182 |
| 956 | Ga0496110_0014970 | 3300048913 | Bacteria | 6448 |
| 957 | Ga0496110_0037454 | 3300048913 | Bacteria | 4216 |
| 958 | Ga0496110_0228384 | 3300048913 | Bacteria | 1692 |
| 959 | Ga0496111_0009332 | 3300048914 | Bacteria | 6542 |
| 960 | Ga0496111_0022054 | 3300048914 | Bacteria | 4454 |
| 961 | Ga0496111_0048862 | 3300048914 | Bacteria | 3049 |
| 962 | Ga0496111_0093566 | 3300048914 | Bacteria | 2203 |
| 963 | Ga0496112_0004892 | 3300048915 | Bacteria | 11458 |
| 964 | Ga0496112_0082579 | 3300048915 | Bacteria | 3177 |
| 965 | Ga0496113_0001989 | 3300048916 | Bacteria | 11709 |
| 966 | Ga0496113_0084543 | 3300048916 | Bacteria | 2436 |
| 967 | Ga0496113_0094777 | 3300048916 | Bacteria | 2306 |
| 968 | Ga0496113_0100258 | 3300048916 | Bacteria | 2244 |
| 969 | Ga0496114_0002505 | 3300048917 | Bacteria | 14023 |
| 970 | Ga0496114_0024049 | 3300048917 | Bacteria | 4971 |
| 971 | Ga0496114_0026459 | 3300048917 | Bacteria | 4750 |
| 972 | Ga0496114_0040268 | 3300048917 | Bacteria | 3867 |
| 973 | Ga0496114_0045021 | 3300048917 | Bacteria | 3664 |
| 974 | Ga0496115_0010920 | 3300048918 | Bacteria | 6798 |
| 975 | Ga0496115_0047311 | 3300048918 | Bacteria | 3439 |
| 976 | Ga0496115_0089318 | 3300048918 | Bacteria | 2516 |
| 977 | Ga0496116_0000158 | 3300048919 | Bacteria | 140604 |
| 978 | Ga0496117_0006542 | 3300048920 | Bacteria | 11734 |
| 979 | Ga0496117_0024182 | 3300048920 | Bacteria | 4812 |
| 980 | Ga0496117_0070630 | 3300048920 | Bacteria | 2344 |
| 981 | Ga0496118_0001553 | 3300048921 | Bacteria | 34122 |
| 982 | Ga0496118_0001836 | 3300048921 | Bacteria | 30415 |
| 983 | Ga0496118_0002524 | 3300048921 | Bacteria | 24564 |
| 984 | Ga0496119_0000045 | 3300048922 | Bacteria | 191361 |
| 985 | Ga0496119_0001580 | 3300048922 | Bacteria | 27109 |
| 986 | Ga0496119_0015558 | 3300048922 | Bacteria | 5844 |
| 987 | Ga0496120_0003713 | 3300048923 | Bacteria | 13580 |
| 988 | Ga0496120_0009620 | 3300048923 | Bacteria | 6830 |
| 989 | Ga0496120_0038301 | 3300048923 | Bacteria | 2837 |
| 990 | Ga0496121_0000289 | 3300048924 | Bacteria | 104434 |
| 991 | Ga0496121_0022502 | 3300048924 | Bacteria | 6113 |
| 992 | Ga0496122_0000013 | 3300048925 | Bacteria | 501039 |
| 993 | Ga0496122_0009784 | 3300048925 | Bacteria | 10012 |
| 994 | Ga0496122_0116103 | 3300048925 | Bacteria | 1742 |
| 995 | Ga0496123_0000010 | 3300048926 | Bacteria | 501039 |
| 996 | Ga0496123_0019345 | 3300048926 | Bacteria | 5372 |
| 997 | Ga0496124_0000152 | 3300048927 | Bacteria | 140118 |
| 998 | Ga0496124_0000361 | 3300048927 | Bacteria | 82908 |
| 999 | Ga0496124_0017932 | 3300048927 | Bacteria | 6652 |
| 1000 | Ga0496125_0000546 | 3300048928 | Bacteria | 64890 |
| 1001 | Ga0496125_0025778 | 3300048928 | Bacteria | 5376 |
| 1002 | Ga0496125_0041595 | 3300048928 | Bacteria | 3927 |
| 1003 | Ga0496125_0044541 | 3300048928 | Bacteria | 3750 |
| 1004 | Ga0496125_0070082 | 3300048928 | Bacteria | 2747 |
| 1005 | Ga0496126_0000284 | 3300048929 | Bacteria | 107119 |
| 1006 | Ga0496126_0000455 | 3300048929 | Bacteria | 81622 |
| 1007 | Ga0496126_0106670 | 3300048929 | Bacteria | 2445 |
| 1008 | Ga0501032_0068908 | 3300049569 | Bacteria | 2361 |
| 1009 | Ga0501032_0079502 | 3300049569 | Bacteria | 2183 |
| 1010 | Ga0501033_0158379 | 3300049570 | Bacteria | 1631 |
| 1011 | Ga0501033_0163129 | 3300049570 | Bacteria | 1603 |
| 1012 | Ga0501034_0000458 | 3300049571 | Bacteria | 67394 |
| 1013 | Ga0501034_0050214 | 3300049571 | Bacteria | 4207 |
| 1014 | Ga0501034_0060215 | 3300049571 | Bacteria | 3814 |
| 1015 | Ga0501034_0086257 | 3300049571 | Bacteria | 3140 |
| 1016 | Ga0501034_0155004 | 3300049571 | Bacteria | 2265 |
| 1017 | Ga0501038_0229608 | 3300049574 | Bacteria | 1477 |
| 1018 | Ga0501043_0146263 | 3300049579 | Bacteria | 1850 |
| 1019 | Ga0501047_0101366 | 3300049581 | Bacteria | 2758 |
| 1020 | Ga0501047_0121680 | 3300049581 | Bacteria | 2491 |
| 1021 | Ga0501047_0307818 | 3300049581 | Bacteria | 1425 |
| 1022 | Ga0501048_0230265 | 3300049582 | Bacteria | 1315 |
| 1023 | Ga0501070_0013624 | 3300049586 | Bacteria | 6853 |
| 1024 | Ga0501071_0188453 | 3300049587 | Bacteria | 1546 |
| 1025 | Ga0501072_0003117 | 3300049588 | Bacteria | 12472 |
| 1026 | Ga0501072_0326551 | 3300049588 | Bacteria | 1219 |
| 1027 | Ga0501074_0110721 | 3300049590 | Bacteria | 1965 |
| 1028 | Ga0501211_005745 | 3300049658 | Bacteria | 1234 |
| 1029 | Ga0501249_000706 | 3300049679 | Bacteria | 7565 |
| 1030 | Ga0501080_0048161 | 3300049742 | Bacteria | 3967 |
| 1031 | Ga0501080_0236751 | 3300049742 | Bacteria | 1668 |
| 1032 | Ga0501083_0054588 | 3300049744 | Bacteria | 2681 |
| 1033 | Ga0501083_0063330 | 3300049744 | Bacteria | 2466 |
| 1034 | Ga0501269_000265 | 3300049766 | Bacteria | 14848 |
| 1035 | Ga0501035_0156072 | 3300049822 | Bacteria | 1978 |
| 1036 | Ga0501035_0205178 | 3300049822 | Bacteria | 1689 |
| 1037 | Ga0501044_0025708 | 3300049823 | Bacteria | 6241 |
| 1038 | Ga0501044_0040799 | 3300049823 | Bacteria | 4836 |
| 1039 | Ga0501044_0150185 | 3300049823 | Bacteria | 2313 |
| 1040 | nmdc:mga00v17_67664_c1 | 3300050491 | Bacteria | 2207 |
| 1041 | nmdc:mga00v17_8062_c1 | 3300050491 | Bacteria | 5654 |
| 1042 | nmdc:mga0yw44_15676_c1 | 3300050492 | Bacteria | 4068 |
| 1043 | nmdc:mga0yw44_187670_c1 | 3300050492 | Bacteria | 1362 |
| 1044 | nmdc:mga06z11_14548_c1 | 3300050494 | Bacteria | 3488 |
| 1045 | nmdc:mga06z11_36_c1 | 3300050494 | Bacteria | 55905 |
| 1046 | nmdc:mga04h51_119_c1 | 3300050495 | Bacteria | 23185 |
| 1047 | nmdc:mga09592_326667_c1 | 3300050508 | Bacteria | 1328 |
| 1048 | nmdc:mga08y16_865_c1 | 3300050511 | Bacteria | 29154 |
| 1049 | nmdc:mga08y16_992_c1 | 3300050511 | Bacteria | 27676 |
| 1050 | nmdc:mga0n895_1104_c1 | 3300050512 | Bacteria | 19751 |
| 1051 | nmdc:mga0n895_169339_c1 | 3300050512 | Bacteria | 2216 |
| 1052 | nmdc:mga0n895_175793_c1 | 3300050512 | Bacteria | 2172 |
| 1053 | nmdc:mga0n895_7653_c1 | 3300050512 | Bacteria | 9289 |
| 1054 | nmdc:mga0rr50_112212_c1 | 3300050513 | Bacteria | 2159 |
| 1055 | nmdc:mga08x19_142521_c1 | 3300050514 | Bacteria | 1619 |
| 1056 | nmdc:mga0a205_44463_c1 | 3300050515 | Bacteria | 4281 |
| 1057 | nmdc:mga0a205_5198_c1 | 3300050515 | Bacteria | 11710 |
| 1058 | nmdc:mga0a205_970_c1 | 3300050515 | Bacteria | 23704 |
| 1059 | Ga0495601_0001428 | 3300053077 | Bacteria | 13162 |
| 1060 | Ga0495601_0001780 | 3300053077 | Bacteria | 11947 |
| 1061 | Ga0495601_0020505 | 3300053077 | Bacteria | 4038 |
| 1062 | Ga0495612_0005327 | 3300053078 | Bacteria | 5313 |
| 1063 | Ga0495612_0010028 | 3300053078 | Bacteria | 3835 |
| 1064 | Ga0495595_0001527 | 3300053084 | Bacteria | 9022 |
| 1065 | Ga0495595_0014275 | 3300053084 | Bacteria | 3367 |
| 1066 | Ga0495595_0023364 | 3300053084 | Bacteria | 2721 |
| 1067 | Ga0495619_0000045 | 3300053085 | Bacteria | 108543 |
| 1068 | Ga0495619_0000388 | 3300053085 | Bacteria | 30051 |
| 1069 | Ga0495619_0060004 | 3300053085 | Bacteria | 2527 |
| 1070 | Ga0495619_0316957 | 3300053085 | Bacteria | 1080 |
| 1071 | Ga0500643_005413 | 3300053087 | Bacteria | 5503 |
| 1072 | Ga0500644_0001370 | 3300053088 | Bacteria | 6493 |
| 1073 | Ga0500651_0001796 | 3300053093 | Bacteria | 10995 |
| 1074 | Ga0500566_0046447 | 3300053094 | Bacteria | 2496 |
| 1075 | Ga0500641_0016992 | 3300053096 | Bacteria | 2714 |
| 1076 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 1077 | Ga0500618_000240 | 3300053125 | Bacteria | 43528 |
| 1078 | Ga0500618_003648 | 3300053125 | Bacteria | 5209 |
| 1079 | Ga0500652_018059 | 3300053131 | Bacteria | 2597 |
| 1080 | Ga0500559_0000076 | 3300053136 | Bacteria | 76510 |
| 1081 | Ga0500559_0087499 | 3300053136 | Bacteria | 1423 |
| 1082 | Ga0500568_0004495 | 3300053139 | Bacteria | 7432 |
| 1083 | Ga0500588_0010191 | 3300053146 | Bacteria | 2261 |
| 1084 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1085 | Ga0500636_0013888 | 3300053177 | Bacteria | 4734 |
| 1086 | Ga0500645_000324 | 3300053730 | Bacteria | 33824 |
| 1087 | Ga0501084_0446089 | 3300054114 | Bacteria | 1094 |
| 1088 | Ga0530510_0099539 | 3300061734 | Bacteria | 2126 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009176 | Ga0105242_10200728 | Ga0105242_102007281 | 291 |
| 2 | 3300027614 | Ga0209970_1006170 | Ga0209970_10061703 | 292 |
| 3 | 3300044684 | Ga0466966_0221144 | Ga0466966_0221144_50_964 | 299 |
| 4 | 3300045049 | Ga0466959_0232475 | Ga0466959_0232475_91_1005 | 299 |
| 5 | 3300009098 | Ga0105245_10361338 | Ga0105245_103613382 | 312 |
| 6 | 3300048914 | Ga0496111_0093566 | Ga0496111_0093566_1228_2178 | 312 |
| 7 | 3300053085 | Ga0495619_0316957 | Ga0495619_0316957_10_963 | 312 |
| 8 | 3300035084 | Ga0373928_0016457 | Ga0373928_0016457_17_985 | 313 |
| 9 | 3300046507 | Ga0495606_0123709 | Ga0495606_0123709_553_1497 | 313 |
| 10 | 3300039437 | Ga0436365_0511988 | Ga0436365_0511988_841_1833 | 326 |
| 11 | 3300046690 | Ga0495624_0255052 | Ga0495624_0255052_48_1043 | 326 |
| 12 | 3300048906 | Ga0496103_0281029 | Ga0496103_0281029_60_1055 | 326 |
| 13 | 3300003322 | rootL2_10089387 | rootL2_100893872 | 328 |
| 14 | 3300003323 | rootH1_10264660 | rootH1_102646602 | 328 |
| 15 | 3300037312 | Ga0395899_0016707 | Ga0395899_0016707_1301_2317 | 330 |
| 16 | 3300038443 | Ga0395901_0024103 | Ga0395901_0024103_955_1971 | 330 |
| 17 | 3300005327 | Ga0070658_10011263 | Ga0070658_100112636 | 332 |
| 18 | 3300005339 | Ga0070660_100001846 | Ga0070660_1000018466 | 332 |
| 19 | 3300005339 | Ga0070660_100027146 | Ga0070660_1000271465 | 332 |
| 20 | 3300005366 | Ga0070659_100000655 | Ga0070659_10000065519 | 332 |
| 21 | 3300005455 | Ga0070663_100107879 | Ga0070663_1001078792 | 332 |
| 22 | 3300005539 | Ga0068853_100000049 | Ga0068853_10000004917 | 332 |
| 23 | 3300005563 | Ga0068855_100126773 | Ga0068855_1001267733 | 332 |
| 24 | 3300005578 | Ga0068854_100000129 | Ga0068854_1000001295 | 332 |
| 25 | 3300005614 | Ga0068856_100169222 | Ga0068856_1001692221 | 332 |
| 26 | 3300009093 | Ga0105240_10003634 | Ga0105240_1000363420 | 332 |
| 27 | 3300013104 | Ga0157370_10023716 | Ga0157370_100237167 | 332 |
| 28 | 3300013307 | Ga0157372_10035365 | Ga0157372_100353653 | 332 |
| 29 | 3300025913 | Ga0207695_10048660 | Ga0207695_100486606 | 332 |
| 30 | 3300025919 | Ga0207657_10001379 | Ga0207657_1000137914 | 332 |
| 31 | 3300025932 | Ga0207690_10001643 | Ga0207690_100016437 | 332 |
| 32 | 3300025949 | Ga0207667_10022346 | Ga0207667_100223466 | 332 |
| 33 | 3300025981 | Ga0207640_10000011 | Ga0207640_1000001196 | 332 |
| 34 | 3300026041 | Ga0207639_10000025 | Ga0207639_100000259 | 332 |
| 35 | 3300026067 | Ga0207678_10126730 | Ga0207678_101267302 | 332 |
| 36 | 3300046543 | Ga0495645_0017249 | Ga0495645_0017249_3357_4457 | 332 |
| 37 | 3300048917 | Ga0496114_0026459 | Ga0496114_0026459_29_1129 | 332 |
| 38 | 3300025935 | Ga0207709_10023439 | Ga0207709_100234394 | 337 |
| 39 | 3300005441 | Ga0070700_100205305 | Ga0070700_1002053051 | 338 |
| 40 | 3300044673 | Ga0453683_0002217 | Ga0453683_0002217_1124_2239 | 338 |
| 41 | 3300050514 | nmdc:mga08x19_142521_c1 | nmdc:mga08x19_142521_c1_408_1433 | 339 |
| 42 | 3300009147 | Ga0114129_10157084 | Ga0114129_101570842 | 340 |
| 43 | 3300038725 | Ga0400484_36850 | Ga0400484_36850_29_1069 | 341 |
| 44 | 3300039062 | Ga0400483_111901 | Ga0400483_111901_21_1052 | 341 |
| 45 | 3300046454 | Ga0495592_0025423 | Ga0495592_0025423_14_1057 | 341 |
| 46 | 3300046507 | Ga0495606_0048104 | Ga0495606_0048104_614_1684 | 341 |
| 47 | 3300046665 | Ga0495661_0037140 | Ga0495661_0037140_1536_2579 | 341 |
| 48 | 3300047469 | Ga0495673_0017136 | Ga0495673_0017136_2489_3532 | 341 |
| 49 | 3300047469 | Ga0495673_0062758 | Ga0495673_0062758_17_1060 | 341 |
| 50 | 3300048905 | Ga0496102_0098408 | Ga0496102_0098408_1659_2702 | 341 |
| 51 | 3300048913 | Ga0496110_0037454 | Ga0496110_0037454_2837_3880 | 341 |
| 52 | 3300048925 | Ga0496122_0116103 | Ga0496122_0116103_684_1727 | 341 |
| 53 | 3300048927 | Ga0496124_0017932 | Ga0496124_0017932_5369_6412 | 341 |
| 54 | 3300007788 | Ga0099795_10002598 | Ga0099795_100025981 | 342 |
| 55 | 3300035117 | Ga0373953_0071495 | Ga0373953_0071495_358_1404 | 342 |
| 56 | 3300036401 | Ga0373937_0027561 | Ga0373937_0027561_160_1206 | 342 |
| 57 | 3300036712 | Ga0316584_0141204 | Ga0316584_0141204_29_1072 | 342 |
| 58 | 3300037466 | Ga0395898_0091125 | Ga0395898_0091125_18_1055 | 342 |
| 59 | 3300046454 | Ga0495592_0107591 | Ga0495592_0107591_533_1579 | 342 |
| 60 | 3300046458 | Ga0495591_046760 | Ga0495591_046760_35_1066 | 342 |
| 61 | 3300046557 | Ga0495622_0055241 | Ga0495622_0055241_304_1347 | 342 |
| 62 | 3300046559 | Ga0495667_0015367 | Ga0495667_0015367_875_1921 | 342 |
| 63 | 3300046663 | Ga0495635_0058027 | Ga0495635_0058027_1423_2469 | 342 |
| 64 | 3300046809 | Ga0495600_0092904 | Ga0495600_0092904_171_1217 | 342 |
| 65 | 3300047317 | Ga0495604_0041622 | Ga0495604_0041622_1738_2784 | 342 |
| 66 | 3300047322 | Ga0495680_0007465 | Ga0495680_0007465_4203_5249 | 342 |
| 67 | 3300047471 | Ga0495684_0168055 | Ga0495684_0168055_64_1110 | 342 |
| 68 | 3300047673 | Ga0495593_0163204 | Ga0495593_0163204_17_1060 | 342 |
| 69 | 3300048912 | Ga0496109_0473650 | Ga0496109_0473650_99_1142 | 342 |
| 70 | 3300053077 | Ga0495601_0001780 | Ga0495601_0001780_3980_5026 | 342 |
| 71 | 3300053078 | Ga0495612_0010028 | Ga0495612_0010028_661_1707 | 342 |
| 72 | 3300053084 | Ga0495595_0001527 | Ga0495595_0001527_4944_5990 | 342 |
| 73 | 3300053085 | Ga0495619_0000045 | Ga0495619_0000045_10252_11298 | 342 |
| 74 | 3300054114 | Ga0501084_0446089 | Ga0501084_0446089_23_1066 | 342 |
| 75 | 3300028573 | Ga0265334_10026845 | Ga0265334_100268452 | 345 |
| 76 | iso_pu_bacteria | 2643221635 | 2644198434 | 345 |
| 77 | iso_pu_bacteria | 2862993130 | 2862995421 | 348 |
| 78 | iso_pu_bacteria | 2896344016 | 2896344106 | 348 |
| 79 | 3300048922 | Ga0496119_0001580 | Ga0496119_0001580_7357_8433 | 350 |
| 80 | 3300048923 | Ga0496120_0009620 | Ga0496120_0009620_4336_5412 | 350 |
| 81 | 3300005539 | Ga0068853_100363998 | Ga0068853_1003639982 | 351 |
| 82 | 3300005563 | Ga0068855_100147794 | Ga0068855_1001477942 | 351 |
| 83 | 3300032004 | Ga0307414_10031414 | Ga0307414_100314141 | 351 |
| 84 | 3300032004 | Ga0307414_10301550 | Ga0307414_103015501 | 351 |
| 85 | 3300032005 | Ga0307411_10106387 | Ga0307411_101063872 | 351 |
| 86 | 3300048924 | Ga0496121_0000289 | Ga0496121_0000289_16273_17352 | 351 |
| 87 | 3300050508 | nmdc:mga09592_326667_c1 | nmdc:mga09592_326667_c1_14_1129 | 351 |
| 88 | 3300005288 | Ga0065714_10014552 | Ga0065714_100145522 | 352 |
| 89 | 3300005548 | Ga0070665_100211083 | Ga0070665_1002110832 | 352 |
| 90 | 3300031251 | Ga0265327_10000142 | Ga0265327_1000014270 | 352 |
| 91 | 3300031251 | Ga0265327_10042591 | Ga0265327_100425913 | 352 |
| 92 | 3300037466 | Ga0395898_0048833 | Ga0395898_0048833_1329_2414 | 352 |
| 93 | 3300053146 | Ga0500588_0010191 | Ga0500588_0010191_415_1482 | 353 |
| 94 | 3300046694 | Ga0495649_0117197 | Ga0495649_0117197_56_1126 | 354 |
| 95 | 3300053125 | Ga0500618_003648 | Ga0500618_003648_2050_3180 | 354 |
| 96 | 3300006195 | Ga0075366_10018799 | Ga0075366_100187992 | 355 |
| 97 | 3300025294 | Ga0209025_1032840 | Ga0209025_10328402 | 355 |
| 98 | 3300025919 | Ga0207657_10029120 | Ga0207657_100291205 | 355 |
| 99 | 3300031344 | Ga0265316_10066188 | Ga0265316_100661883 | 355 |
| 100 | 3300048907 | Ga0496104_0187429 | Ga0496104_0187429_270_1343 | 355 |
| 101 | 3300003856 | Ga0058692_1000047 | Ga0058692_1000047110 | 356 |
| 102 | 3300006871 | Ga0075434_100492441 | Ga0075434_1004924411 | 356 |
| 103 | 3300009093 | Ga0105240_10391429 | Ga0105240_103914292 | 356 |
| 104 | 3300009094 | Ga0111539_10007371 | Ga0111539_100073717 | 356 |
| 105 | 3300009094 | Ga0111539_10345350 | Ga0111539_103453502 | 356 |
| 106 | 3300009148 | Ga0105243_10018182 | Ga0105243_100181823 | 356 |
| 107 | 3300009177 | Ga0105248_10009088 | Ga0105248_100090887 | 356 |
| 108 | 3300009553 | Ga0105249_10007504 | Ga0105249_100075043 | 356 |
| 109 | 3300010375 | Ga0105239_10008469 | Ga0105239_100084698 | 356 |
| 110 | 3300012481 | Ga0157320_1000177 | Ga0157320_10001772 | 356 |
| 111 | 3300012494 | Ga0157341_1001479 | Ga0157341_10014792 | 356 |
| 112 | 3300013306 | Ga0163162_10005169 | Ga0163162_1000516910 | 356 |
| 113 | 3300014325 | Ga0163163_10011894 | Ga0163163_100118946 | 356 |
| 114 | 3300014968 | Ga0157379_10042697 | Ga0157379_100426974 | 356 |
| 115 | 3300027312 | Ga0209371_1000148 | Ga0209371_100014812 | 356 |
| 116 | 3300030500 | Ga0268256_1000122 | Ga0268256_100012274 | 356 |
| 117 | 3300034816 | Ga0373930_0000459 | Ga0373930_0000459_1798_2883 | 356 |
| 118 | 3300034817 | Ga0373948_0001319 | Ga0373948_0001319_544_1629 | 356 |
| 119 | 3300034818 | Ga0373950_0000303 | Ga0373950_0000303_2753_3838 | 356 |
| 120 | 3300034820 | Ga0373959_0006385 | Ga0373959_0006385_524_1609 | 356 |
| 121 | 3300035084 | Ga0373928_0000229 | Ga0373928_0000229_8256_9341 | 356 |
| 122 | 3300035085 | Ga0373929_0007109 | Ga0373929_0007109_480_1565 | 356 |
| 123 | 3300035088 | Ga0373940_0000108 | Ga0373940_0000108_4562_5647 | 356 |
| 124 | 3300035090 | Ga0373949_0001128 | Ga0373949_0001128_6591_7676 | 356 |
| 125 | 3300035092 | Ga0373952_0000394 | Ga0373952_0000394_5697_6782 | 356 |
| 126 | 3300035112 | Ga0373932_0000365 | Ga0373932_0000365_4257_5342 | 356 |
| 127 | 3300035114 | Ga0373939_0006850 | Ga0373939_0006850_531_1616 | 356 |
| 128 | 3300035115 | Ga0373941_0000375 | Ga0373941_0000375_1284_2369 | 356 |
| 129 | 3300035121 | Ga0373960_0001762 | Ga0373960_0001762_2223_3308 | 356 |
| 130 | 3300035207 | Ga0373942_0001391 | Ga0373942_0001391_2289_3374 | 356 |
| 131 | 3300035241 | Ga0373961_0001666 | Ga0373961_0001666_2989_4074 | 356 |
| 132 | 3300035242 | Ga0373962_0000986 | Ga0373962_0000986_2838_3923 | 356 |
| 133 | 3300038996 | Ga0242420_006282 | Ga0242420_006282_234_1319 | 356 |
| 134 | 3300042012 | Ga0439455_0024547 | Ga0439455_0024547_11_1096 | 356 |
| 135 | 3300042876 | Ga0451577_0146809 | Ga0451577_0146809_472_1557 | 356 |
| 136 | 3300044673 | Ga0453683_0105955 | Ga0453683_0105955_110_1195 | 356 |
| 137 | 3300045051 | Ga0451576_0005476 | Ga0451576_0005476_14770_15855 | 356 |
| 138 | 3300048905 | Ga0496102_0018733 | Ga0496102_0018733_2117_3202 | 356 |
| 139 | 3300048907 | Ga0496104_0046429 | Ga0496104_0046429_1812_2897 | 356 |
| 140 | 3300048908 | Ga0496105_0227485 | Ga0496105_0227485_411_1493 | 356 |
| 141 | 3300048909 | Ga0496106_0011103 | Ga0496106_0011103_4899_5984 | 356 |
| 142 | 3300048910 | Ga0496107_0013737 | Ga0496107_0013737_33_1118 | 356 |
| 143 | 3300048910 | Ga0496107_0131800 | Ga0496107_0131800_679_1764 | 356 |
| 144 | 3300048911 | Ga0496108_0114234 | Ga0496108_0114234_915_2000 | 356 |
| 145 | 3300048912 | Ga0496109_0012061 | Ga0496109_0012061_6197_7282 | 356 |
| 146 | 3300048914 | Ga0496111_0009332 | Ga0496111_0009332_1832_2917 | 356 |
| 147 | 3300048915 | Ga0496112_0004892 | Ga0496112_0004892_3698_4783 | 356 |
| 148 | 3300048916 | Ga0496113_0001989 | Ga0496113_0001989_3933_5018 | 356 |
| 149 | 3300049588 | Ga0501072_0326551 | Ga0501072_0326551_20_1105 | 356 |
| 150 | 3300050511 | nmdc:mga08y16_865_c1 | nmdc:mga08y16_865_c1_879_1964 | 356 |
| 151 | 3300050515 | nmdc:mga0a205_44463_c1 | nmdc:mga0a205_44463_c1_2296_3381 | 356 |
| 152 | 3300053084 | Ga0495595_0023364 | Ga0495595_0023364_1607_2695 | 356 |
| 153 | 3300053087 | Ga0500643_005413 | Ga0500643_005413_1623_2708 | 356 |
| 154 | 3300053093 | Ga0500651_0001796 | Ga0500651_0001796_9874_10962 | 356 |
| 155 | 3300053094 | Ga0500566_0046447 | Ga0500566_0046447_1208_2293 | 356 |
| 156 | 3300053096 | Ga0500641_0016992 | Ga0500641_0016992_16_1089 | 356 |
| 157 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_1016635_1017720 | 356 |
| 158 | iso_pu_bacteria | 2711768156 | 2712469935 | 356 |
| 159 | 3300037312 | Ga0395899_0003487 | Ga0395899_0003487_1397_2515 | 357 |
| 160 | 3300037418 | Ga0395900_0158406 | Ga0395900_0158406_539_1657 | 357 |
| 161 | 3300037466 | Ga0395898_0001449 | Ga0395898_0001449_12348_13466 | 357 |
| 162 | 3300038443 | Ga0395901_0002566 | Ga0395901_0002566_5833_6951 | 357 |
| 163 | 3300048906 | Ga0496103_0014193 | Ga0496103_0014193_178_1254 | 357 |
| 164 | 3300048917 | Ga0496114_0045021 | Ga0496114_0045021_2256_3332 | 357 |
| 165 | 3300005330 | Ga0070690_100057349 | Ga0070690_1000573492 | 359 |
| 166 | 3300005331 | Ga0070670_100123214 | Ga0070670_1001232142 | 359 |
| 167 | 3300005354 | Ga0070675_100069193 | Ga0070675_1000691933 | 359 |
| 168 | 3300005459 | Ga0068867_100069950 | Ga0068867_1000699502 | 359 |
| 169 | 3300005617 | Ga0068859_100079116 | Ga0068859_1000791163 | 359 |
| 170 | 3300005840 | Ga0068870_10093499 | Ga0068870_100934992 | 359 |
| 171 | 3300005841 | Ga0068863_100105141 | Ga0068863_1001051413 | 359 |
| 172 | 3300006358 | Ga0068871_100009090 | Ga0068871_1000090902 | 359 |
| 173 | 3300006931 | Ga0097620_100079117 | Ga0097620_1000791173 | 359 |
| 174 | 3300009098 | Ga0105245_10201582 | Ga0105245_102015822 | 359 |
| 175 | 3300009174 | Ga0105241_10061679 | Ga0105241_100616793 | 359 |
| 176 | 3300009176 | Ga0105242_10119562 | Ga0105242_101195623 | 359 |
| 177 | 3300009177 | Ga0105248_10081678 | Ga0105248_100816783 | 359 |
| 178 | 3300010375 | Ga0105239_10092269 | Ga0105239_100922693 | 359 |
| 179 | 3300013297 | Ga0157378_10119504 | Ga0157378_101195042 | 359 |
| 180 | 3300014325 | Ga0163163_10066143 | Ga0163163_100661433 | 359 |
| 181 | 3300014969 | Ga0157376_10004001 | Ga0157376_100040013 | 359 |
| 182 | 3300025938 | Ga0207704_10119975 | Ga0207704_101199752 | 359 |
| 183 | 3300025941 | Ga0207711_10011422 | Ga0207711_100114226 | 359 |
| 184 | 3300025942 | Ga0207689_10001269 | Ga0207689_1000126917 | 359 |
| 185 | 3300025972 | Ga0207668_10076618 | Ga0207668_100766182 | 359 |
| 186 | 3300026035 | Ga0207703_10103258 | Ga0207703_101032582 | 359 |
| 187 | 3300026089 | Ga0207648_10020639 | Ga0207648_100206394 | 359 |
| 188 | 3300026118 | Ga0207675_100073055 | Ga0207675_1000730553 | 359 |
| 189 | 3300049571 | Ga0501034_0000458 | Ga0501034_0000458_31788_32873 | 359 |
| 190 | 3300049571 | Ga0501034_0050214 | Ga0501034_0050214_212_1297 | 359 |
| 191 | 3300049588 | Ga0501072_0003117 | Ga0501072_0003117_10667_11752 | 359 |
| 192 | 3300049742 | Ga0501080_0236751 | Ga0501080_0236751_91_1176 | 359 |
| 193 | 3300049744 | Ga0501083_0054588 | Ga0501083_0054588_339_1424 | 359 |
| 194 | iso_pu_bacteria | 2547132181 | 2547694319 | 359 |
| 195 | iso_pu_bacteria | 2561511199 | 2562466390 | 359 |
| 196 | iso_pu_bacteria | 2600255256 | 2601531884 | 359 |
| 197 | iso_pu_bacteria | 2600255257 | 2601537256 | 359 |
| 198 | iso_pu_bacteria | 2600255310 | 2601755602 | 359 |
| 199 | iso_pu_bacteria | 2600255311 | 2601760970 | 359 |
| 200 | iso_pu_bacteria | 2602042046 | 2603639009 | 359 |
| 201 | iso_pu_bacteria | 2791355010 | 2792312202 | 359 |
| 202 | iso_pu_bacteria | 2811995292 | 2813730068 | 359 |
| 203 | iso_pu_bacteria | 2814123068 | 2814697562 | 359 |
| 204 | iso_pu_bacteria | 2857576091 | 2857577213 | 359 |
| 205 | iso_pu_bacteria | 2935625433 | 2935629259 | 359 |
| 206 | iso_pu_bacteria | 2939617950 | 2939621630 | 359 |
| 207 | iso_pu_bacteria | 2974435778 | 2974437454 | 359 |
| 208 | iso_pu_bacteria | 8019504834 | 8019508228 | 359 |
| 209 | 3300027312 | Ga0209371_1020333 | Ga0209371_10203332 | 360 |
| 210 | 3300030500 | Ga0268256_1022800 | Ga0268256_10228001 | 360 |
| 211 | 3300048928 | Ga0496125_0070082 | Ga0496125_0070082_278_1363 | 360 |
| 212 | 3300053136 | Ga0500559_0087499 | Ga0500559_0087499_138_1238 | 360 |
| 213 | iso_pu_bacteria | 2501025502 | 2501080743 | 360 |
| 214 | iso_pu_bacteria | 2510917013 | 2511086813 | 360 |
| 215 | iso_pu_bacteria | 2537561728 | 2538425847 | 360 |
| 216 | iso_pu_bacteria | 2643221736 | 2644742557 | 360 |
| 217 | iso_pu_bacteria | 2738541317 | 2738944800 | 360 |
| 218 | iso_pu_bacteria | 2841760612 | 2841763960 | 360 |
| 219 | iso_pu_bacteria | 2844104063 | 2844108585 | 360 |
| 220 | iso_pu_bacteria | 2851182111 | 2851185201 | 360 |
| 221 | iso_pu_bacteria | 2851246043 | 2851250395 | 360 |
| 222 | iso_pu_bacteria | 2855195626 | 2855198152 | 360 |
| 223 | iso_pu_bacteria | 2858466076 | 2858469019 | 360 |
| 224 | iso_pu_bacteria | 2871272651 | 2871275711 | 360 |
| 225 | iso_pu_bacteria | 2871282230 | 2871286402 | 360 |
| 226 | iso_pu_bacteria | 2900051742 | 2900052770 | 360 |
| 227 | iso_pu_bacteria | 2904424332 | 2904429362 | 360 |
| 228 | iso_pu_bacteria | 2904434214 | 2904437426 | 360 |
| 229 | iso_pu_bacteria | 2913308742 | 2913309421 | 360 |
| 230 | 3300038742 | Ga0400486_24540 | Ga0400486_24540_2617_3711 | 361 |
| 231 | iso_pu_bacteria | 2511231027 | 2511388955 | 361 |
| 232 | iso_pu_bacteria | 2585427591 | 2585825620 | 361 |
| 233 | iso_pu_bacteria | 2585427592 | 2585832242 | 361 |
| 234 | iso_pu_bacteria | 2602042109 | 2603866764 | 361 |
| 235 | iso_pu_bacteria | 2667528173 | 2671108041 | 361 |
| 236 | iso_pu_bacteria | 2765235802 | 2765466889 | 361 |
| 237 | iso_pu_bacteria | 2839993093 | 2839997264 | 361 |
| 238 | iso_pu_bacteria | 2842871566 | 2842873885 | 361 |
| 239 | iso_pu_bacteria | 2855730933 | 2855732543 | 361 |
| 240 | iso_pu_bacteria | 2855767633 | 2855769251 | 361 |
| 241 | iso_pu_bacteria | 2881412998 | 2881414850 | 361 |
| 242 | iso_pu_bacteria | 2882456835 | 2882463164 | 361 |
| 243 | iso_pu_bacteria | 2904474040 | 2904475284 | 361 |
| 244 | iso_pu_bacteria | 2904504865 | 2904505154 | 361 |
| 245 | iso_pu_bacteria | 2904578770 | 2904583562 | 361 |
| 246 | iso_pu_bacteria | 2908669403 | 2908670510 | 361 |
| 247 | iso_pu_bacteria | 2916178963 | 2916181651 | 361 |
| 248 | iso_pu_bacteria | 2919119836 | 2919124518 | 361 |
| 249 | iso_pu_bacteria | 2919150387 | 2919151630 | 361 |
| 250 | iso_pu_bacteria | 2927143783 | 2927146504 | 361 |
| 251 | iso_pu_bacteria | 2928115317 | 2928116133 | 361 |
| 252 | iso_pu_bacteria | 2928521798 | 2928522869 | 361 |
| 253 | iso_pu_bacteria | 2952252522 | 2952256042 | 361 |
| 254 | iso_pu_bacteria | 2954011201 | 2954013765 | 361 |
| 255 | iso_pu_bacteria | 3002141150 | 3002145640 | 361 |
| 256 | iso_pu_bacteria | 8033232454 | 8033233226 | 361 |
| 257 | 3300005545 | Ga0070695_100002211 | Ga0070695_1000022114 | 362 |
| 258 | 3300005983 | Ga0081540_1000493 | Ga0081540_100049340 | 362 |
| 259 | 3300006871 | Ga0075434_100310236 | Ga0075434_1003102362 | 362 |
| 260 | 3300009551 | Ga0105238_10248464 | Ga0105238_102484642 | 362 |
| 261 | 3300035114 | Ga0373939_0038319 | Ga0373939_0038319_47_1165 | 362 |
| 262 | 3300035115 | Ga0373941_0003492 | Ga0373941_0003492_1748_2866 | 362 |
| 263 | 3300035691 | Ga0373931_0000330 | Ga0373931_0000330_275_1393 | 362 |
| 264 | 3300042876 | Ga0451577_0000093 | Ga0451577_0000093_52699_53826 | 362 |
| 265 | 3300044712 | Ga0453684_0000450 | Ga0453684_0000450_21952_23079 | 362 |
| 266 | 3300045051 | Ga0451576_0007546 | Ga0451576_0007546_8350_9477 | 362 |
| 267 | 3300046501 | Ga0495607_0000187 | Ga0495607_0000187_151_1245 | 362 |
| 268 | 3300048091 | Ga0495626_0019885 | Ga0495626_0019885_2151_3245 | 362 |
| 269 | 3300048903 | Ga0496100_0190820 | Ga0496100_0190820_280_1380 | 362 |
| 270 | 3300048904 | Ga0496101_0088222 | Ga0496101_0088222_813_1913 | 362 |
| 271 | 3300048905 | Ga0496102_0179780 | Ga0496102_0179780_693_1793 | 362 |
| 272 | 3300048907 | Ga0496104_0121431 | Ga0496104_0121431_612_1712 | 362 |
| 273 | 3300048908 | Ga0496105_0078047 | Ga0496105_0078047_694_1794 | 362 |
| 274 | 3300048913 | Ga0496110_0014970 | Ga0496110_0014970_2843_3943 | 362 |
| 275 | 3300048914 | Ga0496111_0022054 | Ga0496111_0022054_2957_4057 | 362 |
| 276 | 3300048916 | Ga0496113_0094777 | Ga0496113_0094777_400_1500 | 362 |
| 277 | 3300048918 | Ga0496115_0010920 | Ga0496115_0010920_4424_5524 | 362 |
| 278 | 3300050492 | nmdc:mga0yw44_187670_c1 | nmdc:mga0yw44_187670_c1_231_1322 | 362 |
| 279 | 3300053139 | Ga0500568_0004495 | Ga0500568_0004495_3391_4491 | 362 |
| 280 | iso_pu_bacteria | 2738543032 | 2739355472 | 362 |
| 281 | iso_pu_bacteria | 2818991461 | 2819682794 | 362 |
| 282 | iso_pu_bacteria | 2894232714 | 2894236954 | 362 |
| 283 | 3300001989 | JGI24739J22299_10000902 | JGI24739J22299_100009027 | 363 |
| 284 | 3300002773 | JGI25152J39213_1000198 | JGI25152J39213_100019836 | 363 |
| 285 | 3300003856 | Ga0058692_1000043 | Ga0058692_100004314 | 363 |
| 286 | 3300003856 | Ga0058692_1005227 | Ga0058692_10052272 | 363 |
| 287 | 3300003856 | Ga0058692_1011006 | Ga0058692_10110062 | 363 |
| 288 | 3300004625 | Ga0055543_1008619 | Ga0055543_10086192 | 363 |
| 289 | 3300005262 | Ga0065165_1000150 | Ga0065165_10001505 | 363 |
| 290 | 3300005327 | Ga0070658_10353495 | Ga0070658_103534951 | 363 |
| 291 | 3300005344 | Ga0070661_100028883 | Ga0070661_1000288834 | 363 |
| 292 | 3300005355 | Ga0070671_100000024 | Ga0070671_10000002453 | 363 |
| 293 | 3300005367 | Ga0070667_100000018 | Ga0070667_10000001816 | 363 |
| 294 | 3300005457 | Ga0070662_100142926 | Ga0070662_1001429262 | 363 |
| 295 | 3300005466 | Ga0070685_10000001 | Ga0070685_10000001235 | 363 |
| 296 | 3300005548 | Ga0070665_100036747 | Ga0070665_1000367472 | 363 |
| 297 | 3300005563 | Ga0068855_100065238 | Ga0068855_1000652384 | 363 |
| 298 | 3300005617 | Ga0068859_100357221 | Ga0068859_1003572212 | 363 |
| 299 | 3300005618 | Ga0068864_100000003 | Ga0068864_10000000317 | 363 |
| 300 | 3300005842 | Ga0068858_100160152 | Ga0068858_1001601522 | 363 |
| 301 | 3300005843 | Ga0068860_100000478 | Ga0068860_10000047839 | 363 |
| 302 | 3300005844 | Ga0068862_100001424 | Ga0068862_10000142419 | 363 |
| 303 | 3300005937 | Ga0081455_10000341 | Ga0081455_1000034161 | 363 |
| 304 | 3300005983 | Ga0081540_1011092 | Ga0081540_10110924 | 363 |
| 305 | 3300006051 | Ga0075364_10027418 | Ga0075364_100274184 | 363 |
| 306 | 3300006931 | Ga0097620_100357160 | Ga0097620_1003571602 | 363 |
| 307 | 3300006946 | Ga0079104_1001697 | Ga0079104_10016977 | 363 |
| 308 | 3300009098 | Ga0105245_10005335 | Ga0105245_100053355 | 363 |
| 309 | 3300009545 | Ga0105237_10068141 | Ga0105237_100681413 | 363 |
| 310 | 3300009553 | Ga0105249_10081191 | Ga0105249_100811913 | 363 |
| 311 | 3300013105 | Ga0157369_10002439 | Ga0157369_100024393 | 363 |
| 312 | 3300013297 | Ga0157378_10087636 | Ga0157378_100876363 | 363 |
| 313 | 3300013307 | Ga0157372_10001000 | Ga0157372_1000100019 | 363 |
| 314 | 3300025258 | Ga0209129_1000015 | Ga0209129_1000015261 | 363 |
| 315 | 3300025284 | Ga0209130_1001086 | Ga0209130_100108611 | 363 |
| 316 | 3300025294 | Ga0209025_1003590 | Ga0209025_100359011 | 363 |
| 317 | 3300025903 | Ga0207680_10086011 | Ga0207680_100860113 | 363 |
| 318 | 3300025904 | Ga0207647_10000205 | Ga0207647_100002054 | 363 |
| 319 | 3300025911 | Ga0207654_10005887 | Ga0207654_100058873 | 363 |
| 320 | 3300025913 | Ga0207695_10056865 | Ga0207695_100568654 | 363 |
| 321 | 3300025914 | Ga0207671_10005808 | Ga0207671_100058087 | 363 |
| 322 | 3300025924 | Ga0207694_10002672 | Ga0207694_100026729 | 363 |
| 323 | 3300025925 | Ga0207650_10000003 | Ga0207650_10000003572 | 363 |
| 324 | 3300025931 | Ga0207644_10000013 | Ga0207644_10000013109 | 363 |
| 325 | 3300025941 | Ga0207711_10000822 | Ga0207711_1000082213 | 363 |
| 326 | 3300025949 | Ga0207667_10044826 | Ga0207667_100448263 | 363 |
| 327 | 3300025949 | Ga0207667_10127128 | Ga0207667_101271282 | 363 |
| 328 | 3300025960 | Ga0207651_10169104 | Ga0207651_101691043 | 363 |
| 329 | 3300025981 | Ga0207640_10119935 | Ga0207640_101199352 | 363 |
| 330 | 3300025986 | Ga0207658_10000004 | Ga0207658_1000000420 | 363 |
| 331 | 3300026035 | Ga0207703_10041348 | Ga0207703_100413483 | 363 |
| 332 | 3300026067 | Ga0207678_10049471 | Ga0207678_100494715 | 363 |
| 333 | 3300026078 | Ga0207702_10004678 | Ga0207702_100046786 | 363 |
| 334 | 3300026088 | Ga0207641_10024972 | Ga0207641_100249722 | 363 |
| 335 | 3300026095 | Ga0207676_10000003 | Ga0207676_10000003523 | 363 |
| 336 | 3300026116 | Ga0207674_10015586 | Ga0207674_100155866 | 363 |
| 337 | 3300026142 | Ga0207698_10033839 | Ga0207698_100338393 | 363 |
| 338 | 3300027111 | Ga0209281_1000114 | Ga0209281_100011428 | 363 |
| 339 | 3300027312 | Ga0209371_1000026 | Ga0209371_1000026298 | 363 |
| 340 | 3300027312 | Ga0209371_1000050 | Ga0209371_100005085 | 363 |
| 341 | 3300027312 | Ga0209371_1001597 | Ga0209371_100159715 | 363 |
| 342 | 3300027312 | Ga0209371_1002855 | Ga0209371_10028557 | 363 |
| 343 | 3300027312 | Ga0209371_1014433 | Ga0209371_10144332 | 363 |
| 344 | 3300028379 | Ga0268266_10041769 | Ga0268266_100417692 | 363 |
| 345 | 3300028380 | Ga0268265_10001134 | Ga0268265_100011342 | 363 |
| 346 | 3300028381 | Ga0268264_10000009 | Ga0268264_1000000994 | 363 |
| 347 | 3300030500 | Ga0268256_1000003 | Ga0268256_1000003298 | 363 |
| 348 | 3300030500 | Ga0268256_1000017 | Ga0268256_1000017498 | 363 |
| 349 | 3300030500 | Ga0268256_1002561 | Ga0268256_10025617 | 363 |
| 350 | 3300030500 | Ga0268256_1008519 | Ga0268256_10085194 | 363 |
| 351 | 3300030500 | Ga0268256_1015984 | Ga0268256_10159842 | 363 |
| 352 | 3300031852 | Ga0307410_10099345 | Ga0307410_100993452 | 363 |
| 353 | 3300032002 | Ga0307416_100132002 | Ga0307416_1001320021 | 363 |
| 354 | 3300038726 | Ga0400490_02226 | Ga0400490_02226_137_1231 | 363 |
| 355 | 3300038726 | Ga0400490_54525 | Ga0400490_54525_590_1729 | 363 |
| 356 | 3300038727 | Ga0400491_18916 | Ga0400491_18916_317_1411 | 363 |
| 357 | 3300038741 | Ga0400488_11060 | Ga0400488_11060_2602_3741 | 363 |
| 358 | 3300038741 | Ga0400488_37986 | Ga0400488_37986_700_1794 | 363 |
| 359 | 3300038741 | Ga0400488_60527 | Ga0400488_60527_205_1299 | 363 |
| 360 | 3300039062 | Ga0400483_191143 | Ga0400483_191143_3694_4788 | 363 |
| 361 | 3300039110 | Ga0400487_12331 | Ga0400487_12331_22427_23521 | 363 |
| 362 | 3300039110 | Ga0400487_29781 | Ga0400487_29781_2300_3439 | 363 |
| 363 | 3300042010 | Ga0439452_000027 | Ga0439452_000027_12078_13169 | 363 |
| 364 | 3300046501 | Ga0495607_0075961 | Ga0495607_0075961_461_1564 | 363 |
| 365 | 3300046522 | Ga0495643_0063271 | Ga0495643_0063271_815_1918 | 363 |
| 366 | 3300046542 | Ga0495597_0049130 | Ga0495597_0049130_668_1777 | 363 |
| 367 | 3300048920 | Ga0496117_0006542 | Ga0496117_0006542_862_1953 | 363 |
| 368 | 3300048921 | Ga0496118_0001553 | Ga0496118_0001553_862_1953 | 363 |
| 369 | 3300048922 | Ga0496119_0000045 | Ga0496119_0000045_49358_50449 | 363 |
| 370 | 3300048923 | Ga0496120_0038301 | Ga0496120_0038301_493_1584 | 363 |
| 371 | 3300048925 | Ga0496122_0009784 | Ga0496122_0009784_1749_2840 | 363 |
| 372 | 3300048926 | Ga0496123_0019345 | Ga0496123_0019345_1226_2317 | 363 |
| 373 | 3300048927 | Ga0496124_0000361 | Ga0496124_0000361_64946_66037 | 363 |
| 374 | 3300048928 | Ga0496125_0044541 | Ga0496125_0044541_1718_2809 | 363 |
| 375 | 3300049822 | Ga0501035_0205178 | Ga0501035_0205178_545_1657 | 363 |
| 376 | 3300049823 | Ga0501044_0025708 | Ga0501044_0025708_3701_4813 | 363 |
| 377 | 3300050491 | nmdc:mga00v17_67664_c1 | nmdc:mga00v17_67664_c1_721_1836 | 363 |
| 378 | iso_pu_bacteria | 2545555834 | 2545676768 | 363 |
| 379 | iso_pu_bacteria | 2738541277 | 2738720614 | 363 |
| 380 | iso_pu_bacteria | 2738543019 | 2739279813 | 363 |
| 381 | iso_pu_bacteria | 2904690495 | 2904690828 | 363 |
| 382 | iso_pu_bacteria | 2919709256 | 2919710466 | 363 |
| 383 | iso_pu_bacteria | 641522639 | 641642901 | 363 |
| 384 | iso_pu_bacteria | 643348564 | 643599815 | 363 |
| 385 | iso_pu_bacteria | 8054302542 | 8054304628 | 363 |
| 386 | 3300003187 | JGI25151J46595_10001308 | JGI25151J46595_100013083 | 364 |
| 387 | 3300003659 | JGI25404J52841_10000234 | JGI25404J52841_100002344 | 364 |
| 388 | 3300005336 | Ga0070680_100013453 | Ga0070680_1000134537 | 364 |
| 389 | 3300005347 | Ga0070668_100065655 | Ga0070668_1000656553 | 364 |
| 390 | 3300005535 | Ga0070684_100041105 | Ga0070684_1000411053 | 364 |
| 391 | 3300005983 | Ga0081540_1000195 | Ga0081540_100019533 | 364 |
| 392 | 3300005983 | Ga0081540_1055753 | Ga0081540_10557532 | 364 |
| 393 | 3300006178 | Ga0075367_10031602 | Ga0075367_100316022 | 364 |
| 394 | 3300006353 | Ga0075370_10034075 | Ga0075370_100340753 | 364 |
| 395 | 3300006852 | Ga0075433_10001122 | Ga0075433_1000112210 | 364 |
| 396 | 3300006871 | Ga0075434_100001564 | Ga0075434_10000156420 | 364 |
| 397 | 3300009036 | Ga0105244_10000748 | Ga0105244_1000074817 | 364 |
| 398 | 3300009094 | Ga0111539_10041772 | Ga0111539_100417726 | 364 |
| 399 | 3300010375 | Ga0105239_10406010 | Ga0105239_104060102 | 364 |
| 400 | 3300013297 | Ga0157378_10521053 | Ga0157378_105210531 | 364 |
| 401 | 3300025294 | Ga0209025_1000057 | Ga0209025_1000057181 | 364 |
| 402 | 3300025302 | Ga0207426_1016136 | Ga0207426_10161362 | 364 |
| 403 | 3300025728 | Ga0207655_1010887 | Ga0207655_10108874 | 364 |
| 404 | 3300025912 | Ga0207707_10062197 | Ga0207707_100621974 | 364 |
| 405 | 3300027866 | Ga0209813_10000121 | Ga0209813_1000012114 | 364 |
| 406 | 3300027907 | Ga0207428_10005810 | Ga0207428_100058103 | 364 |
| 407 | 3300031239 | Ga0265328_10023002 | Ga0265328_100230022 | 364 |
| 408 | 3300031240 | Ga0265320_10034312 | Ga0265320_100343122 | 364 |
| 409 | 3300031247 | Ga0265340_10021885 | Ga0265340_100218853 | 364 |
| 410 | 3300032002 | Ga0307416_100159804 | Ga0307416_1001598042 | 364 |
| 411 | 3300035092 | Ga0373952_0004895 | Ga0373952_0004895_817_1968 | 364 |
| 412 | 3300035092 | Ga0373952_0023074 | Ga0373952_0023074_46_1179 | 364 |
| 413 | 3300035114 | Ga0373939_0008047 | Ga0373939_0008047_269_1402 | 364 |
| 414 | 3300035115 | Ga0373941_0041413 | Ga0373941_0041413_259_1368 | 364 |
| 415 | 3300035121 | Ga0373960_0011866 | Ga0373960_0011866_253_1386 | 364 |
| 416 | 3300035691 | Ga0373931_0005034 | Ga0373931_0005034_163_1296 | 364 |
| 417 | 3300038735 | Ga0400485_06758 | Ga0400485_06758_427_1524 | 364 |
| 418 | 3300038741 | Ga0400488_47107 | Ga0400488_47107_3377_4477 | 364 |
| 419 | 3300038742 | Ga0400486_07908 | Ga0400486_07908_7000_8097 | 364 |
| 420 | 3300038742 | Ga0400486_14585 | Ga0400486_14585_49_1146 | 364 |
| 421 | 3300039062 | Ga0400483_265139 | Ga0400483_265139_1181_2281 | 364 |
| 422 | 3300039110 | Ga0400487_00901 | Ga0400487_00901_1358_2455 | 364 |
| 423 | 3300039447 | Ga0436361_0639952 | Ga0436361_0639952_876_1982 | 364 |
| 424 | 3300042876 | Ga0451577_0079877 | Ga0451577_0079877_501_1622 | 364 |
| 425 | 3300046458 | Ga0495591_003951 | Ga0495591_003951_944_2038 | 364 |
| 426 | 3300046462 | Ga0495651_0031279 | Ga0495651_0031279_998_2128 | 364 |
| 427 | 3300046463 | Ga0495653_0052995 | Ga0495653_0052995_1449_2579 | 364 |
| 428 | 3300046472 | Ga0495580_0000875 | Ga0495580_0000875_4864_5994 | 364 |
| 429 | 3300046474 | Ga0495605_0068699 | Ga0495605_0068699_443_1537 | 364 |
| 430 | 3300046507 | Ga0495606_0000165 | Ga0495606_0000165_573_1670 | 364 |
| 431 | 3300046512 | Ga0495610_0013250 | Ga0495610_0013250_1576_2676 | 364 |
| 432 | 3300046517 | Ga0495630_0044652 | Ga0495630_0044652_1633_2763 | 364 |
| 433 | 3300046524 | Ga0495648_0000775 | Ga0495648_0000775_1421_2536 | 364 |
| 434 | 3300046524 | Ga0495648_0060719 | Ga0495648_0060719_214_1329 | 364 |
| 435 | 3300046526 | Ga0495666_0007275 | Ga0495666_0007275_3386_4516 | 364 |
| 436 | 3300046542 | Ga0495597_0001190 | Ga0495597_0001190_6563_7663 | 364 |
| 437 | 3300046558 | Ga0495633_0000065 | Ga0495633_0000065_121285_122385 | 364 |
| 438 | 3300046660 | Ga0495625_0005161 | Ga0495625_0005161_3352_4452 | 364 |
| 439 | 3300046678 | Ga0495599_0091824 | Ga0495599_0091824_653_1783 | 364 |
| 440 | 3300046680 | Ga0495646_0061535 | Ga0495646_0061535_88_1218 | 364 |
| 441 | 3300047317 | Ga0495604_0048640 | Ga0495604_0048640_463_1593 | 364 |
| 442 | 3300047322 | Ga0495680_0012454 | Ga0495680_0012454_4665_5795 | 364 |
| 443 | 3300047444 | Ga0495675_0037133 | Ga0495675_0037133_1807_2937 | 364 |
| 444 | 3300047446 | Ga0495679_003908 | Ga0495679_003908_3455_4570 | 364 |
| 445 | 3300048088 | Ga0495602_0137293 | Ga0495602_0137293_705_1835 | 364 |
| 446 | 3300048909 | Ga0496106_0000003 | Ga0496106_0000003_191241_192434 | 364 |
| 447 | 3300048924 | Ga0496121_0022502 | Ga0496121_0022502_1922_3115 | 364 |
| 448 | 3300048929 | Ga0496126_0000455 | Ga0496126_0000455_48365_49495 | 364 |
| 449 | 3300049569 | Ga0501032_0068908 | Ga0501032_0068908_282_1403 | 364 |
| 450 | 3300049581 | Ga0501047_0101366 | Ga0501047_0101366_107_1228 | 364 |
| 451 | 3300049679 | Ga0501249_000706 | Ga0501249_000706_3949_5112 | 364 |
| 452 | 3300049742 | Ga0501080_0048161 | Ga0501080_0048161_1146_2267 | 364 |
| 453 | 3300049766 | Ga0501269_000265 | Ga0501269_000265_10070_11233 | 364 |
| 454 | 3300049823 | Ga0501044_0150185 | Ga0501044_0150185_504_1691 | 364 |
| 455 | 3300050491 | nmdc:mga00v17_8062_c1 | nmdc:mga00v17_8062_c1_947_2059 | 364 |
| 456 | 3300050492 | nmdc:mga0yw44_15676_c1 | nmdc:mga0yw44_15676_c1_1834_2946 | 364 |
| 457 | 3300050494 | nmdc:mga06z11_36_c1 | nmdc:mga06z11_36_c1_54730_55842 | 364 |
| 458 | 3300050495 | nmdc:mga04h51_119_c1 | nmdc:mga04h51_119_c1_16588_17700 | 364 |
| 459 | 3300050512 | nmdc:mga0n895_7653_c1 | nmdc:mga0n895_7653_c1_67_1200 | 364 |
| 460 | 3300050515 | nmdc:mga0a205_5198_c1 | nmdc:mga0a205_5198_c1_4238_5371 | 364 |
| 461 | 3300053125 | Ga0500618_000240 | Ga0500618_000240_3570_4685 | 364 |
| 462 | 2162886007 | SwRhRL2b_contig_179494 | SwRhRL2b_0813.00009960 | 365 |
| 463 | 2209111006 | 2214772996 | 2213793064 | 365 |
| 464 | 3300000042 | ARSoilYngRDRAFT_c00480 | ARSoilYngRDRAFT_004802 | 365 |
| 465 | 3300000043 | ARcpr5yngRDRAFT_c000101 | ARcpr5yngRDRAFT_0001014 | 365 |
| 466 | 3300000044 | ARSoilOldRDRAFT_c000111 | ARSoilOldRDRAFT_0001115 | 365 |
| 467 | 3300000652 | ARCol0yngRDRAFT_1000021 | ARCol0yngRDRAFT_100002121 | 365 |
| 468 | 3300001976 | JGI24752J21851_1000948 | JGI24752J21851_10009485 | 365 |
| 469 | 3300001977 | JGI24746J21847_1000005 | JGI24746J21847_100000514 | 365 |
| 470 | 3300001989 | JGI24739J22299_10004819 | JGI24739J22299_100048196 | 365 |
| 471 | 3300002070 | JGI24750J21931_1000059 | JGI24750J21931_100005911 | 365 |
| 472 | 3300002074 | JGI24748J21848_1000644 | JGI24748J21848_10006443 | 365 |
| 473 | 3300002075 | JGI24738J21930_10000278 | JGI24738J21930_1000027811 | 365 |
| 474 | 3300002077 | JGI24744J21845_10000309 | JGI24744J21845_100003097 | 365 |
| 475 | 3300002126 | JGI24035J26624_1000329 | JGI24035J26624_10003294 | 365 |
| 476 | 3300002155 | JGI24033J26618_1003778 | JGI24033J26618_10037782 | 365 |
| 477 | 3300002244 | JGI24742J22300_10000270 | JGI24742J22300_100002706 | 365 |
| 478 | 3300002459 | JGI24751J29686_10009481 | JGI24751J29686_100094812 | 365 |
| 479 | 3300002737 | JGI25162J39368_1000084 | JGI25162J39368_100008449 | 365 |
| 480 | 3300002737 | JGI25162J39368_1004064 | JGI25162J39368_10040642 | 365 |
| 481 | 3300002771 | JGI25163J39215_1000245 | JGI25163J39215_10002458 | 365 |
| 482 | 3300002772 | JGI25164J39214_1000062 | JGI25164J39214_100006261 | 365 |
| 483 | 3300002773 | JGI25152J39213_1004385 | JGI25152J39213_10043852 | 365 |
| 484 | 3300003187 | JGI25151J46595_10009962 | JGI25151J46595_100099622 | 365 |
| 485 | 3300003187 | JGI25151J46595_10022380 | JGI25151J46595_100223802 | 365 |
| 486 | 3300003215 | JGI25153J46596_10009634 | JGI25153J46596_100096342 | 365 |
| 487 | 3300003320 | rootH2_10196814 | rootH2_101968143 | 365 |
| 488 | 3300003354 | JGI25160J50197_1007031 | JGI25160J50197_10070312 | 365 |
| 489 | 3300003751 | Ga0055538_1000060 | Ga0055538_100006049 | 365 |
| 490 | 3300003752 | Ga0055539_1000092 | Ga0055539_100009249 | 365 |
| 491 | 3300003756 | Ga0055533_1000101 | Ga0055533_100010149 | 365 |
| 492 | 3300003759 | Ga0055525_1000134 | Ga0055525_100013449 | 365 |
| 493 | 3300003761 | Ga0055535_1000069 | Ga0055535_100006932 | 365 |
| 494 | 3300003762 | Ga0055542_1000084 | Ga0055542_100008443 | 365 |
| 495 | 3300003771 | Ga0055526_1008447 | Ga0055526_10084475 | 365 |
| 496 | 3300003773 | Ga0055537_1003177 | Ga0055537_10031775 | 365 |
| 497 | 3300003773 | Ga0055537_1005002 | Ga0055537_10050021 | 365 |
| 498 | 3300003775 | Ga0055524_1006091 | Ga0055524_10060915 | 365 |
| 499 | 3300003775 | Ga0055524_1007575 | Ga0055524_10075751 | 365 |
| 500 | 3300003784 | Ga0055534_1003969 | Ga0055534_10039692 | 365 |
| 501 | 3300003784 | Ga0055534_1005085 | Ga0055534_10050851 | 365 |
| 502 | 3300003790 | Ga0055528_1006817 | Ga0055528_10068175 | 365 |
| 503 | 3300003792 | Ga0055540_1008808 | Ga0055540_10088083 | 365 |
| 504 | 3300003794 | Ga0055531_10002481 | Ga0055531_100024816 | 365 |
| 505 | 3300003794 | Ga0055531_10015966 | Ga0055531_100159662 | 365 |
| 506 | 3300003841 | Ga0055541_1000062 | Ga0055541_100006249 | 365 |
| 507 | 3300003856 | Ga0058692_1000055 | Ga0058692_100005517 | 365 |
| 508 | 3300003911 | JGI25405J52794_10005502 | JGI25405J52794_100055022 | 365 |
| 509 | 3300004625 | Ga0055543_1002903 | Ga0055543_10029032 | 365 |
| 510 | 3300005262 | Ga0065165_1007537 | Ga0065165_10075375 | 365 |
| 511 | 3300005289 | Ga0065704_10000664 | Ga0065704_1000066449 | 365 |
| 512 | 3300005290 | Ga0065712_10071326 | Ga0065712_100713262 | 365 |
| 513 | 3300005293 | Ga0065715_10000270 | Ga0065715_100002707 | 365 |
| 514 | 3300005327 | Ga0070658_10006794 | Ga0070658_100067949 | 365 |
| 515 | 3300005327 | Ga0070658_10072861 | Ga0070658_100728612 | 365 |
| 516 | 3300005328 | Ga0070676_10000194 | Ga0070676_1000019410 | 365 |
| 517 | 3300005329 | Ga0070683_100001461 | Ga0070683_10000146115 | 365 |
| 518 | 3300005329 | Ga0070683_100103922 | Ga0070683_1001039222 | 365 |
| 519 | 3300005330 | Ga0070690_100002052 | Ga0070690_1000020527 | 365 |
| 520 | 3300005330 | Ga0070690_100018916 | Ga0070690_1000189163 | 365 |
| 521 | 3300005331 | Ga0070670_100023270 | Ga0070670_1000232702 | 365 |
| 522 | 3300005333 | Ga0070677_10000223 | Ga0070677_1000022315 | 365 |
| 523 | 3300005334 | Ga0068869_100000910 | Ga0068869_10000091014 | 365 |
| 524 | 3300005335 | Ga0070666_10020841 | Ga0070666_100208414 | 365 |
| 525 | 3300005335 | Ga0070666_10278561 | Ga0070666_102785611 | 365 |
| 526 | 3300005336 | Ga0070680_100011303 | Ga0070680_1000113038 | 365 |
| 527 | 3300005336 | Ga0070680_100062133 | Ga0070680_1000621334 | 365 |
| 528 | 3300005336 | Ga0070680_100090091 | Ga0070680_1000900912 | 365 |
| 529 | 3300005336 | Ga0070680_100126842 | Ga0070680_1001268422 | 365 |
| 530 | 3300005337 | Ga0070682_100000411 | Ga0070682_10000041122 | 365 |
| 531 | 3300005337 | Ga0070682_100044608 | Ga0070682_1000446083 | 365 |
| 532 | 3300005338 | Ga0068868_100002658 | Ga0068868_10000265810 | 365 |
| 533 | 3300005339 | Ga0070660_100004007 | Ga0070660_1000040073 | 365 |
| 534 | 3300005339 | Ga0070660_100068030 | Ga0070660_1000680303 | 365 |
| 535 | 3300005339 | Ga0070660_100093718 | Ga0070660_1000937182 | 365 |
| 536 | 3300005339 | Ga0070660_100123565 | Ga0070660_1001235652 | 365 |
| 537 | 3300005340 | Ga0070689_100001606 | Ga0070689_1000016067 | 365 |
| 538 | 3300005341 | Ga0070691_10001869 | Ga0070691_1000186910 | 365 |
| 539 | 3300005341 | Ga0070691_10025121 | Ga0070691_100251213 | 365 |
| 540 | 3300005343 | Ga0070687_100000727 | Ga0070687_1000007274 | 365 |
| 541 | 3300005344 | Ga0070661_100001236 | Ga0070661_1000012369 | 365 |
| 542 | 3300005345 | Ga0070692_10002603 | Ga0070692_100026034 | 365 |
| 543 | 3300005347 | Ga0070668_100002586 | Ga0070668_1000025867 | 365 |
| 544 | 3300005347 | Ga0070668_100051079 | Ga0070668_1000510794 | 365 |
| 545 | 3300005347 | Ga0070668_100051503 | Ga0070668_1000515032 | 365 |
| 546 | 3300005353 | Ga0070669_100002152 | Ga0070669_10000215210 | 365 |
| 547 | 3300005354 | Ga0070675_100002725 | Ga0070675_1000027259 | 365 |
| 548 | 3300005354 | Ga0070675_100016211 | Ga0070675_1000162114 | 365 |
| 549 | 3300005355 | Ga0070671_100000400 | Ga0070671_10000040013 | 365 |
| 550 | 3300005355 | Ga0070671_100012085 | Ga0070671_1000120855 | 365 |
| 551 | 3300005355 | Ga0070671_100153813 | Ga0070671_1001538132 | 365 |
| 552 | 3300005355 | Ga0070671_100165420 | Ga0070671_1001654202 | 365 |
| 553 | 3300005356 | Ga0070674_100001765 | Ga0070674_1000017654 | 365 |
| 554 | 3300005356 | Ga0070674_100086083 | Ga0070674_1000860832 | 365 |
| 555 | 3300005364 | Ga0070673_100000169 | Ga0070673_10000016921 | 365 |
| 556 | 3300005364 | Ga0070673_100116828 | Ga0070673_1001168281 | 365 |
| 557 | 3300005365 | Ga0070688_100000757 | Ga0070688_10000075712 | 365 |
| 558 | 3300005365 | Ga0070688_100002817 | Ga0070688_1000028178 | 365 |
| 559 | 3300005365 | Ga0070688_100003731 | Ga0070688_1000037314 | 365 |
| 560 | 3300005366 | Ga0070659_100001586 | Ga0070659_1000015867 | 365 |
| 561 | 3300005366 | Ga0070659_100061921 | Ga0070659_1000619213 | 365 |
| 562 | 3300005367 | Ga0070667_100001596 | Ga0070667_10000159610 | 365 |
| 563 | 3300005367 | Ga0070667_100022988 | Ga0070667_1000229886 | 365 |
| 564 | 3300005367 | Ga0070667_100027904 | Ga0070667_1000279045 | 365 |
| 565 | 3300005406 | Ga0070703_10005976 | Ga0070703_100059764 | 365 |
| 566 | 3300005434 | Ga0070709_10215533 | Ga0070709_102155332 | 365 |
| 567 | 3300005435 | Ga0070714_100019824 | Ga0070714_1000198243 | 365 |
| 568 | 3300005436 | Ga0070713_100014412 | Ga0070713_1000144126 | 365 |
| 569 | 3300005436 | Ga0070713_100040260 | Ga0070713_1000402602 | 365 |
| 570 | 3300005437 | Ga0070710_10021998 | Ga0070710_100219984 | 365 |
| 571 | 3300005438 | Ga0070701_10000774 | Ga0070701_100007744 | 365 |
| 572 | 3300005440 | Ga0070705_100001954 | Ga0070705_1000019544 | 365 |
| 573 | 3300005440 | Ga0070705_100262542 | Ga0070705_1002625421 | 365 |
| 574 | 3300005441 | Ga0070700_100001821 | Ga0070700_1000018217 | 365 |
| 575 | 3300005444 | Ga0070694_100001416 | Ga0070694_10000141610 | 365 |
| 576 | 3300005455 | Ga0070663_100000593 | Ga0070663_10000059313 | 365 |
| 577 | 3300005456 | Ga0070678_100000301 | Ga0070678_1000003014 | 365 |
| 578 | 3300005456 | Ga0070678_100004800 | Ga0070678_1000048002 | 365 |
| 579 | 3300005457 | Ga0070662_100001940 | Ga0070662_1000019409 | 365 |
| 580 | 3300005457 | Ga0070662_100005709 | Ga0070662_1000057094 | 365 |
| 581 | 3300005458 | Ga0070681_10014859 | Ga0070681_100148594 | 365 |
| 582 | 3300005458 | Ga0070681_10024101 | Ga0070681_100241015 | 365 |
| 583 | 3300005458 | Ga0070681_10030328 | Ga0070681_100303287 | 365 |
| 584 | 3300005458 | Ga0070681_10051355 | Ga0070681_100513554 | 365 |
| 585 | 3300005458 | Ga0070681_10339905 | Ga0070681_103399051 | 365 |
| 586 | 3300005459 | Ga0068867_100002072 | Ga0068867_10000207210 | 365 |
| 587 | 3300005459 | Ga0068867_100042681 | Ga0068867_1000426813 | 365 |
| 588 | 3300005466 | Ga0070685_10008779 | Ga0070685_100087796 | 365 |
| 589 | 3300005471 | Ga0070698_100223529 | Ga0070698_1002235293 | 365 |
| 590 | 3300005530 | Ga0070679_100012097 | Ga0070679_1000120972 | 365 |
| 591 | 3300005530 | Ga0070679_100022903 | Ga0070679_1000229036 | 365 |
| 592 | 3300005530 | Ga0070679_100068424 | Ga0070679_1000684243 | 365 |
| 593 | 3300005530 | Ga0070679_100093531 | Ga0070679_1000935313 | 365 |
| 594 | 3300005530 | Ga0070679_100300950 | Ga0070679_1003009502 | 365 |
| 595 | 3300005535 | Ga0070684_100005903 | Ga0070684_10000590310 | 365 |
| 596 | 3300005535 | Ga0070684_100018107 | Ga0070684_1000181073 | 365 |
| 597 | 3300005535 | Ga0070684_100361084 | Ga0070684_1003610842 | 365 |
| 598 | 3300005536 | Ga0070697_100130535 | Ga0070697_1001305352 | 365 |
| 599 | 3300005539 | Ga0068853_100009652 | Ga0068853_1000096527 | 365 |
| 600 | 3300005543 | Ga0070672_100000611 | Ga0070672_10000061110 | 365 |
| 601 | 3300005544 | Ga0070686_100001276 | Ga0070686_10000127610 | 365 |
| 602 | 3300005545 | Ga0070695_100002233 | Ga0070695_1000022337 | 365 |
| 603 | 3300005545 | Ga0070695_100002508 | Ga0070695_10000250810 | 365 |
| 604 | 3300005546 | Ga0070696_100038028 | Ga0070696_1000380284 | 365 |
| 605 | 3300005546 | Ga0070696_100087462 | Ga0070696_1000874622 | 365 |
| 606 | 3300005547 | Ga0070693_100001538 | Ga0070693_1000015387 | 365 |
| 607 | 3300005548 | Ga0070665_100031263 | Ga0070665_1000312633 | 365 |
| 608 | 3300005548 | Ga0070665_100146475 | Ga0070665_1001464753 | 365 |
| 609 | 3300005549 | Ga0070704_100001853 | Ga0070704_1000018535 | 365 |
| 610 | 3300005563 | Ga0068855_100002375 | Ga0068855_10000237513 | 365 |
| 611 | 3300005563 | Ga0068855_100011650 | Ga0068855_10001165010 | 365 |
| 612 | 3300005563 | Ga0068855_100074018 | Ga0068855_1000740183 | 365 |
| 613 | 3300005563 | Ga0068855_100147182 | Ga0068855_1001471821 | 365 |
| 614 | 3300005564 | Ga0070664_100024208 | Ga0070664_1000242084 | 365 |
| 615 | 3300005564 | Ga0070664_100105013 | Ga0070664_1001050132 | 365 |
| 616 | 3300005564 | Ga0070664_100119986 | Ga0070664_1001199863 | 365 |
| 617 | 3300005577 | Ga0068857_100003420 | Ga0068857_1000034204 | 365 |
| 618 | 3300005577 | Ga0068857_100185896 | Ga0068857_1001858961 | 365 |
| 619 | 3300005578 | Ga0068854_100001082 | Ga0068854_10000108214 | 365 |
| 620 | 3300005578 | Ga0068854_100175138 | Ga0068854_1001751381 | 365 |
| 621 | 3300005614 | Ga0068856_100006654 | Ga0068856_10000665411 | 365 |
| 622 | 3300005614 | Ga0068856_100157768 | Ga0068856_1001577682 | 365 |
| 623 | 3300005614 | Ga0068856_100226520 | Ga0068856_1002265201 | 365 |
| 624 | 3300005614 | Ga0068856_100259546 | Ga0068856_1002595462 | 365 |
| 625 | 3300005616 | Ga0068852_100003054 | Ga0068852_1000030549 | 365 |
| 626 | 3300005616 | Ga0068852_100015790 | Ga0068852_1000157906 | 365 |
| 627 | 3300005616 | Ga0068852_100058996 | Ga0068852_1000589961 | 365 |
| 628 | 3300005617 | Ga0068859_100006509 | Ga0068859_10000650911 | 365 |
| 629 | 3300005617 | Ga0068859_100164577 | Ga0068859_1001645771 | 365 |
| 630 | 3300005618 | Ga0068864_100001244 | Ga0068864_10000124415 | 365 |
| 631 | 3300005618 | Ga0068864_100024235 | Ga0068864_1000242356 | 365 |
| 632 | 3300005718 | Ga0068866_10000500 | Ga0068866_1000050014 | 365 |
| 633 | 3300005719 | Ga0068861_100003449 | Ga0068861_10000344910 | 365 |
| 634 | 3300005834 | Ga0068851_10004471 | Ga0068851_100044715 | 365 |
| 635 | 3300005840 | Ga0068870_10000015 | Ga0068870_1000001559 | 365 |
| 636 | 3300005841 | Ga0068863_100003914 | Ga0068863_1000039147 | 365 |
| 637 | 3300005841 | Ga0068863_100043836 | Ga0068863_1000438364 | 365 |
| 638 | 3300005842 | Ga0068858_100002760 | Ga0068858_10000276015 | 365 |
| 639 | 3300005842 | Ga0068858_100004772 | Ga0068858_1000047729 | 365 |
| 640 | 3300005842 | Ga0068858_100113326 | Ga0068858_1001133262 | 365 |
| 641 | 3300005842 | Ga0068858_100317014 | Ga0068858_1003170142 | 365 |
| 642 | 3300005843 | Ga0068860_100003116 | Ga0068860_1000031167 | 365 |
| 643 | 3300005844 | Ga0068862_100003903 | Ga0068862_10000390310 | 365 |
| 644 | 3300005844 | Ga0068862_100176586 | Ga0068862_1001765863 | 365 |
| 645 | 3300005937 | Ga0081455_10000081 | Ga0081455_1000008181 | 365 |
| 646 | 3300006028 | Ga0070717_10014273 | Ga0070717_100142732 | 365 |
| 647 | 3300006163 | Ga0070715_10014818 | Ga0070715_100148182 | 365 |
| 648 | 3300006175 | Ga0070712_100016368 | Ga0070712_1000163685 | 365 |
| 649 | 3300006175 | Ga0070712_100126903 | Ga0070712_1001269032 | 365 |
| 650 | 3300006178 | Ga0075367_10022567 | Ga0075367_100225674 | 365 |
| 651 | 3300006237 | Ga0097621_100001400 | Ga0097621_10000140012 | 365 |
| 652 | 3300006237 | Ga0097621_100075291 | Ga0097621_1000752913 | 365 |
| 653 | 3300006358 | Ga0068871_100000359 | Ga0068871_10000035914 | 365 |
| 654 | 3300006358 | Ga0068871_100003972 | Ga0068871_1000039726 | 365 |
| 655 | 3300006852 | Ga0075433_10009420 | Ga0075433_100094207 | 365 |
| 656 | 3300006871 | Ga0075434_100000760 | Ga0075434_10000076014 | 365 |
| 657 | 3300006871 | Ga0075434_100058075 | Ga0075434_1000580753 | 365 |
| 658 | 3300006881 | Ga0068865_100000439 | Ga0068865_1000004399 | 365 |
| 659 | 3300006881 | Ga0068865_100019171 | Ga0068865_1000191716 | 365 |
| 660 | 3300006914 | Ga0075436_100139744 | Ga0075436_1001397442 | 365 |
| 661 | 3300006931 | Ga0097620_100006509 | Ga0097620_10000650911 | 365 |
| 662 | 3300006931 | Ga0097620_100164584 | Ga0097620_1001645841 | 365 |
| 663 | 3300009011 | Ga0105251_10025058 | Ga0105251_100250581 | 365 |
| 664 | 3300009036 | Ga0105244_10000418 | Ga0105244_1000041823 | 365 |
| 665 | 3300009036 | Ga0105244_10011426 | Ga0105244_100114262 | 365 |
| 666 | 3300009092 | Ga0105250_10000039 | Ga0105250_1000003949 | 365 |
| 667 | 3300009092 | Ga0105250_10000743 | Ga0105250_1000074314 | 365 |
| 668 | 3300009093 | Ga0105240_10006246 | Ga0105240_1000624610 | 365 |
| 669 | 3300009093 | Ga0105240_10514829 | Ga0105240_105148291 | 365 |
| 670 | 3300009094 | Ga0111539_10007413 | Ga0111539_100074137 | 365 |
| 671 | 3300009098 | Ga0105245_10001227 | Ga0105245_100012277 | 365 |
| 672 | 3300009098 | Ga0105245_10145284 | Ga0105245_101452841 | 365 |
| 673 | 3300009101 | Ga0105247_10007195 | Ga0105247_100071956 | 365 |
| 674 | 3300009101 | Ga0105247_10056412 | Ga0105247_100564121 | 365 |
| 675 | 3300009148 | Ga0105243_10001341 | Ga0105243_1000134110 | 365 |
| 676 | 3300009148 | Ga0105243_10006861 | Ga0105243_100068615 | 365 |
| 677 | 3300009148 | Ga0105243_10055695 | Ga0105243_100556952 | 365 |
| 678 | 3300009176 | Ga0105242_10000411 | Ga0105242_1000041129 | 365 |
| 679 | 3300009176 | Ga0105242_10023552 | Ga0105242_100235524 | 365 |
| 680 | 3300009177 | Ga0105248_10010917 | Ga0105248_100109175 | 365 |
| 681 | 3300009177 | Ga0105248_10341972 | Ga0105248_103419721 | 365 |
| 682 | 3300009177 | Ga0105248_10344196 | Ga0105248_103441961 | 365 |
| 683 | 3300009545 | Ga0105237_10012158 | Ga0105237_100121586 | 365 |
| 684 | 3300009545 | Ga0105237_10016890 | Ga0105237_100168903 | 365 |
| 685 | 3300009545 | Ga0105237_10269459 | Ga0105237_102694592 | 365 |
| 686 | 3300009551 | Ga0105238_10032313 | Ga0105238_100323133 | 365 |
| 687 | 3300009551 | Ga0105238_10106443 | Ga0105238_101064432 | 365 |
| 688 | 3300009553 | Ga0105249_10003261 | Ga0105249_100032617 | 365 |
| 689 | 3300009553 | Ga0105249_10337878 | Ga0105249_103378782 | 365 |
| 690 | 3300010375 | Ga0105239_10006472 | Ga0105239_100064727 | 365 |
| 691 | 3300011119 | Ga0105246_10000384 | Ga0105246_1000038411 | 365 |
| 692 | 3300011119 | Ga0105246_10097438 | Ga0105246_100974382 | 365 |
| 693 | 3300013100 | Ga0157373_10166355 | Ga0157373_101663552 | 365 |
| 694 | 3300013102 | Ga0157371_10000101 | Ga0157371_10000101140 | 365 |
| 695 | 3300013102 | Ga0157371_10009572 | Ga0157371_100095728 | 365 |
| 696 | 3300013104 | Ga0157370_10209952 | Ga0157370_102099521 | 365 |
| 697 | 3300013105 | Ga0157369_10090925 | Ga0157369_100909253 | 365 |
| 698 | 3300013297 | Ga0157378_10005961 | Ga0157378_100059614 | 365 |
| 699 | 3300013306 | Ga0163162_10001455 | Ga0163162_1000145510 | 365 |
| 700 | 3300013307 | Ga0157372_10059126 | Ga0157372_100591261 | 365 |
| 701 | 3300013307 | Ga0157372_10127126 | Ga0157372_101271262 | 365 |
| 702 | 3300013308 | Ga0157375_10005043 | Ga0157375_100050438 | 365 |
| 703 | 3300013308 | Ga0157375_10032741 | Ga0157375_100327413 | 365 |
| 704 | 3300014325 | Ga0163163_10170586 | Ga0163163_101705863 | 365 |
| 705 | 3300014325 | Ga0163163_10242690 | Ga0163163_102426901 | 365 |
| 706 | 3300014326 | Ga0157380_10003014 | Ga0157380_100030144 | 365 |
| 707 | 3300014745 | Ga0157377_10000224 | Ga0157377_1000022422 | 365 |
| 708 | 3300014968 | Ga0157379_10002183 | Ga0157379_1000218312 | 365 |
| 709 | 3300014968 | Ga0157379_10024465 | Ga0157379_100244655 | 365 |
| 710 | 3300014968 | Ga0157379_10063592 | Ga0157379_100635924 | 365 |
| 711 | 3300014969 | Ga0157376_10001879 | Ga0157376_1000187912 | 365 |
| 712 | 3300017792 | Ga0163161_10000471 | Ga0163161_1000047124 | 365 |
| 713 | 3300017792 | Ga0163161_10018737 | Ga0163161_100187375 | 365 |
| 714 | 3300017792 | Ga0163161_10035790 | Ga0163161_100357904 | 365 |
| 715 | 3300020070 | Ga0206356_10495441 | Ga0206356_104954413 | 365 |
| 716 | 3300021361 | Ga0213872_10035362 | Ga0213872_100353622 | 365 |
| 717 | 3300021384 | Ga0213876_10048152 | Ga0213876_100481522 | 365 |
| 718 | 3300025207 | Ga0209760_100001 | Ga0209760_100001111 | 365 |
| 719 | 3300025208 | Ga0209436_106393 | Ga0209436_1063932 | 365 |
| 720 | 3300025224 | Ga0209784_100001 | Ga0209784_1000011166 | 365 |
| 721 | 3300025225 | Ga0209566_100001 | Ga0209566_1000011166 | 365 |
| 722 | 3300025226 | Ga0209674_100002 | Ga0209674_1000021166 | 365 |
| 723 | 3300025228 | Ga0209672_101496 | Ga0209672_1014964 | 365 |
| 724 | 3300025230 | Ga0209563_100008 | Ga0209563_1000081167 | 365 |
| 725 | 3300025231 | Ga0207427_100002 | Ga0207427_100002111 | 365 |
| 726 | 3300025233 | Ga0209437_100007 | Ga0209437_100007619 | 365 |
| 727 | 3300025242 | Ga0209258_100093 | Ga0209258_100093176 | 365 |
| 728 | 3300025245 | Ga0207425_1002336 | Ga0207425_10023364 | 365 |
| 729 | 3300025253 | Ga0209677_100004 | Ga0209677_1000041167 | 365 |
| 730 | 3300025254 | Ga0209148_1000007 | Ga0209148_10000071143 | 365 |
| 731 | 3300025258 | Ga0209129_1000147 | Ga0209129_100014736 | 365 |
| 732 | 3300025261 | Ga0209233_1005667 | Ga0209233_10056671 | 365 |
| 733 | 3300025263 | Ga0209565_1000109 | Ga0209565_10001091 | 365 |
| 734 | 3300025263 | Ga0209565_1000534 | Ga0209565_100053413 | 365 |
| 735 | 3300025271 | Ga0207666_1000074 | Ga0207666_100007410 | 365 |
| 736 | 3300025271 | Ga0207666_1000672 | Ga0207666_10006725 | 365 |
| 737 | 3300025273 | Ga0209673_1010944 | Ga0209673_10109442 | 365 |
| 738 | 3300025273 | Ga0209673_1045579 | Ga0209673_10455791 | 365 |
| 739 | 3300025284 | Ga0209130_1000916 | Ga0209130_100091616 | 365 |
| 740 | 3300025290 | Ga0207673_1000705 | Ga0207673_10007052 | 365 |
| 741 | 3300025291 | Ga0209675_1000379 | Ga0209675_100037921 | 365 |
| 742 | 3300025291 | Ga0209675_1002300 | Ga0209675_10023001 | 365 |
| 743 | 3300025294 | Ga0209025_1000194 | Ga0209025_1000194128 | 365 |
| 744 | 3300025294 | Ga0209025_1000307 | Ga0209025_100030781 | 365 |
| 745 | 3300025294 | Ga0209025_1001123 | Ga0209025_10011239 | 365 |
| 746 | 3300025295 | Ga0209564_1000327 | Ga0209564_100032716 | 365 |
| 747 | 3300025295 | Ga0209564_1003792 | Ga0209564_10037921 | 365 |
| 748 | 3300025297 | Ga0209758_1000199 | Ga0209758_100019955 | 365 |
| 749 | 3300025297 | Ga0209758_1029495 | Ga0209758_10294952 | 365 |
| 750 | 3300025299 | Ga0209256_1000151 | Ga0209256_10001519 | 365 |
| 751 | 3300025299 | Ga0209256_1002908 | Ga0209256_10029081 | 365 |
| 752 | 3300025302 | Ga0207426_1000049 | Ga0207426_1000049248 | 365 |
| 753 | 3300025303 | Ga0209051_1000301 | Ga0209051_100030146 | 365 |
| 754 | 3300025303 | Ga0209051_1000354 | Ga0209051_100035410 | 365 |
| 755 | 3300025303 | Ga0209051_1009720 | Ga0209051_10097205 | 365 |
| 756 | 3300025304 | Ga0209257_1000022 | Ga0209257_1000022551 | 365 |
| 757 | 3300025315 | Ga0207697_10001234 | Ga0207697_100012347 | 365 |
| 758 | 3300025321 | Ga0207656_10008685 | Ga0207656_100086854 | 365 |
| 759 | 3300025711 | Ga0207696_1000026 | Ga0207696_1000026361 | 365 |
| 760 | 3300025711 | Ga0207696_1000625 | Ga0207696_10006257 | 365 |
| 761 | 3300025728 | Ga0207655_1000894 | Ga0207655_100089424 | 365 |
| 762 | 3300025728 | Ga0207655_1001329 | Ga0207655_10013299 | 365 |
| 763 | 3300025885 | Ga0207653_10010869 | Ga0207653_100108693 | 365 |
| 764 | 3300025893 | Ga0207682_10000169 | Ga0207682_1000016915 | 365 |
| 765 | 3300025899 | Ga0207642_10001573 | Ga0207642_100015733 | 365 |
| 766 | 3300025900 | Ga0207710_10002213 | Ga0207710_1000221310 | 365 |
| 767 | 3300025900 | Ga0207710_10003166 | Ga0207710_100031664 | 365 |
| 768 | 3300025901 | Ga0207688_10000157 | Ga0207688_1000015711 | 365 |
| 769 | 3300025903 | Ga0207680_10004108 | Ga0207680_100041083 | 365 |
| 770 | 3300025903 | Ga0207680_10018417 | Ga0207680_100184174 | 365 |
| 771 | 3300025904 | Ga0207647_10001770 | Ga0207647_1000177010 | 365 |
| 772 | 3300025906 | Ga0207699_10145371 | Ga0207699_101453712 | 365 |
| 773 | 3300025907 | Ga0207645_10003164 | Ga0207645_1000316410 | 365 |
| 774 | 3300025908 | Ga0207643_10000004 | Ga0207643_10000004103 | 365 |
| 775 | 3300025909 | Ga0207705_10212602 | Ga0207705_102126021 | 365 |
| 776 | 3300025911 | Ga0207654_10001412 | Ga0207654_100014128 | 365 |
| 777 | 3300025912 | Ga0207707_10000992 | Ga0207707_1000099218 | 365 |
| 778 | 3300025912 | Ga0207707_10027076 | Ga0207707_100270765 | 365 |
| 779 | 3300025912 | Ga0207707_10031970 | Ga0207707_100319705 | 365 |
| 780 | 3300025912 | Ga0207707_10153007 | Ga0207707_101530072 | 365 |
| 781 | 3300025913 | Ga0207695_10027245 | Ga0207695_100272456 | 365 |
| 782 | 3300025914 | Ga0207671_10012511 | Ga0207671_100125113 | 365 |
| 783 | 3300025914 | Ga0207671_10110335 | Ga0207671_101103352 | 365 |
| 784 | 3300025915 | Ga0207693_10001228 | Ga0207693_1000122816 | 365 |
| 785 | 3300025915 | Ga0207693_10082116 | Ga0207693_100821163 | 365 |
| 786 | 3300025916 | Ga0207663_10057725 | Ga0207663_100577253 | 365 |
| 787 | 3300025917 | Ga0207660_10000307 | Ga0207660_100003074 | 365 |
| 788 | 3300025917 | Ga0207660_10044506 | Ga0207660_100445064 | 365 |
| 789 | 3300025917 | Ga0207660_10057522 | Ga0207660_100575222 | 365 |
| 790 | 3300025918 | Ga0207662_10000850 | Ga0207662_1000085010 | 365 |
| 791 | 3300025919 | Ga0207657_10002203 | Ga0207657_100022039 | 365 |
| 792 | 3300025919 | Ga0207657_10008189 | Ga0207657_100081898 | 365 |
| 793 | 3300025919 | Ga0207657_10041021 | Ga0207657_100410212 | 365 |
| 794 | 3300025919 | Ga0207657_10175869 | Ga0207657_101758692 | 365 |
| 795 | 3300025920 | Ga0207649_10001352 | Ga0207649_100013524 | 365 |
| 796 | 3300025921 | Ga0207652_10002958 | Ga0207652_1000295814 | 365 |
| 797 | 3300025921 | Ga0207652_10055916 | Ga0207652_100559162 | 365 |
| 798 | 3300025921 | Ga0207652_10064427 | Ga0207652_100644272 | 365 |
| 799 | 3300025922 | Ga0207646_10198128 | Ga0207646_101981283 | 365 |
| 800 | 3300025923 | Ga0207681_10001165 | Ga0207681_1000116511 | 365 |
| 801 | 3300025923 | Ga0207681_10059100 | Ga0207681_100591002 | 365 |
| 802 | 3300025924 | Ga0207694_10168088 | Ga0207694_101680881 | 365 |
| 803 | 3300025925 | Ga0207650_10007784 | Ga0207650_100077844 | 365 |
| 804 | 3300025926 | Ga0207659_10000038 | Ga0207659_1000003892 | 365 |
| 805 | 3300025926 | Ga0207659_10078264 | Ga0207659_100782642 | 365 |
| 806 | 3300025927 | Ga0207687_10000966 | Ga0207687_1000096611 | 365 |
| 807 | 3300025927 | Ga0207687_10005917 | Ga0207687_100059172 | 365 |
| 808 | 3300025927 | Ga0207687_10059041 | Ga0207687_100590414 | 365 |
| 809 | 3300025929 | Ga0207664_10147467 | Ga0207664_101474672 | 365 |
| 810 | 3300025929 | Ga0207664_10160249 | Ga0207664_101602491 | 365 |
| 811 | 3300025931 | Ga0207644_10000785 | Ga0207644_100007852 | 365 |
| 812 | 3300025931 | Ga0207644_10081528 | Ga0207644_100815283 | 365 |
| 813 | 3300025931 | Ga0207644_10159425 | Ga0207644_101594252 | 365 |
| 814 | 3300025932 | Ga0207690_10000805 | Ga0207690_100008058 | 365 |
| 815 | 3300025932 | Ga0207690_10063829 | Ga0207690_100638291 | 365 |
| 816 | 3300025933 | Ga0207706_10003945 | Ga0207706_100039457 | 365 |
| 817 | 3300025933 | Ga0207706_10004195 | Ga0207706_1000419510 | 365 |
| 818 | 3300025933 | Ga0207706_10126173 | Ga0207706_101261732 | 365 |
| 819 | 3300025934 | Ga0207686_10001021 | Ga0207686_100010219 | 365 |
| 820 | 3300025934 | Ga0207686_10009204 | Ga0207686_100092045 | 365 |
| 821 | 3300025935 | Ga0207709_10000645 | Ga0207709_1000064519 | 365 |
| 822 | 3300025935 | Ga0207709_10010819 | Ga0207709_100108192 | 365 |
| 823 | 3300025936 | Ga0207670_10001354 | Ga0207670_100013548 | 365 |
| 824 | 3300025936 | Ga0207670_10029551 | Ga0207670_100295512 | 365 |
| 825 | 3300025937 | Ga0207669_10000063 | Ga0207669_1000006313 | 365 |
| 826 | 3300025937 | Ga0207669_10037738 | Ga0207669_100377381 | 365 |
| 827 | 3300025937 | Ga0207669_10063360 | Ga0207669_100633603 | 365 |
| 828 | 3300025938 | Ga0207704_10000540 | Ga0207704_100005405 | 365 |
| 829 | 3300025938 | Ga0207704_10172593 | Ga0207704_101725932 | 365 |
| 830 | 3300025939 | Ga0207665_10002733 | Ga0207665_1000273311 | 365 |
| 831 | 3300025939 | Ga0207665_10012974 | Ga0207665_100129742 | 365 |
| 832 | 3300025940 | Ga0207691_10004163 | Ga0207691_1000416310 | 365 |
| 833 | 3300025941 | Ga0207711_10002693 | Ga0207711_1000269313 | 365 |
| 834 | 3300025941 | Ga0207711_10010594 | Ga0207711_100105942 | 365 |
| 835 | 3300025941 | Ga0207711_10020036 | Ga0207711_100200366 | 365 |
| 836 | 3300025942 | Ga0207689_10001462 | Ga0207689_1000146211 | 365 |
| 837 | 3300025942 | Ga0207689_10008666 | Ga0207689_100086664 | 365 |
| 838 | 3300025944 | Ga0207661_10001037 | Ga0207661_100010376 | 365 |
| 839 | 3300025944 | Ga0207661_10172123 | Ga0207661_101721232 | 365 |
| 840 | 3300025945 | Ga0207679_10000673 | Ga0207679_1000067319 | 365 |
| 841 | 3300025945 | Ga0207679_10107168 | Ga0207679_101071682 | 365 |
| 842 | 3300025949 | Ga0207667_10020248 | Ga0207667_100202486 | 365 |
| 843 | 3300025949 | Ga0207667_10372545 | Ga0207667_103725451 | 365 |
| 844 | 3300025960 | Ga0207651_10000116 | Ga0207651_1000011625 | 365 |
| 845 | 3300025960 | Ga0207651_10307417 | Ga0207651_103074171 | 365 |
| 846 | 3300025961 | Ga0207712_10002012 | Ga0207712_100020127 | 365 |
| 847 | 3300025961 | Ga0207712_10004960 | Ga0207712_100049604 | 365 |
| 848 | 3300025972 | Ga0207668_10000300 | Ga0207668_1000030019 | 365 |
| 849 | 3300025972 | Ga0207668_10043709 | Ga0207668_100437093 | 365 |
| 850 | 3300025981 | Ga0207640_10000435 | Ga0207640_1000043515 | 365 |
| 851 | 3300025986 | Ga0207658_10002963 | Ga0207658_100029634 | 365 |
| 852 | 3300025986 | Ga0207658_10022657 | Ga0207658_100226575 | 365 |
| 853 | 3300025986 | Ga0207658_10128470 | Ga0207658_101284702 | 365 |
| 854 | 3300026023 | Ga0207677_10000587 | Ga0207677_1000058711 | 365 |
| 855 | 3300026035 | Ga0207703_10002543 | Ga0207703_100025436 | 365 |
| 856 | 3300026035 | Ga0207703_10015006 | Ga0207703_100150064 | 365 |
| 857 | 3300026035 | Ga0207703_10104050 | Ga0207703_101040503 | 365 |
| 858 | 3300026041 | Ga0207639_10002760 | Ga0207639_100027605 | 365 |
| 859 | 3300026041 | Ga0207639_10032120 | Ga0207639_100321204 | 365 |
| 860 | 3300026041 | Ga0207639_10034881 | Ga0207639_100348814 | 365 |
| 861 | 3300026067 | Ga0207678_10001349 | Ga0207678_100013496 | 365 |
| 862 | 3300026067 | Ga0207678_10022212 | Ga0207678_100222122 | 365 |
| 863 | 3300026075 | Ga0207708_10002313 | Ga0207708_100023137 | 365 |
| 864 | 3300026075 | Ga0207708_10021050 | Ga0207708_100210506 | 365 |
| 865 | 3300026078 | Ga0207702_10005132 | Ga0207702_100051326 | 365 |
| 866 | 3300026078 | Ga0207702_10067598 | Ga0207702_100675982 | 365 |
| 867 | 3300026078 | Ga0207702_10104329 | Ga0207702_101043293 | 365 |
| 868 | 3300026078 | Ga0207702_10280800 | Ga0207702_102808001 | 365 |
| 869 | 3300026078 | Ga0207702_10428487 | Ga0207702_104284871 | 365 |
| 870 | 3300026088 | Ga0207641_10002690 | Ga0207641_1000269012 | 365 |
| 871 | 3300026088 | Ga0207641_10042050 | Ga0207641_100420502 | 365 |
| 872 | 3300026088 | Ga0207641_10193884 | Ga0207641_101938842 | 365 |
| 873 | 3300026089 | Ga0207648_10004670 | Ga0207648_1000467010 | 365 |
| 874 | 3300026095 | Ga0207676_10001465 | Ga0207676_1000146511 | 365 |
| 875 | 3300026095 | Ga0207676_10005579 | Ga0207676_100055795 | 365 |
| 876 | 3300026116 | Ga0207674_10005769 | Ga0207674_1000576911 | 365 |
| 877 | 3300026118 | Ga0207675_100004143 | Ga0207675_10000414310 | 365 |
| 878 | 3300026118 | Ga0207675_100064784 | Ga0207675_1000647842 | 365 |
| 879 | 3300026121 | Ga0207683_10000138 | Ga0207683_1000013847 | 365 |
| 880 | 3300026121 | Ga0207683_10005177 | Ga0207683_100051776 | 365 |
| 881 | 3300026142 | Ga0207698_10000568 | Ga0207698_1000056811 | 365 |
| 882 | 3300027617 | Ga0210002_1000723 | Ga0210002_10007233 | 365 |
| 883 | 3300027682 | Ga0209971_1001690 | Ga0209971_10016904 | 365 |
| 884 | 3300027695 | Ga0209966_1001187 | Ga0209966_10011875 | 365 |
| 885 | 3300027695 | Ga0209966_1002127 | Ga0209966_10021274 | 365 |
| 886 | 3300027907 | Ga0207428_10000501 | Ga0207428_1000050122 | 365 |
| 887 | 3300027907 | Ga0207428_10001016 | Ga0207428_1000101623 | 365 |
| 888 | 3300028379 | Ga0268266_10001262 | Ga0268266_100012629 | 365 |
| 889 | 3300028379 | Ga0268266_10051613 | Ga0268266_100516134 | 365 |
| 890 | 3300028380 | Ga0268265_10001141 | Ga0268265_100011419 | 365 |
| 891 | 3300028380 | Ga0268265_10110556 | Ga0268265_101105563 | 365 |
| 892 | 3300028380 | Ga0268265_10126649 | Ga0268265_101266491 | 365 |
| 893 | 3300028381 | Ga0268264_10001321 | Ga0268264_100013219 | 365 |
| 894 | 3300028381 | Ga0268264_10171002 | Ga0268264_101710022 | 365 |
| 895 | 3300028558 | Ga0265326_10002676 | Ga0265326_100026765 | 365 |
| 896 | 3300028573 | Ga0265334_10011858 | Ga0265334_100118584 | 365 |
| 897 | 3300028577 | Ga0265318_10000647 | Ga0265318_100006476 | 365 |
| 898 | 3300028786 | Ga0307517_10004912 | Ga0307517_100049128 | 365 |
| 899 | 3300028786 | Ga0307517_10065343 | Ga0307517_100653432 | 365 |
| 900 | 3300028794 | Ga0307515_10000138 | Ga0307515_10000138151 | 365 |
| 901 | 3300028794 | Ga0307515_10005581 | Ga0307515_100055813 | 365 |
| 902 | 3300028800 | Ga0265338_10006098 | Ga0265338_100060989 | 365 |
| 903 | 3300028800 | Ga0265338_10015318 | Ga0265338_100153185 | 365 |
| 904 | 3300030522 | Ga0307512_10010075 | Ga0307512_100100753 | 365 |
| 905 | 3300031235 | Ga0265330_10003117 | Ga0265330_100031177 | 365 |
| 906 | 3300031238 | Ga0265332_10006961 | Ga0265332_100069615 | 365 |
| 907 | 3300031239 | Ga0265328_10007481 | Ga0265328_100074815 | 365 |
| 908 | 3300031240 | Ga0265320_10002935 | Ga0265320_100029358 | 365 |
| 909 | 3300031241 | Ga0265325_10003130 | Ga0265325_100031305 | 365 |
| 910 | 3300031242 | Ga0265329_10003338 | Ga0265329_100033385 | 365 |
| 911 | 3300031249 | Ga0265339_10021781 | Ga0265339_100217811 | 365 |
| 912 | 3300031249 | Ga0265339_10032015 | Ga0265339_100320153 | 365 |
| 913 | 3300031250 | Ga0265331_10024664 | Ga0265331_100246643 | 365 |
| 914 | 3300031344 | Ga0265316_10007577 | Ga0265316_100075777 | 365 |
| 915 | 3300031456 | Ga0307513_10023661 | Ga0307513_100236614 | 365 |
| 916 | 3300031456 | Ga0307513_10051472 | Ga0307513_100514722 | 365 |
| 917 | 3300031507 | Ga0307509_10004147 | Ga0307509_1000414718 | 365 |
| 918 | 3300031507 | Ga0307509_10004183 | Ga0307509_1000418310 | 365 |
| 919 | 3300031507 | Ga0307509_10004884 | Ga0307509_1000488421 | 365 |
| 920 | 3300031507 | Ga0307509_10061981 | Ga0307509_100619812 | 365 |
| 921 | 3300031548 | Ga0307408_100002313 | Ga0307408_1000023138 | 365 |
| 922 | 3300031548 | Ga0307408_100081580 | Ga0307408_1000815801 | 365 |
| 923 | 3300031548 | Ga0307408_100186313 | Ga0307408_1001863132 | 365 |
| 924 | 3300031595 | Ga0265313_10000716 | Ga0265313_100007167 | 365 |
| 925 | 3300031595 | Ga0265313_10003101 | Ga0265313_100031016 | 365 |
| 926 | 3300031616 | Ga0307508_10011794 | Ga0307508_100117943 | 365 |
| 927 | 3300031616 | Ga0307508_10012983 | Ga0307508_100129836 | 365 |
| 928 | 3300031711 | Ga0265314_10002259 | Ga0265314_1000225918 | 365 |
| 929 | 3300031711 | Ga0265314_10006251 | Ga0265314_100062515 | 365 |
| 930 | 3300031711 | Ga0265314_10010751 | Ga0265314_100107513 | 365 |
| 931 | 3300031712 | Ga0265342_10000940 | Ga0265342_100009408 | 365 |
| 932 | 3300031712 | Ga0265342_10048027 | Ga0265342_100480272 | 365 |
| 933 | 3300031731 | Ga0307405_10194860 | Ga0307405_101948601 | 365 |
| 934 | 3300031824 | Ga0307413_10003432 | Ga0307413_100034323 | 365 |
| 935 | 3300031852 | Ga0307410_10007603 | Ga0307410_100076035 | 365 |
| 936 | 3300031901 | Ga0307406_10016613 | Ga0307406_100166134 | 365 |
| 937 | 3300031903 | Ga0307407_10005458 | Ga0307407_100054585 | 365 |
| 938 | 3300031995 | Ga0307409_100023384 | Ga0307409_1000233844 | 365 |
| 939 | 3300032002 | Ga0307416_100017717 | Ga0307416_1000177173 | 365 |
| 940 | 3300032005 | Ga0307411_10059818 | Ga0307411_100598183 | 365 |
| 941 | 3300032126 | Ga0307415_100016117 | Ga0307415_1000161172 | 365 |
| 942 | 3300033180 | Ga0307510_10012162 | Ga0307510_100121626 | 365 |
| 943 | 3300033180 | Ga0307510_10044259 | Ga0307510_100442593 | 365 |
| 944 | 3300034818 | Ga0373950_0007719 | Ga0373950_0007719_500_1615 | 365 |
| 945 | 3300034819 | Ga0373958_0000662 | Ga0373958_0000662_1728_2843 | 365 |
| 946 | 3300035086 | Ga0373934_0040745 | Ga0373934_0040745_348_1463 | 365 |
| 947 | 3300035090 | Ga0373949_0000806 | Ga0373949_0000806_6724_7839 | 365 |
| 948 | 3300035091 | Ga0373951_0005691 | Ga0373951_0005691_115_1233 | 365 |
| 949 | 3300035092 | Ga0373952_0001150 | Ga0373952_0001150_2856_3971 | 365 |
| 950 | 3300035111 | Ga0373923_0050991 | Ga0373923_0050991_398_1513 | 365 |
| 951 | 3300035112 | Ga0373932_0000362 | Ga0373932_0000362_728_1843 | 365 |
| 952 | 3300035112 | Ga0373932_0008571 | Ga0373932_0008571_793_1911 | 365 |
| 953 | 3300035114 | Ga0373939_0000233 | Ga0373939_0000233_5904_7019 | 365 |
| 954 | 3300035114 | Ga0373939_0014739 | Ga0373939_0014739_815_1933 | 365 |
| 955 | 3300035115 | Ga0373941_0000133 | Ga0373941_0000133_7637_8752 | 365 |
| 956 | 3300035118 | Ga0373954_0004727 | Ga0373954_0004727_4359_5474 | 365 |
| 957 | 3300035120 | Ga0373957_0010497 | Ga0373957_0010497_258_1373 | 365 |
| 958 | 3300035121 | Ga0373960_0000182 | Ga0373960_0000182_7212_8327 | 365 |
| 959 | 3300035171 | Ga0373946_0021326 | Ga0373946_0021326_863_1978 | 365 |
| 960 | 3300035207 | Ga0373942_0004221 | Ga0373942_0004221_1899_3017 | 365 |
| 961 | 3300035241 | Ga0373961_0015346 | Ga0373961_0015346_259_1374 | 365 |
| 962 | 3300035242 | Ga0373962_0001963 | Ga0373962_0001963_2162_3277 | 365 |
| 963 | 3300035242 | Ga0373962_0003879 | Ga0373962_0003879_205_1323 | 365 |
| 964 | 3300035691 | Ga0373931_0000201 | Ga0373931_0000201_9234_10349 | 365 |
| 965 | 3300035692 | Ga0373935_0027106 | Ga0373935_0027106_1872_2990 | 365 |
| 966 | 3300035692 | Ga0373935_0080452 | Ga0373935_0080452_404_1519 | 365 |
| 967 | 3300035695 | Ga0373927_0083536 | Ga0373927_0083536_46_1161 | 365 |
| 968 | 3300035725 | Ga0373947_0001864 | Ga0373947_0001864_4500_5618 | 365 |
| 969 | 3300036401 | Ga0373937_0363920 | Ga0373937_0363920_67_1182 | 365 |
| 970 | 3300037068 | Ga0373925_0001650 | Ga0373925_0001650_9562_10674 | 365 |
| 971 | 3300037068 | Ga0373925_0003098 | Ga0373925_0003098_574_1692 | 365 |
| 972 | 3300037312 | Ga0395899_0008070 | Ga0395899_0008070_1861_2976 | 365 |
| 973 | 3300037312 | Ga0395899_0011883 | Ga0395899_0011883_3939_5054 | 365 |
| 974 | 3300037312 | Ga0395899_0012727 | Ga0395899_0012727_2643_3752 | 365 |
| 975 | 3300037312 | Ga0395899_0119134 | Ga0395899_0119134_295_1458 | 365 |
| 976 | 3300037418 | Ga0395900_0009953 | Ga0395900_0009953_7333_8442 | 365 |
| 977 | 3300037418 | Ga0395900_0075223 | Ga0395900_0075223_2224_3339 | 365 |
| 978 | 3300037466 | Ga0395898_0004361 | Ga0395898_0004361_14339_15454 | 365 |
| 979 | 3300037466 | Ga0395898_0011214 | Ga0395898_0011214_2388_3497 | 365 |
| 980 | 3300037466 | Ga0395898_0036029 | Ga0395898_0036029_960_2075 | 365 |
| 981 | 3300037466 | Ga0395898_0071002 | Ga0395898_0071002_263_1372 | 365 |
| 982 | 3300037471 | Ga0395905_0000431 | Ga0395905_0000431_46729_47844 | 365 |
| 983 | 3300037471 | Ga0395905_0002347 | Ga0395905_0002347_2486_3622 | 365 |
| 984 | 3300037471 | Ga0395905_0029909 | Ga0395905_0029909_2224_3333 | 365 |
| 985 | 3300037471 | Ga0395905_0119283 | Ga0395905_0119283_937_2052 | 365 |
| 986 | 3300038443 | Ga0395901_0007051 | Ga0395901_0007051_3489_4604 | 365 |
| 987 | 3300038443 | Ga0395901_0020806 | Ga0395901_0020806_1415_2530 | 365 |
| 988 | 3300038443 | Ga0395901_0073003 | Ga0395901_0073003_688_1851 | 365 |
| 989 | 3300038443 | Ga0395901_0181993 | Ga0395901_0181993_1020_2129 | 365 |
| 990 | 3300038443 | Ga0395901_0268068 | Ga0395901_0268068_311_1426 | 365 |
| 991 | 3300038705 | Ga0237819_00544 | Ga0237819_00544_10239_11345 | 365 |
| 992 | 3300039447 | Ga0436361_1049346 | Ga0436361_1049346_4628_5743 | 365 |
| 993 | 3300041413 | Ga0439465_0026623 | Ga0439465_0026623_534_1673 | 365 |
| 994 | 3300044669 | Ga0466981_0000028 | Ga0466981_0000028_18555_19655 | 365 |
| 995 | 3300044694 | Ga0466963_0044773 | Ga0466963_0044773_1652_2779 | 365 |
| 996 | 3300044694 | Ga0466963_0050584 | Ga0466963_0050584_830_1993 | 365 |
| 997 | 3300044712 | Ga0453684_0424549 | Ga0453684_0424549_127_1257 | 365 |
| 998 | 3300044842 | Ga0466957_0059843 | Ga0466957_0059843_69_1178 | 365 |
| 999 | 3300045051 | Ga0451576_0001995 | Ga0451576_0001995_18949_20079 | 365 |
| 1000 | 3300046454 | Ga0495592_0000250 | Ga0495592_0000250_29908_31023 | 365 |
| 1001 | 3300046455 | Ga0495603_0048103 | Ga0495603_0048103_1168_2286 | 365 |
| 1002 | 3300046457 | Ga0495590_0000194 | Ga0495590_0000194_25527_26642 | 365 |
| 1003 | 3300046459 | Ga0495629_0000753 | Ga0495629_0000753_18063_19181 | 365 |
| 1004 | 3300046460 | Ga0495638_0173392 | Ga0495638_0173392_19_1137 | 365 |
| 1005 | 3300046461 | Ga0495641_0072722 | Ga0495641_0072722_313_1428 | 365 |
| 1006 | 3300046462 | Ga0495651_0001426 | Ga0495651_0001426_1328_2443 | 365 |
| 1007 | 3300046463 | Ga0495653_0007689 | Ga0495653_0007689_5347_6462 | 365 |
| 1008 | 3300046463 | Ga0495653_0020780 | Ga0495653_0020780_4157_5272 | 365 |
| 1009 | 3300046471 | Ga0495650_0000016 | Ga0495650_0000016_31714_32811 | 365 |
| 1010 | 3300046472 | Ga0495580_0082792 | Ga0495580_0082792_788_1903 | 365 |
| 1011 | 3300046473 | Ga0495582_0001659 | Ga0495582_0001659_6587_7702 | 365 |
| 1012 | 3300046473 | Ga0495582_0015740 | Ga0495582_0015740_1498_2616 | 365 |
| 1013 | 3300046473 | Ga0495582_0089400 | Ga0495582_0089400_567_1682 | 365 |
| 1014 | 3300046473 | Ga0495582_0131603 | Ga0495582_0131603_92_1207 | 365 |
| 1015 | 3300046474 | Ga0495605_0070831 | Ga0495605_0070831_161_1285 | 365 |
| 1016 | 3300046475 | Ga0495639_0030825 | Ga0495639_0030825_1200_2315 | 365 |
| 1017 | 3300046476 | Ga0495662_0112075 | Ga0495662_0112075_22_1137 | 365 |
| 1018 | 3300046491 | Ga0495584_0043774 | Ga0495584_0043774_559_1674 | 365 |
| 1019 | 3300046500 | Ga0495596_0002323 | Ga0495596_0002323_1240_2355 | 365 |
| 1020 | 3300046500 | Ga0495596_0006771 | Ga0495596_0006771_3477_4580 | 365 |
| 1021 | 3300046501 | Ga0495607_0019573 | Ga0495607_0019573_329_1483 | 365 |
| 1022 | 3300046506 | Ga0495583_0000149 | Ga0495583_0000149_93359_94474 | 365 |
| 1023 | 3300046507 | Ga0495606_0003759 | Ga0495606_0003759_9477_10592 | 365 |
| 1024 | 3300046511 | Ga0495608_0001990 | Ga0495608_0001990_13427_14542 | 365 |
| 1025 | 3300046512 | Ga0495610_0060500 | Ga0495610_0060500_557_1672 | 365 |
| 1026 | 3300046514 | Ga0495618_0002569 | Ga0495618_0002569_6841_7956 | 365 |
| 1027 | 3300046515 | Ga0495620_0043614 | Ga0495620_0043614_304_1419 | 365 |
| 1028 | 3300046517 | Ga0495630_0004025 | Ga0495630_0004025_7669_8784 | 365 |
| 1029 | 3300046517 | Ga0495630_0076160 | Ga0495630_0076160_639_1754 | 365 |
| 1030 | 3300046517 | Ga0495630_0138706 | Ga0495630_0138706_699_1814 | 365 |
| 1031 | 3300046523 | Ga0495644_0037635 | Ga0495644_0037635_299_1414 | 365 |
| 1032 | 3300046526 | Ga0495666_0029609 | Ga0495666_0029609_1372_2487 | 365 |
| 1033 | 3300046529 | Ga0495652_0049824 | Ga0495652_0049824_1122_2237 | 365 |
| 1034 | 3300046531 | Ga0495665_0033100 | Ga0495665_0033100_518_1633 | 365 |
| 1035 | 3300046536 | Ga0495587_0005444 | Ga0495587_0005444_2639_3754 | 365 |
| 1036 | 3300046538 | Ga0495609_0009954 | Ga0495609_0009954_1033_2148 | 365 |
| 1037 | 3300046543 | Ga0495645_0049903 | Ga0495645_0049903_166_1281 | 365 |
| 1038 | 3300046557 | Ga0495622_0063627 | Ga0495622_0063627_180_1295 | 365 |
| 1039 | 3300046557 | Ga0495622_0064014 | Ga0495622_0064014_558_1676 | 365 |
| 1040 | 3300046616 | Ga0495668_0002416 | Ga0495668_0002416_10839_11954 | 365 |
| 1041 | 3300046642 | Ga0495634_0047634 | Ga0495634_0047634_1654_2769 | 365 |
| 1042 | 3300046660 | Ga0495625_0001637 | Ga0495625_0001637_825_1940 | 365 |
| 1043 | 3300046660 | Ga0495625_0014089 | Ga0495625_0014089_2623_3738 | 365 |
| 1044 | 3300046665 | Ga0495661_0072174 | Ga0495661_0072174_473_1588 | 365 |
| 1045 | 3300046674 | Ga0495588_0026815 | Ga0495588_0026815_719_1834 | 365 |
| 1046 | 3300046674 | Ga0495588_0099986 | Ga0495588_0099986_110_1225 | 365 |
| 1047 | 3300046679 | Ga0495623_0034053 | Ga0495623_0034053_1574_2689 | 365 |
| 1048 | 3300046680 | Ga0495646_0017562 | Ga0495646_0017562_3274_4389 | 365 |
| 1049 | 3300046681 | Ga0495647_0066535 | Ga0495647_0066535_53_1168 | 365 |
| 1050 | 3300046683 | Ga0495658_0006858 | Ga0495658_0006858_2124_3242 | 365 |
| 1051 | 3300046683 | Ga0495658_0048860 | Ga0495658_0048860_798_1913 | 365 |
| 1052 | 3300046684 | Ga0495669_0000075 | Ga0495669_0000075_14978_16093 | 365 |
| 1053 | 3300046689 | Ga0495613_0004700 | Ga0495613_0004700_2578_3732 | 365 |
| 1054 | 3300046689 | Ga0495613_0019456 | Ga0495613_0019456_1254_2372 | 365 |
| 1055 | 3300046692 | Ga0495671_0003075 | Ga0495671_0003075_5739_6854 | 365 |
| 1056 | 3300046692 | Ga0495671_0018007 | Ga0495671_0018007_1354_2469 | 365 |
| 1057 | 3300046694 | Ga0495649_0000396 | Ga0495649_0000396_32797_33912 | 365 |
| 1058 | 3300046794 | Ga0495589_0028828 | Ga0495589_0028828_482_1597 | 365 |
| 1059 | 3300046809 | Ga0495600_0006772 | Ga0495600_0006772_4091_5206 | 365 |
| 1060 | 3300046809 | Ga0495600_0041087 | Ga0495600_0041087_604_1719 | 365 |
| 1061 | 3300046810 | Ga0495660_0000189 | Ga0495660_0000189_11266_12363 | 365 |
| 1062 | 3300047315 | Ga0495581_0025513 | Ga0495581_0025513_60_1175 | 365 |
| 1063 | 3300047317 | Ga0495604_0066259 | Ga0495604_0066259_645_1760 | 365 |
| 1064 | 3300047319 | Ga0495674_0022419 | Ga0495674_0022419_4076_5191 | 365 |
| 1065 | 3300047319 | Ga0495674_0113184 | Ga0495674_0113184_259_1374 | 365 |
| 1066 | 3300047321 | Ga0495676_0017396 | Ga0495676_0017396_2059_3177 | 365 |
| 1067 | 3300047444 | Ga0495675_0017062 | Ga0495675_0017062_2730_3845 | 365 |
| 1068 | 3300047445 | Ga0495677_0000154 | Ga0495677_0000154_9172_10287 | 365 |
| 1069 | 3300047445 | Ga0495677_0006061 | Ga0495677_0006061_1979_3094 | 365 |
| 1070 | 3300047445 | Ga0495677_0034044 | Ga0495677_0034044_155_1435 | 365 |
| 1071 | 3300047471 | Ga0495684_0192923 | Ga0495684_0192923_109_1224 | 365 |
| 1072 | 3300047472 | Ga0495686_0000923 | Ga0495686_0000923_12578_13693 | 365 |
| 1073 | 3300047472 | Ga0495686_0013528 | Ga0495686_0013528_3675_4790 | 365 |
| 1074 | 3300047472 | Ga0495686_0035130 | Ga0495686_0035130_1008_2114 | 365 |
| 1075 | 3300048088 | Ga0495602_0002022 | Ga0495602_0002022_4832_5947 | 365 |
| 1076 | 3300048089 | Ga0495614_0024919 | Ga0495614_0024919_1068_2183 | 365 |
| 1077 | 3300048903 | Ga0496100_0000326 | Ga0496100_0000326_7191_8306 | 365 |
| 1078 | 3300048903 | Ga0496100_0034458 | Ga0496100_0034458_1997_3115 | 365 |
| 1079 | 3300048903 | Ga0496100_0110257 | Ga0496100_0110257_257_1372 | 365 |
| 1080 | 3300048904 | Ga0496101_0010563 | Ga0496101_0010563_2445_3560 | 365 |
| 1081 | 3300048904 | Ga0496101_0022406 | Ga0496101_0022406_63_1181 | 365 |
| 1082 | 3300048905 | Ga0496102_0001315 | Ga0496102_0001315_12151_13266 | 365 |
| 1083 | 3300048905 | Ga0496102_0108357 | Ga0496102_0108357_63_1175 | 365 |
| 1084 | 3300048905 | Ga0496102_0180372 | Ga0496102_0180372_205_1323 | 365 |
| 1085 | 3300048905 | Ga0496102_0248324 | Ga0496102_0248324_497_1615 | 365 |
| 1086 | 3300048906 | Ga0496103_0002237 | Ga0496103_0002237_8469_9584 | 365 |
| 1087 | 3300048906 | Ga0496103_0054276 | Ga0496103_0054276_354_1472 | 365 |
| 1088 | 3300048907 | Ga0496104_0000484 | Ga0496104_0000484_31225_32322 | 365 |
| 1089 | 3300048907 | Ga0496104_0109955 | Ga0496104_0109955_1461_2579 | 365 |
| 1090 | 3300048909 | Ga0496106_0005158 | Ga0496106_0005158_2667_3782 | 365 |
| 1091 | 3300048909 | Ga0496106_0025179 | Ga0496106_0025179_215_1333 | 365 |
| 1092 | 3300048910 | Ga0496107_0002339 | Ga0496107_0002339_7370_8485 | 365 |
| 1093 | 3300048910 | Ga0496107_0004092 | Ga0496107_0004092_1256_2374 | 365 |
| 1094 | 3300048911 | Ga0496108_0002892 | Ga0496108_0002892_12573_13688 | 365 |
| 1095 | 3300048911 | Ga0496108_0191912 | Ga0496108_0191912_590_1708 | 365 |
| 1096 | 3300048912 | Ga0496109_0000409 | Ga0496109_0000409_8210_9325 | 365 |
| 1097 | 3300048912 | Ga0496109_0121411 | Ga0496109_0121411_63_1181 | 365 |
| 1098 | 3300048912 | Ga0496109_0121798 | Ga0496109_0121798_63_1175 | 365 |
| 1099 | 3300048913 | Ga0496110_0228384 | Ga0496110_0228384_63_1181 | 365 |
| 1100 | 3300048914 | Ga0496111_0048862 | Ga0496111_0048862_63_1181 | 365 |
| 1101 | 3300048915 | Ga0496112_0082579 | Ga0496112_0082579_63_1181 | 365 |
| 1102 | 3300048916 | Ga0496113_0084543 | Ga0496113_0084543_1256_2374 | 365 |
| 1103 | 3300048916 | Ga0496113_0100258 | Ga0496113_0100258_1017_2132 | 365 |
| 1104 | 3300048917 | Ga0496114_0002505 | Ga0496114_0002505_9212_10327 | 365 |
| 1105 | 3300048917 | Ga0496114_0024049 | Ga0496114_0024049_2622_3740 | 365 |
| 1106 | 3300048917 | Ga0496114_0040268 | Ga0496114_0040268_2522_3637 | 365 |
| 1107 | 3300048918 | Ga0496115_0047311 | Ga0496115_0047311_188_1303 | 365 |
| 1108 | 3300048918 | Ga0496115_0089318 | Ga0496115_0089318_305_1423 | 365 |
| 1109 | 3300048919 | Ga0496116_0000158 | Ga0496116_0000158_11267_12364 | 365 |
| 1110 | 3300048920 | Ga0496117_0024182 | Ga0496117_0024182_552_1649 | 365 |
| 1111 | 3300048920 | Ga0496117_0070630 | Ga0496117_0070630_959_2098 | 365 |
| 1112 | 3300048921 | Ga0496118_0001836 | Ga0496118_0001836_20206_21303 | 365 |
| 1113 | 3300048921 | Ga0496118_0002524 | Ga0496118_0002524_12841_13980 | 365 |
| 1114 | 3300048922 | Ga0496119_0015558 | Ga0496119_0015558_2405_3502 | 365 |
| 1115 | 3300048923 | Ga0496120_0003713 | Ga0496120_0003713_11683_12780 | 365 |
| 1116 | 3300048925 | Ga0496122_0000013 | Ga0496122_0000013_31712_32809 | 365 |
| 1117 | 3300048926 | Ga0496123_0000010 | Ga0496123_0000010_468231_469328 | 365 |
| 1118 | 3300048927 | Ga0496124_0000152 | Ga0496124_0000152_50969_52066 | 365 |
| 1119 | 3300048928 | Ga0496125_0000546 | Ga0496125_0000546_16556_17653 | 365 |
| 1120 | 3300048928 | Ga0496125_0025778 | Ga0496125_0025778_631_1770 | 365 |
| 1121 | 3300048928 | Ga0496125_0041595 | Ga0496125_0041595_1787_2911 | 365 |
| 1122 | 3300048929 | Ga0496126_0000284 | Ga0496126_0000284_11353_12450 | 365 |
| 1123 | 3300048929 | Ga0496126_0106670 | Ga0496126_0106670_423_1544 | 365 |
| 1124 | 3300049569 | Ga0501032_0079502 | Ga0501032_0079502_896_2008 | 365 |
| 1125 | 3300049570 | Ga0501033_0158379 | Ga0501033_0158379_368_1483 | 365 |
| 1126 | 3300049570 | Ga0501033_0163129 | Ga0501033_0163129_44_1156 | 365 |
| 1127 | 3300049571 | Ga0501034_0060215 | Ga0501034_0060215_427_1539 | 365 |
| 1128 | 3300049571 | Ga0501034_0086257 | Ga0501034_0086257_551_1663 | 365 |
| 1129 | 3300049571 | Ga0501034_0155004 | Ga0501034_0155004_1047_2162 | 365 |
| 1130 | 3300049574 | Ga0501038_0229608 | Ga0501038_0229608_11_1123 | 365 |
| 1131 | 3300049579 | Ga0501043_0146263 | Ga0501043_0146263_504_1616 | 365 |
| 1132 | 3300049581 | Ga0501047_0121680 | Ga0501047_0121680_278_1390 | 365 |
| 1133 | 3300049581 | Ga0501047_0307818 | Ga0501047_0307818_146_1414 | 365 |
| 1134 | 3300049582 | Ga0501048_0230265 | Ga0501048_0230265_26_1138 | 365 |
| 1135 | 3300049586 | Ga0501070_0013624 | Ga0501070_0013624_2404_3516 | 365 |
| 1136 | 3300049587 | Ga0501071_0188453 | Ga0501071_0188453_354_1466 | 365 |
| 1137 | 3300049590 | Ga0501074_0110721 | Ga0501074_0110721_38_1144 | 365 |
| 1138 | 3300049658 | Ga0501211_005745 | Ga0501211_005745_20_1135 | 365 |
| 1139 | 3300049744 | Ga0501083_0063330 | Ga0501083_0063330_976_2088 | 365 |
| 1140 | 3300049822 | Ga0501035_0156072 | Ga0501035_0156072_342_1457 | 365 |
| 1141 | 3300049823 | Ga0501044_0040799 | Ga0501044_0040799_150_1265 | 365 |
| 1142 | 3300050494 | nmdc:mga06z11_14548_c1 | nmdc:mga06z11_14548_c1_441_1556 | 365 |
| 1143 | 3300050511 | nmdc:mga08y16_992_c1 | nmdc:mga08y16_992_c1_19850_20965 | 365 |
| 1144 | 3300050512 | nmdc:mga0n895_1104_c1 | nmdc:mga0n895_1104_c1_12969_14084 | 365 |
| 1145 | 3300050512 | nmdc:mga0n895_169339_c1 | nmdc:mga0n895_169339_c1_1077_2195 | 365 |
| 1146 | 3300050512 | nmdc:mga0n895_175793_c1 | nmdc:mga0n895_175793_c1_872_1990 | 365 |
| 1147 | 3300050513 | nmdc:mga0rr50_112212_c1 | nmdc:mga0rr50_112212_c1_379_1497 | 365 |
| 1148 | 3300050515 | nmdc:mga0a205_970_c1 | nmdc:mga0a205_970_c1_12387_13502 | 365 |
| 1149 | 3300053077 | Ga0495601_0001428 | Ga0495601_0001428_897_2012 | 365 |
| 1150 | 3300053077 | Ga0495601_0020505 | Ga0495601_0020505_484_1590 | 365 |
| 1151 | 3300053078 | Ga0495612_0005327 | Ga0495612_0005327_1900_3015 | 365 |
| 1152 | 3300053084 | Ga0495595_0014275 | Ga0495595_0014275_539_1654 | 365 |
| 1153 | 3300053085 | Ga0495619_0000388 | Ga0495619_0000388_7006_8124 | 365 |
| 1154 | 3300053085 | Ga0495619_0060004 | Ga0495619_0060004_507_1622 | 365 |
| 1155 | 3300053088 | Ga0500644_0001370 | Ga0500644_0001370_4479_5618 | 365 |
| 1156 | 3300053131 | Ga0500652_018059 | Ga0500652_018059_113_1231 | 365 |
| 1157 | 3300053136 | Ga0500559_0000076 | Ga0500559_0000076_29007_30122 | 365 |
| 1158 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1125832_1126950 | 365 |
| 1159 | 3300053177 | Ga0500636_0013888 | Ga0500636_0013888_1511_2626 | 365 |
| 1160 | 3300053730 | Ga0500645_000324 | Ga0500645_000324_25538_26656 | 365 |
| 1161 | 3300061734 | Ga0530510_0099539 | Ga0530510_0099539_710_1825 | 365 |
| 1162 | iso_pu_bacteria | 2643221672 | 2644400612 | 365 |
| 1163 | iso_pu_bacteria | 2738541307 | 2738884205 | 365 |
| 1164 | iso_pu_bacteria | 2818991446 | 2819601303 | 365 |
| 1165 | iso_pu_bacteria | 2831265667 | 2831269696 | 365 |
| 1166 | iso_pu_bacteria | 2838054893 | 2838055286 | 365 |
| 1167 | iso_pu_bacteria | 2899924645 | 2899927349 | 365 |
| 1168 | iso_pu_bacteria | 2928037797 | 2928042738 | 365 |
| 1169 | iso_pu_bacteria | 2928044640 | 2928048835 | 365 |
| 1170 | iso_pu_bacteria | 2928051484 | 2928055168 | 365 |
| 1171 | iso_pu_bacteria | 2928064002 | 2928068594 | 365 |
| 1172 | iso_pu_bacteria | 2928070936 | 2928073498 | 365 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8pun-assembly1.cif.gz_D | old yellow enzyme from the thermophilic ferrovum sp. ja12 | 0.9849 | 2 | 354 |
| 3hf3-assembly1.cif.gz_D | old yellow enzyme from thermus scotoductus sa-01 | 0.9743 | 2 | 353 |
| 5nux-assembly1.cif.gz_A | thermus scotoductus sa-01 ene-reductase double mutant tser_c25d_i67t | 0.974 | 2 | 353 |
| 8pun-assembly1.cif.gz_D | old yellow enzyme from the thermophilic ferrovum sp. ja12 | 0.974 | 2 | 354 |
| 5ogt-assembly1.cif.gz_A | thermus scotoductus sa-01 ene-reductase triple mutant tser_c25d_i67t_a102h | 0.9729 | 2 | 353 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ocsA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9867 | 1 | 365 | 3.20.20.70 |
| 5ocsA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9841 | 1 | 365 | 3.20.20.70 |
| af_O94467_31_394_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.974 | 2 | 353 | 3.20.20.70 |
| af_Q54JW3_30_435_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9664 | 1 | 352 | 3.20.20.70 |
| 3gr7A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9651 | 1 | 352 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N8EJW6-F1-model_v4 | Oxidoreductase | 0.9965 | 129 | 338 |
GO:0003959
GO:0010181 GO:0050661 |
| AF-A0A520IZC7-F1-model_v4 | NADH:flavin oxidoreductase/NADH oxidase | 0.996 | 2 | 324 |
GO:0003959
GO:0010181 GO:0050661 |
| AF-A0A837FS68-F1-model_v4 | deleted | 0.995 | 1 | 363 |
|
| AF-A0A2P5ILS7-F1-model_v4 | deleted | 0.9946 | 1 | 363 |
|
| AF-A0A0D6JGB1-F1-model_v4 | NADPH dehydrogenase (EC 1.6.99.1) | 0.9939 | 1 | 364 |
GO:0003959
GO:0010181 GO:0050661 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar