F490453
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1124 | 509 | 1071 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300050512|nmdc:mga0n895_648041_c1|nmdc:mga0n895_648041_c1_235_1020 |
| Length | 261 |
| Sequence | MQDGDIIEAPQTLKQGAQLEIRDGRTSSACAGASGSIKSNGDTNMPVRIGDEAPDFTAETTEGQIRFHDWIGDKWAILFSHPKDFTPVCTTELGYMAKLKPEFDKRNTKIIGLSVDPVSDHKSWVKDIEETQGAKVNYPMIGDADLNVAKAYDMIHPNASGGKRTAVDNATVRSVFIIGPDKKVKAMLIYPMSAGRNFDEVLRLLDSLQLNAKHTVATPVNWKPGEDVIIPTSVSDEDAKKKYPQGYKTHKPYLRTVSQPK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 2 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 3 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 4 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 5 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 6 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 7 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 8 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 9 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 10 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 11 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 12 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 13 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 14 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 15 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 16 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 17 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 18 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 19 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 20 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 21 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 22 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 23 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 24 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 25 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 26 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 27 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 28 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 29 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 30 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 31 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 32 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 33 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 34 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 35 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 36 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 37 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 38 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 39 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 40 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 41 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 42 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 43 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 44 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 45 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 46 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 47 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 48 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 49 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 50 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 51 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 52 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 53 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 54 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 55 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 56 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 57 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 58 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 59 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 60 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 61 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 63 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 64 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 65 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 66 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 67 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 68 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 69 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 70 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 78 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 80 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 103 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 104 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 109 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 110 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 112 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 114 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 115 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 120 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 122 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 123 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 124 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 125 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 126 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 127 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 128 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 129 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 130 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 131 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 132 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 133 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 134 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 135 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 136 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 137 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 138 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 139 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 140 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 141 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 142 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 143 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 145 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 146 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 147 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 148 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 149 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 150 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 151 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 152 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 153 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 154 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 156 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 157 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 158 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 184 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 187 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 188 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 189 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 190 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 191 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 192 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 193 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 194 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 195 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 196 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 197 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 207 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 211 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 284 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 285 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 286 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 287 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 288 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 289 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 290 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 291 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 292 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 293 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 294 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 295 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 296 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 297 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 298 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 299 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 300 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 301 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 302 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 303 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 304 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 305 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 306 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 307 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 308 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 309 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 310 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 311 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 312 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 313 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 314 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 315 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 316 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 317 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 318 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 319 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 320 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 321 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 322 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 323 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 324 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 325 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 326 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 327 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 328 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 329 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 330 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 331 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 332 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 333 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 334 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 335 | 3300044668 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 | Metagenome | Unclassified |
| 336 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 337 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 338 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 339 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 340 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 341 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 342 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 343 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 344 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 345 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 346 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 347 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 348 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 349 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 350 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 424 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 425 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 426 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 427 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 428 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 429 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 430 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 431 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 432 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 433 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 434 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 435 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 436 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 437 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 438 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 439 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 440 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 441 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 442 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 443 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 444 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 445 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 446 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 447 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 448 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 450 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 468 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 474 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 475 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 476 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 477 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 478 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 479 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 480 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 484 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 485 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 486 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 487 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 488 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 489 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 495 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 496 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 497 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 498 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 501 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 502 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 503 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 504 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 505 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 506 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 507 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 508 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 509 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.97 |
| Metatranscriptomes | 2.31 |
| Isolates | 4.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.43 |
| Nodule | 1.42 |
| Rhizoplane | 4.63 |
| Rhizosphere | 83.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001218 | 3300001979 | Bacteria | 11643 |
| 2 | JGI24740J21852_10069483 | 3300001979 | Bacteria | 947 |
| 3 | JGI24739J22299_10007358 | 3300001989 | Bacteria | 4133 |
| 4 | JGI24739J22299_10007911 | 3300001989 | Bacteria | 3978 |
| 5 | JGI24739J22299_10010141 | 3300001989 | Bacteria | 3500 |
| 6 | JGI24737J22298_10006425 | 3300001990 | Bacteria | 4015 |
| 7 | JGI24737J22298_10017867 | 3300001990 | Bacteria | 2280 |
| 8 | JGI24737J22298_10111933 | 3300001990 | Bacteria | 807 |
| 9 | JGI24735J21928_10000112 | 3300002067 | Bacteria | 29556 |
| 10 | JGI24735J21928_10003160 | 3300002067 | Bacteria | 5639 |
| 11 | JGI24735J21928_10008835 | 3300002067 | Bacteria | 3250 |
| 12 | JGI24735J21928_10016148 | 3300002067 | Bacteria | 2322 |
| 13 | JGI24735J21928_10020077 | 3300002067 | Bacteria | 2049 |
| 14 | JGI24735J21928_10041790 | 3300002067 | Bacteria | 1336 |
| 15 | JGI24735J21928_10041859 | 3300002067 | Bacteria | 1334 |
| 16 | JGI24738J21930_10001789 | 3300002075 | Bacteria | 5850 |
| 17 | JGI24738J21930_10025831 | 3300002075 | Bacteria | 1206 |
| 18 | JGI25156J39149_1000219 | 3300002705 | Bacteria | 39858 |
| 19 | JGI25156J39149_1002857 | 3300002705 | Bacteria | 5925 |
| 20 | JGI25164J39214_1008578 | 3300002772 | Bacteria | 1018 |
| 21 | JGI25165J46597_1002266 | 3300003214 | Bacteria | 6625 |
| 22 | Ga0006556J51387_1024206 | 3300003479 | Bacteria | 921 |
| 23 | Ga0006554J51385_1019889 | 3300003567 | Bacteria | 1378 |
| 24 | Ga0006562J51391_1046179 | 3300003578 | Bacteria | 883 |
| 25 | Ga0055533_1000306 | 3300003756 | Bacteria | 24070 |
| 26 | Ga0055533_1003661 | 3300003756 | Bacteria | 3021 |
| 27 | Ga0055532_1000022 | 3300003758 | Bacteria | 248737 |
| 28 | Ga0055532_1001602 | 3300003758 | Bacteria | 5983 |
| 29 | Ga0055525_1002523 | 3300003759 | Bacteria | 1837 |
| 30 | Ga0055527_1000016 | 3300003760 | Bacteria | 248736 |
| 31 | Ga0055535_1000017 | 3300003761 | Bacteria | 248735 |
| 32 | Ga0055542_1000030 | 3300003762 | Bacteria | 248717 |
| 33 | Ga0055529_1000033 | 3300003763 | Bacteria | 248734 |
| 34 | Ga0055531_10000317 | 3300003794 | Bacteria | 47389 |
| 35 | Ga0058863_11823999 | 3300004799 | Unclassified | 748 |
| 36 | Ga0058861_11807144 | 3300004800 | Unclassified | 780 |
| 37 | Ga0058860_12166380 | 3300004801 | Unclassified | 814 |
| 38 | Ga0058862_10139900 | 3300004803 | Unclassified | 804 |
| 39 | Ga0058862_12455986 | 3300004803 | Bacteria | 1176 |
| 40 | Ga0065165_1000489 | 3300005262 | Bacteria | 61162 |
| 41 | Ga0065712_10001293 | 3300005290 | Bacteria | 7578 |
| 42 | Ga0065712_10068048 | 3300005290 | Bacteria | 16088 |
| 43 | Ga0065712_10078230 | 3300005290 | Bacteria | 3376 |
| 44 | Ga0065715_10088924 | 3300005293 | Bacteria | 28459 |
| 45 | Ga0065715_10211111 | 3300005293 | Bacteria | 1314 |
| 46 | Ga0065715_10253367 | 3300005293 | Unclassified | 1149 |
| 47 | Ga0065707_10088203 | 3300005295 | Bacteria | 4741 |
| 48 | Ga0065707_10451990 | 3300005295 | Bacteria | 799 |
| 49 | Ga0065707_10525249 | 3300005295 | Bacteria | 739 |
| 50 | Ga0070658_10003087 | 3300005327 | Bacteria | 13742 |
| 51 | Ga0070658_10004656 | 3300005327 | Bacteria | 11161 |
| 52 | Ga0070658_10006183 | 3300005327 | Bacteria | 9707 |
| 53 | Ga0070658_10013021 | 3300005327 | Bacteria | 6675 |
| 54 | Ga0070658_10043430 | 3300005327 | Bacteria | 3631 |
| 55 | Ga0070658_10110515 | 3300005327 | Bacteria | 2277 |
| 56 | Ga0070658_10135860 | 3300005327 | Bacteria | 2052 |
| 57 | Ga0070658_10160620 | 3300005327 | Bacteria | 1885 |
| 58 | Ga0070658_10272347 | 3300005327 | Bacteria | 1440 |
| 59 | Ga0070676_10054969 | 3300005328 | Bacteria | 2348 |
| 60 | Ga0070683_100018296 | 3300005329 | Bacteria | 6203 |
| 61 | Ga0070683_100047351 | 3300005329 | Bacteria | 3972 |
| 62 | Ga0070683_100756869 | 3300005329 | Bacteria | 931 |
| 63 | Ga0070670_100001241 | 3300005331 | Bacteria | 20292 |
| 64 | Ga0070670_100008380 | 3300005331 | Bacteria | 8811 |
| 65 | Ga0070677_10024857 | 3300005333 | Bacteria | 2231 |
| 66 | Ga0070677_10043998 | 3300005333 | Bacteria | 1775 |
| 67 | Ga0070666_10017611 | 3300005335 | Bacteria | 4583 |
| 68 | Ga0070666_10038616 | 3300005335 | Bacteria | 3178 |
| 69 | Ga0070666_10116260 | 3300005335 | Unclassified | 1852 |
| 70 | Ga0070680_100008371 | 3300005336 | Bacteria | 7920 |
| 71 | Ga0068868_100014826 | 3300005338 | Bacteria | 5753 |
| 72 | Ga0068868_100063143 | 3300005338 | Bacteria | 2938 |
| 73 | Ga0068868_100163794 | 3300005338 | Bacteria | 1838 |
| 74 | Ga0070660_100002014 | 3300005339 | Bacteria | 14009 |
| 75 | Ga0070660_100003253 | 3300005339 | Bacteria | 11151 |
| 76 | Ga0070660_100078332 | 3300005339 | Bacteria | 2592 |
| 77 | Ga0070660_100085875 | 3300005339 | Bacteria | 2475 |
| 78 | Ga0070689_100124485 | 3300005340 | Bacteria | 2062 |
| 79 | Ga0070691_10023615 | 3300005341 | Bacteria | 2856 |
| 80 | Ga0070687_100052376 | 3300005343 | Bacteria | 2118 |
| 81 | Ga0070661_100001747 | 3300005344 | Bacteria | 15072 |
| 82 | Ga0070661_100018903 | 3300005344 | Bacteria | 4907 |
| 83 | Ga0070661_100028212 | 3300005344 | Unclassified | 4047 |
| 84 | Ga0070661_100032230 | 3300005344 | Bacteria | 3793 |
| 85 | Ga0070692_10193033 | 3300005345 | Bacteria | 1188 |
| 86 | Ga0070668_100064795 | 3300005347 | Bacteria | 2833 |
| 87 | Ga0070669_100003151 | 3300005353 | Bacteria | 11858 |
| 88 | Ga0070675_100011196 | 3300005354 | Bacteria | 7018 |
| 89 | Ga0070675_100047571 | 3300005354 | Bacteria | 3514 |
| 90 | Ga0070671_100009662 | 3300005355 | Bacteria | 7749 |
| 91 | Ga0070671_100121588 | 3300005355 | Bacteria | 2197 |
| 92 | Ga0070671_100167476 | 3300005355 | Bacteria | 1858 |
| 93 | Ga0070674_100005072 | 3300005356 | Bacteria | 7569 |
| 94 | Ga0070674_100063552 | 3300005356 | Bacteria | 2584 |
| 95 | Ga0070673_100007590 | 3300005364 | Bacteria | 7173 |
| 96 | Ga0070673_100015973 | 3300005364 | Bacteria | 5291 |
| 97 | Ga0070673_100146559 | 3300005364 | Bacteria | 1996 |
| 98 | Ga0070659_100009464 | 3300005366 | Bacteria | 7159 |
| 99 | Ga0070659_100387901 | 3300005366 | Unclassified | 1177 |
| 100 | Ga0070667_100018740 | 3300005367 | Bacteria | 5741 |
| 101 | Ga0070667_100059040 | 3300005367 | Bacteria | 3244 |
| 102 | Ga0070667_100100440 | 3300005367 | Bacteria | 2499 |
| 103 | Ga0070714_100079538 | 3300005435 | Bacteria | 2851 |
| 104 | Ga0070710_10039981 | 3300005437 | Bacteria | 2583 |
| 105 | Ga0070711_100040343 | 3300005439 | Bacteria | 3148 |
| 106 | Ga0070711_100536687 | 3300005439 | Bacteria | 969 |
| 107 | Ga0070705_100052916 | 3300005440 | Bacteria | 2374 |
| 108 | Ga0070700_100039036 | 3300005441 | Bacteria | 2897 |
| 109 | Ga0070694_100027560 | 3300005444 | Unclassified | 3690 |
| 110 | Ga0070694_100176327 | 3300005444 | Bacteria | 1578 |
| 111 | Ga0070694_100498588 | 3300005444 | Bacteria | 969 |
| 112 | Ga0070708_100043219 | 3300005445 | Bacteria | 3959 |
| 113 | Ga0070708_100163120 | 3300005445 | Bacteria | 2077 |
| 114 | Ga0070708_100432244 | 3300005445 | Bacteria | 1242 |
| 115 | Ga0070663_100012253 | 3300005455 | Bacteria | 5415 |
| 116 | Ga0070663_100189702 | 3300005455 | Bacteria | 1599 |
| 117 | Ga0070663_100319187 | 3300005455 | Bacteria | 1249 |
| 118 | Ga0070663_100539348 | 3300005455 | Bacteria | 974 |
| 119 | Ga0070678_100004858 | 3300005456 | Bacteria | 7677 |
| 120 | Ga0070678_100162194 | 3300005456 | Bacteria | 1812 |
| 121 | Ga0070662_100021633 | 3300005457 | Bacteria | 4394 |
| 122 | Ga0070681_10004285 | 3300005458 | Bacteria | 13543 |
| 123 | Ga0070681_10007917 | 3300005458 | Bacteria | 10399 |
| 124 | Ga0070681_10022516 | 3300005458 | Bacteria | 6327 |
| 125 | Ga0070681_10028372 | 3300005458 | Bacteria | 5626 |
| 126 | Ga0068867_100000031 | 3300005459 | Bacteria | 85969 |
| 127 | Ga0068867_100021037 | 3300005459 | Bacteria | 4653 |
| 128 | Ga0068867_100067543 | 3300005459 | Bacteria | 2666 |
| 129 | Ga0070706_100006506 | 3300005467 | Bacteria | 11029 |
| 130 | Ga0070706_100303251 | 3300005467 | Bacteria | 1490 |
| 131 | Ga0070707_100420942 | 3300005468 | Bacteria | 1296 |
| 132 | Ga0070698_100000360 | 3300005471 | Bacteria | 47129 |
| 133 | Ga0070698_100101436 | 3300005471 | Bacteria | 2849 |
| 134 | Ga0070698_100478909 | 3300005471 | Bacteria | 1181 |
| 135 | Ga0070698_100491490 | 3300005471 | Bacteria | 1165 |
| 136 | Ga0070699_100008542 | 3300005518 | Bacteria | 8875 |
| 137 | Ga0070699_100009432 | 3300005518 | Bacteria | 8456 |
| 138 | Ga0070699_100024044 | 3300005518 | Bacteria | 5250 |
| 139 | Ga0070699_100037577 | 3300005518 | Bacteria | 4192 |
| 140 | Ga0070679_100015194 | 3300005530 | Bacteria | 7397 |
| 141 | Ga0070679_100105860 | 3300005530 | Bacteria | 2799 |
| 142 | Ga0070679_100106501 | 3300005530 | Bacteria | 2789 |
| 143 | Ga0070684_100336698 | 3300005535 | Unclassified | 1387 |
| 144 | Ga0070684_100590117 | 3300005535 | Bacteria | 1033 |
| 145 | Ga0070697_100009047 | 3300005536 | Bacteria | 7782 |
| 146 | Ga0070697_100057612 | 3300005536 | Bacteria | 3161 |
| 147 | Ga0070697_100090194 | 3300005536 | Bacteria | 2533 |
| 148 | Ga0070697_100096908 | 3300005536 | Bacteria | 2447 |
| 149 | Ga0070697_100729774 | 3300005536 | Bacteria | 875 |
| 150 | Ga0068853_100011721 | 3300005539 | Bacteria | 7124 |
| 151 | Ga0068853_100759059 | 3300005539 | Bacteria | 927 |
| 152 | Ga0070672_100154414 | 3300005543 | Bacteria | 1901 |
| 153 | Ga0070672_100162864 | 3300005543 | Bacteria | 1852 |
| 154 | Ga0070686_100010413 | 3300005544 | Bacteria | 5241 |
| 155 | Ga0070695_100009516 | 3300005545 | Bacteria | 5789 |
| 156 | Ga0070695_100010479 | 3300005545 | Bacteria | 5534 |
| 157 | Ga0070695_100011818 | 3300005545 | Bacteria | 5224 |
| 158 | Ga0070695_100417562 | 3300005545 | Bacteria | 1021 |
| 159 | Ga0070696_100005007 | 3300005546 | Bacteria | 8854 |
| 160 | Ga0070696_100011139 | 3300005546 | Bacteria | 6017 |
| 161 | Ga0070693_100012746 | 3300005547 | Bacteria | 4263 |
| 162 | Ga0070693_100271851 | 3300005547 | Bacteria | 1131 |
| 163 | Ga0070693_100341616 | 3300005547 | Bacteria | 1022 |
| 164 | Ga0070665_100371413 | 3300005548 | Bacteria | 1437 |
| 165 | Ga0070665_100378371 | 3300005548 | Unclassified | 1423 |
| 166 | Ga0070704_100003123 | 3300005549 | Bacteria | 9449 |
| 167 | Ga0070704_100115276 | 3300005549 | Bacteria | 2053 |
| 168 | Ga0070704_100214352 | 3300005549 | Bacteria | 1562 |
| 169 | Ga0070704_100766744 | 3300005549 | Bacteria | 860 |
| 170 | Ga0068855_100010091 | 3300005563 | Bacteria | 11383 |
| 171 | Ga0068855_100026348 | 3300005563 | Bacteria | 6954 |
| 172 | Ga0068855_100065945 | 3300005563 | Bacteria | 4221 |
| 173 | Ga0068855_100884376 | 3300005563 | Bacteria | 945 |
| 174 | Ga0070664_100001859 | 3300005564 | Bacteria | 16917 |
| 175 | Ga0070664_100005743 | 3300005564 | Bacteria | 10004 |
| 176 | Ga0068857_100028110 | 3300005577 | Bacteria | 4961 |
| 177 | Ga0068857_100339349 | 3300005577 | Bacteria | 1390 |
| 178 | Ga0068854_100036899 | 3300005578 | Bacteria | 3428 |
| 179 | Ga0068854_100070369 | 3300005578 | Bacteria | 2557 |
| 180 | Ga0068854_100162708 | 3300005578 | Bacteria | 1730 |
| 181 | Ga0068854_100477050 | 3300005578 | Bacteria | 1047 |
| 182 | Ga0068856_100006744 | 3300005614 | Bacteria | 11246 |
| 183 | Ga0068856_100009816 | 3300005614 | Bacteria | 9298 |
| 184 | Ga0068856_100084585 | 3300005614 | Bacteria | 3151 |
| 185 | Ga0068856_100408432 | 3300005614 | Bacteria | 1378 |
| 186 | Ga0068852_100005526 | 3300005616 | Bacteria | 9060 |
| 187 | Ga0068852_100011776 | 3300005616 | Bacteria | 6604 |
| 188 | Ga0068852_100012112 | 3300005616 | Bacteria | 6531 |
| 189 | Ga0068852_100012336 | 3300005616 | Bacteria | 6482 |
| 190 | Ga0068852_100096782 | 3300005616 | Bacteria | 2654 |
| 191 | Ga0068852_100435871 | 3300005616 | Bacteria | 1295 |
| 192 | Ga0068859_100231085 | 3300005617 | Bacteria | 1938 |
| 193 | Ga0068864_100199184 | 3300005618 | Bacteria | 1839 |
| 194 | Ga0068851_10000435 | 3300005834 | Bacteria | 18666 |
| 195 | Ga0068851_10011188 | 3300005834 | Bacteria | 4203 |
| 196 | Ga0068851_10068528 | 3300005834 | Bacteria | 1831 |
| 197 | Ga0068870_10267937 | 3300005840 | Bacteria | 1066 |
| 198 | Ga0068863_100706750 | 3300005841 | Bacteria | 1002 |
| 199 | Ga0068860_100543685 | 3300005843 | Bacteria | 1163 |
| 200 | Ga0081455_10280774 | 3300005937 | Bacteria | 1203 |
| 201 | Ga0081538_10118502 | 3300005981 | Bacteria | 1279 |
| 202 | Ga0075365_10018211 | 3300006038 | Bacteria | 4314 |
| 203 | Ga0075365_10021202 | 3300006038 | Bacteria | 4048 |
| 204 | Ga0075368_10020446 | 3300006042 | Bacteria | 2508 |
| 205 | Ga0075363_100043761 | 3300006048 | Bacteria | 2369 |
| 206 | Ga0075363_100152419 | 3300006048 | Bacteria | 1305 |
| 207 | Ga0075364_10008898 | 3300006051 | Bacteria | 6014 |
| 208 | Ga0070716_100019172 | 3300006173 | Bacteria | 3573 |
| 209 | Ga0070716_100072625 | 3300006173 | Bacteria | 2026 |
| 210 | Ga0070712_100150211 | 3300006175 | Bacteria | 1788 |
| 211 | Ga0075362_10085592 | 3300006177 | Bacteria | 1457 |
| 212 | Ga0075367_10068082 | 3300006178 | Bacteria | 2135 |
| 213 | Ga0075369_10123157 | 3300006186 | Bacteria | 1175 |
| 214 | Ga0075366_10193631 | 3300006195 | Bacteria | 1236 |
| 215 | Ga0075366_10270604 | 3300006195 | Bacteria | 1037 |
| 216 | Ga0097621_100014106 | 3300006237 | Bacteria | 5973 |
| 217 | Ga0097621_100030594 | 3300006237 | Bacteria | 4263 |
| 218 | Ga0075370_10003614 | 3300006353 | Bacteria | 7398 |
| 219 | Ga0068871_100031263 | 3300006358 | Bacteria | 4197 |
| 220 | Ga0068871_100567747 | 3300006358 | Bacteria | 1029 |
| 221 | Ga0075428_100107410 | 3300006844 | Bacteria | 3042 |
| 222 | Ga0075428_100720102 | 3300006844 | Bacteria | 1063 |
| 223 | Ga0075430_100106627 | 3300006846 | Bacteria | 2337 |
| 224 | Ga0075430_100278682 | 3300006846 | Bacteria | 1383 |
| 225 | Ga0075431_100124180 | 3300006847 | Bacteria | 2663 |
| 226 | Ga0075431_100647245 | 3300006847 | Bacteria | 1038 |
| 227 | Ga0075433_10141249 | 3300006852 | Bacteria | 2140 |
| 228 | Ga0075433_10221195 | 3300006852 | Bacteria | 1682 |
| 229 | Ga0075433_10392391 | 3300006852 | Bacteria | 1225 |
| 230 | Ga0075433_10448182 | 3300006852 | Bacteria | 1138 |
| 231 | Ga0075434_100006779 | 3300006871 | Bacteria | 10528 |
| 232 | Ga0075434_100031307 | 3300006871 | Bacteria | 5244 |
| 233 | Ga0075434_100051193 | 3300006871 | Bacteria | 4103 |
| 234 | Ga0075434_100084202 | 3300006871 | Bacteria | 3178 |
| 235 | Ga0075434_100171505 | 3300006871 | Bacteria | 2190 |
| 236 | Ga0075434_100624016 | 3300006871 | Bacteria | 1097 |
| 237 | Ga0075429_100546923 | 3300006880 | Bacteria | 1015 |
| 238 | Ga0068865_100069440 | 3300006881 | Bacteria | 2493 |
| 239 | Ga0068865_100137545 | 3300006881 | Bacteria | 1838 |
| 240 | Ga0068865_100380522 | 3300006881 | Bacteria | 1151 |
| 241 | Ga0075436_100003079 | 3300006914 | Bacteria | 11423 |
| 242 | Ga0075436_100013082 | 3300006914 | Bacteria | 5688 |
| 243 | Ga0075436_100099874 | 3300006914 | Bacteria | 2021 |
| 244 | Ga0075436_100102379 | 3300006914 | Bacteria | 1995 |
| 245 | Ga0075436_100103059 | 3300006914 | Bacteria | 1988 |
| 246 | Ga0075436_100146654 | 3300006914 | Bacteria | 1660 |
| 247 | Ga0075436_100336596 | 3300006914 | Bacteria | 1086 |
| 248 | Ga0075436_100691779 | 3300006914 | Bacteria | 755 |
| 249 | Ga0097620_100231069 | 3300006931 | Bacteria | 1938 |
| 250 | Ga0075435_100037443 | 3300007076 | Bacteria | 3863 |
| 251 | Ga0075435_100079990 | 3300007076 | Bacteria | 2683 |
| 252 | Ga0075435_100110225 | 3300007076 | Bacteria | 2289 |
| 253 | Ga0075435_100186734 | 3300007076 | Bacteria | 1753 |
| 254 | Ga0075435_100360710 | 3300007076 | Bacteria | 1246 |
| 255 | Ga0075435_100551896 | 3300007076 | Unclassified | 998 |
| 256 | Ga0099794_10389510 | 3300007265 | Bacteria | 727 |
| 257 | Ga0099795_10038086 | 3300007788 | Bacteria | 1696 |
| 258 | Ga0099795_10177452 | 3300007788 | Bacteria | 888 |
| 259 | Ga0105251_10000157 | 3300009011 | Bacteria | 69461 |
| 260 | Ga0105251_10089188 | 3300009011 | Bacteria | 1418 |
| 261 | Ga0105244_10138845 | 3300009036 | Bacteria | 1170 |
| 262 | Ga0105240_10007978 | 3300009093 | Bacteria | 15267 |
| 263 | Ga0105240_10050343 | 3300009093 | Bacteria | 5253 |
| 264 | Ga0105240_10624706 | 3300009093 | Bacteria | 1183 |
| 265 | Ga0111539_10029117 | 3300009094 | Bacteria | 6733 |
| 266 | Ga0111539_10132057 | 3300009094 | Bacteria | 2924 |
| 267 | Ga0111539_10551206 | 3300009094 | Bacteria | 1343 |
| 268 | Ga0105245_10435126 | 3300009098 | Bacteria | 1317 |
| 269 | Ga0105247_10077517 | 3300009101 | Bacteria | 2089 |
| 270 | Ga0105247_10476721 | 3300009101 | Bacteria | 905 |
| 271 | Ga0114129_10008335 | 3300009147 | Bacteria | 14783 |
| 272 | Ga0114129_10184466 | 3300009147 | Bacteria | 2837 |
| 273 | Ga0114129_10335763 | 3300009147 | Bacteria | 2006 |
| 274 | Ga0114129_10412616 | 3300009147 | Bacteria | 1778 |
| 275 | Ga0114129_11492760 | 3300009147 | Bacteria | 831 |
| 276 | Ga0114129_11757201 | 3300009147 | Bacteria | 755 |
| 277 | Ga0105243_10063465 | 3300009148 | Bacteria | 2960 |
| 278 | Ga0105241_10031258 | 3300009174 | Bacteria | 3986 |
| 279 | Ga0105241_10440032 | 3300009174 | Bacteria | 1151 |
| 280 | Ga0105241_10932765 | 3300009174 | Bacteria | 808 |
| 281 | Ga0105242_10014349 | 3300009176 | Bacteria | 6137 |
| 282 | Ga0105242_10106966 | 3300009176 | Unclassified | 2378 |
| 283 | Ga0105248_10108510 | 3300009177 | Bacteria | 3130 |
| 284 | Ga0105248_10246908 | 3300009177 | Bacteria | 2009 |
| 285 | Ga0105237_10003909 | 3300009545 | Bacteria | 17462 |
| 286 | Ga0105237_10091255 | 3300009545 | Bacteria | 3036 |
| 287 | Ga0105237_10179507 | 3300009545 | Bacteria | 2117 |
| 288 | Ga0105238_10013643 | 3300009551 | Bacteria | 8205 |
| 289 | Ga0105238_10020173 | 3300009551 | Bacteria | 6784 |
| 290 | Ga0105238_10504880 | 3300009551 | Bacteria | 1210 |
| 291 | Ga0105239_10005610 | 3300010375 | Bacteria | 14674 |
| 292 | Ga0105239_10336620 | 3300010375 | Bacteria | 1703 |
| 293 | Ga0105246_10026306 | 3300011119 | Unclassified | 3799 |
| 294 | Ga0157373_10047080 | 3300013100 | Bacteria | 3077 |
| 295 | Ga0157373_10099058 | 3300013100 | Bacteria | 2051 |
| 296 | Ga0157371_10000739 | 3300013102 | Bacteria | 38165 |
| 297 | Ga0157371_10029805 | 3300013102 | Bacteria | 3942 |
| 298 | Ga0157371_10127553 | 3300013102 | Bacteria | 1809 |
| 299 | Ga0157370_10000965 | 3300013104 | Bacteria | 36401 |
| 300 | Ga0157370_10004637 | 3300013104 | Bacteria | 15715 |
| 301 | Ga0157370_10007365 | 3300013104 | Bacteria | 11998 |
| 302 | Ga0157370_10011838 | 3300013104 | Bacteria | 9100 |
| 303 | Ga0157370_10159855 | 3300013104 | Bacteria | 2096 |
| 304 | Ga0157369_10001012 | 3300013105 | Bacteria | 35358 |
| 305 | Ga0157369_10005380 | 3300013105 | Bacteria | 14908 |
| 306 | Ga0157369_10010373 | 3300013105 | Bacteria | 10620 |
| 307 | Ga0157369_10252308 | 3300013105 | Bacteria | 1841 |
| 308 | Ga0157369_10473548 | 3300013105 | Bacteria | 1296 |
| 309 | Ga0157369_10809158 | 3300013105 | Bacteria | 963 |
| 310 | Ga0157374_10003804 | 3300013296 | Bacteria | 12691 |
| 311 | Ga0157374_10011164 | 3300013296 | Bacteria | 7765 |
| 312 | Ga0157374_10016646 | 3300013296 | Bacteria | 6466 |
| 313 | Ga0157378_10012733 | 3300013297 | Bacteria | 7361 |
| 314 | Ga0157378_10025323 | 3300013297 | Bacteria | 5225 |
| 315 | Ga0157378_10111384 | 3300013297 | Bacteria | 2510 |
| 316 | Ga0157378_10196650 | 3300013297 | Bacteria | 1905 |
| 317 | Ga0163162_10028105 | 3300013306 | Bacteria | 5563 |
| 318 | Ga0163162_10132062 | 3300013306 | Bacteria | 2606 |
| 319 | Ga0163162_10413361 | 3300013306 | Bacteria | 1481 |
| 320 | Ga0157372_10011957 | 3300013307 | Bacteria | 9248 |
| 321 | Ga0157372_10091848 | 3300013307 | Bacteria | 3452 |
| 322 | Ga0157372_10128868 | 3300013307 | Bacteria | 2910 |
| 323 | Ga0157375_10049473 | 3300013308 | Bacteria | 4119 |
| 324 | Ga0163163_10028824 | 3300014325 | Bacteria | 5335 |
| 325 | Ga0182008_10123010 | 3300014497 | Bacteria | 1290 |
| 326 | Ga0157377_10000235 | 3300014745 | Bacteria | 28671 |
| 327 | Ga0157376_10081213 | 3300014969 | Unclassified | 2783 |
| 328 | Ga0182006_1028847 | 3300015261 | Bacteria | 2253 |
| 329 | Ga0182007_10001687 | 3300015262 | Bacteria | 11693 |
| 330 | Ga0182007_10006143 | 3300015262 | Bacteria | 5187 |
| 331 | Ga0182007_10073794 | 3300015262 | Bacteria | 1118 |
| 332 | Ga0206356_10151721 | 3300020070 | Unclassified | 792 |
| 333 | Ga0206356_10563753 | 3300020070 | Bacteria | 1095 |
| 334 | Ga0206356_11575614 | 3300020070 | Bacteria | 724 |
| 335 | Ga0206349_1007483 | 3300020075 | Bacteria | 688 |
| 336 | Ga0206355_1615061 | 3300020076 | Bacteria | 2238 |
| 337 | Ga0206351_10719405 | 3300020077 | Bacteria | 893 |
| 338 | Ga0206352_10228866 | 3300020078 | Unclassified | 677 |
| 339 | Ga0206352_11331274 | 3300020078 | Bacteria | 1305 |
| 340 | Ga0206350_10756569 | 3300020080 | Bacteria | 2495 |
| 341 | Ga0206350_11076876 | 3300020080 | Bacteria | 798 |
| 342 | Ga0206353_10002810 | 3300020082 | Bacteria | 821 |
| 343 | Ga0206353_11275437 | 3300020082 | Unclassified | 759 |
| 344 | Ga0224712_10032476 | 3300022467 | Bacteria | 1903 |
| 345 | Ga0224712_10135079 | 3300022467 | Bacteria | 1080 |
| 346 | Ga0209435_102216 | 3300025206 | Bacteria | 2308 |
| 347 | Ga0209566_100472 | 3300025225 | Bacteria | 28862 |
| 348 | Ga0209674_100017 | 3300025226 | Bacteria | 689087 |
| 349 | Ga0209674_100211 | 3300025226 | Bacteria | 58106 |
| 350 | Ga0209674_102160 | 3300025226 | Bacteria | 4422 |
| 351 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 352 | Ga0209672_100271 | 3300025228 | Bacteria | 38041 |
| 353 | Ga0209672_103474 | 3300025228 | Bacteria | 3242 |
| 354 | Ga0209147_100022 | 3300025229 | Bacteria | 443906 |
| 355 | Ga0209147_100121 | 3300025229 | Bacteria | 139167 |
| 356 | Ga0209563_101145 | 3300025230 | Bacteria | 7447 |
| 357 | Ga0207427_101579 | 3300025231 | Bacteria | 7853 |
| 358 | Ga0209258_100033 | 3300025242 | Bacteria | 443845 |
| 359 | Ga0209677_111067 | 3300025253 | Bacteria | 1441 |
| 360 | Ga0209148_1000046 | 3300025254 | Bacteria | 443881 |
| 361 | Ga0209759_1000331 | 3300025256 | Bacteria | 62167 |
| 362 | Ga0209759_1000366 | 3300025256 | Bacteria | 56702 |
| 363 | Ga0209759_1010528 | 3300025256 | Bacteria | 2705 |
| 364 | Ga0209759_1016444 | 3300025256 | Bacteria | 1869 |
| 365 | Ga0209233_1000050 | 3300025261 | Bacteria | 450736 |
| 366 | Ga0209455_1000038 | 3300025272 | Bacteria | 443899 |
| 367 | Ga0209130_1005176 | 3300025284 | Bacteria | 4621 |
| 368 | Ga0209564_1007781 | 3300025295 | Bacteria | 5441 |
| 369 | Ga0207426_1000004 | 3300025302 | Bacteria | 1047900 |
| 370 | Ga0207426_1004157 | 3300025302 | Bacteria | 7237 |
| 371 | Ga0207697_10003982 | 3300025315 | Bacteria | 7167 |
| 372 | Ga0207656_10007085 | 3300025321 | Bacteria | 4072 |
| 373 | Ga0207656_10013184 | 3300025321 | Bacteria | 3154 |
| 374 | Ga0207656_10067097 | 3300025321 | Bacteria | 1587 |
| 375 | Ga0207696_1064564 | 3300025711 | Bacteria | 1025 |
| 376 | Ga0207655_1120899 | 3300025728 | Bacteria | 868 |
| 377 | Ga0207713_1000336 | 3300025735 | Bacteria | 52391 |
| 378 | Ga0207713_1012631 | 3300025735 | Bacteria | 4499 |
| 379 | Ga0207682_10017545 | 3300025893 | Bacteria | 2796 |
| 380 | Ga0207688_10015407 | 3300025901 | Bacteria | 4146 |
| 381 | Ga0207680_10014305 | 3300025903 | Bacteria | 4101 |
| 382 | Ga0207680_10038507 | 3300025903 | Bacteria | 2767 |
| 383 | Ga0207680_10078446 | 3300025903 | Bacteria | 2068 |
| 384 | Ga0207647_10000396 | 3300025904 | Bacteria | 35814 |
| 385 | Ga0207647_10003690 | 3300025904 | Bacteria | 11445 |
| 386 | Ga0207647_10026012 | 3300025904 | Bacteria | 3834 |
| 387 | Ga0207647_10028846 | 3300025904 | Bacteria | 3599 |
| 388 | Ga0207647_10030002 | 3300025904 | Bacteria | 3513 |
| 389 | Ga0207647_10040542 | 3300025904 | Bacteria | 2932 |
| 390 | Ga0207699_10027168 | 3300025906 | Bacteria | 3165 |
| 391 | Ga0207645_10066014 | 3300025907 | Bacteria | 2313 |
| 392 | Ga0207705_10012575 | 3300025909 | Bacteria | 6109 |
| 393 | Ga0207705_10024026 | 3300025909 | Bacteria | 4349 |
| 394 | Ga0207705_10175222 | 3300025909 | Bacteria | 1616 |
| 395 | Ga0207705_10348320 | 3300025909 | Bacteria | 1141 |
| 396 | Ga0207684_10010463 | 3300025910 | Bacteria | 8166 |
| 397 | Ga0207684_10029127 | 3300025910 | Bacteria | 4704 |
| 398 | Ga0207684_10214320 | 3300025910 | Bacteria | 1661 |
| 399 | Ga0207684_10639638 | 3300025910 | Bacteria | 907 |
| 400 | Ga0207654_10063090 | 3300025911 | Bacteria | 2173 |
| 401 | Ga0207654_10092655 | 3300025911 | Bacteria | 1845 |
| 402 | Ga0207654_10364327 | 3300025911 | Unclassified | 998 |
| 403 | Ga0207707_10013398 | 3300025912 | Bacteria | 7149 |
| 404 | Ga0207707_10041491 | 3300025912 | Bacteria | 4018 |
| 405 | Ga0207707_10089484 | 3300025912 | Bacteria | 2690 |
| 406 | Ga0207707_10438474 | 3300025912 | Bacteria | 1118 |
| 407 | Ga0207695_10004994 | 3300025913 | Bacteria | 17834 |
| 408 | Ga0207695_10007589 | 3300025913 | Bacteria | 13751 |
| 409 | Ga0207695_10133103 | 3300025913 | Bacteria | 2442 |
| 410 | Ga0207695_10229180 | 3300025913 | Bacteria | 1763 |
| 411 | Ga0207671_10012713 | 3300025914 | Bacteria | 6752 |
| 412 | Ga0207671_10218474 | 3300025914 | Bacteria | 1493 |
| 413 | Ga0207693_10584217 | 3300025915 | Bacteria | 870 |
| 414 | Ga0207660_10354491 | 3300025917 | Bacteria | 1176 |
| 415 | Ga0207662_10234999 | 3300025918 | Bacteria | 1198 |
| 416 | Ga0207657_10006089 | 3300025919 | Bacteria | 12550 |
| 417 | Ga0207657_10007609 | 3300025919 | Bacteria | 11089 |
| 418 | Ga0207657_10024918 | 3300025919 | Bacteria | 5528 |
| 419 | Ga0207649_10001822 | 3300025920 | Bacteria | 12167 |
| 420 | Ga0207649_10095757 | 3300025920 | Bacteria | 1954 |
| 421 | Ga0207649_10098907 | 3300025920 | Bacteria | 1926 |
| 422 | Ga0207649_10253253 | 3300025920 | Bacteria | 1269 |
| 423 | Ga0207652_10075966 | 3300025921 | Bacteria | 2928 |
| 424 | Ga0207652_10151951 | 3300025921 | Bacteria | 2073 |
| 425 | Ga0207646_10024812 | 3300025922 | Bacteria | 5488 |
| 426 | Ga0207646_10032895 | 3300025922 | Bacteria | 4690 |
| 427 | Ga0207646_10108850 | 3300025922 | Bacteria | 2486 |
| 428 | Ga0207681_10368747 | 3300025923 | Unclassified | 1153 |
| 429 | Ga0207694_10002912 | 3300025924 | Bacteria | 13776 |
| 430 | Ga0207694_10109155 | 3300025924 | Bacteria | 2199 |
| 431 | Ga0207650_10001712 | 3300025925 | Bacteria | 15568 |
| 432 | Ga0207650_10001913 | 3300025925 | Bacteria | 14662 |
| 433 | Ga0207650_10627557 | 3300025925 | Bacteria | 905 |
| 434 | Ga0207659_10055875 | 3300025926 | Bacteria | 2825 |
| 435 | Ga0207659_10108350 | 3300025926 | Bacteria | 2107 |
| 436 | Ga0207687_10184630 | 3300025927 | Bacteria | 1618 |
| 437 | Ga0207664_10155657 | 3300025929 | Bacteria | 1945 |
| 438 | Ga0207664_10944061 | 3300025929 | Bacteria | 774 |
| 439 | Ga0207644_10003354 | 3300025931 | Bacteria | 10333 |
| 440 | Ga0207644_10176030 | 3300025931 | Bacteria | 1674 |
| 441 | Ga0207644_10639097 | 3300025931 | Bacteria | 885 |
| 442 | Ga0207690_10005945 | 3300025932 | Bacteria | 7226 |
| 443 | Ga0207690_10260098 | 3300025932 | Bacteria | 1344 |
| 444 | Ga0207690_10321293 | 3300025932 | Bacteria | 1217 |
| 445 | Ga0207706_10000853 | 3300025933 | Bacteria | 31374 |
| 446 | Ga0207706_10162609 | 3300025933 | Bacteria | 1962 |
| 447 | Ga0207686_10193587 | 3300025934 | Bacteria | 1451 |
| 448 | Ga0207709_10009168 | 3300025935 | Bacteria | 5451 |
| 449 | Ga0207670_10279091 | 3300025936 | Bacteria | 1301 |
| 450 | Ga0207669_10058531 | 3300025937 | Bacteria | 2351 |
| 451 | Ga0207704_10086042 | 3300025938 | Bacteria | 2049 |
| 452 | Ga0207665_10032835 | 3300025939 | Bacteria | 3437 |
| 453 | Ga0207665_10054478 | 3300025939 | Bacteria | 2697 |
| 454 | Ga0207665_10252384 | 3300025939 | Bacteria | 1304 |
| 455 | Ga0207691_10009758 | 3300025940 | Bacteria | 9215 |
| 456 | Ga0207691_10012098 | 3300025940 | Bacteria | 8273 |
| 457 | Ga0207711_10410838 | 3300025941 | Unclassified | 1258 |
| 458 | Ga0207689_10179150 | 3300025942 | Bacteria | 1748 |
| 459 | Ga0207689_10410111 | 3300025942 | Bacteria | 1130 |
| 460 | Ga0207679_10018716 | 3300025945 | Bacteria | 4645 |
| 461 | Ga0207679_10030199 | 3300025945 | Bacteria | 3782 |
| 462 | Ga0207667_10008902 | 3300025949 | Bacteria | 11878 |
| 463 | Ga0207667_10031926 | 3300025949 | Bacteria | 5680 |
| 464 | Ga0207667_10035988 | 3300025949 | Bacteria | 5309 |
| 465 | Ga0207667_10212428 | 3300025949 | Unclassified | 1983 |
| 466 | Ga0207651_10869089 | 3300025960 | Bacteria | 802 |
| 467 | Ga0207668_10087586 | 3300025972 | Bacteria | 2278 |
| 468 | Ga0207640_10014227 | 3300025981 | Bacteria | 4575 |
| 469 | Ga0207640_10124240 | 3300025981 | Bacteria | 1855 |
| 470 | Ga0207640_10326330 | 3300025981 | Bacteria | 1224 |
| 471 | Ga0207640_10861805 | 3300025981 | Bacteria | 789 |
| 472 | Ga0207658_10091679 | 3300025986 | Bacteria | 2358 |
| 473 | Ga0207658_10190715 | 3300025986 | Bacteria | 1703 |
| 474 | Ga0207658_10216383 | 3300025986 | Bacteria | 1609 |
| 475 | Ga0207677_10001053 | 3300026023 | Bacteria | 15130 |
| 476 | Ga0207677_10128648 | 3300026023 | Bacteria | 1918 |
| 477 | Ga0207677_10175298 | 3300026023 | Bacteria | 1681 |
| 478 | Ga0207639_10000520 | 3300026041 | Bacteria | 26585 |
| 479 | Ga0207639_10067478 | 3300026041 | Bacteria | 2783 |
| 480 | Ga0207678_10046935 | 3300026067 | Bacteria | 3735 |
| 481 | Ga0207678_10075196 | 3300026067 | Bacteria | 2893 |
| 482 | Ga0207678_10100602 | 3300026067 | Bacteria | 2469 |
| 483 | Ga0207678_10226518 | 3300026067 | Bacteria | 1600 |
| 484 | Ga0207708_10063567 | 3300026075 | Bacteria | 2820 |
| 485 | Ga0207702_10060129 | 3300026078 | Bacteria | 3238 |
| 486 | Ga0207702_10095787 | 3300026078 | Bacteria | 2609 |
| 487 | Ga0207702_10811355 | 3300026078 | Unclassified | 925 |
| 488 | Ga0207641_10943025 | 3300026088 | Bacteria | 858 |
| 489 | Ga0207648_10001189 | 3300026089 | Bacteria | 29139 |
| 490 | Ga0207648_10030812 | 3300026089 | Bacteria | 4747 |
| 491 | Ga0207676_10033488 | 3300026095 | Bacteria | 3882 |
| 492 | Ga0207674_10038495 | 3300026116 | Bacteria | 4961 |
| 493 | Ga0207674_10300735 | 3300026116 | Bacteria | 1553 |
| 494 | Ga0207683_10000838 | 3300026121 | Bacteria | 28142 |
| 495 | Ga0207683_10002698 | 3300026121 | Bacteria | 15506 |
| 496 | Ga0207698_10000603 | 3300026142 | Bacteria | 21081 |
| 497 | Ga0207698_10001098 | 3300026142 | Bacteria | 15752 |
| 498 | Ga0207698_10005537 | 3300026142 | Bacteria | 7816 |
| 499 | Ga0207698_10010801 | 3300026142 | Bacteria | 5890 |
| 500 | Ga0207698_10022534 | 3300026142 | Bacteria | 4380 |
| 501 | Ga0207698_10398314 | 3300026142 | Bacteria | 1315 |
| 502 | Ga0209371_1011284 | 3300027312 | Bacteria | 2665 |
| 503 | Ga0209984_1003102 | 3300027424 | Bacteria | 1885 |
| 504 | Ga0209968_1011434 | 3300027526 | Bacteria | 1376 |
| 505 | Ga0209970_1036755 | 3300027614 | Bacteria | 863 |
| 506 | Ga0210002_1006145 | 3300027617 | Bacteria | 1807 |
| 507 | Ga0210002_1011843 | 3300027617 | Bacteria | 1350 |
| 508 | Ga0209983_1015181 | 3300027665 | Bacteria | 1588 |
| 509 | Ga0209983_1017103 | 3300027665 | Bacteria | 1499 |
| 510 | Ga0209983_1032469 | 3300027665 | Bacteria | 1116 |
| 511 | Ga0209588_1021994 | 3300027671 | Bacteria | 2006 |
| 512 | Ga0209971_1001003 | 3300027682 | Bacteria | 7238 |
| 513 | Ga0209971_1034787 | 3300027682 | Bacteria | 1211 |
| 514 | Ga0209813_10042171 | 3300027866 | Bacteria | 1394 |
| 515 | Ga0209974_10002915 | 3300027876 | Bacteria | 6207 |
| 516 | Ga0209974_10006328 | 3300027876 | Bacteria | 4137 |
| 517 | Ga0209974_10043685 | 3300027876 | Bacteria | 1494 |
| 518 | Ga0268265_10464038 | 3300028380 | Bacteria | 1186 |
| 519 | Ga0268264_10497053 | 3300028381 | Bacteria | 1189 |
| 520 | Ga0268264_10793808 | 3300028381 | Bacteria | 945 |
| 521 | Ga0307515_10000219 | 3300028794 | Bacteria | 141532 |
| 522 | Ga0265338_10000159 | 3300028800 | Bacteria | 123495 |
| 523 | Ga0265338_10193381 | 3300028800 | Bacteria | 1540 |
| 524 | Ga0268256_1009781 | 3300030500 | Bacteria | 3148 |
| 525 | Ga0265332_10162881 | 3300031238 | Bacteria | 931 |
| 526 | Ga0265340_10142989 | 3300031247 | Bacteria | 1094 |
| 527 | Ga0265339_10002778 | 3300031249 | Bacteria | 12449 |
| 528 | Ga0307408_100003309 | 3300031548 | Bacteria | 11082 |
| 529 | Ga0307408_100027057 | 3300031548 | Bacteria | 3949 |
| 530 | Ga0307408_100372028 | 3300031548 | Bacteria | 1219 |
| 531 | Ga0307405_10018263 | 3300031731 | Bacteria | 3866 |
| 532 | Ga0307413_10188889 | 3300031824 | Bacteria | 1477 |
| 533 | Ga0307410_10155070 | 3300031852 | Bacteria | 1709 |
| 534 | Ga0307410_10296962 | 3300031852 | Bacteria | 1273 |
| 535 | Ga0307406_10518856 | 3300031901 | Bacteria | 969 |
| 536 | Ga0307407_10019840 | 3300031903 | Bacteria | 3431 |
| 537 | Ga0307407_10324002 | 3300031903 | Bacteria | 1082 |
| 538 | Ga0307412_10000011 | 3300031911 | Bacteria | 405842 |
| 539 | Ga0307412_10214523 | 3300031911 | Bacteria | 1471 |
| 540 | Ga0307409_100056694 | 3300031995 | Bacteria | 3031 |
| 541 | Ga0307409_100152197 | 3300031995 | Bacteria | 2010 |
| 542 | Ga0307409_100163271 | 3300031995 | Bacteria | 1951 |
| 543 | Ga0307409_100321625 | 3300031995 | Bacteria | 1448 |
| 544 | Ga0307416_100028718 | 3300032002 | Bacteria | 4142 |
| 545 | Ga0307416_100594523 | 3300032002 | Bacteria | 1185 |
| 546 | Ga0307416_100936678 | 3300032002 | Bacteria | 968 |
| 547 | Ga0307414_10007355 | 3300032004 | Bacteria | 6188 |
| 548 | Ga0307411_10033971 | 3300032005 | Bacteria | 3169 |
| 549 | Ga0307411_10382465 | 3300032005 | Bacteria | 1158 |
| 550 | Ga0307415_100095676 | 3300032126 | Bacteria | 2163 |
| 551 | Ga0307415_100834957 | 3300032126 | Bacteria | 844 |
| 552 | Ga0373929_0027199 | 3300035085 | Bacteria | 1200 |
| 553 | Ga0373934_0003851 | 3300035086 | Bacteria | 5519 |
| 554 | Ga0373923_0182594 | 3300035111 | Bacteria | 964 |
| 555 | Ga0373936_0016441 | 3300035113 | Bacteria | 2846 |
| 556 | Ga0373939_0107208 | 3300035114 | Bacteria | 968 |
| 557 | Ga0373945_0018911 | 3300035116 | Bacteria | 2348 |
| 558 | Ga0373953_0007056 | 3300035117 | Bacteria | 3740 |
| 559 | Ga0373956_0058093 | 3300035119 | Bacteria | 1748 |
| 560 | Ga0373957_0001050 | 3300035120 | Bacteria | 7296 |
| 561 | Ga0373955_0026251 | 3300035172 | Bacteria | 2998 |
| 562 | Ga0373955_0030261 | 3300035172 | Bacteria | 2824 |
| 563 | Ga0373924_0001454 | 3300035410 | Bacteria | 7699 |
| 564 | Ga0373924_0007996 | 3300035410 | Bacteria | 3828 |
| 565 | Ga0373935_0082656 | 3300035692 | Bacteria | 2089 |
| 566 | Ga0373935_0126432 | 3300035692 | Bacteria | 1713 |
| 567 | Ga0373927_0009366 | 3300035695 | Bacteria | 6569 |
| 568 | Ga0373927_0032345 | 3300035695 | Bacteria | 3407 |
| 569 | Ga0373927_0135661 | 3300035695 | Bacteria | 1608 |
| 570 | Ga0373927_0321067 | 3300035695 | Bacteria | 1020 |
| 571 | Ga0373933_0025633 | 3300035724 | Bacteria | 3382 |
| 572 | Ga0373933_0045247 | 3300035724 | Bacteria | 2609 |
| 573 | Ga0373947_0077381 | 3300035725 | Bacteria | 2052 |
| 574 | Ga0373937_0051508 | 3300036401 | Bacteria | 3773 |
| 575 | Ga0373937_0367808 | 3300036401 | Bacteria | 1363 |
| 576 | Ga0373925_0032407 | 3300037068 | Bacteria | 3846 |
| 577 | Ga0373925_0130053 | 3300037068 | Bacteria | 1962 |
| 578 | Ga0395899_0017035 | 3300037312 | Bacteria | 5536 |
| 579 | Ga0395899_0063257 | 3300037312 | Bacteria | 2722 |
| 580 | Ga0395899_0081333 | 3300037312 | Bacteria | 2357 |
| 581 | Ga0395900_0033748 | 3300037418 | Bacteria | 5266 |
| 582 | Ga0395900_0149631 | 3300037418 | Bacteria | 2385 |
| 583 | Ga0395900_0215718 | 3300037418 | Bacteria | 1936 |
| 584 | Ga0395900_0244747 | 3300037418 | Bacteria | 1797 |
| 585 | Ga0395900_0277990 | 3300037418 | Bacteria | 1667 |
| 586 | Ga0395900_0742441 | 3300037418 | Bacteria | 912 |
| 587 | Ga0395900_0865776 | 3300037418 | Bacteria | 828 |
| 588 | Ga0395898_0023476 | 3300037466 | Bacteria | 6231 |
| 589 | Ga0395898_0026748 | 3300037466 | Bacteria | 5798 |
| 590 | Ga0395898_0053375 | 3300037466 | Bacteria | 3948 |
| 591 | Ga0395898_0169894 | 3300037466 | Bacteria | 2084 |
| 592 | Ga0395898_0241852 | 3300037466 | Bacteria | 1721 |
| 593 | Ga0395905_0015881 | 3300037471 | Bacteria | 7152 |
| 594 | Ga0395905_0041189 | 3300037471 | Bacteria | 4334 |
| 595 | Ga0395905_0091083 | 3300037471 | Bacteria | 2859 |
| 596 | Ga0436364_1101072 | 3300037853 | Bacteria | 919 |
| 597 | Ga0395901_0127955 | 3300038443 | Bacteria | 2669 |
| 598 | Ga0395901_0217475 | 3300038443 | Bacteria | 1998 |
| 599 | Ga0395901_0389746 | 3300038443 | Bacteria | 1432 |
| 600 | Ga0395901_0456251 | 3300038443 | Bacteria | 1306 |
| 601 | Ga0242420_057203 | 3300038996 | Bacteria | 772 |
| 602 | Ga0436360_0981097 | 3300039438 | Bacteria | 1574 |
| 603 | Ga0436361_0875914 | 3300039447 | Bacteria | 1339 |
| 604 | Ga0439438_012311 | 3300041405 | Bacteria | 2625 |
| 605 | Ga0439447_005564 | 3300041407 | Bacteria | 4172 |
| 606 | Ga0439466_0002347 | 3300041411 | Bacteria | 7425 |
| 607 | Ga0439466_0015237 | 3300041411 | Bacteria | 2793 |
| 608 | Ga0439448_0000736 | 3300042005 | Bacteria | 7912 |
| 609 | Ga0439452_000093 | 3300042010 | Bacteria | 77343 |
| 610 | Ga0439452_044192 | 3300042010 | Bacteria | 1040 |
| 611 | Ga0450907_018903 | 3300042146 | Bacteria | 1154 |
| 612 | Ga0451577_0074147 | 3300042876 | Bacteria | 3036 |
| 613 | Ga0451577_0442727 | 3300042876 | Bacteria | 1180 |
| 614 | Ga0466969_0002723 | 3300044656 | Bacteria | 9449 |
| 615 | Ga0466969_0005664 | 3300044656 | Bacteria | 6643 |
| 616 | Ga0466969_0042769 | 3300044656 | Bacteria | 2259 |
| 617 | Ga0466980_0132384 | 3300044668 | Bacteria | 1679 |
| 618 | Ga0453683_0007776 | 3300044673 | Bacteria | 7249 |
| 619 | Ga0466965_0001313 | 3300044683 | Bacteria | 9932 |
| 620 | Ga0466966_0000039 | 3300044684 | Bacteria | 97202 |
| 621 | Ga0466966_0008831 | 3300044684 | Bacteria | 6673 |
| 622 | Ga0466966_0014455 | 3300044684 | Bacteria | 5225 |
| 623 | Ga0466966_0037177 | 3300044684 | Bacteria | 3141 |
| 624 | Ga0466966_0048767 | 3300044684 | Bacteria | 2697 |
| 625 | Ga0466966_0209892 | 3300044684 | Bacteria | 1177 |
| 626 | Ga0466961_0000207 | 3300044693 | Bacteria | 39646 |
| 627 | Ga0466961_0001899 | 3300044693 | Bacteria | 13012 |
| 628 | Ga0466961_0004748 | 3300044693 | Bacteria | 8552 |
| 629 | Ga0466961_0054617 | 3300044693 | Bacteria | 2547 |
| 630 | Ga0466963_0016298 | 3300044694 | Bacteria | 4620 |
| 631 | Ga0466963_0031487 | 3300044694 | Bacteria | 3429 |
| 632 | Ga0466963_0193713 | 3300044694 | Bacteria | 1420 |
| 633 | Ga0453684_0135504 | 3300044712 | Unclassified | 2949 |
| 634 | Ga0466971_0003647 | 3300044719 | Bacteria | 6583 |
| 635 | Ga0466971_0012794 | 3300044719 | Bacteria | 3678 |
| 636 | Ga0466971_0045577 | 3300044719 | Bacteria | 1969 |
| 637 | Ga0466968_0298587 | 3300044735 | Bacteria | 774 |
| 638 | Ga0466970_0002943 | 3300044765 | Bacteria | 8253 |
| 639 | Ga0466970_0021183 | 3300044765 | Bacteria | 3385 |
| 640 | Ga0466970_0042389 | 3300044765 | Bacteria | 2420 |
| 641 | Ga0466970_0050792 | 3300044765 | Bacteria | 2212 |
| 642 | Ga0466957_0000515 | 3300044842 | Bacteria | 19383 |
| 643 | Ga0466957_0002486 | 3300044842 | Bacteria | 9906 |
| 644 | Ga0466957_0299366 | 3300044842 | Bacteria | 1080 |
| 645 | Ga0466959_0004552 | 3300045049 | Bacteria | 9302 |
| 646 | Ga0466959_0009026 | 3300045049 | Bacteria | 7072 |
| 647 | Ga0466959_0009377 | 3300045049 | Bacteria | 6958 |
| 648 | Ga0466959_0014770 | 3300045049 | Bacteria | 5684 |
| 649 | Ga0466959_0100740 | 3300045049 | Bacteria | 2067 |
| 650 | Ga0466959_0203789 | 3300045049 | Bacteria | 1376 |
| 651 | Ga0451576_0073438 | 3300045051 | Bacteria | 3559 |
| 652 | Ga0451576_0075928 | 3300045051 | Bacteria | 3497 |
| 653 | Ga0451576_0206316 | 3300045051 | Bacteria | 2052 |
| 654 | Ga0466958_0003175 | 3300045836 | Bacteria | 8467 |
| 655 | Ga0466958_0021682 | 3300045836 | Bacteria | 3756 |
| 656 | Ga0466958_0195931 | 3300045836 | Bacteria | 1285 |
| 657 | Ga0466967_0661511 | 3300045976 | Bacteria | 1033 |
| 658 | Ga0466967_0711420 | 3300045976 | Bacteria | 995 |
| 659 | Ga0495627_004833 | 3300046453 | Bacteria | 5549 |
| 660 | Ga0495592_0001021 | 3300046454 | Bacteria | 19420 |
| 661 | Ga0495592_0058142 | 3300046454 | Bacteria | 2852 |
| 662 | Ga0495592_0153597 | 3300046454 | Bacteria | 1590 |
| 663 | Ga0495592_0258830 | 3300046454 | Bacteria | 1147 |
| 664 | Ga0495603_0000430 | 3300046455 | Bacteria | 23265 |
| 665 | Ga0495590_0007055 | 3300046457 | Bacteria | 4352 |
| 666 | Ga0495590_0019696 | 3300046457 | Bacteria | 2401 |
| 667 | Ga0495590_0065133 | 3300046457 | Bacteria | 1275 |
| 668 | Ga0495629_0000184 | 3300046459 | Bacteria | 56265 |
| 669 | Ga0495629_0002988 | 3300046459 | Bacteria | 12856 |
| 670 | Ga0495629_0043550 | 3300046459 | Bacteria | 3151 |
| 671 | Ga0495629_0144566 | 3300046459 | Bacteria | 1654 |
| 672 | Ga0495629_0158760 | 3300046459 | Bacteria | 1571 |
| 673 | Ga0495651_0003256 | 3300046462 | Bacteria | 12459 |
| 674 | Ga0495651_0005334 | 3300046462 | Bacteria | 9807 |
| 675 | Ga0495651_0363732 | 3300046462 | Bacteria | 953 |
| 676 | Ga0495653_0000458 | 3300046463 | Bacteria | 31816 |
| 677 | Ga0495653_0028921 | 3300046463 | Bacteria | 4430 |
| 678 | Ga0495653_0037707 | 3300046463 | Bacteria | 3795 |
| 679 | Ga0495653_0145713 | 3300046463 | Bacteria | 1660 |
| 680 | Ga0495653_0325178 | 3300046463 | Bacteria | 995 |
| 681 | Ga0495650_0000155 | 3300046471 | Bacteria | 155947 |
| 682 | Ga0495650_0008029 | 3300046471 | Bacteria | 6233 |
| 683 | Ga0495580_0003676 | 3300046472 | Bacteria | 13009 |
| 684 | Ga0495580_0007003 | 3300046472 | Bacteria | 9090 |
| 685 | Ga0495580_0019201 | 3300046472 | Bacteria | 5080 |
| 686 | Ga0495580_0045774 | 3300046472 | Bacteria | 3107 |
| 687 | Ga0495580_0051269 | 3300046472 | Bacteria | 2917 |
| 688 | Ga0495580_0131594 | 3300046472 | Bacteria | 1735 |
| 689 | Ga0495582_0100335 | 3300046473 | Bacteria | 1620 |
| 690 | Ga0495605_0003642 | 3300046474 | Bacteria | 9144 |
| 691 | Ga0495605_0007723 | 3300046474 | Bacteria | 6096 |
| 692 | Ga0495639_0002731 | 3300046475 | Bacteria | 7674 |
| 693 | Ga0495639_0004581 | 3300046475 | Bacteria | 5929 |
| 694 | Ga0495662_0003851 | 3300046476 | Bacteria | 7566 |
| 695 | Ga0495662_0033063 | 3300046476 | Bacteria | 2499 |
| 696 | Ga0495662_0121389 | 3300046476 | Bacteria | 1283 |
| 697 | Ga0495664_0009344 | 3300046477 | Bacteria | 5484 |
| 698 | Ga0495584_0093221 | 3300046491 | Bacteria | 1520 |
| 699 | Ga0495585_0000756 | 3300046492 | Bacteria | 28639 |
| 700 | Ga0495594_0030730 | 3300046499 | Bacteria | 2909 |
| 701 | Ga0495594_0132249 | 3300046499 | Bacteria | 1413 |
| 702 | Ga0495596_0013516 | 3300046500 | Bacteria | 3460 |
| 703 | Ga0495596_0078620 | 3300046500 | Bacteria | 1281 |
| 704 | Ga0495583_0002052 | 3300046506 | Bacteria | 18249 |
| 705 | Ga0495583_0023731 | 3300046506 | Bacteria | 3096 |
| 706 | Ga0495606_0003521 | 3300046507 | Bacteria | 16538 |
| 707 | Ga0495606_0010907 | 3300046507 | Bacteria | 7481 |
| 708 | Ga0495606_0036960 | 3300046507 | Bacteria | 3320 |
| 709 | Ga0495608_0019092 | 3300046511 | Bacteria | 4725 |
| 710 | Ga0495608_0084089 | 3300046511 | Bacteria | 2065 |
| 711 | Ga0495608_0112547 | 3300046511 | Bacteria | 1749 |
| 712 | Ga0495608_0214575 | 3300046511 | Bacteria | 1209 |
| 713 | Ga0495610_0013957 | 3300046512 | Bacteria | 4746 |
| 714 | Ga0495610_0027577 | 3300046512 | Bacteria | 3016 |
| 715 | Ga0495616_0045437 | 3300046513 | Bacteria | 2223 |
| 716 | Ga0495618_0005497 | 3300046514 | Bacteria | 7715 |
| 717 | Ga0495618_0051561 | 3300046514 | Bacteria | 2599 |
| 718 | Ga0495628_0000612 | 3300046516 | Bacteria | 32753 |
| 719 | Ga0495628_0001377 | 3300046516 | Bacteria | 22309 |
| 720 | Ga0495628_0002577 | 3300046516 | Bacteria | 16323 |
| 721 | Ga0495628_0008978 | 3300046516 | Bacteria | 8550 |
| 722 | Ga0495628_0047491 | 3300046516 | Bacteria | 3406 |
| 723 | Ga0495628_0050024 | 3300046516 | Bacteria | 3307 |
| 724 | Ga0495628_0058645 | 3300046516 | Bacteria | 3023 |
| 725 | Ga0495628_0096860 | 3300046516 | Bacteria | 2279 |
| 726 | Ga0495628_0152777 | 3300046516 | Bacteria | 1757 |
| 727 | Ga0495628_0173739 | 3300046516 | Bacteria | 1633 |
| 728 | Ga0495630_0000001 | 3300046517 | Bacteria | 1687293 |
| 729 | Ga0495630_0006146 | 3300046517 | Bacteria | 8516 |
| 730 | Ga0495630_0021822 | 3300046517 | Bacteria | 4727 |
| 731 | Ga0495630_0042233 | 3300046517 | Bacteria | 3405 |
| 732 | Ga0495630_0056979 | 3300046517 | Bacteria | 2928 |
| 733 | Ga0495630_0175263 | 3300046517 | Bacteria | 1634 |
| 734 | Ga0495637_0006474 | 3300046520 | Bacteria | 5875 |
| 735 | Ga0495648_0002413 | 3300046524 | Bacteria | 17327 |
| 736 | Ga0495666_0011194 | 3300046526 | Bacteria | 4476 |
| 737 | Ga0495666_0023256 | 3300046526 | Bacteria | 3064 |
| 738 | Ga0495666_0101340 | 3300046526 | Bacteria | 1356 |
| 739 | Ga0495666_0214938 | 3300046526 | Bacteria | 881 |
| 740 | Ga0495642_0042416 | 3300046528 | Bacteria | 1853 |
| 741 | Ga0495652_0001770 | 3300046529 | Bacteria | 23136 |
| 742 | Ga0495652_0002873 | 3300046529 | Bacteria | 17371 |
| 743 | Ga0495652_0019423 | 3300046529 | Bacteria | 6053 |
| 744 | Ga0495652_0029318 | 3300046529 | Bacteria | 4835 |
| 745 | Ga0495652_0030200 | 3300046529 | Bacteria | 4755 |
| 746 | Ga0495652_0237329 | 3300046529 | Bacteria | 1359 |
| 747 | Ga0495652_0547782 | 3300046529 | Bacteria | 796 |
| 748 | Ga0495654_0062788 | 3300046530 | Bacteria | 1780 |
| 749 | Ga0495665_0000741 | 3300046531 | Bacteria | 16897 |
| 750 | Ga0495665_0012406 | 3300046531 | Bacteria | 4610 |
| 751 | Ga0495665_0034988 | 3300046531 | Bacteria | 2685 |
| 752 | Ga0495640_0012828 | 3300046533 | Bacteria | 6393 |
| 753 | Ga0495640_0036400 | 3300046533 | Bacteria | 3477 |
| 754 | Ga0495586_0003135 | 3300046535 | Bacteria | 8895 |
| 755 | Ga0495586_0016699 | 3300046535 | Bacteria | 3904 |
| 756 | Ga0495586_0025541 | 3300046535 | Bacteria | 3161 |
| 757 | Ga0495586_0034512 | 3300046535 | Bacteria | 2717 |
| 758 | Ga0495587_0001813 | 3300046536 | Bacteria | 14251 |
| 759 | Ga0495587_0010252 | 3300046536 | Bacteria | 5973 |
| 760 | Ga0495587_0088935 | 3300046536 | Bacteria | 1785 |
| 761 | Ga0495597_0001849 | 3300046542 | Bacteria | 14481 |
| 762 | Ga0495597_0007892 | 3300046542 | Bacteria | 5366 |
| 763 | Ga0495645_0000102 | 3300046543 | Bacteria | 59126 |
| 764 | Ga0495645_0000216 | 3300046543 | Bacteria | 41409 |
| 765 | Ga0495645_0178563 | 3300046543 | Bacteria | 1456 |
| 766 | Ga0495645_0192110 | 3300046543 | Bacteria | 1390 |
| 767 | Ga0495645_0212969 | 3300046543 | Bacteria | 1304 |
| 768 | Ga0495622_0011928 | 3300046557 | Bacteria | 4020 |
| 769 | Ga0495622_0025958 | 3300046557 | Bacteria | 2738 |
| 770 | Ga0495622_0088620 | 3300046557 | Bacteria | 1422 |
| 771 | Ga0495667_0029368 | 3300046559 | Bacteria | 3701 |
| 772 | Ga0495667_0121786 | 3300046559 | Bacteria | 1684 |
| 773 | Ga0495668_0209375 | 3300046616 | Bacteria | 1068 |
| 774 | Ga0495634_0000154 | 3300046642 | Bacteria | 61397 |
| 775 | Ga0495634_0015021 | 3300046642 | Bacteria | 5567 |
| 776 | Ga0495634_0027544 | 3300046642 | Bacteria | 3953 |
| 777 | Ga0495634_0513238 | 3300046642 | Bacteria | 702 |
| 778 | Ga0495635_0000051 | 3300046663 | Bacteria | 74756 |
| 779 | Ga0495635_0006318 | 3300046663 | Bacteria | 8257 |
| 780 | Ga0495635_0007827 | 3300046663 | Bacteria | 7461 |
| 781 | Ga0495635_0045492 | 3300046663 | Bacteria | 3029 |
| 782 | Ga0495635_0126150 | 3300046663 | Bacteria | 1745 |
| 783 | Ga0495588_0133585 | 3300046674 | Bacteria | 1309 |
| 784 | Ga0495657_0026574 | 3300046675 | Bacteria | 4098 |
| 785 | Ga0495657_0081045 | 3300046675 | Bacteria | 2099 |
| 786 | Ga0495657_0291557 | 3300046675 | Bacteria | 974 |
| 787 | Ga0495599_0000176 | 3300046678 | Bacteria | 42077 |
| 788 | Ga0495599_0068119 | 3300046678 | Bacteria | 2222 |
| 789 | Ga0495599_0077061 | 3300046678 | Bacteria | 2082 |
| 790 | Ga0495599_0291554 | 3300046678 | Bacteria | 986 |
| 791 | Ga0495623_0001241 | 3300046679 | Bacteria | 17322 |
| 792 | Ga0495623_0001591 | 3300046679 | Bacteria | 15289 |
| 793 | Ga0495623_0138585 | 3300046679 | Bacteria | 1449 |
| 794 | Ga0495646_0001764 | 3300046680 | Bacteria | 12994 |
| 795 | Ga0495646_0003339 | 3300046680 | Bacteria | 9979 |
| 796 | Ga0495646_0014182 | 3300046680 | Bacteria | 5066 |
| 797 | Ga0495646_0020151 | 3300046680 | Bacteria | 4216 |
| 798 | Ga0495646_0101339 | 3300046680 | Bacteria | 1650 |
| 799 | Ga0495647_0008851 | 3300046681 | Bacteria | 3391 |
| 800 | Ga0495658_0023929 | 3300046683 | Bacteria | 3247 |
| 801 | Ga0495613_0010481 | 3300046689 | Bacteria | 6881 |
| 802 | Ga0495613_0092657 | 3300046689 | Bacteria | 2187 |
| 803 | Ga0495613_0260163 | 3300046689 | Bacteria | 1209 |
| 804 | Ga0495624_0001086 | 3300046690 | Bacteria | 21490 |
| 805 | Ga0495624_0034561 | 3300046690 | Bacteria | 3269 |
| 806 | Ga0495671_0180625 | 3300046692 | Bacteria | 1025 |
| 807 | Ga0495649_0003924 | 3300046694 | Bacteria | 9836 |
| 808 | Ga0495649_0015531 | 3300046694 | Bacteria | 4332 |
| 809 | Ga0495649_0026116 | 3300046694 | Bacteria | 3251 |
| 810 | Ga0495649_0058880 | 3300046694 | Bacteria | 2069 |
| 811 | Ga0495589_0004136 | 3300046794 | Bacteria | 7763 |
| 812 | Ga0495589_0010883 | 3300046794 | Bacteria | 4726 |
| 813 | Ga0495589_0104796 | 3300046794 | Bacteria | 1367 |
| 814 | Ga0495589_0283342 | 3300046794 | Bacteria | 770 |
| 815 | Ga0495600_0007472 | 3300046809 | Bacteria | 6689 |
| 816 | Ga0495600_0011407 | 3300046809 | Bacteria | 5535 |
| 817 | Ga0495600_0014208 | 3300046809 | Bacteria | 5016 |
| 818 | Ga0495660_0012233 | 3300046810 | Bacteria | 4980 |
| 819 | Ga0495581_0004254 | 3300047315 | Bacteria | 8253 |
| 820 | Ga0495581_0013486 | 3300047315 | Bacteria | 4740 |
| 821 | Ga0495581_0020822 | 3300047315 | Bacteria | 3805 |
| 822 | Ga0495604_0003840 | 3300047317 | Bacteria | 11968 |
| 823 | Ga0495604_0004609 | 3300047317 | Bacteria | 10920 |
| 824 | Ga0495604_0037997 | 3300047317 | Bacteria | 3788 |
| 825 | Ga0495604_0067069 | 3300047317 | Bacteria | 2727 |
| 826 | Ga0495604_0078914 | 3300047317 | Bacteria | 2469 |
| 827 | Ga0495674_0003055 | 3300047319 | Bacteria | 16277 |
| 828 | Ga0495674_0003130 | 3300047319 | Bacteria | 16071 |
| 829 | Ga0495674_0030343 | 3300047319 | Bacteria | 4917 |
| 830 | Ga0495672_0005687 | 3300047320 | Bacteria | 9824 |
| 831 | Ga0495672_0013269 | 3300047320 | Bacteria | 5691 |
| 832 | Ga0495672_0199507 | 3300047320 | Bacteria | 1001 |
| 833 | Ga0495676_0011001 | 3300047321 | Bacteria | 8182 |
| 834 | Ga0495680_0001302 | 3300047322 | Bacteria | 27175 |
| 835 | Ga0495680_0003003 | 3300047322 | Bacteria | 16822 |
| 836 | Ga0495680_0021279 | 3300047322 | Bacteria | 5431 |
| 837 | Ga0495680_0021591 | 3300047322 | Bacteria | 5387 |
| 838 | Ga0495680_0045279 | 3300047322 | Bacteria | 3474 |
| 839 | Ga0495680_0049107 | 3300047322 | Bacteria | 3308 |
| 840 | Ga0495680_0125477 | 3300047322 | Bacteria | 1891 |
| 841 | Ga0495683_0002414 | 3300047323 | Bacteria | 11305 |
| 842 | Ga0495683_0012338 | 3300047323 | Bacteria | 4489 |
| 843 | Ga0495683_0017289 | 3300047323 | Bacteria | 3740 |
| 844 | Ga0495687_000029 | 3300047443 | Bacteria | 293244 |
| 845 | Ga0495687_005545 | 3300047443 | Bacteria | 8004 |
| 846 | Ga0495687_012506 | 3300047443 | Bacteria | 4481 |
| 847 | Ga0495687_015266 | 3300047443 | Bacteria | 3914 |
| 848 | Ga0495675_0014968 | 3300047444 | Bacteria | 4904 |
| 849 | Ga0495675_0021231 | 3300047444 | Bacteria | 4134 |
| 850 | Ga0495675_0080414 | 3300047444 | Bacteria | 2053 |
| 851 | Ga0495675_0239590 | 3300047444 | Bacteria | 1092 |
| 852 | Ga0495673_0000426 | 3300047469 | Bacteria | 47785 |
| 853 | Ga0495673_0012569 | 3300047469 | Bacteria | 4481 |
| 854 | Ga0495673_0034361 | 3300047469 | Bacteria | 2344 |
| 855 | Ga0495681_0004331 | 3300047470 | Bacteria | 9713 |
| 856 | Ga0495686_0001282 | 3300047472 | Bacteria | 28414 |
| 857 | Ga0495686_0013767 | 3300047472 | Bacteria | 5603 |
| 858 | Ga0495593_0002283 | 3300047673 | Bacteria | 11491 |
| 859 | Ga0495593_0003295 | 3300047673 | Bacteria | 9674 |
| 860 | Ga0495593_0008272 | 3300047673 | Bacteria | 6054 |
| 861 | Ga0495593_0020592 | 3300047673 | Bacteria | 3693 |
| 862 | Ga0495602_0000575 | 3300048088 | Bacteria | 34209 |
| 863 | Ga0495602_0026341 | 3300048088 | Bacteria | 5608 |
| 864 | Ga0495602_0101434 | 3300048088 | Bacteria | 2361 |
| 865 | Ga0495602_0150249 | 3300048088 | Bacteria | 1832 |
| 866 | Ga0495614_0009952 | 3300048089 | Bacteria | 4197 |
| 867 | Ga0495614_0032145 | 3300048089 | Bacteria | 2259 |
| 868 | Ga0495614_0133392 | 3300048089 | Bacteria | 1100 |
| 869 | Ga0495626_0090571 | 3300048091 | Bacteria | 1345 |
| 870 | Ga0496100_0002447 | 3300048903 | Bacteria | 9421 |
| 871 | Ga0496100_0003542 | 3300048903 | Bacteria | 8152 |
| 872 | Ga0496100_0015183 | 3300048903 | Bacteria | 4493 |
| 873 | Ga0496100_0053719 | 3300048903 | Bacteria | 2625 |
| 874 | Ga0496100_0115862 | 3300048903 | Bacteria | 1869 |
| 875 | Ga0496100_0207897 | 3300048903 | Bacteria | 1430 |
| 876 | Ga0496101_0003024 | 3300048904 | Bacteria | 10368 |
| 877 | Ga0496101_0007849 | 3300048904 | Bacteria | 6942 |
| 878 | Ga0496101_0008207 | 3300048904 | Bacteria | 6818 |
| 879 | Ga0496101_0028733 | 3300048904 | Bacteria | 3885 |
| 880 | Ga0496101_0631377 | 3300048904 | Bacteria | 846 |
| 881 | Ga0496102_0000311 | 3300048905 | Bacteria | 61342 |
| 882 | Ga0496102_0000743 | 3300048905 | Bacteria | 31908 |
| 883 | Ga0496102_0031281 | 3300048905 | Bacteria | 4773 |
| 884 | Ga0496102_0032709 | 3300048905 | Bacteria | 4673 |
| 885 | Ga0496103_0000272 | 3300048906 | Bacteria | 49098 |
| 886 | Ga0496103_0002440 | 3300048906 | Bacteria | 11693 |
| 887 | Ga0496103_0151899 | 3300048906 | Bacteria | 1483 |
| 888 | Ga0496104_0010707 | 3300048907 | Bacteria | 8200 |
| 889 | Ga0496104_0045833 | 3300048907 | Bacteria | 4114 |
| 890 | Ga0496104_0048629 | 3300048907 | Bacteria | 3998 |
| 891 | Ga0496104_0604642 | 3300048907 | Unclassified | 1007 |
| 892 | Ga0496104_0633370 | 3300048907 | Bacteria | 979 |
| 893 | Ga0496105_0061430 | 3300048908 | Bacteria | 3100 |
| 894 | Ga0496105_0182429 | 3300048908 | Bacteria | 1718 |
| 895 | Ga0496106_0000003 | 3300048909 | Bacteria | 305293 |
| 896 | Ga0496106_0061592 | 3300048909 | Bacteria | 2847 |
| 897 | Ga0496106_0675141 | 3300048909 | Bacteria | 824 |
| 898 | Ga0496107_0022179 | 3300048910 | Bacteria | 4486 |
| 899 | Ga0496107_0110846 | 3300048910 | Bacteria | 2017 |
| 900 | Ga0496108_0081594 | 3300048911 | Bacteria | 2741 |
| 901 | Ga0496109_0007189 | 3300048912 | Bacteria | 9409 |
| 902 | Ga0496109_0025770 | 3300048912 | Bacteria | 5241 |
| 903 | Ga0496109_0234039 | 3300048912 | Bacteria | 1729 |
| 904 | Ga0496109_0800399 | 3300048912 | Bacteria | 881 |
| 905 | Ga0496110_0006170 | 3300048913 | Bacteria | 9456 |
| 906 | Ga0496110_0070686 | 3300048913 | Bacteria | 3093 |
| 907 | Ga0496111_0001680 | 3300048914 | Bacteria | 12890 |
| 908 | Ga0496112_0003079 | 3300048915 | Bacteria | 13660 |
| 909 | Ga0496112_0013812 | 3300048915 | Bacteria | 7470 |
| 910 | Ga0496112_0014139 | 3300048915 | Bacteria | 7393 |
| 911 | Ga0496112_0259728 | 3300048915 | Bacteria | 1686 |
| 912 | Ga0496114_0031593 | 3300048917 | Bacteria | 4356 |
| 913 | Ga0496114_0181049 | 3300048917 | Bacteria | 1841 |
| 914 | Ga0496114_0284879 | 3300048917 | Bacteria | 1457 |
| 915 | Ga0496114_0656298 | 3300048917 | Bacteria | 922 |
| 916 | Ga0496115_0077818 | 3300048918 | Bacteria | 2698 |
| 917 | Ga0496115_0164989 | 3300048918 | Bacteria | 1832 |
| 918 | Ga0496115_0356092 | 3300048918 | Bacteria | 1193 |
| 919 | Ga0496115_0611880 | 3300048918 | Bacteria | 865 |
| 920 | Ga0496116_0042732 | 3300048919 | Bacteria | 3095 |
| 921 | Ga0496116_0061076 | 3300048919 | Bacteria | 2441 |
| 922 | Ga0496116_0114975 | 3300048919 | Bacteria | 1571 |
| 923 | Ga0496116_0132466 | 3300048919 | Bacteria | 1418 |
| 924 | Ga0496117_0001294 | 3300048920 | Bacteria | 36834 |
| 925 | Ga0496117_0001668 | 3300048920 | Bacteria | 31030 |
| 926 | Ga0496117_0004782 | 3300048920 | Bacteria | 14680 |
| 927 | Ga0496117_0045296 | 3300048920 | Bacteria | 3179 |
| 928 | Ga0496117_0074082 | 3300048920 | Bacteria | 2268 |
| 929 | Ga0496117_0237964 | 3300048920 | Bacteria | 1001 |
| 930 | Ga0496118_0003719 | 3300048921 | Bacteria | 18884 |
| 931 | Ga0496118_0008066 | 3300048921 | Bacteria | 10983 |
| 932 | Ga0496118_0009825 | 3300048921 | Bacteria | 9578 |
| 933 | Ga0496118_0027153 | 3300048921 | Bacteria | 4852 |
| 934 | Ga0496118_0033803 | 3300048921 | Bacteria | 4186 |
| 935 | Ga0496118_0039900 | 3300048921 | Bacteria | 3740 |
| 936 | Ga0496119_0120489 | 3300048922 | Bacteria | 1443 |
| 937 | Ga0496119_0279544 | 3300048922 | Bacteria | 830 |
| 938 | Ga0496121_0005839 | 3300048924 | Bacteria | 15603 |
| 939 | Ga0496121_0015344 | 3300048924 | Bacteria | 8036 |
| 940 | Ga0496121_0033105 | 3300048924 | Bacteria | 4684 |
| 941 | Ga0496121_0110134 | 3300048924 | Bacteria | 2102 |
| 942 | Ga0496121_0184620 | 3300048924 | Bacteria | 1501 |
| 943 | Ga0496122_0024165 | 3300048925 | Bacteria | 5325 |
| 944 | Ga0496123_0011378 | 3300048926 | Bacteria | 7719 |
| 945 | Ga0496124_0045823 | 3300048927 | Bacteria | 3748 |
| 946 | Ga0496125_0042195 | 3300048928 | Bacteria | 3889 |
| 947 | Ga0496126_0000031 | 3300048929 | Bacteria | 373371 |
| 948 | Ga0496126_0012131 | 3300048929 | Bacteria | 8846 |
| 949 | Ga0496126_0048120 | 3300048929 | Bacteria | 3900 |
| 950 | Ga0496126_0292276 | 3300048929 | Bacteria | 1347 |
| 951 | Ga0495682_0032432 | 3300049460 | Bacteria | 1929 |
| 952 | Ga0501299_041191 | 3300049522 | Bacteria | 927 |
| 953 | Ga0501317_021833 | 3300049533 | Bacteria | 873 |
| 954 | Ga0501033_0006804 | 3300049570 | Bacteria | 8928 |
| 955 | Ga0501033_0395976 | 3300049570 | Bacteria | 964 |
| 956 | Ga0501034_0170194 | 3300049571 | Bacteria | 2146 |
| 957 | Ga0501036_0051302 | 3300049572 | Bacteria | 3492 |
| 958 | Ga0501038_0386026 | 3300049574 | Bacteria | 1085 |
| 959 | Ga0501042_0012783 | 3300049578 | Bacteria | 5697 |
| 960 | Ga0501046_0039186 | 3300049580 | Bacteria | 3796 |
| 961 | Ga0501048_0003630 | 3300049582 | Bacteria | 11750 |
| 962 | Ga0501048_0230017 | 3300049582 | Bacteria | 1316 |
| 963 | Ga0501069_0231730 | 3300049585 | Bacteria | 1075 |
| 964 | Ga0501070_0033907 | 3300049586 | Bacteria | 4271 |
| 965 | Ga0501071_0001355 | 3300049587 | Bacteria | 14019 |
| 966 | Ga0501071_0111769 | 3300049587 | Bacteria | 2019 |
| 967 | Ga0501071_0320763 | 3300049587 | Bacteria | 1177 |
| 968 | Ga0501072_0053813 | 3300049588 | Bacteria | 3170 |
| 969 | Ga0501072_0069380 | 3300049588 | Bacteria | 2783 |
| 970 | Ga0501072_0124394 | 3300049588 | Bacteria | 2055 |
| 971 | Ga0501072_0257211 | 3300049588 | Bacteria | 1390 |
| 972 | Ga0501073_0127920 | 3300049589 | Bacteria | 1761 |
| 973 | Ga0501074_0027381 | 3300049590 | Bacteria | 4133 |
| 974 | Ga0501075_0103882 | 3300049591 | Bacteria | 2159 |
| 975 | Ga0501076_0009098 | 3300049592 | Bacteria | 7312 |
| 976 | Ga0501076_0356561 | 3300049592 | Bacteria | 1201 |
| 977 | Ga0501076_0604442 | 3300049592 | Bacteria | 905 |
| 978 | Ga0501077_0084969 | 3300049593 | Bacteria | 2006 |
| 979 | Ga0501077_0145002 | 3300049593 | Bacteria | 1506 |
| 980 | Ga0501225_0032214 | 3300049705 | Bacteria | 1442 |
| 981 | Ga0501079_0034275 | 3300049741 | Bacteria | 3906 |
| 982 | Ga0501079_0053070 | 3300049741 | Bacteria | 3128 |
| 983 | Ga0501079_0433297 | 3300049741 | Bacteria | 1032 |
| 984 | Ga0501080_0000704 | 3300049742 | Bacteria | 26907 |
| 985 | Ga0501080_0012384 | 3300049742 | Bacteria | 7818 |
| 986 | Ga0501081_0016262 | 3300049743 | Bacteria | 4917 |
| 987 | Ga0501081_0093469 | 3300049743 | Bacteria | 2117 |
| 988 | Ga0501044_0059358 | 3300049823 | Bacteria | 3919 |
| 989 | Ga0501045_0636889 | 3300049824 | Bacteria | 788 |
| 990 | nmdc:mga03683_52961_c1 | 3300050489 | Bacteria | 1697 |
| 991 | nmdc:mga03n38_20976_c1 | 3300050490 | Bacteria | 2622 |
| 992 | nmdc:mga00v17_10852_c1 | 3300050491 | Bacteria | 4992 |
| 993 | nmdc:mga00v17_39184_c1 | 3300050491 | Bacteria | 2837 |
| 994 | nmdc:mga00v17_6976_c1 | 3300050491 | Bacteria | 6011 |
| 995 | nmdc:mga0yw44_120728_c1 | 3300050492 | Bacteria | 1688 |
| 996 | nmdc:mga0yw44_26301_c1 | 3300050492 | Bacteria | 3322 |
| 997 | nmdc:mga0yw44_66150_c1 | 3300050492 | Bacteria | 2230 |
| 998 | nmdc:mga06z11_78924_c1 | 3300050494 | Bacteria | 1761 |
| 999 | nmdc:mga04h51_20413_c1 | 3300050495 | Bacteria | 1978 |
| 1000 | nmdc:mga07m45_128547_c1 | 3300050496 | Bacteria | 1466 |
| 1001 | nmdc:mga07m45_173152_c1 | 3300050496 | Bacteria | 1255 |
| 1002 | nmdc:mga07m45_17777_c1 | 3300050496 | Bacteria | 3826 |
| 1003 | nmdc:mga05p37_132370_c1 | 3300050507 | Bacteria | 3060 |
| 1004 | nmdc:mga05p37_15217_c1 | 3300050507 | Bacteria | 9239 |
| 1005 | nmdc:mga05p37_21530_c1 | 3300050507 | Bacteria | 7810 |
| 1006 | nmdc:mga05p37_281951_c1 | 3300050507 | Bacteria | 1981 |
| 1007 | nmdc:mga05p37_315415_c1 | 3300050507 | Bacteria | 1852 |
| 1008 | nmdc:mga09592_246465_c1 | 3300050508 | Bacteria | 1548 |
| 1009 | nmdc:mga0qj67_19781_c1 | 3300050509 | Bacteria | 5148 |
| 1010 | nmdc:mga0qj67_267040_c1 | 3300050509 | Bacteria | 1388 |
| 1011 | nmdc:mga0qj67_500632_c1 | 3300050509 | Bacteria | 977 |
| 1012 | nmdc:mga06r32_476319_c1 | 3300050510 | Bacteria | 1227 |
| 1013 | nmdc:mga08y16_410436_c1 | 3300050511 | Bacteria | 1385 |
| 1014 | nmdc:mga08y16_562513_c1 | 3300050511 | Bacteria | 1153 |
| 1015 | nmdc:mga08y16_70042_c1 | 3300050511 | Bacteria | 3656 |
| 1016 | nmdc:mga08y16_99277_c1 | 3300050511 | Unclassified | 3031 |
| 1017 | nmdc:mga0n895_1012_c1 | 3300050512 | Bacteria | 20423 |
| 1018 | nmdc:mga0n895_134873_c1 | 3300050512 | Bacteria | 2495 |
| 1019 | nmdc:mga0n895_18197_c1 | 3300050512 | Bacteria | 6495 |
| 1020 | nmdc:mga0n895_196467_c1 | 3300050512 | Bacteria | 2048 |
| 1021 | nmdc:mga0n895_278479_c1 | 3300050512 | Bacteria | 1696 |
| 1022 | nmdc:mga0n895_648041_c1 | 3300050512 | Bacteria | 1055 |
| 1023 | nmdc:mga0n895_8049_c1 | 3300050512 | Bacteria | 9096 |
| 1024 | nmdc:mga0n895_84240_c1 | 3300050512 | Bacteria | 3172 |
| 1025 | nmdc:mga0n895_93158_c1 | 3300050512 | Bacteria | 3016 |
| 1026 | nmdc:mga0rr50_103076_c1 | 3300050513 | Bacteria | 2245 |
| 1027 | nmdc:mga0rr50_13011_c1 | 3300050513 | Bacteria | 5400 |
| 1028 | nmdc:mga0rr50_325429_c1 | 3300050513 | Bacteria | 1289 |
| 1029 | nmdc:mga0rr50_746954_c1 | 3300050513 | Unclassified | 835 |
| 1030 | nmdc:mga0rr50_86529_c1 | 3300050513 | Bacteria | 2431 |
| 1031 | nmdc:mga0rr50_9949_c1 | 3300050513 | Bacteria | 6012 |
| 1032 | nmdc:mga08x19_106964_c1 | 3300050514 | Bacteria | 1861 |
| 1033 | nmdc:mga08x19_133991_c1 | 3300050514 | Bacteria | 1669 |
| 1034 | nmdc:mga08x19_146100_c1 | 3300050514 | Bacteria | 1599 |
| 1035 | nmdc:mga08x19_2190_c1 | 3300050514 | Bacteria | 11947 |
| 1036 | nmdc:mga08x19_287611_c1 | 3300050514 | Bacteria | 1140 |
| 1037 | nmdc:mga08x19_29593_c1 | 3300050514 | Bacteria | 3436 |
| 1038 | nmdc:mga08x19_30851_c1 | 3300050514 | Bacteria | 3369 |
| 1039 | nmdc:mga08x19_317459_c1 | 3300050514 | Bacteria | 1084 |
| 1040 | nmdc:mga08x19_434563_c1 | 3300050514 | Bacteria | 923 |
| 1041 | nmdc:mga08x19_85798_c1 | 3300050514 | Bacteria | 2072 |
| 1042 | nmdc:mga0a205_240792_c1 | 3300050515 | Bacteria | 1690 |
| 1043 | nmdc:mga0a205_259789_c1 | 3300050515 | Bacteria | 1614 |
| 1044 | nmdc:mga0a205_410607_c1 | 3300050515 | Bacteria | 1217 |
| 1045 | nmdc:mga0a205_428606_c1 | 3300050515 | Bacteria | 1184 |
| 1046 | nmdc:mga0a205_482384_c1 | 3300050515 | Bacteria | 1098 |
| 1047 | nmdc:mga0a205_542809_c1 | 3300050515 | Bacteria | 1018 |
| 1048 | nmdc:mga0a205_5463_c1 | 3300050515 | Bacteria | 11449 |
| 1049 | Ga0495601_0002609 | 3300053077 | Bacteria | 10219 |
| 1050 | Ga0495612_0021748 | 3300053078 | Bacteria | 2573 |
| 1051 | Ga0495655_0029270 | 3300053083 | Bacteria | 1323 |
| 1052 | Ga0495595_0005162 | 3300053084 | Bacteria | 5275 |
| 1053 | Ga0495619_0018499 | 3300053085 | Bacteria | 4419 |
| 1054 | Ga0500641_0004322 | 3300053096 | Bacteria | 5013 |
| 1055 | Ga0500577_0000643 | 3300053142 | Bacteria | 8969 |
| 1056 | Ga0501084_0199802 | 3300054114 | Bacteria | 1687 |
| 1057 | Ga0501084_0550663 | 3300054114 | Bacteria | 975 |
| 1058 | Ga0587085_003335 | 3300059506 | Bacteria | 1736 |
| 1059 | Ga0587085_015536 | 3300059506 | Bacteria | 1090 |
| 1060 | Ga0587062_030904 | 3300059639 | Bacteria | 820 |
| 1061 | Ga0501082_0005433 | 3300060353 | Bacteria | 11059 |
| 1062 | Ga0501082_0057150 | 3300060353 | Bacteria | 3362 |
| 1063 | Ga0501082_0302479 | 3300060353 | Bacteria | 1393 |
| 1064 | Ga0466962_0001368 | 3300061719 | Bacteria | 11287 |
| 1065 | Ga0466962_0016467 | 3300061719 | Bacteria | 3566 |
| 1066 | Ga0466962_0018570 | 3300061719 | Bacteria | 3344 |
| 1067 | Ga0530510_0000443 | 3300061734 | Bacteria | 26727 |
| 1068 | Ga0530510_0184217 | 3300061734 | Bacteria | 1549 |
| 1069 | Ga0530510_0198607 | 3300061734 | Bacteria | 1489 |
| 1070 | Ga0530510_0199114 | 3300061734 | Bacteria | 1487 |
| 1071 | Ga0530510_0213823 | 3300061734 | Bacteria | 1432 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300020077 | Ga0206351_10719405 | Ga0206351_107194051 | 197 |
| 2 | 3300037418 | Ga0395900_0244747 | Ga0395900_0244747_295_927 | 205 |
| 3 | 3300006042 | Ga0075368_10020446 | Ga0075368_100204462 | 209 |
| 4 | 3300006048 | Ga0075363_100043761 | Ga0075363_1000437612 | 209 |
| 5 | 3300006051 | Ga0075364_10008898 | Ga0075364_100088983 | 209 |
| 6 | 3300006177 | Ga0075362_10085592 | Ga0075362_100855922 | 209 |
| 7 | 3300006178 | Ga0075367_10068082 | Ga0075367_100680822 | 209 |
| 8 | 3300006186 | Ga0075369_10123157 | Ga0075369_101231572 | 209 |
| 9 | 3300027866 | Ga0209813_10042171 | Ga0209813_100421713 | 209 |
| 10 | 3300050490 | nmdc:mga03n38_20976_c1 | nmdc:mga03n38_20976_c1_1858_2490 | 209 |
| 11 | 3300050491 | nmdc:mga00v17_6976_c1 | nmdc:mga00v17_6976_c1_3885_4517 | 209 |
| 12 | 3300050492 | nmdc:mga0yw44_26301_c1 | nmdc:mga0yw44_26301_c1_1915_2547 | 209 |
| 13 | 3300050494 | nmdc:mga06z11_78924_c1 | nmdc:mga06z11_78924_c1_973_1605 | 209 |
| 14 | 3300050495 | nmdc:mga04h51_20413_c1 | nmdc:mga04h51_20413_c1_1299_1931 | 209 |
| 15 | 3300050496 | nmdc:mga07m45_173152_c1 | nmdc:mga07m45_173152_c1_452_1084 | 209 |
| 16 | 3300005329 | Ga0070683_100756869 | Ga0070683_1007568691 | 210 |
| 17 | 3300005437 | Ga0070710_10039981 | Ga0070710_100399812 | 210 |
| 18 | 3300005535 | Ga0070684_100590117 | Ga0070684_1005901171 | 210 |
| 19 | 3300006038 | Ga0075365_10018211 | Ga0075365_100182113 | 210 |
| 20 | 3300007788 | Ga0099795_10177452 | Ga0099795_101774522 | 210 |
| 21 | 3300013297 | Ga0157378_10111384 | Ga0157378_101113842 | 210 |
| 22 | 3300020070 | Ga0206356_11575614 | Ga0206356_115756141 | 210 |
| 23 | 3300025915 | Ga0207693_10584217 | Ga0207693_105842171 | 210 |
| 24 | 3300025929 | Ga0207664_10944061 | Ga0207664_109440611 | 210 |
| 25 | 3300028800 | Ga0265338_10193381 | Ga0265338_101933811 | 210 |
| 26 | 3300031247 | Ga0265340_10142989 | Ga0265340_101429892 | 210 |
| 27 | 3300031249 | Ga0265339_10002778 | Ga0265339_100027782 | 210 |
| 28 | 3300035692 | Ga0373935_0126432 | Ga0373935_0126432_636_1271 | 210 |
| 29 | 3300046462 | Ga0495651_0363732 | Ga0495651_0363732_189_827 | 210 |
| 30 | 3300048088 | Ga0495602_0150249 | Ga0495602_0150249_1146_1784 | 210 |
| 31 | 3300050489 | nmdc:mga03683_52961_c1 | nmdc:mga03683_52961_c1_1001_1636 | 210 |
| 32 | 3300050491 | nmdc:mga00v17_39184_c1 | nmdc:mga00v17_39184_c1_107_742 | 210 |
| 33 | 3300050492 | nmdc:mga0yw44_66150_c1 | nmdc:mga0yw44_66150_c1_576_1211 | 210 |
| 34 | 3300050507 | nmdc:mga05p37_132370_c1 | nmdc:mga05p37_132370_c1_1359_1991 | 210 |
| 35 | iso_pu_bacteria | 2511231027 | 2511390943 | 212 |
| 36 | iso_pu_bacteria | 2738541337 | 2739055669 | 212 |
| 37 | iso_pu_bacteria | 2842871566 | 2842874333 | 212 |
| 38 | iso_pu_bacteria | 2928521798 | 2928524966 | 212 |
| 39 | iso_pu_bacteria | 2508501125 | 2509131795 | 213 |
| 40 | iso_pu_bacteria | 2513237150 | 2513954864 | 213 |
| 41 | iso_pu_bacteria | 2513237151 | 2513959455 | 213 |
| 42 | iso_pu_bacteria | 2513237165 | 2514042865 | 213 |
| 43 | iso_pu_bacteria | 2515154123 | 2515692314 | 213 |
| 44 | iso_pu_bacteria | 2526164713 | 2527079552 | 213 |
| 45 | iso_pu_bacteria | 2562617112 | 2563057039 | 213 |
| 46 | iso_pu_bacteria | 2599185239 | 2599736206 | 213 |
| 47 | iso_pu_bacteria | 2623620446 | 2624491237 | 213 |
| 48 | iso_pu_bacteria | 2711768613 | 2713480942 | 213 |
| 49 | iso_pu_bacteria | 2738541296 | 2738822254 | 213 |
| 50 | iso_pu_bacteria | 2738541298 | 2738836610 | 213 |
| 51 | iso_pu_bacteria | 2738541306 | 2738875940 | 213 |
| 52 | iso_pu_bacteria | 2738543002 | 2739187892 | 213 |
| 53 | iso_pu_bacteria | 2738543008 | 2739222538 | 213 |
| 54 | iso_pu_bacteria | 2744054900 | 2746084942 | 213 |
| 55 | iso_pu_bacteria | 2744054901 | 2746099605 | 213 |
| 56 | iso_pu_bacteria | 2808606379 | 2808943331 | 213 |
| 57 | iso_pu_bacteria | 2818991450 | 2819621351 | 213 |
| 58 | iso_pu_bacteria | 2818991452 | 2819634047 | 213 |
| 59 | iso_pu_bacteria | 2842324504 | 2842329867 | 213 |
| 60 | iso_pu_bacteria | 2842348783 | 2842354667 | 213 |
| 61 | iso_pu_bacteria | 2842454564 | 2842460116 | 213 |
| 62 | iso_pu_bacteria | 2860339153 | 2860344164 | 213 |
| 63 | iso_pu_bacteria | 2883087390 | 2883095413 | 213 |
| 64 | iso_pu_bacteria | 2904483920 | 2904488238 | 213 |
| 65 | iso_pu_bacteria | 2919527303 | 2919530999 | 213 |
| 66 | iso_pu_bacteria | 2919697872 | 2919701250 | 213 |
| 67 | iso_pu_bacteria | 2921643360 | 2921646172 | 213 |
| 68 | iso_pu_bacteria | 2928108538 | 2928109137 | 213 |
| 69 | iso_pu_bacteria | 2928135762 | 2928136360 | 213 |
| 70 | iso_pu_bacteria | 2928170801 | 2928171358 | 213 |
| 71 | iso_pu_bacteria | 2928503688 | 2928503858 | 213 |
| 72 | iso_pu_bacteria | 2931396565 | 2931402920 | 213 |
| 73 | iso_pu_bacteria | 2945934425 | 2945934962 | 213 |
| 74 | iso_pu_bacteria | 2981990288 | 2981991548 | 213 |
| 75 | iso_pu_bacteria | 2990703756 | 2990704481 | 213 |
| 76 | iso_pu_bacteria | 3007619802 | 3007623596 | 213 |
| 77 | iso_pu_bacteria | 641736151 | 642424869 | 213 |
| 78 | iso_pu_bacteria | 644736347 | 644752026 | 213 |
| 79 | iso_pu_bacteria | 8018845410 | 8018853771 | 213 |
| 80 | iso_pu_bacteria | 8019775933 | 8019778130 | 213 |
| 81 | iso_pu_bacteria | 8021120328 | 8021123519 | 213 |
| 82 | iso_pu_bacteria | 8055266321 | 8055267890 | 213 |
| 83 | iso_pu_bacteria | 8055301274 | 8055304381 | 213 |
| 84 | iso_pu_bacteria | 8056155041 | 8056160229 | 213 |
| 85 | iso_pu_bacteria | 2842324504 | 2842328554 | 214 |
| 86 | iso_pu_bacteria | 2842348783 | 2842352870 | 214 |
| 87 | iso_pu_bacteria | 2842454564 | 2842458785 | 214 |
| 88 | 3300005293 | Ga0065715_10211111 | Ga0065715_102111111 | 215 |
| 89 | 3300005335 | Ga0070666_10017611 | Ga0070666_100176114 | 215 |
| 90 | 3300005367 | Ga0070667_100018740 | Ga0070667_1000187403 | 215 |
| 91 | 3300005435 | Ga0070714_100079538 | Ga0070714_1000795382 | 215 |
| 92 | 3300005439 | Ga0070711_100536687 | Ga0070711_1005366872 | 215 |
| 93 | 3300005440 | Ga0070705_100052916 | Ga0070705_1000529163 | 215 |
| 94 | 3300005458 | Ga0070681_10022516 | Ga0070681_100225164 | 215 |
| 95 | 3300005467 | Ga0070706_100303251 | Ga0070706_1003032512 | 215 |
| 96 | 3300005518 | Ga0070699_100037577 | Ga0070699_1000375774 | 215 |
| 97 | 3300005536 | Ga0070697_100057612 | Ga0070697_1000576125 | 215 |
| 98 | 3300005536 | Ga0070697_100729774 | Ga0070697_1007297741 | 215 |
| 99 | 3300005545 | Ga0070695_100011818 | Ga0070695_1000118184 | 215 |
| 100 | 3300005546 | Ga0070696_100005007 | Ga0070696_1000050077 | 215 |
| 101 | 3300005547 | Ga0070693_100341616 | Ga0070693_1003416161 | 215 |
| 102 | 3300005549 | Ga0070704_100214352 | Ga0070704_1002143521 | 215 |
| 103 | 3300005563 | Ga0068855_100884376 | Ga0068855_1008843761 | 215 |
| 104 | 3300006038 | Ga0075365_10021202 | Ga0075365_100212024 | 215 |
| 105 | 3300006846 | Ga0075430_100106627 | Ga0075430_1001066273 | 215 |
| 106 | 3300006871 | Ga0075434_100624016 | Ga0075434_1006240162 | 215 |
| 107 | 3300006914 | Ga0075436_100013082 | Ga0075436_1000130825 | 215 |
| 108 | 3300006914 | Ga0075436_100146654 | Ga0075436_1001466542 | 215 |
| 109 | 3300025903 | Ga0207680_10014305 | Ga0207680_100143053 | 215 |
| 110 | 3300025912 | Ga0207707_10013398 | Ga0207707_100133986 | 215 |
| 111 | 3300025929 | Ga0207664_10155657 | Ga0207664_101556571 | 215 |
| 112 | 3300025986 | Ga0207658_10190715 | Ga0207658_101907152 | 215 |
| 113 | 3300027665 | Ga0209983_1032469 | Ga0209983_10324692 | 215 |
| 114 | 3300032002 | Ga0307416_100594523 | Ga0307416_1005945232 | 215 |
| 115 | 3300035085 | Ga0373929_0027199 | Ga0373929_0027199_488_1141 | 215 |
| 116 | 3300035111 | Ga0373923_0182594 | Ga0373923_0182594_261_914 | 215 |
| 117 | 3300035410 | Ga0373924_0007996 | Ga0373924_0007996_196_849 | 215 |
| 118 | 3300035695 | Ga0373927_0321067 | Ga0373927_0321067_142_795 | 215 |
| 119 | 3300036401 | Ga0373937_0051508 | Ga0373937_0051508_2994_3647 | 215 |
| 120 | 3300046463 | Ga0495653_0145713 | Ga0495653_0145713_433_1086 | 215 |
| 121 | 3300046511 | Ga0495608_0214575 | Ga0495608_0214575_224_877 | 215 |
| 122 | 3300046559 | Ga0495667_0029368 | Ga0495667_0029368_2917_3570 | 215 |
| 123 | 3300046675 | Ga0495657_0291557 | Ga0495657_0291557_52_705 | 215 |
| 124 | 3300047322 | Ga0495680_0125477 | Ga0495680_0125477_872_1525 | 215 |
| 125 | 3300049585 | Ga0501069_0231730 | Ga0501069_0231730_200_853 | 215 |
| 126 | 3300050492 | nmdc:mga0yw44_120728_c1 | nmdc:mga0yw44_120728_c1_717_1373 | 215 |
| 127 | 3300050509 | nmdc:mga0qj67_19781_c1 | nmdc:mga0qj67_19781_c1_2265_2918 | 215 |
| 128 | 3300050513 | nmdc:mga0rr50_103076_c1 | nmdc:mga0rr50_103076_c1_712_1365 | 215 |
| 129 | 3300050514 | nmdc:mga08x19_106964_c1 | nmdc:mga08x19_106964_c1_1048_1701 | 215 |
| 130 | 3300050514 | nmdc:mga08x19_29593_c1 | nmdc:mga08x19_29593_c1_2064_2717 | 215 |
| 131 | 3300050514 | nmdc:mga08x19_30851_c1 | nmdc:mga08x19_30851_c1_1796_2449 | 215 |
| 132 | 3300050514 | nmdc:mga08x19_317459_c1 | nmdc:mga08x19_317459_c1_285_938 | 215 |
| 133 | 3300050515 | nmdc:mga0a205_410607_c1 | nmdc:mga0a205_410607_c1_65_718 | 215 |
| 134 | 3300003578 | Ga0006562J51391_1046179 | Ga0006562J51391_10461791 | 216 |
| 135 | 3300003794 | Ga0055531_10000317 | Ga0055531_1000031731 | 216 |
| 136 | 3300005327 | Ga0070658_10110515 | Ga0070658_101105152 | 216 |
| 137 | 3300005329 | Ga0070683_100047351 | Ga0070683_1000473514 | 216 |
| 138 | 3300005344 | Ga0070661_100032230 | Ga0070661_1000322301 | 216 |
| 139 | 3300005355 | Ga0070671_100167476 | Ga0070671_1001674762 | 216 |
| 140 | 3300005439 | Ga0070711_100040343 | Ga0070711_1000403433 | 216 |
| 141 | 3300005455 | Ga0070663_100319187 | Ga0070663_1003191872 | 216 |
| 142 | 3300005563 | Ga0068855_100065945 | Ga0068855_1000659455 | 216 |
| 143 | 3300005578 | Ga0068854_100162708 | Ga0068854_1001627082 | 216 |
| 144 | 3300005578 | Ga0068854_100477050 | Ga0068854_1004770502 | 216 |
| 145 | 3300005614 | Ga0068856_100006744 | Ga0068856_1000067449 | 216 |
| 146 | 3300005614 | Ga0068856_100009816 | Ga0068856_1000098167 | 216 |
| 147 | 3300005616 | Ga0068852_100005526 | Ga0068852_1000055269 | 216 |
| 148 | 3300005937 | Ga0081455_10280774 | Ga0081455_102807742 | 216 |
| 149 | 3300006353 | Ga0075370_10003614 | Ga0075370_100036145 | 216 |
| 150 | 3300006914 | Ga0075436_100003079 | Ga0075436_10000307911 | 216 |
| 151 | 3300006914 | Ga0075436_100336596 | Ga0075436_1003365962 | 216 |
| 152 | 3300007076 | Ga0075435_100186734 | Ga0075435_1001867342 | 216 |
| 153 | 3300009098 | Ga0105245_10435126 | Ga0105245_104351262 | 216 |
| 154 | 3300009101 | Ga0105247_10476721 | Ga0105247_104767211 | 216 |
| 155 | 3300013100 | Ga0157373_10099058 | Ga0157373_100990582 | 216 |
| 156 | 3300013105 | Ga0157369_10001012 | Ga0157369_1000101236 | 216 |
| 157 | 3300013297 | Ga0157378_10025323 | Ga0157378_100253232 | 216 |
| 158 | 3300020080 | Ga0206350_11076876 | Ga0206350_110768761 | 216 |
| 159 | 3300025913 | Ga0207695_10004994 | Ga0207695_100049947 | 216 |
| 160 | 3300025920 | Ga0207649_10095757 | Ga0207649_100957572 | 216 |
| 161 | 3300025927 | Ga0207687_10184630 | Ga0207687_101846301 | 216 |
| 162 | 3300025931 | Ga0207644_10176030 | Ga0207644_101760301 | 216 |
| 163 | 3300025931 | Ga0207644_10639097 | Ga0207644_106390971 | 216 |
| 164 | 3300025936 | Ga0207670_10279091 | Ga0207670_102790911 | 216 |
| 165 | 3300025942 | Ga0207689_10410111 | Ga0207689_104101112 | 216 |
| 166 | 3300025949 | Ga0207667_10008902 | Ga0207667_100089022 | 216 |
| 167 | 3300025981 | Ga0207640_10326330 | Ga0207640_103263302 | 216 |
| 168 | 3300025981 | Ga0207640_10861805 | Ga0207640_108618051 | 216 |
| 169 | 3300026041 | Ga0207639_10067478 | Ga0207639_100674782 | 216 |
| 170 | 3300026067 | Ga0207678_10046935 | Ga0207678_100469352 | 216 |
| 171 | 3300026078 | Ga0207702_10060129 | Ga0207702_100601292 | 216 |
| 172 | 3300026088 | Ga0207641_10943025 | Ga0207641_109430251 | 216 |
| 173 | 3300028794 | Ga0307515_10000219 | Ga0307515_1000021984 | 216 |
| 174 | 3300037312 | Ga0395899_0017035 | Ga0395899_0017035_4754_5422 | 216 |
| 175 | 3300037312 | Ga0395899_0081333 | Ga0395899_0081333_48_716 | 216 |
| 176 | 3300037418 | Ga0395900_0033748 | Ga0395900_0033748_3295_3963 | 216 |
| 177 | 3300037466 | Ga0395898_0026748 | Ga0395898_0026748_2519_3187 | 216 |
| 178 | 3300038443 | Ga0395901_0217475 | Ga0395901_0217475_353_1009 | 216 |
| 179 | 3300038443 | Ga0395901_0389746 | Ga0395901_0389746_168_836 | 216 |
| 180 | 3300044656 | Ga0466969_0002723 | Ga0466969_0002723_6584_7252 | 216 |
| 181 | 3300044673 | Ga0453683_0007776 | Ga0453683_0007776_5566_6228 | 216 |
| 182 | 3300044684 | Ga0466966_0000039 | Ga0466966_0000039_24923_25585 | 216 |
| 183 | 3300044684 | Ga0466966_0014455 | Ga0466966_0014455_2496_3164 | 216 |
| 184 | 3300044693 | Ga0466961_0001899 | Ga0466961_0001899_4328_4996 | 216 |
| 185 | 3300044693 | Ga0466961_0054617 | Ga0466961_0054617_1169_1831 | 216 |
| 186 | 3300044694 | Ga0466963_0016298 | Ga0466963_0016298_3680_4348 | 216 |
| 187 | 3300044719 | Ga0466971_0012794 | Ga0466971_0012794_1243_1911 | 216 |
| 188 | 3300044765 | Ga0466970_0021183 | Ga0466970_0021183_369_1037 | 216 |
| 189 | 3300044842 | Ga0466957_0000515 | Ga0466957_0000515_11235_11903 | 216 |
| 190 | 3300045049 | Ga0466959_0009377 | Ga0466959_0009377_1465_2133 | 216 |
| 191 | 3300045049 | Ga0466959_0100740 | Ga0466959_0100740_753_1421 | 216 |
| 192 | 3300045836 | Ga0466958_0003175 | Ga0466958_0003175_2062_2730 | 216 |
| 193 | 3300050496 | nmdc:mga07m45_17777_c1 | nmdc:mga07m45_17777_c1_453_1112 | 216 |
| 194 | 3300050512 | nmdc:mga0n895_134873_c1 | nmdc:mga0n895_134873_c1_485_1135 | 216 |
| 195 | 3300050512 | nmdc:mga0n895_18197_c1 | nmdc:mga0n895_18197_c1_3728_4381 | 216 |
| 196 | 3300050513 | nmdc:mga0rr50_325429_c1 | nmdc:mga0rr50_325429_c1_617_1267 | 216 |
| 197 | 3300050514 | nmdc:mga08x19_2190_c1 | nmdc:mga08x19_2190_c1_4024_4674 | 216 |
| 198 | 3300050514 | nmdc:mga08x19_287611_c1 | nmdc:mga08x19_287611_c1_294_947 | 216 |
| 199 | 3300059506 | Ga0587085_003335 | Ga0587085_003335_12_719 | 216 |
| 200 | 3300061719 | Ga0466962_0018570 | Ga0466962_0018570_1307_1975 | 216 |
| 201 | 3300001979 | JGI24740J21852_10001218 | JGI24740J21852_100012189 | 217 |
| 202 | 3300001979 | JGI24740J21852_10069483 | JGI24740J21852_100694832 | 217 |
| 203 | 3300001989 | JGI24739J22299_10007358 | JGI24739J22299_100073582 | 217 |
| 204 | 3300001989 | JGI24739J22299_10007911 | JGI24739J22299_100079113 | 217 |
| 205 | 3300001989 | JGI24739J22299_10010141 | JGI24739J22299_100101412 | 217 |
| 206 | 3300001990 | JGI24737J22298_10006425 | JGI24737J22298_100064253 | 217 |
| 207 | 3300001990 | JGI24737J22298_10017867 | JGI24737J22298_100178673 | 217 |
| 208 | 3300001990 | JGI24737J22298_10111933 | JGI24737J22298_101119331 | 217 |
| 209 | 3300002067 | JGI24735J21928_10000112 | JGI24735J21928_1000011216 | 217 |
| 210 | 3300002067 | JGI24735J21928_10003160 | JGI24735J21928_100031606 | 217 |
| 211 | 3300002067 | JGI24735J21928_10008835 | JGI24735J21928_100088353 | 217 |
| 212 | 3300002067 | JGI24735J21928_10016148 | JGI24735J21928_100161482 | 217 |
| 213 | 3300002067 | JGI24735J21928_10020077 | JGI24735J21928_100200772 | 217 |
| 214 | 3300002067 | JGI24735J21928_10041790 | JGI24735J21928_100417902 | 217 |
| 215 | 3300002067 | JGI24735J21928_10041859 | JGI24735J21928_100418591 | 217 |
| 216 | 3300002075 | JGI24738J21930_10001789 | JGI24738J21930_100017894 | 217 |
| 217 | 3300002075 | JGI24738J21930_10025831 | JGI24738J21930_100258312 | 217 |
| 218 | 3300002705 | JGI25156J39149_1000219 | JGI25156J39149_10002193 | 217 |
| 219 | 3300002705 | JGI25156J39149_1002857 | JGI25156J39149_10028572 | 217 |
| 220 | 3300002772 | JGI25164J39214_1008578 | JGI25164J39214_10085782 | 217 |
| 221 | 3300003214 | JGI25165J46597_1002266 | JGI25165J46597_10022663 | 217 |
| 222 | 3300003479 | Ga0006556J51387_1024206 | Ga0006556J51387_10242061 | 217 |
| 223 | 3300003567 | Ga0006554J51385_1019889 | Ga0006554J51385_10198891 | 217 |
| 224 | 3300003756 | Ga0055533_1000306 | Ga0055533_100030616 | 217 |
| 225 | 3300003756 | Ga0055533_1003661 | Ga0055533_10036613 | 217 |
| 226 | 3300003758 | Ga0055532_1000022 | Ga0055532_1000022120 | 217 |
| 227 | 3300003758 | Ga0055532_1001602 | Ga0055532_10016027 | 217 |
| 228 | 3300003759 | Ga0055525_1002523 | Ga0055525_10025232 | 217 |
| 229 | 3300003760 | Ga0055527_1000016 | Ga0055527_1000016120 | 217 |
| 230 | 3300003761 | Ga0055535_1000017 | Ga0055535_1000017120 | 217 |
| 231 | 3300003762 | Ga0055542_1000030 | Ga0055542_1000030120 | 217 |
| 232 | 3300003763 | Ga0055529_1000033 | Ga0055529_1000033120 | 217 |
| 233 | 3300004799 | Ga0058863_11823999 | Ga0058863_118239991 | 217 |
| 234 | 3300004800 | Ga0058861_11807144 | Ga0058861_118071441 | 217 |
| 235 | 3300004801 | Ga0058860_12166380 | Ga0058860_121663801 | 217 |
| 236 | 3300004803 | Ga0058862_10139900 | Ga0058862_101399001 | 217 |
| 237 | 3300004803 | Ga0058862_12455986 | Ga0058862_124559862 | 217 |
| 238 | 3300005262 | Ga0065165_1000489 | Ga0065165_100048917 | 217 |
| 239 | 3300005290 | Ga0065712_10001293 | Ga0065712_100012932 | 217 |
| 240 | 3300005290 | Ga0065712_10068048 | Ga0065712_100680482 | 217 |
| 241 | 3300005290 | Ga0065712_10078230 | Ga0065712_100782304 | 217 |
| 242 | 3300005293 | Ga0065715_10088924 | Ga0065715_1008892425 | 217 |
| 243 | 3300005293 | Ga0065715_10253367 | Ga0065715_102533671 | 217 |
| 244 | 3300005295 | Ga0065707_10088203 | Ga0065707_100882031 | 217 |
| 245 | 3300005295 | Ga0065707_10451990 | Ga0065707_104519901 | 217 |
| 246 | 3300005295 | Ga0065707_10525249 | Ga0065707_105252491 | 217 |
| 247 | 3300005327 | Ga0070658_10003087 | Ga0070658_100030877 | 217 |
| 248 | 3300005327 | Ga0070658_10004656 | Ga0070658_1000465610 | 217 |
| 249 | 3300005327 | Ga0070658_10006183 | Ga0070658_100061832 | 217 |
| 250 | 3300005327 | Ga0070658_10013021 | Ga0070658_100130213 | 217 |
| 251 | 3300005327 | Ga0070658_10043430 | Ga0070658_100434303 | 217 |
| 252 | 3300005327 | Ga0070658_10135860 | Ga0070658_101358602 | 217 |
| 253 | 3300005327 | Ga0070658_10160620 | Ga0070658_101606202 | 217 |
| 254 | 3300005327 | Ga0070658_10272347 | Ga0070658_102723473 | 217 |
| 255 | 3300005328 | Ga0070676_10054969 | Ga0070676_100549692 | 217 |
| 256 | 3300005329 | Ga0070683_100018296 | Ga0070683_1000182965 | 217 |
| 257 | 3300005331 | Ga0070670_100001241 | Ga0070670_10000124117 | 217 |
| 258 | 3300005331 | Ga0070670_100008380 | Ga0070670_1000083802 | 217 |
| 259 | 3300005333 | Ga0070677_10024857 | Ga0070677_100248572 | 217 |
| 260 | 3300005333 | Ga0070677_10043998 | Ga0070677_100439982 | 217 |
| 261 | 3300005335 | Ga0070666_10038616 | Ga0070666_100386164 | 217 |
| 262 | 3300005335 | Ga0070666_10116260 | Ga0070666_101162601 | 217 |
| 263 | 3300005336 | Ga0070680_100008371 | Ga0070680_1000083713 | 217 |
| 264 | 3300005338 | Ga0068868_100014826 | Ga0068868_1000148264 | 217 |
| 265 | 3300005338 | Ga0068868_100063143 | Ga0068868_1000631433 | 217 |
| 266 | 3300005338 | Ga0068868_100163794 | Ga0068868_1001637942 | 217 |
| 267 | 3300005339 | Ga0070660_100002014 | Ga0070660_1000020144 | 217 |
| 268 | 3300005339 | Ga0070660_100003253 | Ga0070660_1000032536 | 217 |
| 269 | 3300005339 | Ga0070660_100078332 | Ga0070660_1000783323 | 217 |
| 270 | 3300005339 | Ga0070660_100085875 | Ga0070660_1000858751 | 217 |
| 271 | 3300005340 | Ga0070689_100124485 | Ga0070689_1001244852 | 217 |
| 272 | 3300005341 | Ga0070691_10023615 | Ga0070691_100236152 | 217 |
| 273 | 3300005343 | Ga0070687_100052376 | Ga0070687_1000523762 | 217 |
| 274 | 3300005344 | Ga0070661_100001747 | Ga0070661_1000017473 | 217 |
| 275 | 3300005344 | Ga0070661_100018903 | Ga0070661_1000189032 | 217 |
| 276 | 3300005344 | Ga0070661_100028212 | Ga0070661_1000282126 | 217 |
| 277 | 3300005345 | Ga0070692_10193033 | Ga0070692_101930332 | 217 |
| 278 | 3300005347 | Ga0070668_100064795 | Ga0070668_1000647952 | 217 |
| 279 | 3300005353 | Ga0070669_100003151 | Ga0070669_10000315110 | 217 |
| 280 | 3300005354 | Ga0070675_100011196 | Ga0070675_1000111961 | 217 |
| 281 | 3300005354 | Ga0070675_100047571 | Ga0070675_1000475713 | 217 |
| 282 | 3300005355 | Ga0070671_100009662 | Ga0070671_1000096623 | 217 |
| 283 | 3300005355 | Ga0070671_100121588 | Ga0070671_1001215882 | 217 |
| 284 | 3300005356 | Ga0070674_100005072 | Ga0070674_1000050721 | 217 |
| 285 | 3300005356 | Ga0070674_100063552 | Ga0070674_1000635522 | 217 |
| 286 | 3300005364 | Ga0070673_100007590 | Ga0070673_1000075904 | 217 |
| 287 | 3300005364 | Ga0070673_100015973 | Ga0070673_1000159735 | 217 |
| 288 | 3300005364 | Ga0070673_100146559 | Ga0070673_1001465591 | 217 |
| 289 | 3300005366 | Ga0070659_100009464 | Ga0070659_1000094642 | 217 |
| 290 | 3300005366 | Ga0070659_100387901 | Ga0070659_1003879011 | 217 |
| 291 | 3300005367 | Ga0070667_100059040 | Ga0070667_1000590404 | 217 |
| 292 | 3300005367 | Ga0070667_100100440 | Ga0070667_1001004402 | 217 |
| 293 | 3300005441 | Ga0070700_100039036 | Ga0070700_1000390362 | 217 |
| 294 | 3300005444 | Ga0070694_100027560 | Ga0070694_1000275602 | 217 |
| 295 | 3300005444 | Ga0070694_100176327 | Ga0070694_1001763272 | 217 |
| 296 | 3300005444 | Ga0070694_100498588 | Ga0070694_1004985881 | 217 |
| 297 | 3300005445 | Ga0070708_100043219 | Ga0070708_1000432195 | 217 |
| 298 | 3300005445 | Ga0070708_100163120 | Ga0070708_1001631203 | 217 |
| 299 | 3300005445 | Ga0070708_100432244 | Ga0070708_1004322442 | 217 |
| 300 | 3300005455 | Ga0070663_100012253 | Ga0070663_1000122536 | 217 |
| 301 | 3300005455 | Ga0070663_100189702 | Ga0070663_1001897022 | 217 |
| 302 | 3300005455 | Ga0070663_100539348 | Ga0070663_1005393481 | 217 |
| 303 | 3300005456 | Ga0070678_100004858 | Ga0070678_1000048582 | 217 |
| 304 | 3300005456 | Ga0070678_100162194 | Ga0070678_1001621942 | 217 |
| 305 | 3300005457 | Ga0070662_100021633 | Ga0070662_1000216332 | 217 |
| 306 | 3300005458 | Ga0070681_10004285 | Ga0070681_100042858 | 217 |
| 307 | 3300005458 | Ga0070681_10007917 | Ga0070681_100079174 | 217 |
| 308 | 3300005458 | Ga0070681_10028372 | Ga0070681_100283722 | 217 |
| 309 | 3300005459 | Ga0068867_100000031 | Ga0068867_1000000318 | 217 |
| 310 | 3300005459 | Ga0068867_100021037 | Ga0068867_1000210373 | 217 |
| 311 | 3300005459 | Ga0068867_100067543 | Ga0068867_1000675434 | 217 |
| 312 | 3300005467 | Ga0070706_100006506 | Ga0070706_1000065065 | 217 |
| 313 | 3300005468 | Ga0070707_100420942 | Ga0070707_1004209421 | 217 |
| 314 | 3300005471 | Ga0070698_100000360 | Ga0070698_10000036052 | 217 |
| 315 | 3300005471 | Ga0070698_100101436 | Ga0070698_1001014363 | 217 |
| 316 | 3300005471 | Ga0070698_100478909 | Ga0070698_1004789092 | 217 |
| 317 | 3300005471 | Ga0070698_100491490 | Ga0070698_1004914902 | 217 |
| 318 | 3300005518 | Ga0070699_100008542 | Ga0070699_1000085427 | 217 |
| 319 | 3300005518 | Ga0070699_100009432 | Ga0070699_1000094323 | 217 |
| 320 | 3300005518 | Ga0070699_100024044 | Ga0070699_1000240445 | 217 |
| 321 | 3300005530 | Ga0070679_100015194 | Ga0070679_1000151946 | 217 |
| 322 | 3300005530 | Ga0070679_100105860 | Ga0070679_1001058604 | 217 |
| 323 | 3300005530 | Ga0070679_100106501 | Ga0070679_1001065014 | 217 |
| 324 | 3300005535 | Ga0070684_100336698 | Ga0070684_1003366982 | 217 |
| 325 | 3300005536 | Ga0070697_100009047 | Ga0070697_1000090478 | 217 |
| 326 | 3300005536 | Ga0070697_100090194 | Ga0070697_1000901942 | 217 |
| 327 | 3300005536 | Ga0070697_100096908 | Ga0070697_1000969082 | 217 |
| 328 | 3300005539 | Ga0068853_100011721 | Ga0068853_1000117217 | 217 |
| 329 | 3300005539 | Ga0068853_100759059 | Ga0068853_1007590591 | 217 |
| 330 | 3300005543 | Ga0070672_100154414 | Ga0070672_1001544143 | 217 |
| 331 | 3300005543 | Ga0070672_100162864 | Ga0070672_1001628642 | 217 |
| 332 | 3300005544 | Ga0070686_100010413 | Ga0070686_1000104133 | 217 |
| 333 | 3300005545 | Ga0070695_100009516 | Ga0070695_1000095164 | 217 |
| 334 | 3300005545 | Ga0070695_100010479 | Ga0070695_1000104792 | 217 |
| 335 | 3300005545 | Ga0070695_100417562 | Ga0070695_1004175621 | 217 |
| 336 | 3300005546 | Ga0070696_100011139 | Ga0070696_1000111396 | 217 |
| 337 | 3300005547 | Ga0070693_100012746 | Ga0070693_1000127462 | 217 |
| 338 | 3300005547 | Ga0070693_100271851 | Ga0070693_1002718512 | 217 |
| 339 | 3300005548 | Ga0070665_100371413 | Ga0070665_1003714132 | 217 |
| 340 | 3300005548 | Ga0070665_100378371 | Ga0070665_1003783711 | 217 |
| 341 | 3300005549 | Ga0070704_100003123 | Ga0070704_1000031239 | 217 |
| 342 | 3300005549 | Ga0070704_100115276 | Ga0070704_1001152762 | 217 |
| 343 | 3300005549 | Ga0070704_100766744 | Ga0070704_1007667442 | 217 |
| 344 | 3300005563 | Ga0068855_100010091 | Ga0068855_1000100916 | 217 |
| 345 | 3300005563 | Ga0068855_100026348 | Ga0068855_1000263483 | 217 |
| 346 | 3300005564 | Ga0070664_100001859 | Ga0070664_1000018597 | 217 |
| 347 | 3300005564 | Ga0070664_100005743 | Ga0070664_1000057437 | 217 |
| 348 | 3300005577 | Ga0068857_100028110 | Ga0068857_1000281102 | 217 |
| 349 | 3300005577 | Ga0068857_100339349 | Ga0068857_1003393492 | 217 |
| 350 | 3300005578 | Ga0068854_100036899 | Ga0068854_1000368994 | 217 |
| 351 | 3300005578 | Ga0068854_100070369 | Ga0068854_1000703692 | 217 |
| 352 | 3300005614 | Ga0068856_100084585 | Ga0068856_1000845852 | 217 |
| 353 | 3300005614 | Ga0068856_100408432 | Ga0068856_1004084322 | 217 |
| 354 | 3300005616 | Ga0068852_100011776 | Ga0068852_1000117762 | 217 |
| 355 | 3300005616 | Ga0068852_100012112 | Ga0068852_1000121125 | 217 |
| 356 | 3300005616 | Ga0068852_100012336 | Ga0068852_1000123363 | 217 |
| 357 | 3300005616 | Ga0068852_100096782 | Ga0068852_1000967822 | 217 |
| 358 | 3300005616 | Ga0068852_100435871 | Ga0068852_1004358712 | 217 |
| 359 | 3300005617 | Ga0068859_100231085 | Ga0068859_1002310852 | 217 |
| 360 | 3300005618 | Ga0068864_100199184 | Ga0068864_1001991841 | 217 |
| 361 | 3300005834 | Ga0068851_10000435 | Ga0068851_1000043516 | 217 |
| 362 | 3300005834 | Ga0068851_10011188 | Ga0068851_100111884 | 217 |
| 363 | 3300005834 | Ga0068851_10068528 | Ga0068851_100685282 | 217 |
| 364 | 3300005840 | Ga0068870_10267937 | Ga0068870_102679371 | 217 |
| 365 | 3300005841 | Ga0068863_100706750 | Ga0068863_1007067502 | 217 |
| 366 | 3300005843 | Ga0068860_100543685 | Ga0068860_1005436852 | 217 |
| 367 | 3300005981 | Ga0081538_10118502 | Ga0081538_101185021 | 217 |
| 368 | 3300006048 | Ga0075363_100152419 | Ga0075363_1001524192 | 217 |
| 369 | 3300006173 | Ga0070716_100019172 | Ga0070716_1000191723 | 217 |
| 370 | 3300006173 | Ga0070716_100072625 | Ga0070716_1000726252 | 217 |
| 371 | 3300006175 | Ga0070712_100150211 | Ga0070712_1001502113 | 217 |
| 372 | 3300006195 | Ga0075366_10193631 | Ga0075366_101936312 | 217 |
| 373 | 3300006195 | Ga0075366_10270604 | Ga0075366_102706041 | 217 |
| 374 | 3300006237 | Ga0097621_100014106 | Ga0097621_1000141061 | 217 |
| 375 | 3300006237 | Ga0097621_100030594 | Ga0097621_1000305944 | 217 |
| 376 | 3300006358 | Ga0068871_100031263 | Ga0068871_1000312633 | 217 |
| 377 | 3300006358 | Ga0068871_100567747 | Ga0068871_1005677472 | 217 |
| 378 | 3300006844 | Ga0075428_100107410 | Ga0075428_1001074103 | 217 |
| 379 | 3300006844 | Ga0075428_100720102 | Ga0075428_1007201021 | 217 |
| 380 | 3300006846 | Ga0075430_100278682 | Ga0075430_1002786822 | 217 |
| 381 | 3300006847 | Ga0075431_100124180 | Ga0075431_1001241802 | 217 |
| 382 | 3300006847 | Ga0075431_100647245 | Ga0075431_1006472452 | 217 |
| 383 | 3300006852 | Ga0075433_10141249 | Ga0075433_101412492 | 217 |
| 384 | 3300006852 | Ga0075433_10221195 | Ga0075433_102211952 | 217 |
| 385 | 3300006852 | Ga0075433_10392391 | Ga0075433_103923912 | 217 |
| 386 | 3300006852 | Ga0075433_10448182 | Ga0075433_104481822 | 217 |
| 387 | 3300006871 | Ga0075434_100006779 | Ga0075434_10000677911 | 217 |
| 388 | 3300006871 | Ga0075434_100031307 | Ga0075434_1000313071 | 217 |
| 389 | 3300006871 | Ga0075434_100051193 | Ga0075434_1000511933 | 217 |
| 390 | 3300006871 | Ga0075434_100084202 | Ga0075434_1000842022 | 217 |
| 391 | 3300006871 | Ga0075434_100171505 | Ga0075434_1001715053 | 217 |
| 392 | 3300006880 | Ga0075429_100546923 | Ga0075429_1005469231 | 217 |
| 393 | 3300006881 | Ga0068865_100069440 | Ga0068865_1000694402 | 217 |
| 394 | 3300006881 | Ga0068865_100137545 | Ga0068865_1001375452 | 217 |
| 395 | 3300006881 | Ga0068865_100380522 | Ga0068865_1003805222 | 217 |
| 396 | 3300006914 | Ga0075436_100099874 | Ga0075436_1000998742 | 217 |
| 397 | 3300006914 | Ga0075436_100102379 | Ga0075436_1001023792 | 217 |
| 398 | 3300006914 | Ga0075436_100103059 | Ga0075436_1001030591 | 217 |
| 399 | 3300006914 | Ga0075436_100691779 | Ga0075436_1006917791 | 217 |
| 400 | 3300006931 | Ga0097620_100231069 | Ga0097620_1002310692 | 217 |
| 401 | 3300007076 | Ga0075435_100037443 | Ga0075435_1000374435 | 217 |
| 402 | 3300007076 | Ga0075435_100079990 | Ga0075435_1000799902 | 217 |
| 403 | 3300007076 | Ga0075435_100110225 | Ga0075435_1001102251 | 217 |
| 404 | 3300007076 | Ga0075435_100360710 | Ga0075435_1003607101 | 217 |
| 405 | 3300007076 | Ga0075435_100551896 | Ga0075435_1005518961 | 217 |
| 406 | 3300007265 | Ga0099794_10389510 | Ga0099794_103895101 | 217 |
| 407 | 3300007788 | Ga0099795_10038086 | Ga0099795_100380862 | 217 |
| 408 | 3300009011 | Ga0105251_10000157 | Ga0105251_1000015713 | 217 |
| 409 | 3300009011 | Ga0105251_10089188 | Ga0105251_100891882 | 217 |
| 410 | 3300009036 | Ga0105244_10138845 | Ga0105244_101388452 | 217 |
| 411 | 3300009093 | Ga0105240_10007978 | Ga0105240_100079785 | 217 |
| 412 | 3300009093 | Ga0105240_10050343 | Ga0105240_100503433 | 217 |
| 413 | 3300009093 | Ga0105240_10624706 | Ga0105240_106247061 | 217 |
| 414 | 3300009094 | Ga0111539_10029117 | Ga0111539_100291173 | 217 |
| 415 | 3300009094 | Ga0111539_10132057 | Ga0111539_101320572 | 217 |
| 416 | 3300009094 | Ga0111539_10551206 | Ga0111539_105512062 | 217 |
| 417 | 3300009101 | Ga0105247_10077517 | Ga0105247_100775172 | 217 |
| 418 | 3300009147 | Ga0114129_10008335 | Ga0114129_100083357 | 217 |
| 419 | 3300009147 | Ga0114129_10184466 | Ga0114129_101844662 | 217 |
| 420 | 3300009147 | Ga0114129_10335763 | Ga0114129_103357632 | 217 |
| 421 | 3300009147 | Ga0114129_10412616 | Ga0114129_104126162 | 217 |
| 422 | 3300009147 | Ga0114129_11492760 | Ga0114129_114927601 | 217 |
| 423 | 3300009147 | Ga0114129_11757201 | Ga0114129_117572011 | 217 |
| 424 | 3300009148 | Ga0105243_10063465 | Ga0105243_100634653 | 217 |
| 425 | 3300009174 | Ga0105241_10031258 | Ga0105241_100312583 | 217 |
| 426 | 3300009174 | Ga0105241_10440032 | Ga0105241_104400321 | 217 |
| 427 | 3300009174 | Ga0105241_10932765 | Ga0105241_109327651 | 217 |
| 428 | 3300009176 | Ga0105242_10014349 | Ga0105242_100143496 | 217 |
| 429 | 3300009176 | Ga0105242_10106966 | Ga0105242_101069662 | 217 |
| 430 | 3300009177 | Ga0105248_10108510 | Ga0105248_101085103 | 217 |
| 431 | 3300009177 | Ga0105248_10246908 | Ga0105248_102469082 | 217 |
| 432 | 3300009545 | Ga0105237_10003909 | Ga0105237_100039092 | 217 |
| 433 | 3300009545 | Ga0105237_10091255 | Ga0105237_100912553 | 217 |
| 434 | 3300009545 | Ga0105237_10179507 | Ga0105237_101795073 | 217 |
| 435 | 3300009551 | Ga0105238_10013643 | Ga0105238_100136436 | 217 |
| 436 | 3300009551 | Ga0105238_10020173 | Ga0105238_100201732 | 217 |
| 437 | 3300009551 | Ga0105238_10504880 | Ga0105238_105048802 | 217 |
| 438 | 3300010375 | Ga0105239_10005610 | Ga0105239_100056106 | 217 |
| 439 | 3300010375 | Ga0105239_10336620 | Ga0105239_103366201 | 217 |
| 440 | 3300011119 | Ga0105246_10026306 | Ga0105246_100263062 | 217 |
| 441 | 3300013100 | Ga0157373_10047080 | Ga0157373_100470802 | 217 |
| 442 | 3300013102 | Ga0157371_10000739 | Ga0157371_1000073927 | 217 |
| 443 | 3300013102 | Ga0157371_10029805 | Ga0157371_100298052 | 217 |
| 444 | 3300013102 | Ga0157371_10127553 | Ga0157371_101275532 | 217 |
| 445 | 3300013104 | Ga0157370_10000965 | Ga0157370_100009659 | 217 |
| 446 | 3300013104 | Ga0157370_10004637 | Ga0157370_1000463711 | 217 |
| 447 | 3300013104 | Ga0157370_10007365 | Ga0157370_100073657 | 217 |
| 448 | 3300013104 | Ga0157370_10011838 | Ga0157370_100118382 | 217 |
| 449 | 3300013104 | Ga0157370_10159855 | Ga0157370_101598552 | 217 |
| 450 | 3300013105 | Ga0157369_10005380 | Ga0157369_100053809 | 217 |
| 451 | 3300013105 | Ga0157369_10010373 | Ga0157369_1001037311 | 217 |
| 452 | 3300013105 | Ga0157369_10252308 | Ga0157369_102523082 | 217 |
| 453 | 3300013105 | Ga0157369_10473548 | Ga0157369_104735482 | 217 |
| 454 | 3300013105 | Ga0157369_10809158 | Ga0157369_108091581 | 217 |
| 455 | 3300013296 | Ga0157374_10003804 | Ga0157374_100038044 | 217 |
| 456 | 3300013296 | Ga0157374_10011164 | Ga0157374_100111646 | 217 |
| 457 | 3300013296 | Ga0157374_10016646 | Ga0157374_100166465 | 217 |
| 458 | 3300013297 | Ga0157378_10012733 | Ga0157378_100127331 | 217 |
| 459 | 3300013297 | Ga0157378_10196650 | Ga0157378_101966502 | 217 |
| 460 | 3300013306 | Ga0163162_10028105 | Ga0163162_100281056 | 217 |
| 461 | 3300013306 | Ga0163162_10132062 | Ga0163162_101320624 | 217 |
| 462 | 3300013306 | Ga0163162_10413361 | Ga0163162_104133612 | 217 |
| 463 | 3300013307 | Ga0157372_10011957 | Ga0157372_100119575 | 217 |
| 464 | 3300013307 | Ga0157372_10091848 | Ga0157372_100918482 | 217 |
| 465 | 3300013307 | Ga0157372_10128868 | Ga0157372_101288682 | 217 |
| 466 | 3300013308 | Ga0157375_10049473 | Ga0157375_100494733 | 217 |
| 467 | 3300014325 | Ga0163163_10028824 | Ga0163163_100288245 | 217 |
| 468 | 3300014497 | Ga0182008_10123010 | Ga0182008_101230102 | 217 |
| 469 | 3300014745 | Ga0157377_10000235 | Ga0157377_1000023523 | 217 |
| 470 | 3300014969 | Ga0157376_10081213 | Ga0157376_100812132 | 217 |
| 471 | 3300015261 | Ga0182006_1028847 | Ga0182006_10288473 | 217 |
| 472 | 3300015262 | Ga0182007_10001687 | Ga0182007_100016876 | 217 |
| 473 | 3300015262 | Ga0182007_10006143 | Ga0182007_100061434 | 217 |
| 474 | 3300015262 | Ga0182007_10073794 | Ga0182007_100737941 | 217 |
| 475 | 3300020070 | Ga0206356_10151721 | Ga0206356_101517211 | 217 |
| 476 | 3300020070 | Ga0206356_10563753 | Ga0206356_105637531 | 217 |
| 477 | 3300020075 | Ga0206349_1007483 | Ga0206349_10074831 | 217 |
| 478 | 3300020076 | Ga0206355_1615061 | Ga0206355_16150614 | 217 |
| 479 | 3300020078 | Ga0206352_10228866 | Ga0206352_102288661 | 217 |
| 480 | 3300020078 | Ga0206352_11331274 | Ga0206352_113312742 | 217 |
| 481 | 3300020080 | Ga0206350_10756569 | Ga0206350_107565694 | 217 |
| 482 | 3300020082 | Ga0206353_10002810 | Ga0206353_100028102 | 217 |
| 483 | 3300020082 | Ga0206353_11275437 | Ga0206353_112754371 | 217 |
| 484 | 3300022467 | Ga0224712_10032476 | Ga0224712_100324761 | 217 |
| 485 | 3300022467 | Ga0224712_10135079 | Ga0224712_101350792 | 217 |
| 486 | 3300025206 | Ga0209435_102216 | Ga0209435_1022162 | 217 |
| 487 | 3300025225 | Ga0209566_100472 | Ga0209566_1004726 | 217 |
| 488 | 3300025226 | Ga0209674_100017 | Ga0209674_100017274 | 217 |
| 489 | 3300025226 | Ga0209674_100211 | Ga0209674_10021119 | 217 |
| 490 | 3300025226 | Ga0209674_102160 | Ga0209674_1021602 | 217 |
| 491 | 3300025228 | Ga0209672_100001 | Ga0209672_1000012214 | 217 |
| 492 | 3300025228 | Ga0209672_100271 | Ga0209672_10027124 | 217 |
| 493 | 3300025228 | Ga0209672_103474 | Ga0209672_1034743 | 217 |
| 494 | 3300025229 | Ga0209147_100022 | Ga0209147_100022294 | 217 |
| 495 | 3300025229 | Ga0209147_100121 | Ga0209147_10012120 | 217 |
| 496 | 3300025230 | Ga0209563_101145 | Ga0209563_1011454 | 217 |
| 497 | 3300025231 | Ga0207427_101579 | Ga0207427_1015794 | 217 |
| 498 | 3300025242 | Ga0209258_100033 | Ga0209258_100033119 | 217 |
| 499 | 3300025253 | Ga0209677_111067 | Ga0209677_1110672 | 217 |
| 500 | 3300025254 | Ga0209148_1000046 | Ga0209148_1000046295 | 217 |
| 501 | 3300025256 | Ga0209759_1000331 | Ga0209759_100033121 | 217 |
| 502 | 3300025256 | Ga0209759_1000366 | Ga0209759_100036621 | 217 |
| 503 | 3300025256 | Ga0209759_1010528 | Ga0209759_10105284 | 217 |
| 504 | 3300025256 | Ga0209759_1016444 | Ga0209759_10164442 | 217 |
| 505 | 3300025261 | Ga0209233_1000050 | Ga0209233_1000050284 | 217 |
| 506 | 3300025272 | Ga0209455_1000038 | Ga0209455_1000038295 | 217 |
| 507 | 3300025284 | Ga0209130_1005176 | Ga0209130_10051761 | 217 |
| 508 | 3300025295 | Ga0209564_1007781 | Ga0209564_10077813 | 217 |
| 509 | 3300025302 | Ga0207426_1000004 | Ga0207426_1000004132 | 217 |
| 510 | 3300025302 | Ga0207426_1004157 | Ga0207426_10041571 | 217 |
| 511 | 3300025315 | Ga0207697_10003982 | Ga0207697_100039822 | 217 |
| 512 | 3300025321 | Ga0207656_10007085 | Ga0207656_100070851 | 217 |
| 513 | 3300025321 | Ga0207656_10013184 | Ga0207656_100131842 | 217 |
| 514 | 3300025321 | Ga0207656_10067097 | Ga0207656_100670972 | 217 |
| 515 | 3300025711 | Ga0207696_1064564 | Ga0207696_10645641 | 217 |
| 516 | 3300025728 | Ga0207655_1120899 | Ga0207655_11208991 | 217 |
| 517 | 3300025735 | Ga0207713_1000336 | Ga0207713_100033656 | 217 |
| 518 | 3300025735 | Ga0207713_1012631 | Ga0207713_10126312 | 217 |
| 519 | 3300025893 | Ga0207682_10017545 | Ga0207682_100175452 | 217 |
| 520 | 3300025901 | Ga0207688_10015407 | Ga0207688_100154073 | 217 |
| 521 | 3300025903 | Ga0207680_10038507 | Ga0207680_100385072 | 217 |
| 522 | 3300025903 | Ga0207680_10078446 | Ga0207680_100784461 | 217 |
| 523 | 3300025904 | Ga0207647_10000396 | Ga0207647_100003964 | 217 |
| 524 | 3300025904 | Ga0207647_10003690 | Ga0207647_100036908 | 217 |
| 525 | 3300025904 | Ga0207647_10026012 | Ga0207647_100260122 | 217 |
| 526 | 3300025904 | Ga0207647_10028846 | Ga0207647_100288462 | 217 |
| 527 | 3300025904 | Ga0207647_10030002 | Ga0207647_100300023 | 217 |
| 528 | 3300025904 | Ga0207647_10040542 | Ga0207647_100405422 | 217 |
| 529 | 3300025906 | Ga0207699_10027168 | Ga0207699_100271683 | 217 |
| 530 | 3300025907 | Ga0207645_10066014 | Ga0207645_100660142 | 217 |
| 531 | 3300025909 | Ga0207705_10012575 | Ga0207705_100125752 | 217 |
| 532 | 3300025909 | Ga0207705_10024026 | Ga0207705_100240264 | 217 |
| 533 | 3300025909 | Ga0207705_10175222 | Ga0207705_101752221 | 217 |
| 534 | 3300025909 | Ga0207705_10348320 | Ga0207705_103483201 | 217 |
| 535 | 3300025910 | Ga0207684_10010463 | Ga0207684_100104632 | 217 |
| 536 | 3300025910 | Ga0207684_10029127 | Ga0207684_100291272 | 217 |
| 537 | 3300025910 | Ga0207684_10214320 | Ga0207684_102143202 | 217 |
| 538 | 3300025910 | Ga0207684_10639638 | Ga0207684_106396382 | 217 |
| 539 | 3300025911 | Ga0207654_10063090 | Ga0207654_100630901 | 217 |
| 540 | 3300025911 | Ga0207654_10092655 | Ga0207654_100926553 | 217 |
| 541 | 3300025911 | Ga0207654_10364327 | Ga0207654_103643272 | 217 |
| 542 | 3300025912 | Ga0207707_10041491 | Ga0207707_100414912 | 217 |
| 543 | 3300025912 | Ga0207707_10089484 | Ga0207707_100894843 | 217 |
| 544 | 3300025912 | Ga0207707_10438474 | Ga0207707_104384742 | 217 |
| 545 | 3300025913 | Ga0207695_10007589 | Ga0207695_100075895 | 217 |
| 546 | 3300025913 | Ga0207695_10133103 | Ga0207695_101331031 | 217 |
| 547 | 3300025913 | Ga0207695_10229180 | Ga0207695_102291802 | 217 |
| 548 | 3300025914 | Ga0207671_10012713 | Ga0207671_100127133 | 217 |
| 549 | 3300025914 | Ga0207671_10218474 | Ga0207671_102184742 | 217 |
| 550 | 3300025917 | Ga0207660_10354491 | Ga0207660_103544911 | 217 |
| 551 | 3300025918 | Ga0207662_10234999 | Ga0207662_102349991 | 217 |
| 552 | 3300025919 | Ga0207657_10006089 | Ga0207657_100060899 | 217 |
| 553 | 3300025919 | Ga0207657_10007609 | Ga0207657_100076096 | 217 |
| 554 | 3300025919 | Ga0207657_10024918 | Ga0207657_100249183 | 217 |
| 555 | 3300025920 | Ga0207649_10001822 | Ga0207649_100018226 | 217 |
| 556 | 3300025920 | Ga0207649_10098907 | Ga0207649_100989071 | 217 |
| 557 | 3300025920 | Ga0207649_10253253 | Ga0207649_102532532 | 217 |
| 558 | 3300025921 | Ga0207652_10075966 | Ga0207652_100759662 | 217 |
| 559 | 3300025921 | Ga0207652_10151951 | Ga0207652_101519512 | 217 |
| 560 | 3300025922 | Ga0207646_10024812 | Ga0207646_100248124 | 217 |
| 561 | 3300025922 | Ga0207646_10032895 | Ga0207646_100328958 | 217 |
| 562 | 3300025922 | Ga0207646_10108850 | Ga0207646_101088501 | 217 |
| 563 | 3300025923 | Ga0207681_10368747 | Ga0207681_103687472 | 217 |
| 564 | 3300025924 | Ga0207694_10002912 | Ga0207694_100029129 | 217 |
| 565 | 3300025924 | Ga0207694_10109155 | Ga0207694_101091553 | 217 |
| 566 | 3300025925 | Ga0207650_10001712 | Ga0207650_1000171215 | 217 |
| 567 | 3300025925 | Ga0207650_10001913 | Ga0207650_100019133 | 217 |
| 568 | 3300025925 | Ga0207650_10627557 | Ga0207650_106275571 | 217 |
| 569 | 3300025926 | Ga0207659_10055875 | Ga0207659_100558752 | 217 |
| 570 | 3300025926 | Ga0207659_10108350 | Ga0207659_101083502 | 217 |
| 571 | 3300025931 | Ga0207644_10003354 | Ga0207644_100033542 | 217 |
| 572 | 3300025932 | Ga0207690_10005945 | Ga0207690_100059452 | 217 |
| 573 | 3300025932 | Ga0207690_10260098 | Ga0207690_102600982 | 217 |
| 574 | 3300025932 | Ga0207690_10321293 | Ga0207690_103212932 | 217 |
| 575 | 3300025933 | Ga0207706_10000853 | Ga0207706_1000085320 | 217 |
| 576 | 3300025933 | Ga0207706_10162609 | Ga0207706_101626092 | 217 |
| 577 | 3300025934 | Ga0207686_10193587 | Ga0207686_101935871 | 217 |
| 578 | 3300025935 | Ga0207709_10009168 | Ga0207709_100091682 | 217 |
| 579 | 3300025937 | Ga0207669_10058531 | Ga0207669_100585312 | 217 |
| 580 | 3300025938 | Ga0207704_10086042 | Ga0207704_100860422 | 217 |
| 581 | 3300025939 | Ga0207665_10032835 | Ga0207665_100328353 | 217 |
| 582 | 3300025939 | Ga0207665_10054478 | Ga0207665_100544782 | 217 |
| 583 | 3300025939 | Ga0207665_10252384 | Ga0207665_102523842 | 217 |
| 584 | 3300025940 | Ga0207691_10009758 | Ga0207691_100097585 | 217 |
| 585 | 3300025940 | Ga0207691_10012098 | Ga0207691_100120986 | 217 |
| 586 | 3300025941 | Ga0207711_10410838 | Ga0207711_104108382 | 217 |
| 587 | 3300025942 | Ga0207689_10179150 | Ga0207689_101791503 | 217 |
| 588 | 3300025945 | Ga0207679_10018716 | Ga0207679_100187162 | 217 |
| 589 | 3300025945 | Ga0207679_10030199 | Ga0207679_100301992 | 217 |
| 590 | 3300025949 | Ga0207667_10031926 | Ga0207667_100319266 | 217 |
| 591 | 3300025949 | Ga0207667_10035988 | Ga0207667_100359883 | 217 |
| 592 | 3300025949 | Ga0207667_10212428 | Ga0207667_102124282 | 217 |
| 593 | 3300025960 | Ga0207651_10869089 | Ga0207651_108690891 | 217 |
| 594 | 3300025972 | Ga0207668_10087586 | Ga0207668_100875862 | 217 |
| 595 | 3300025981 | Ga0207640_10014227 | Ga0207640_100142272 | 217 |
| 596 | 3300025981 | Ga0207640_10124240 | Ga0207640_101242402 | 217 |
| 597 | 3300025986 | Ga0207658_10091679 | Ga0207658_100916792 | 217 |
| 598 | 3300025986 | Ga0207658_10216383 | Ga0207658_102163832 | 217 |
| 599 | 3300026023 | Ga0207677_10001053 | Ga0207677_1000105312 | 217 |
| 600 | 3300026023 | Ga0207677_10128648 | Ga0207677_101286482 | 217 |
| 601 | 3300026023 | Ga0207677_10175298 | Ga0207677_101752983 | 217 |
| 602 | 3300026041 | Ga0207639_10000520 | Ga0207639_100005202 | 217 |
| 603 | 3300026067 | Ga0207678_10075196 | Ga0207678_100751963 | 217 |
| 604 | 3300026067 | Ga0207678_10100602 | Ga0207678_101006022 | 217 |
| 605 | 3300026067 | Ga0207678_10226518 | Ga0207678_102265182 | 217 |
| 606 | 3300026075 | Ga0207708_10063567 | Ga0207708_100635673 | 217 |
| 607 | 3300026078 | Ga0207702_10095787 | Ga0207702_100957872 | 217 |
| 608 | 3300026078 | Ga0207702_10811355 | Ga0207702_108113551 | 217 |
| 609 | 3300026089 | Ga0207648_10001189 | Ga0207648_100011898 | 217 |
| 610 | 3300026089 | Ga0207648_10030812 | Ga0207648_100308123 | 217 |
| 611 | 3300026095 | Ga0207676_10033488 | Ga0207676_100334882 | 217 |
| 612 | 3300026116 | Ga0207674_10038495 | Ga0207674_100384952 | 217 |
| 613 | 3300026116 | Ga0207674_10300735 | Ga0207674_103007352 | 217 |
| 614 | 3300026121 | Ga0207683_10000838 | Ga0207683_1000083830 | 217 |
| 615 | 3300026121 | Ga0207683_10002698 | Ga0207683_1000269816 | 217 |
| 616 | 3300026142 | Ga0207698_10000603 | Ga0207698_1000060315 | 217 |
| 617 | 3300026142 | Ga0207698_10001098 | Ga0207698_1000109811 | 217 |
| 618 | 3300026142 | Ga0207698_10005537 | Ga0207698_100055376 | 217 |
| 619 | 3300026142 | Ga0207698_10010801 | Ga0207698_100108013 | 217 |
| 620 | 3300026142 | Ga0207698_10022534 | Ga0207698_100225345 | 217 |
| 621 | 3300026142 | Ga0207698_10398314 | Ga0207698_103983142 | 217 |
| 622 | 3300027312 | Ga0209371_1011284 | Ga0209371_10112842 | 217 |
| 623 | 3300027424 | Ga0209984_1003102 | Ga0209984_10031022 | 217 |
| 624 | 3300027526 | Ga0209968_1011434 | Ga0209968_10114343 | 217 |
| 625 | 3300027614 | Ga0209970_1036755 | Ga0209970_10367551 | 217 |
| 626 | 3300027617 | Ga0210002_1006145 | Ga0210002_10061452 | 217 |
| 627 | 3300027617 | Ga0210002_1011843 | Ga0210002_10118431 | 217 |
| 628 | 3300027665 | Ga0209983_1015181 | Ga0209983_10151813 | 217 |
| 629 | 3300027665 | Ga0209983_1017103 | Ga0209983_10171032 | 217 |
| 630 | 3300027671 | Ga0209588_1021994 | Ga0209588_10219942 | 217 |
| 631 | 3300027682 | Ga0209971_1001003 | Ga0209971_10010033 | 217 |
| 632 | 3300027682 | Ga0209971_1034787 | Ga0209971_10347872 | 217 |
| 633 | 3300027876 | Ga0209974_10002915 | Ga0209974_100029156 | 217 |
| 634 | 3300027876 | Ga0209974_10006328 | Ga0209974_100063284 | 217 |
| 635 | 3300027876 | Ga0209974_10043685 | Ga0209974_100436852 | 217 |
| 636 | 3300028380 | Ga0268265_10464038 | Ga0268265_104640381 | 217 |
| 637 | 3300028381 | Ga0268264_10497053 | Ga0268264_104970532 | 217 |
| 638 | 3300028381 | Ga0268264_10793808 | Ga0268264_107938081 | 217 |
| 639 | 3300028800 | Ga0265338_10000159 | Ga0265338_1000015988 | 217 |
| 640 | 3300030500 | Ga0268256_1009781 | Ga0268256_10097813 | 217 |
| 641 | 3300031238 | Ga0265332_10162881 | Ga0265332_101628812 | 217 |
| 642 | 3300031548 | Ga0307408_100003309 | Ga0307408_1000033098 | 217 |
| 643 | 3300031548 | Ga0307408_100027057 | Ga0307408_1000270574 | 217 |
| 644 | 3300031548 | Ga0307408_100372028 | Ga0307408_1003720282 | 217 |
| 645 | 3300031731 | Ga0307405_10018263 | Ga0307405_100182635 | 217 |
| 646 | 3300031824 | Ga0307413_10188889 | Ga0307413_101888891 | 217 |
| 647 | 3300031852 | Ga0307410_10155070 | Ga0307410_101550702 | 217 |
| 648 | 3300031852 | Ga0307410_10296962 | Ga0307410_102969622 | 217 |
| 649 | 3300031901 | Ga0307406_10518856 | Ga0307406_105188561 | 217 |
| 650 | 3300031903 | Ga0307407_10019840 | Ga0307407_100198402 | 217 |
| 651 | 3300031903 | Ga0307407_10324002 | Ga0307407_103240021 | 217 |
| 652 | 3300031911 | Ga0307412_10000011 | Ga0307412_10000011282 | 217 |
| 653 | 3300031911 | Ga0307412_10214523 | Ga0307412_102145231 | 217 |
| 654 | 3300031995 | Ga0307409_100056694 | Ga0307409_1000566941 | 217 |
| 655 | 3300031995 | Ga0307409_100152197 | Ga0307409_1001521973 | 217 |
| 656 | 3300031995 | Ga0307409_100163271 | Ga0307409_1001632712 | 217 |
| 657 | 3300031995 | Ga0307409_100321625 | Ga0307409_1003216252 | 217 |
| 658 | 3300032002 | Ga0307416_100028718 | Ga0307416_1000287183 | 217 |
| 659 | 3300032002 | Ga0307416_100936678 | Ga0307416_1009366781 | 217 |
| 660 | 3300032004 | Ga0307414_10007355 | Ga0307414_100073555 | 217 |
| 661 | 3300032005 | Ga0307411_10033971 | Ga0307411_100339712 | 217 |
| 662 | 3300032005 | Ga0307411_10382465 | Ga0307411_103824652 | 217 |
| 663 | 3300032126 | Ga0307415_100095676 | Ga0307415_1000956762 | 217 |
| 664 | 3300032126 | Ga0307415_100834957 | Ga0307415_1008349571 | 217 |
| 665 | 3300035086 | Ga0373934_0003851 | Ga0373934_0003851_2920_3573 | 217 |
| 666 | 3300035113 | Ga0373936_0016441 | Ga0373936_0016441_1436_2089 | 217 |
| 667 | 3300035114 | Ga0373939_0107208 | Ga0373939_0107208_300_953 | 217 |
| 668 | 3300035116 | Ga0373945_0018911 | Ga0373945_0018911_1661_2314 | 217 |
| 669 | 3300035117 | Ga0373953_0007056 | Ga0373953_0007056_1065_1718 | 217 |
| 670 | 3300035119 | Ga0373956_0058093 | Ga0373956_0058093_295_948 | 217 |
| 671 | 3300035120 | Ga0373957_0001050 | Ga0373957_0001050_3900_4592 | 217 |
| 672 | 3300035172 | Ga0373955_0026251 | Ga0373955_0026251_1659_2312 | 217 |
| 673 | 3300035172 | Ga0373955_0030261 | Ga0373955_0030261_1851_2543 | 217 |
| 674 | 3300035410 | Ga0373924_0001454 | Ga0373924_0001454_5370_6023 | 217 |
| 675 | 3300035692 | Ga0373935_0082656 | Ga0373935_0082656_526_1179 | 217 |
| 676 | 3300035695 | Ga0373927_0009366 | Ga0373927_0009366_4519_5172 | 217 |
| 677 | 3300035695 | Ga0373927_0032345 | Ga0373927_0032345_2140_2793 | 217 |
| 678 | 3300035695 | Ga0373927_0135661 | Ga0373927_0135661_740_1393 | 217 |
| 679 | 3300035724 | Ga0373933_0025633 | Ga0373933_0025633_2408_3100 | 217 |
| 680 | 3300035724 | Ga0373933_0045247 | Ga0373933_0045247_323_976 | 217 |
| 681 | 3300035725 | Ga0373947_0077381 | Ga0373947_0077381_1146_1799 | 217 |
| 682 | 3300036401 | Ga0373937_0367808 | Ga0373937_0367808_86_739 | 217 |
| 683 | 3300037068 | Ga0373925_0032407 | Ga0373925_0032407_2871_3524 | 217 |
| 684 | 3300037068 | Ga0373925_0130053 | Ga0373925_0130053_959_1723 | 217 |
| 685 | 3300037312 | Ga0395899_0063257 | Ga0395899_0063257_678_1346 | 217 |
| 686 | 3300037418 | Ga0395900_0149631 | Ga0395900_0149631_1078_1746 | 217 |
| 687 | 3300037418 | Ga0395900_0215718 | Ga0395900_0215718_75_737 | 217 |
| 688 | 3300037418 | Ga0395900_0277990 | Ga0395900_0277990_772_1434 | 217 |
| 689 | 3300037418 | Ga0395900_0742441 | Ga0395900_0742441_242_895 | 217 |
| 690 | 3300037418 | Ga0395900_0865776 | Ga0395900_0865776_75_737 | 217 |
| 691 | 3300037466 | Ga0395898_0023476 | Ga0395898_0023476_1264_1932 | 217 |
| 692 | 3300037466 | Ga0395898_0053375 | Ga0395898_0053375_3148_3810 | 217 |
| 693 | 3300037466 | Ga0395898_0169894 | Ga0395898_0169894_782_1444 | 217 |
| 694 | 3300037466 | Ga0395898_0241852 | Ga0395898_0241852_329_982 | 217 |
| 695 | 3300037471 | Ga0395905_0015881 | Ga0395905_0015881_1929_2594 | 217 |
| 696 | 3300037471 | Ga0395905_0041189 | Ga0395905_0041189_129_785 | 217 |
| 697 | 3300037471 | Ga0395905_0091083 | Ga0395905_0091083_1763_2422 | 217 |
| 698 | 3300037853 | Ga0436364_1101072 | Ga0436364_1101072_112_771 | 217 |
| 699 | 3300038443 | Ga0395901_0127955 | Ga0395901_0127955_1200_1862 | 217 |
| 700 | 3300038443 | Ga0395901_0456251 | Ga0395901_0456251_621_1289 | 217 |
| 701 | 3300038996 | Ga0242420_057203 | Ga0242420_057203_51_704 | 217 |
| 702 | 3300039438 | Ga0436360_0981097 | Ga0436360_0981097_848_1540 | 217 |
| 703 | 3300039447 | Ga0436361_0875914 | Ga0436361_0875914_105_758 | 217 |
| 704 | 3300041405 | Ga0439438_012311 | Ga0439438_012311_1477_2130 | 217 |
| 705 | 3300041407 | Ga0439447_005564 | Ga0439447_005564_2469_3122 | 217 |
| 706 | 3300041411 | Ga0439466_0002347 | Ga0439466_0002347_6657_7310 | 217 |
| 707 | 3300041411 | Ga0439466_0015237 | Ga0439466_0015237_664_1317 | 217 |
| 708 | 3300042005 | Ga0439448_0000736 | Ga0439448_0000736_3637_4290 | 217 |
| 709 | 3300042010 | Ga0439452_000093 | Ga0439452_000093_42251_42904 | 217 |
| 710 | 3300042010 | Ga0439452_044192 | Ga0439452_044192_297_953 | 217 |
| 711 | 3300042146 | Ga0450907_018903 | Ga0450907_018903_366_1019 | 217 |
| 712 | 3300042876 | Ga0451577_0074147 | Ga0451577_0074147_2065_2721 | 217 |
| 713 | 3300042876 | Ga0451577_0442727 | Ga0451577_0442727_164_817 | 217 |
| 714 | 3300044656 | Ga0466969_0005664 | Ga0466969_0005664_520_1176 | 217 |
| 715 | 3300044656 | Ga0466969_0042769 | Ga0466969_0042769_1129_1782 | 217 |
| 716 | 3300044668 | Ga0466980_0132384 | Ga0466980_0132384_459_1112 | 217 |
| 717 | 3300044683 | Ga0466965_0001313 | Ga0466965_0001313_8747_9400 | 217 |
| 718 | 3300044684 | Ga0466966_0008831 | Ga0466966_0008831_1622_2284 | 217 |
| 719 | 3300044684 | Ga0466966_0037177 | Ga0466966_0037177_493_1149 | 217 |
| 720 | 3300044684 | Ga0466966_0048767 | Ga0466966_0048767_1813_2466 | 217 |
| 721 | 3300044684 | Ga0466966_0209892 | Ga0466966_0209892_305_964 | 217 |
| 722 | 3300044693 | Ga0466961_0000207 | Ga0466961_0000207_14508_15164 | 217 |
| 723 | 3300044693 | Ga0466961_0004748 | Ga0466961_0004748_6370_7023 | 217 |
| 724 | 3300044694 | Ga0466963_0031487 | Ga0466963_0031487_2626_3279 | 217 |
| 725 | 3300044694 | Ga0466963_0193713 | Ga0466963_0193713_641_1294 | 217 |
| 726 | 3300044712 | Ga0453684_0135504 | Ga0453684_0135504_1673_2329 | 217 |
| 727 | 3300044719 | Ga0466971_0003647 | Ga0466971_0003647_1164_1817 | 217 |
| 728 | 3300044719 | Ga0466971_0045577 | Ga0466971_0045577_263_916 | 217 |
| 729 | 3300044735 | Ga0466968_0298587 | Ga0466968_0298587_75_728 | 217 |
| 730 | 3300044765 | Ga0466970_0002943 | Ga0466970_0002943_1442_2095 | 217 |
| 731 | 3300044765 | Ga0466970_0042389 | Ga0466970_0042389_488_1141 | 217 |
| 732 | 3300044765 | Ga0466970_0050792 | Ga0466970_0050792_1287_1943 | 217 |
| 733 | 3300044842 | Ga0466957_0002486 | Ga0466957_0002486_6474_7127 | 217 |
| 734 | 3300044842 | Ga0466957_0299366 | Ga0466957_0299366_194_847 | 217 |
| 735 | 3300045049 | Ga0466959_0004552 | Ga0466959_0004552_1677_2330 | 217 |
| 736 | 3300045049 | Ga0466959_0009026 | Ga0466959_0009026_2073_2735 | 217 |
| 737 | 3300045049 | Ga0466959_0014770 | Ga0466959_0014770_67_723 | 217 |
| 738 | 3300045049 | Ga0466959_0203789 | Ga0466959_0203789_463_1116 | 217 |
| 739 | 3300045051 | Ga0451576_0073438 | Ga0451576_0073438_916_1674 | 217 |
| 740 | 3300045051 | Ga0451576_0075928 | Ga0451576_0075928_306_959 | 217 |
| 741 | 3300045051 | Ga0451576_0206316 | Ga0451576_0206316_1183_1836 | 217 |
| 742 | 3300045836 | Ga0466958_0021682 | Ga0466958_0021682_1930_2583 | 217 |
| 743 | 3300045836 | Ga0466958_0195931 | Ga0466958_0195931_278_940 | 217 |
| 744 | 3300045976 | Ga0466967_0661511 | Ga0466967_0661511_52_717 | 217 |
| 745 | 3300045976 | Ga0466967_0711420 | Ga0466967_0711420_197_862 | 217 |
| 746 | 3300046453 | Ga0495627_004833 | Ga0495627_004833_203_856 | 217 |
| 747 | 3300046454 | Ga0495592_0001021 | Ga0495592_0001021_13521_14186 | 217 |
| 748 | 3300046454 | Ga0495592_0058142 | Ga0495592_0058142_828_1487 | 217 |
| 749 | 3300046454 | Ga0495592_0153597 | Ga0495592_0153597_880_1536 | 217 |
| 750 | 3300046454 | Ga0495592_0258830 | Ga0495592_0258830_434_1087 | 217 |
| 751 | 3300046455 | Ga0495603_0000430 | Ga0495603_0000430_14470_15123 | 217 |
| 752 | 3300046457 | Ga0495590_0007055 | Ga0495590_0007055_10_669 | 217 |
| 753 | 3300046457 | Ga0495590_0019696 | Ga0495590_0019696_1257_1913 | 217 |
| 754 | 3300046457 | Ga0495590_0065133 | Ga0495590_0065133_31_699 | 217 |
| 755 | 3300046459 | Ga0495629_0000184 | Ga0495629_0000184_8211_8864 | 217 |
| 756 | 3300046459 | Ga0495629_0002988 | Ga0495629_0002988_21_680 | 217 |
| 757 | 3300046459 | Ga0495629_0043550 | Ga0495629_0043550_179_907 | 217 |
| 758 | 3300046459 | Ga0495629_0144566 | Ga0495629_0144566_741_1394 | 217 |
| 759 | 3300046459 | Ga0495629_0158760 | Ga0495629_0158760_256_939 | 217 |
| 760 | 3300046462 | Ga0495651_0003256 | Ga0495651_0003256_6933_7586 | 217 |
| 761 | 3300046462 | Ga0495651_0005334 | Ga0495651_0005334_3440_4093 | 217 |
| 762 | 3300046463 | Ga0495653_0000458 | Ga0495653_0000458_6098_6754 | 217 |
| 763 | 3300046463 | Ga0495653_0028921 | Ga0495653_0028921_1998_2651 | 217 |
| 764 | 3300046463 | Ga0495653_0037707 | Ga0495653_0037707_2590_3243 | 217 |
| 765 | 3300046463 | Ga0495653_0325178 | Ga0495653_0325178_195_854 | 217 |
| 766 | 3300046471 | Ga0495650_0000155 | Ga0495650_0000155_122537_123190 | 217 |
| 767 | 3300046471 | Ga0495650_0008029 | Ga0495650_0008029_1964_2671 | 217 |
| 768 | 3300046472 | Ga0495580_0003676 | Ga0495580_0003676_11387_12040 | 217 |
| 769 | 3300046472 | Ga0495580_0007003 | Ga0495580_0007003_6391_7134 | 217 |
| 770 | 3300046472 | Ga0495580_0019201 | Ga0495580_0019201_2608_3261 | 217 |
| 771 | 3300046472 | Ga0495580_0045774 | Ga0495580_0045774_2324_2977 | 217 |
| 772 | 3300046472 | Ga0495580_0051269 | Ga0495580_0051269_929_1582 | 217 |
| 773 | 3300046472 | Ga0495580_0131594 | Ga0495580_0131594_1062_1715 | 217 |
| 774 | 3300046473 | Ga0495582_0100335 | Ga0495582_0100335_667_1320 | 217 |
| 775 | 3300046474 | Ga0495605_0003642 | Ga0495605_0003642_4463_5206 | 217 |
| 776 | 3300046474 | Ga0495605_0007723 | Ga0495605_0007723_21_680 | 217 |
| 777 | 3300046475 | Ga0495639_0002731 | Ga0495639_0002731_5741_6394 | 217 |
| 778 | 3300046475 | Ga0495639_0004581 | Ga0495639_0004581_2929_3582 | 217 |
| 779 | 3300046476 | Ga0495662_0003851 | Ga0495662_0003851_1076_1729 | 217 |
| 780 | 3300046476 | Ga0495662_0033063 | Ga0495662_0033063_501_1154 | 217 |
| 781 | 3300046476 | Ga0495662_0121389 | Ga0495662_0121389_544_1200 | 217 |
| 782 | 3300046477 | Ga0495664_0009344 | Ga0495664_0009344_2484_3137 | 217 |
| 783 | 3300046491 | Ga0495584_0093221 | Ga0495584_0093221_848_1504 | 217 |
| 784 | 3300046492 | Ga0495585_0000756 | Ga0495585_0000756_23542_24195 | 217 |
| 785 | 3300046499 | Ga0495594_0030730 | Ga0495594_0030730_754_1407 | 217 |
| 786 | 3300046499 | Ga0495594_0132249 | Ga0495594_0132249_43_696 | 217 |
| 787 | 3300046500 | Ga0495596_0013516 | Ga0495596_0013516_1567_2220 | 217 |
| 788 | 3300046500 | Ga0495596_0078620 | Ga0495596_0078620_94_750 | 217 |
| 789 | 3300046506 | Ga0495583_0002052 | Ga0495583_0002052_8891_9634 | 217 |
| 790 | 3300046506 | Ga0495583_0023731 | Ga0495583_0023731_795_1448 | 217 |
| 791 | 3300046507 | Ga0495606_0003521 | Ga0495606_0003521_2557_3213 | 217 |
| 792 | 3300046507 | Ga0495606_0010907 | Ga0495606_0010907_1929_2588 | 217 |
| 793 | 3300046507 | Ga0495606_0036960 | Ga0495606_0036960_1952_2608 | 217 |
| 794 | 3300046511 | Ga0495608_0019092 | Ga0495608_0019092_1659_2312 | 217 |
| 795 | 3300046511 | Ga0495608_0084089 | Ga0495608_0084089_883_1536 | 217 |
| 796 | 3300046511 | Ga0495608_0112547 | Ga0495608_0112547_801_1460 | 217 |
| 797 | 3300046512 | Ga0495610_0013957 | Ga0495610_0013957_4013_4666 | 217 |
| 798 | 3300046512 | Ga0495610_0027577 | Ga0495610_0027577_19_678 | 217 |
| 799 | 3300046513 | Ga0495616_0045437 | Ga0495616_0045437_846_1589 | 217 |
| 800 | 3300046514 | Ga0495618_0005497 | Ga0495618_0005497_5245_5898 | 217 |
| 801 | 3300046514 | Ga0495618_0051561 | Ga0495618_0051561_1799_2458 | 217 |
| 802 | 3300046516 | Ga0495628_0000612 | Ga0495628_0000612_14561_15214 | 217 |
| 803 | 3300046516 | Ga0495628_0001377 | Ga0495628_0001377_16098_16763 | 217 |
| 804 | 3300046516 | Ga0495628_0002577 | Ga0495628_0002577_2746_3399 | 217 |
| 805 | 3300046516 | Ga0495628_0008978 | Ga0495628_0008978_2407_3063 | 217 |
| 806 | 3300046516 | Ga0495628_0047491 | Ga0495628_0047491_1082_1735 | 217 |
| 807 | 3300046516 | Ga0495628_0050024 | Ga0495628_0050024_277_930 | 217 |
| 808 | 3300046516 | Ga0495628_0058645 | Ga0495628_0058645_1495_2154 | 217 |
| 809 | 3300046516 | Ga0495628_0096860 | Ga0495628_0096860_1302_1955 | 217 |
| 810 | 3300046516 | Ga0495628_0152777 | Ga0495628_0152777_486_1139 | 217 |
| 811 | 3300046516 | Ga0495628_0173739 | Ga0495628_0173739_437_1090 | 217 |
| 812 | 3300046517 | Ga0495630_0000001 | Ga0495630_0000001_562330_562983 | 217 |
| 813 | 3300046517 | Ga0495630_0006146 | Ga0495630_0006146_3349_4002 | 217 |
| 814 | 3300046517 | Ga0495630_0021822 | Ga0495630_0021822_1343_2002 | 217 |
| 815 | 3300046517 | Ga0495630_0042233 | Ga0495630_0042233_323_976 | 217 |
| 816 | 3300046517 | Ga0495630_0056979 | Ga0495630_0056979_1189_1845 | 217 |
| 817 | 3300046517 | Ga0495630_0175263 | Ga0495630_0175263_283_975 | 217 |
| 818 | 3300046520 | Ga0495637_0006474 | Ga0495637_0006474_2639_3292 | 217 |
| 819 | 3300046524 | Ga0495648_0002413 | Ga0495648_0002413_12476_13135 | 217 |
| 820 | 3300046526 | Ga0495666_0011194 | Ga0495666_0011194_195_854 | 217 |
| 821 | 3300046526 | Ga0495666_0023256 | Ga0495666_0023256_1765_2418 | 217 |
| 822 | 3300046526 | Ga0495666_0101340 | Ga0495666_0101340_560_1213 | 217 |
| 823 | 3300046526 | Ga0495666_0214938 | Ga0495666_0214938_143_796 | 217 |
| 824 | 3300046528 | Ga0495642_0042416 | Ga0495642_0042416_100_753 | 217 |
| 825 | 3300046529 | Ga0495652_0001770 | Ga0495652_0001770_17401_18066 | 217 |
| 826 | 3300046529 | Ga0495652_0002873 | Ga0495652_0002873_7896_8549 | 217 |
| 827 | 3300046529 | Ga0495652_0019423 | Ga0495652_0019423_1148_1807 | 217 |
| 828 | 3300046529 | Ga0495652_0029318 | Ga0495652_0029318_1721_2377 | 217 |
| 829 | 3300046529 | Ga0495652_0030200 | Ga0495652_0030200_803_1456 | 217 |
| 830 | 3300046529 | Ga0495652_0237329 | Ga0495652_0237329_16_669 | 217 |
| 831 | 3300046529 | Ga0495652_0547782 | Ga0495652_0547782_72_728 | 217 |
| 832 | 3300046530 | Ga0495654_0062788 | Ga0495654_0062788_953_1606 | 217 |
| 833 | 3300046531 | Ga0495665_0000741 | Ga0495665_0000741_5474_6130 | 217 |
| 834 | 3300046531 | Ga0495665_0012406 | Ga0495665_0012406_3530_4189 | 217 |
| 835 | 3300046531 | Ga0495665_0034988 | Ga0495665_0034988_1845_2498 | 217 |
| 836 | 3300046533 | Ga0495640_0012828 | Ga0495640_0012828_2296_2955 | 217 |
| 837 | 3300046533 | Ga0495640_0036400 | Ga0495640_0036400_801_1454 | 217 |
| 838 | 3300046535 | Ga0495586_0003135 | Ga0495586_0003135_6378_7031 | 217 |
| 839 | 3300046535 | Ga0495586_0016699 | Ga0495586_0016699_157_816 | 217 |
| 840 | 3300046535 | Ga0495586_0025541 | Ga0495586_0025541_1299_1952 | 217 |
| 841 | 3300046535 | Ga0495586_0034512 | Ga0495586_0034512_1421_2074 | 217 |
| 842 | 3300046536 | Ga0495587_0001813 | Ga0495587_0001813_11424_12077 | 217 |
| 843 | 3300046536 | Ga0495587_0010252 | Ga0495587_0010252_2174_2827 | 217 |
| 844 | 3300046536 | Ga0495587_0088935 | Ga0495587_0088935_810_1463 | 217 |
| 845 | 3300046542 | Ga0495597_0001849 | Ga0495597_0001849_10960_11616 | 217 |
| 846 | 3300046542 | Ga0495597_0007892 | Ga0495597_0007892_768_1421 | 217 |
| 847 | 3300046543 | Ga0495645_0000102 | Ga0495645_0000102_34059_34712 | 217 |
| 848 | 3300046543 | Ga0495645_0000216 | Ga0495645_0000216_4501_5166 | 217 |
| 849 | 3300046543 | Ga0495645_0178563 | Ga0495645_0178563_551_1207 | 217 |
| 850 | 3300046543 | Ga0495645_0192110 | Ga0495645_0192110_175_828 | 217 |
| 851 | 3300046543 | Ga0495645_0212969 | Ga0495645_0212969_559_1212 | 217 |
| 852 | 3300046557 | Ga0495622_0011928 | Ga0495622_0011928_939_1592 | 217 |
| 853 | 3300046557 | Ga0495622_0025958 | Ga0495622_0025958_1345_1998 | 217 |
| 854 | 3300046557 | Ga0495622_0088620 | Ga0495622_0088620_49_792 | 217 |
| 855 | 3300046559 | Ga0495667_0121786 | Ga0495667_0121786_582_1235 | 217 |
| 856 | 3300046616 | Ga0495668_0209375 | Ga0495668_0209375_305_961 | 217 |
| 857 | 3300046642 | Ga0495634_0000154 | Ga0495634_0000154_45255_45908 | 217 |
| 858 | 3300046642 | Ga0495634_0015021 | Ga0495634_0015021_4114_4767 | 217 |
| 859 | 3300046642 | Ga0495634_0027544 | Ga0495634_0027544_195_854 | 217 |
| 860 | 3300046642 | Ga0495634_0513238 | Ga0495634_0513238_32_688 | 217 |
| 861 | 3300046663 | Ga0495635_0000051 | Ga0495635_0000051_52391_53044 | 217 |
| 862 | 3300046663 | Ga0495635_0006318 | Ga0495635_0006318_794_1447 | 217 |
| 863 | 3300046663 | Ga0495635_0007827 | Ga0495635_0007827_4009_4665 | 217 |
| 864 | 3300046663 | Ga0495635_0045492 | Ga0495635_0045492_1115_1768 | 217 |
| 865 | 3300046663 | Ga0495635_0126150 | Ga0495635_0126150_270_929 | 217 |
| 866 | 3300046674 | Ga0495588_0133585 | Ga0495588_0133585_198_851 | 217 |
| 867 | 3300046675 | Ga0495657_0026574 | Ga0495657_0026574_2289_2948 | 217 |
| 868 | 3300046675 | Ga0495657_0081045 | Ga0495657_0081045_687_1340 | 217 |
| 869 | 3300046678 | Ga0495599_0000176 | Ga0495599_0000176_31518_32183 | 217 |
| 870 | 3300046678 | Ga0495599_0068119 | Ga0495599_0068119_1546_2202 | 217 |
| 871 | 3300046678 | Ga0495599_0077061 | Ga0495599_0077061_588_1241 | 217 |
| 872 | 3300046678 | Ga0495599_0291554 | Ga0495599_0291554_308_961 | 217 |
| 873 | 3300046679 | Ga0495623_0001241 | Ga0495623_0001241_11630_12283 | 217 |
| 874 | 3300046679 | Ga0495623_0001591 | Ga0495623_0001591_12715_13374 | 217 |
| 875 | 3300046679 | Ga0495623_0138585 | Ga0495623_0138585_634_1287 | 217 |
| 876 | 3300046680 | Ga0495646_0001764 | Ga0495646_0001764_3797_4453 | 217 |
| 877 | 3300046680 | Ga0495646_0003339 | Ga0495646_0003339_6931_7584 | 217 |
| 878 | 3300046680 | Ga0495646_0014182 | Ga0495646_0014182_4229_4882 | 217 |
| 879 | 3300046680 | Ga0495646_0020151 | Ga0495646_0020151_1797_2456 | 217 |
| 880 | 3300046680 | Ga0495646_0101339 | Ga0495646_0101339_947_1600 | 217 |
| 881 | 3300046681 | Ga0495647_0008851 | Ga0495647_0008851_675_1328 | 217 |
| 882 | 3300046683 | Ga0495658_0023929 | Ga0495658_0023929_86_739 | 217 |
| 883 | 3300046689 | Ga0495613_0010481 | Ga0495613_0010481_2020_2673 | 217 |
| 884 | 3300046689 | Ga0495613_0092657 | Ga0495613_0092657_1291_1944 | 217 |
| 885 | 3300046689 | Ga0495613_0260163 | Ga0495613_0260163_433_1086 | 217 |
| 886 | 3300046690 | Ga0495624_0001086 | Ga0495624_0001086_6592_7248 | 217 |
| 887 | 3300046690 | Ga0495624_0034561 | Ga0495624_0034561_1911_2564 | 217 |
| 888 | 3300046692 | Ga0495671_0180625 | Ga0495671_0180625_331_984 | 217 |
| 889 | 3300046694 | Ga0495649_0003924 | Ga0495649_0003924_8972_9628 | 217 |
| 890 | 3300046694 | Ga0495649_0015531 | Ga0495649_0015531_2586_3245 | 217 |
| 891 | 3300046694 | Ga0495649_0026116 | Ga0495649_0026116_421_1080 | 217 |
| 892 | 3300046694 | Ga0495649_0058880 | Ga0495649_0058880_1315_2058 | 217 |
| 893 | 3300046794 | Ga0495589_0004136 | Ga0495589_0004136_4664_5317 | 217 |
| 894 | 3300046794 | Ga0495589_0010883 | Ga0495589_0010883_60_716 | 217 |
| 895 | 3300046794 | Ga0495589_0104796 | Ga0495589_0104796_53_712 | 217 |
| 896 | 3300046794 | Ga0495589_0283342 | Ga0495589_0283342_30_686 | 217 |
| 897 | 3300046809 | Ga0495600_0007472 | Ga0495600_0007472_1151_1804 | 217 |
| 898 | 3300046809 | Ga0495600_0011407 | Ga0495600_0011407_3226_3885 | 217 |
| 899 | 3300046809 | Ga0495600_0014208 | Ga0495600_0014208_2148_2801 | 217 |
| 900 | 3300046810 | Ga0495660_0012233 | Ga0495660_0012233_860_1513 | 217 |
| 901 | 3300047315 | Ga0495581_0004254 | Ga0495581_0004254_5378_6031 | 217 |
| 902 | 3300047315 | Ga0495581_0013486 | Ga0495581_0013486_393_1052 | 217 |
| 903 | 3300047315 | Ga0495581_0020822 | Ga0495581_0020822_2551_3204 | 217 |
| 904 | 3300047317 | Ga0495604_0003840 | Ga0495604_0003840_3360_4016 | 217 |
| 905 | 3300047317 | Ga0495604_0004609 | Ga0495604_0004609_8135_8788 | 217 |
| 906 | 3300047317 | Ga0495604_0037997 | Ga0495604_0037997_1626_2279 | 217 |
| 907 | 3300047317 | Ga0495604_0067069 | Ga0495604_0067069_1149_1808 | 217 |
| 908 | 3300047317 | Ga0495604_0078914 | Ga0495604_0078914_1075_1728 | 217 |
| 909 | 3300047319 | Ga0495674_0003055 | Ga0495674_0003055_6338_6991 | 217 |
| 910 | 3300047319 | Ga0495674_0003130 | Ga0495674_0003130_10131_10784 | 217 |
| 911 | 3300047319 | Ga0495674_0030343 | Ga0495674_0030343_2383_3036 | 217 |
| 912 | 3300047320 | Ga0495672_0005687 | Ga0495672_0005687_702_1355 | 217 |
| 913 | 3300047320 | Ga0495672_0013269 | Ga0495672_0013269_4857_5600 | 217 |
| 914 | 3300047320 | Ga0495672_0199507 | Ga0495672_0199507_108_764 | 217 |
| 915 | 3300047321 | Ga0495676_0011001 | Ga0495676_0011001_305_964 | 217 |
| 916 | 3300047322 | Ga0495680_0001302 | Ga0495680_0001302_1180_1833 | 217 |
| 917 | 3300047322 | Ga0495680_0003003 | Ga0495680_0003003_8020_8673 | 217 |
| 918 | 3300047322 | Ga0495680_0021279 | Ga0495680_0021279_1065_1718 | 217 |
| 919 | 3300047322 | Ga0495680_0021591 | Ga0495680_0021591_4651_5307 | 217 |
| 920 | 3300047322 | Ga0495680_0045279 | Ga0495680_0045279_647_1300 | 217 |
| 921 | 3300047322 | Ga0495680_0049107 | Ga0495680_0049107_482_1138 | 217 |
| 922 | 3300047323 | Ga0495683_0002414 | Ga0495683_0002414_6490_7146 | 217 |
| 923 | 3300047323 | Ga0495683_0012338 | Ga0495683_0012338_3405_4064 | 217 |
| 924 | 3300047323 | Ga0495683_0017289 | Ga0495683_0017289_236_895 | 217 |
| 925 | 3300047443 | Ga0495687_000029 | Ga0495687_000029_8140_8796 | 217 |
| 926 | 3300047443 | Ga0495687_005545 | Ga0495687_005545_286_939 | 217 |
| 927 | 3300047443 | Ga0495687_012506 | Ga0495687_012506_2535_3194 | 217 |
| 928 | 3300047443 | Ga0495687_015266 | Ga0495687_015266_2169_2912 | 217 |
| 929 | 3300047444 | Ga0495675_0014968 | Ga0495675_0014968_1655_2308 | 217 |
| 930 | 3300047444 | Ga0495675_0021231 | Ga0495675_0021231_2150_2803 | 217 |
| 931 | 3300047444 | Ga0495675_0080414 | Ga0495675_0080414_422_1081 | 217 |
| 932 | 3300047444 | Ga0495675_0239590 | Ga0495675_0239590_261_914 | 217 |
| 933 | 3300047469 | Ga0495673_0000426 | Ga0495673_0000426_13239_13892 | 217 |
| 934 | 3300047469 | Ga0495673_0012569 | Ga0495673_0012569_3660_4313 | 217 |
| 935 | 3300047469 | Ga0495673_0034361 | Ga0495673_0034361_1005_1748 | 217 |
| 936 | 3300047470 | Ga0495681_0004331 | Ga0495681_0004331_7709_8362 | 217 |
| 937 | 3300047472 | Ga0495686_0001282 | Ga0495686_0001282_4359_5012 | 217 |
| 938 | 3300047472 | Ga0495686_0013767 | Ga0495686_0013767_388_1041 | 217 |
| 939 | 3300047673 | Ga0495593_0002283 | Ga0495593_0002283_41_697 | 217 |
| 940 | 3300047673 | Ga0495593_0003295 | Ga0495593_0003295_1713_2366 | 217 |
| 941 | 3300047673 | Ga0495593_0008272 | Ga0495593_0008272_4116_4775 | 217 |
| 942 | 3300047673 | Ga0495593_0020592 | Ga0495593_0020592_2006_2659 | 217 |
| 943 | 3300048088 | Ga0495602_0000575 | Ga0495602_0000575_10801_11457 | 217 |
| 944 | 3300048088 | Ga0495602_0026341 | Ga0495602_0026341_2905_3564 | 217 |
| 945 | 3300048088 | Ga0495602_0101434 | Ga0495602_0101434_607_1260 | 217 |
| 946 | 3300048089 | Ga0495614_0009952 | Ga0495614_0009952_776_1435 | 217 |
| 947 | 3300048089 | Ga0495614_0032145 | Ga0495614_0032145_150_806 | 217 |
| 948 | 3300048089 | Ga0495614_0133392 | Ga0495614_0133392_220_873 | 217 |
| 949 | 3300048091 | Ga0495626_0090571 | Ga0495626_0090571_310_969 | 217 |
| 950 | 3300048903 | Ga0496100_0002447 | Ga0496100_0002447_7044_7697 | 217 |
| 951 | 3300048903 | Ga0496100_0003542 | Ga0496100_0003542_539_1192 | 217 |
| 952 | 3300048903 | Ga0496100_0015183 | Ga0496100_0015183_2747_3403 | 217 |
| 953 | 3300048903 | Ga0496100_0053719 | Ga0496100_0053719_992_1654 | 217 |
| 954 | 3300048903 | Ga0496100_0115862 | Ga0496100_0115862_29_691 | 217 |
| 955 | 3300048903 | Ga0496100_0207897 | Ga0496100_0207897_734_1390 | 217 |
| 956 | 3300048904 | Ga0496101_0003024 | Ga0496101_0003024_2724_3377 | 217 |
| 957 | 3300048904 | Ga0496101_0007849 | Ga0496101_0007849_1294_1947 | 217 |
| 958 | 3300048904 | Ga0496101_0008207 | Ga0496101_0008207_2827_3483 | 217 |
| 959 | 3300048904 | Ga0496101_0028733 | Ga0496101_0028733_1456_2118 | 217 |
| 960 | 3300048904 | Ga0496101_0631377 | Ga0496101_0631377_180_833 | 217 |
| 961 | 3300048905 | Ga0496102_0000311 | Ga0496102_0000311_21484_22137 | 217 |
| 962 | 3300048905 | Ga0496102_0000743 | Ga0496102_0000743_24276_24929 | 217 |
| 963 | 3300048905 | Ga0496102_0031281 | Ga0496102_0031281_2947_3600 | 217 |
| 964 | 3300048905 | Ga0496102_0032709 | Ga0496102_0032709_604_1260 | 217 |
| 965 | 3300048906 | Ga0496103_0000272 | Ga0496103_0000272_15479_16132 | 217 |
| 966 | 3300048906 | Ga0496103_0002440 | Ga0496103_0002440_4189_4842 | 217 |
| 967 | 3300048906 | Ga0496103_0151899 | Ga0496103_0151899_571_1227 | 217 |
| 968 | 3300048907 | Ga0496104_0010707 | Ga0496104_0010707_4544_5206 | 217 |
| 969 | 3300048907 | Ga0496104_0045833 | Ga0496104_0045833_2672_3325 | 217 |
| 970 | 3300048907 | Ga0496104_0048629 | Ga0496104_0048629_2134_2790 | 217 |
| 971 | 3300048907 | Ga0496104_0604642 | Ga0496104_0604642_218_874 | 217 |
| 972 | 3300048907 | Ga0496104_0633370 | Ga0496104_0633370_17_679 | 217 |
| 973 | 3300048908 | Ga0496105_0061430 | Ga0496105_0061430_1660_2316 | 217 |
| 974 | 3300048908 | Ga0496105_0182429 | Ga0496105_0182429_165_827 | 217 |
| 975 | 3300048909 | Ga0496106_0000003 | Ga0496106_0000003_144525_145178 | 217 |
| 976 | 3300048909 | Ga0496106_0061592 | Ga0496106_0061592_699_1352 | 217 |
| 977 | 3300048909 | Ga0496106_0675141 | Ga0496106_0675141_114_770 | 217 |
| 978 | 3300048910 | Ga0496107_0022179 | Ga0496107_0022179_219_875 | 217 |
| 979 | 3300048910 | Ga0496107_0110846 | Ga0496107_0110846_676_1329 | 217 |
| 980 | 3300048911 | Ga0496108_0081594 | Ga0496108_0081594_1820_2476 | 217 |
| 981 | 3300048912 | Ga0496109_0007189 | Ga0496109_0007189_7948_8601 | 217 |
| 982 | 3300048912 | Ga0496109_0025770 | Ga0496109_0025770_4234_4890 | 217 |
| 983 | 3300048912 | Ga0496109_0234039 | Ga0496109_0234039_508_1164 | 217 |
| 984 | 3300048912 | Ga0496109_0800399 | Ga0496109_0800399_27_686 | 217 |
| 985 | 3300048913 | Ga0496110_0006170 | Ga0496110_0006170_2761_3414 | 217 |
| 986 | 3300048913 | Ga0496110_0070686 | Ga0496110_0070686_630_1286 | 217 |
| 987 | 3300048914 | Ga0496111_0001680 | Ga0496111_0001680_4090_4746 | 217 |
| 988 | 3300048915 | Ga0496112_0003079 | Ga0496112_0003079_66_824 | 217 |
| 989 | 3300048915 | Ga0496112_0013812 | Ga0496112_0013812_5892_6545 | 217 |
| 990 | 3300048915 | Ga0496112_0014139 | Ga0496112_0014139_6237_6893 | 217 |
| 991 | 3300048915 | Ga0496112_0259728 | Ga0496112_0259728_769_1425 | 217 |
| 992 | 3300048917 | Ga0496114_0031593 | Ga0496114_0031593_2416_3069 | 217 |
| 993 | 3300048917 | Ga0496114_0181049 | Ga0496114_0181049_22_675 | 217 |
| 994 | 3300048917 | Ga0496114_0284879 | Ga0496114_0284879_537_1190 | 217 |
| 995 | 3300048917 | Ga0496114_0656298 | Ga0496114_0656298_135_788 | 217 |
| 996 | 3300048918 | Ga0496115_0077818 | Ga0496115_0077818_73_732 | 217 |
| 997 | 3300048918 | Ga0496115_0164989 | Ga0496115_0164989_926_1579 | 217 |
| 998 | 3300048918 | Ga0496115_0356092 | Ga0496115_0356092_344_997 | 217 |
| 999 | 3300048918 | Ga0496115_0611880 | Ga0496115_0611880_95_754 | 217 |
| 1000 | 3300048919 | Ga0496116_0042732 | Ga0496116_0042732_232_885 | 217 |
| 1001 | 3300048919 | Ga0496116_0061076 | Ga0496116_0061076_567_1223 | 217 |
| 1002 | 3300048919 | Ga0496116_0114975 | Ga0496116_0114975_700_1359 | 217 |
| 1003 | 3300048919 | Ga0496116_0132466 | Ga0496116_0132466_235_894 | 217 |
| 1004 | 3300048920 | Ga0496117_0001294 | Ga0496117_0001294_28742_29395 | 217 |
| 1005 | 3300048920 | Ga0496117_0001668 | Ga0496117_0001668_7886_8539 | 217 |
| 1006 | 3300048920 | Ga0496117_0004782 | Ga0496117_0004782_7642_8295 | 217 |
| 1007 | 3300048920 | Ga0496117_0045296 | Ga0496117_0045296_2286_2942 | 217 |
| 1008 | 3300048920 | Ga0496117_0074082 | Ga0496117_0074082_636_1295 | 217 |
| 1009 | 3300048920 | Ga0496117_0237964 | Ga0496117_0237964_250_909 | 217 |
| 1010 | 3300048921 | Ga0496118_0003719 | Ga0496118_0003719_5228_5881 | 217 |
| 1011 | 3300048921 | Ga0496118_0008066 | Ga0496118_0008066_8038_8691 | 217 |
| 1012 | 3300048921 | Ga0496118_0009825 | Ga0496118_0009825_3120_3773 | 217 |
| 1013 | 3300048921 | Ga0496118_0027153 | Ga0496118_0027153_1157_1816 | 217 |
| 1014 | 3300048921 | Ga0496118_0033803 | Ga0496118_0033803_3049_3708 | 217 |
| 1015 | 3300048921 | Ga0496118_0039900 | Ga0496118_0039900_2579_3235 | 217 |
| 1016 | 3300048922 | Ga0496119_0120489 | Ga0496119_0120489_777_1433 | 217 |
| 1017 | 3300048922 | Ga0496119_0279544 | Ga0496119_0279544_81_734 | 217 |
| 1018 | 3300048924 | Ga0496121_0005839 | Ga0496121_0005839_13318_13971 | 217 |
| 1019 | 3300048924 | Ga0496121_0015344 | Ga0496121_0015344_3565_4221 | 217 |
| 1020 | 3300048924 | Ga0496121_0033105 | Ga0496121_0033105_3020_3673 | 217 |
| 1021 | 3300048924 | Ga0496121_0110134 | Ga0496121_0110134_471_1124 | 217 |
| 1022 | 3300048924 | Ga0496121_0184620 | Ga0496121_0184620_447_1100 | 217 |
| 1023 | 3300048925 | Ga0496122_0024165 | Ga0496122_0024165_62_718 | 217 |
| 1024 | 3300048926 | Ga0496123_0011378 | Ga0496123_0011378_5892_6548 | 217 |
| 1025 | 3300048927 | Ga0496124_0045823 | Ga0496124_0045823_2726_3382 | 217 |
| 1026 | 3300048928 | Ga0496125_0042195 | Ga0496125_0042195_355_1011 | 217 |
| 1027 | 3300048929 | Ga0496126_0000031 | Ga0496126_0000031_72879_73532 | 217 |
| 1028 | 3300048929 | Ga0496126_0012131 | Ga0496126_0012131_5574_6227 | 217 |
| 1029 | 3300048929 | Ga0496126_0048120 | Ga0496126_0048120_871_1527 | 217 |
| 1030 | 3300048929 | Ga0496126_0292276 | Ga0496126_0292276_356_1012 | 217 |
| 1031 | 3300049460 | Ga0495682_0032432 | Ga0495682_0032432_776_1519 | 217 |
| 1032 | 3300049522 | Ga0501299_041191 | Ga0501299_041191_26_682 | 217 |
| 1033 | 3300049533 | Ga0501317_021833 | Ga0501317_021833_196_858 | 217 |
| 1034 | 3300049570 | Ga0501033_0006804 | Ga0501033_0006804_1788_2444 | 217 |
| 1035 | 3300049570 | Ga0501033_0395976 | Ga0501033_0395976_30_683 | 217 |
| 1036 | 3300049571 | Ga0501034_0170194 | Ga0501034_0170194_148_804 | 217 |
| 1037 | 3300049572 | Ga0501036_0051302 | Ga0501036_0051302_1390_2046 | 217 |
| 1038 | 3300049574 | Ga0501038_0386026 | Ga0501038_0386026_288_944 | 217 |
| 1039 | 3300049578 | Ga0501042_0012783 | Ga0501042_0012783_1969_2625 | 217 |
| 1040 | 3300049580 | Ga0501046_0039186 | Ga0501046_0039186_1947_2603 | 217 |
| 1041 | 3300049582 | Ga0501048_0003630 | Ga0501048_0003630_3345_4001 | 217 |
| 1042 | 3300049582 | Ga0501048_0230017 | Ga0501048_0230017_299_952 | 217 |
| 1043 | 3300049586 | Ga0501070_0033907 | Ga0501070_0033907_271_927 | 217 |
| 1044 | 3300049587 | Ga0501071_0001355 | Ga0501071_0001355_1074_1727 | 217 |
| 1045 | 3300049587 | Ga0501071_0111769 | Ga0501071_0111769_85_741 | 217 |
| 1046 | 3300049587 | Ga0501071_0320763 | Ga0501071_0320763_305_958 | 217 |
| 1047 | 3300049588 | Ga0501072_0053813 | Ga0501072_0053813_545_1201 | 217 |
| 1048 | 3300049588 | Ga0501072_0069380 | Ga0501072_0069380_1740_2393 | 217 |
| 1049 | 3300049588 | Ga0501072_0124394 | Ga0501072_0124394_41_694 | 217 |
| 1050 | 3300049588 | Ga0501072_0257211 | Ga0501072_0257211_634_1296 | 217 |
| 1051 | 3300049589 | Ga0501073_0127920 | Ga0501073_0127920_660_1313 | 217 |
| 1052 | 3300049590 | Ga0501074_0027381 | Ga0501074_0027381_1166_1822 | 217 |
| 1053 | 3300049591 | Ga0501075_0103882 | Ga0501075_0103882_559_1212 | 217 |
| 1054 | 3300049592 | Ga0501076_0009098 | Ga0501076_0009098_1717_2370 | 217 |
| 1055 | 3300049592 | Ga0501076_0356561 | Ga0501076_0356561_172_825 | 217 |
| 1056 | 3300049592 | Ga0501076_0604442 | Ga0501076_0604442_205_864 | 217 |
| 1057 | 3300049593 | Ga0501077_0084969 | Ga0501077_0084969_1091_1753 | 217 |
| 1058 | 3300049593 | Ga0501077_0145002 | Ga0501077_0145002_173_826 | 217 |
| 1059 | 3300049705 | Ga0501225_0032214 | Ga0501225_0032214_618_1274 | 217 |
| 1060 | 3300049741 | Ga0501079_0034275 | Ga0501079_0034275_3105_3758 | 217 |
| 1061 | 3300049741 | Ga0501079_0053070 | Ga0501079_0053070_1978_2631 | 217 |
| 1062 | 3300049741 | Ga0501079_0433297 | Ga0501079_0433297_240_959 | 217 |
| 1063 | 3300049742 | Ga0501080_0000704 | Ga0501080_0000704_24378_25031 | 217 |
| 1064 | 3300049742 | Ga0501080_0012384 | Ga0501080_0012384_3198_3854 | 217 |
| 1065 | 3300049743 | Ga0501081_0016262 | Ga0501081_0016262_2550_3203 | 217 |
| 1066 | 3300049743 | Ga0501081_0093469 | Ga0501081_0093469_886_1542 | 217 |
| 1067 | 3300049823 | Ga0501044_0059358 | Ga0501044_0059358_952_1608 | 217 |
| 1068 | 3300049824 | Ga0501045_0636889 | Ga0501045_0636889_115_768 | 217 |
| 1069 | 3300050491 | nmdc:mga00v17_10852_c1 | nmdc:mga00v17_10852_c1_741_1400 | 217 |
| 1070 | 3300050496 | nmdc:mga07m45_128547_c1 | nmdc:mga07m45_128547_c1_771_1430 | 217 |
| 1071 | 3300050507 | nmdc:mga05p37_15217_c1 | nmdc:mga05p37_15217_c1_5436_6098 | 217 |
| 1072 | 3300050507 | nmdc:mga05p37_21530_c1 | nmdc:mga05p37_21530_c1_1684_2343 | 217 |
| 1073 | 3300050507 | nmdc:mga05p37_281951_c1 | nmdc:mga05p37_281951_c1_1296_1952 | 217 |
| 1074 | 3300050507 | nmdc:mga05p37_315415_c1 | nmdc:mga05p37_315415_c1_571_1227 | 217 |
| 1075 | 3300050508 | nmdc:mga09592_246465_c1 | nmdc:mga09592_246465_c1_184_840 | 217 |
| 1076 | 3300050509 | nmdc:mga0qj67_267040_c1 | nmdc:mga0qj67_267040_c1_489_1145 | 217 |
| 1077 | 3300050509 | nmdc:mga0qj67_500632_c1 | nmdc:mga0qj67_500632_c1_245_901 | 217 |
| 1078 | 3300050510 | nmdc:mga06r32_476319_c1 | nmdc:mga06r32_476319_c1_330_986 | 217 |
| 1079 | 3300050511 | nmdc:mga08y16_410436_c1 | nmdc:mga08y16_410436_c1_344_1000 | 217 |
| 1080 | 3300050511 | nmdc:mga08y16_562513_c1 | nmdc:mga08y16_562513_c1_464_1141 | 217 |
| 1081 | 3300050511 | nmdc:mga08y16_70042_c1 | nmdc:mga08y16_70042_c1_2417_3073 | 217 |
| 1082 | 3300050511 | nmdc:mga08y16_99277_c1 | nmdc:mga08y16_99277_c1_2216_2872 | 217 |
| 1083 | 3300050512 | nmdc:mga0n895_1012_c1 | nmdc:mga0n895_1012_c1_14477_15133 | 217 |
| 1084 | 3300050512 | nmdc:mga0n895_196467_c1 | nmdc:mga0n895_196467_c1_995_1648 | 217 |
| 1085 | 3300050512 | nmdc:mga0n895_278479_c1 | nmdc:mga0n895_278479_c1_756_1412 | 217 |
| 1086 | 3300050512 | nmdc:mga0n895_648041_c1 | nmdc:mga0n895_648041_c1_235_1020 | 217 |
| 1087 | 3300050512 | nmdc:mga0n895_8049_c1 | nmdc:mga0n895_8049_c1_2098_2856 | 217 |
| 1088 | 3300050512 | nmdc:mga0n895_84240_c1 | nmdc:mga0n895_84240_c1_1756_2412 | 217 |
| 1089 | 3300050512 | nmdc:mga0n895_93158_c1 | nmdc:mga0n895_93158_c1_141_794 | 217 |
| 1090 | 3300050513 | nmdc:mga0rr50_13011_c1 | nmdc:mga0rr50_13011_c1_3788_4444 | 217 |
| 1091 | 3300050513 | nmdc:mga0rr50_746954_c1 | nmdc:mga0rr50_746954_c1_116_772 | 217 |
| 1092 | 3300050513 | nmdc:mga0rr50_86529_c1 | nmdc:mga0rr50_86529_c1_440_1093 | 217 |
| 1093 | 3300050513 | nmdc:mga0rr50_9949_c1 | nmdc:mga0rr50_9949_c1_4842_5600 | 217 |
| 1094 | 3300050514 | nmdc:mga08x19_133991_c1 | nmdc:mga08x19_133991_c1_671_1324 | 217 |
| 1095 | 3300050514 | nmdc:mga08x19_146100_c1 | nmdc:mga08x19_146100_c1_141_794 | 217 |
| 1096 | 3300050514 | nmdc:mga08x19_434563_c1 | nmdc:mga08x19_434563_c1_78_836 | 217 |
| 1097 | 3300050514 | nmdc:mga08x19_85798_c1 | nmdc:mga08x19_85798_c1_1351_2004 | 217 |
| 1098 | 3300050515 | nmdc:mga0a205_240792_c1 | nmdc:mga0a205_240792_c1_77_733 | 217 |
| 1099 | 3300050515 | nmdc:mga0a205_259789_c1 | nmdc:mga0a205_259789_c1_50_703 | 217 |
| 1100 | 3300050515 | nmdc:mga0a205_428606_c1 | nmdc:mga0a205_428606_c1_455_1108 | 217 |
| 1101 | 3300050515 | nmdc:mga0a205_482384_c1 | nmdc:mga0a205_482384_c1_235_891 | 217 |
| 1102 | 3300050515 | nmdc:mga0a205_542809_c1 | nmdc:mga0a205_542809_c1_175_831 | 217 |
| 1103 | 3300050515 | nmdc:mga0a205_5463_c1 | nmdc:mga0a205_5463_c1_7036_7692 | 217 |
| 1104 | 3300053077 | Ga0495601_0002609 | Ga0495601_0002609_1719_2372 | 217 |
| 1105 | 3300053078 | Ga0495612_0021748 | Ga0495612_0021748_216_911 | 217 |
| 1106 | 3300053083 | Ga0495655_0029270 | Ga0495655_0029270_561_1220 | 217 |
| 1107 | 3300053084 | Ga0495595_0005162 | Ga0495595_0005162_2381_3034 | 217 |
| 1108 | 3300053085 | Ga0495619_0018499 | Ga0495619_0018499_2814_3467 | 217 |
| 1109 | 3300053096 | Ga0500641_0004322 | Ga0500641_0004322_2990_3649 | 217 |
| 1110 | 3300053142 | Ga0500577_0000643 | Ga0500577_0000643_1988_2647 | 217 |
| 1111 | 3300054114 | Ga0501084_0199802 | Ga0501084_0199802_906_1565 | 217 |
| 1112 | 3300054114 | Ga0501084_0550663 | Ga0501084_0550663_306_959 | 217 |
| 1113 | 3300059506 | Ga0587085_015536 | Ga0587085_015536_202_861 | 217 |
| 1114 | 3300059639 | Ga0587062_030904 | Ga0587062_030904_77_730 | 217 |
| 1115 | 3300060353 | Ga0501082_0005433 | Ga0501082_0005433_6438_7094 | 217 |
| 1116 | 3300060353 | Ga0501082_0057150 | Ga0501082_0057150_822_1484 | 217 |
| 1117 | 3300060353 | Ga0501082_0302479 | Ga0501082_0302479_52_705 | 217 |
| 1118 | 3300061719 | Ga0466962_0001368 | Ga0466962_0001368_7131_7784 | 217 |
| 1119 | 3300061719 | Ga0466962_0016467 | Ga0466962_0016467_206_859 | 217 |
| 1120 | 3300061734 | Ga0530510_0000443 | Ga0530510_0000443_4891_5544 | 217 |
| 1121 | 3300061734 | Ga0530510_0184217 | Ga0530510_0184217_566_1228 | 217 |
| 1122 | 3300061734 | Ga0530510_0198607 | Ga0530510_0198607_282_935 | 217 |
| 1123 | 3300061734 | Ga0530510_0199114 | Ga0530510_0199114_810_1463 | 217 |
| 1124 | 3300061734 | Ga0530510_0213823 | Ga0530510_0213823_364_1083 | 217 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.967 | 3 | 217 |
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.9632 | 3 | 217 |
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.9623 | 3 | 217 |
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.9539 | 3 | 217 |
| 5ykj-assembly1.cif.gz_A | structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems | 0.9435 | 3 | 214 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P34227_199_260_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9796 | 153 | 214 | 3.30.1020.10 |
| af_A0A0R0K508_6_109_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9635 | 5 | 106 | 3.40.30.10 |
| af_Q54SE2_176_239_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9609 | 153 | 216 | 3.30.1020.10 |
| af_P34227_199_260_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9491 | 153 | 214 | 3.30.1020.10 |
| af_Q54SE2_176_239_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9467 | 153 | 216 | 3.30.1020.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2S068-F1-model_v4 | Peroxidase | 0.9937 | 1 | 106 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A659YRX5-F1-model_v4 | deleted | 0.9916 | 1 | 104 |
|
| AF-A0A3M6WLM4-F1-model_v4 | Thioredoxin domain-containing protein | 0.9867 | 1 | 111 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A2V5ZNJ6-F1-model_v4 | Peroxidase | 0.984 | 3 | 94 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A659YRX5-F1-model_v4 | deleted | 0.9822 | 1 | 104 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar