F490453

General Info

Members Datasets Scaffolds Average Seq Length
1124 509 1071 218

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_648041_c1|nmdc:mga0n895_648041_c1_235_1020
Length 261
Sequence MQDGDIIEAPQTLKQGAQLEIRDGRTSSACAGASGSIKSNGDTNMPVRIGDEAPDFTAETTEGQIRFHDWIGDKWAILFSHPKDFTPVCTTELGYMAKLKPEFDKRNTKIIGLSVDPVSDHKSWVKDIEETQGAKVNYPMIGDADLNVAKAYDMIHPNASGGKRTAVDNATVRSVFIIGPDKKVKAMLIYPMSAGRNFDEVLRLLDSLQLNAKHTVATPVNWKPGEDVIIPTSVSDEDAKKKYPQGYKTHKPYLRTVSQPK

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
3 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
4 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
5 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
6 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
7 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
8 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
9 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
10 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
11 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
12 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
13 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
14 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
15 2738541337 Pelomonas sp. BT06 Isolate Unclassified
16 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
17 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
18 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
19 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
20 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
21 2818991450 Burkholderia sp. 604 Isolate Unclassified
22 2818991452 Burkholderia cepacia 561 Isolate Unclassified
23 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
24 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
25 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
26 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
27 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
28 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
29 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
30 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
31 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
32 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
33 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
34 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
35 2928170801 Burkholderia sp. 572 Isolate Unclassified
36 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
37 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
38 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
39 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
40 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
41 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
42 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
43 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
44 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
45 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
46 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
47 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
48 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
49 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
50 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
51 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
52 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
53 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
54 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
55 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
56 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
57 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
58 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
59 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
60 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
65 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
67 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
68 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
69 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
70 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
71 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
72 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
73 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
74 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
75 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
76 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
77 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
78 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
79 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
80 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
81 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
82 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
83 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
84 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
85 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
86 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
87 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
88 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
89 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
90 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
91 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
92 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
93 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
94 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
95 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
96 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
97 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
98 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
99 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
100 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
101 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
102 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
103 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
104 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
105 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
106 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
107 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
108 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
109 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
110 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
111 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
112 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
113 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
114 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
115 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
116 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
117 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
118 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
119 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
120 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
121 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
122 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
123 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
124 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
125 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
126 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
127 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
128 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
129 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
130 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
131 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
132 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
133 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
134 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
135 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
136 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
137 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
138 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
139 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
140 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
141 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
142 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
143 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
144 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
145 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
146 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
147 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
148 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
149 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
150 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
151 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
152 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
153 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
154 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
155 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
156 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
157 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
158 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
159 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
160 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
161 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
162 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
163 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
164 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
165 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
166 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
167 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
168 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
169 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
170 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
171 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
172 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
173 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
174 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
175 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
176 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
177 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
178 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
179 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
180 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
181 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
182 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
183 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
184 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
185 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
186 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
187 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
188 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
189 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
190 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
191 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
192 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
193 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
194 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
195 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
196 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
197 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
203 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
207 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
208 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
210 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
211 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
212 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
280 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
281 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
284 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
285 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
286 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
287 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
288 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
289 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
290 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
291 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
292 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
293 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
294 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
295 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
296 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
297 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
298 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
299 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
300 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
301 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
302 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
303 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
304 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
305 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
306 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
307 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
308 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
309 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
310 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
311 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
312 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
313 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
314 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
315 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
316 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
317 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
318 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
319 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
320 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
321 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
322 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
323 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
324 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
325 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
326 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
327 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
328 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
329 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
330 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
331 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
332 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
333 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
334 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
335 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
336 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
337 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
338 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
339 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
340 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
341 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
342 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
343 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
344 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
345 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
346 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
347 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
348 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
349 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
350 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
351 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
352 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
353 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
354 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
355 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
356 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
357 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
358 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
359 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
360 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
361 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
362 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
363 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
364 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
365 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
366 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
367 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
368 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
369 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
370 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
371 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
372 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
373 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
374 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
375 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
376 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
377 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
378 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
379 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
380 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
381 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
382 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
383 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
384 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
385 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
386 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
387 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
388 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
389 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
390 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
391 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
392 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
393 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
394 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
395 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
396 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
397 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
398 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
399 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
400 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
401 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
402 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
403 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
404 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
405 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
406 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
407 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
408 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
409 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
410 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
411 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
412 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
413 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
414 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
415 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
416 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
417 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
418 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
419 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
420 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
421 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
422 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
423 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
424 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
425 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
426 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
427 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
428 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
429 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
430 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
431 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
432 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
433 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
434 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
435 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
436 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
437 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
438 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
439 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
440 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
441 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
442 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
443 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
444 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
445 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
446 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
447 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
448 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
449 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
450 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
452 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
454 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
456 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
459 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
460 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
461 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
462 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
463 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
464 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
465 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
466 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
467 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
468 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
469 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
470 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
471 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
473 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
474 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
475 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
476 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
477 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
478 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
479 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
480 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
481 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
482 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
483 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
484 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
485 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
486 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
487 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
488 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
489 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
490 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
491 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
492 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
493 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
494 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
495 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
496 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
497 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
500 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
501 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
502 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
503 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
504 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
505 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
506 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
507 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
508 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
509 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.97
Metatranscriptomes 2.31
Isolates 4.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.43
Nodule 1.42
Rhizoplane 4.63
Rhizosphere 83.01
Stem 0
Stem Tuber 0
Unclassified 5.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001218 3300001979 Bacteria 11643
2 JGI24740J21852_10069483 3300001979 Bacteria 947
3 JGI24739J22299_10007358 3300001989 Bacteria 4133
4 JGI24739J22299_10007911 3300001989 Bacteria 3978
5 JGI24739J22299_10010141 3300001989 Bacteria 3500
6 JGI24737J22298_10006425 3300001990 Bacteria 4015
7 JGI24737J22298_10017867 3300001990 Bacteria 2280
8 JGI24737J22298_10111933 3300001990 Bacteria 807
9 JGI24735J21928_10000112 3300002067 Bacteria 29556
10 JGI24735J21928_10003160 3300002067 Bacteria 5639
11 JGI24735J21928_10008835 3300002067 Bacteria 3250
12 JGI24735J21928_10016148 3300002067 Bacteria 2322
13 JGI24735J21928_10020077 3300002067 Bacteria 2049
14 JGI24735J21928_10041790 3300002067 Bacteria 1336
15 JGI24735J21928_10041859 3300002067 Bacteria 1334
16 JGI24738J21930_10001789 3300002075 Bacteria 5850
17 JGI24738J21930_10025831 3300002075 Bacteria 1206
18 JGI25156J39149_1000219 3300002705 Bacteria 39858
19 JGI25156J39149_1002857 3300002705 Bacteria 5925
20 JGI25164J39214_1008578 3300002772 Bacteria 1018
21 JGI25165J46597_1002266 3300003214 Bacteria 6625
22 Ga0006556J51387_1024206 3300003479 Bacteria 921
23 Ga0006554J51385_1019889 3300003567 Bacteria 1378
24 Ga0006562J51391_1046179 3300003578 Bacteria 883
25 Ga0055533_1000306 3300003756 Bacteria 24070
26 Ga0055533_1003661 3300003756 Bacteria 3021
27 Ga0055532_1000022 3300003758 Bacteria 248737
28 Ga0055532_1001602 3300003758 Bacteria 5983
29 Ga0055525_1002523 3300003759 Bacteria 1837
30 Ga0055527_1000016 3300003760 Bacteria 248736
31 Ga0055535_1000017 3300003761 Bacteria 248735
32 Ga0055542_1000030 3300003762 Bacteria 248717
33 Ga0055529_1000033 3300003763 Bacteria 248734
34 Ga0055531_10000317 3300003794 Bacteria 47389
35 Ga0058863_11823999 3300004799 Unclassified 748
36 Ga0058861_11807144 3300004800 Unclassified 780
37 Ga0058860_12166380 3300004801 Unclassified 814
38 Ga0058862_10139900 3300004803 Unclassified 804
39 Ga0058862_12455986 3300004803 Bacteria 1176
40 Ga0065165_1000489 3300005262 Bacteria 61162
41 Ga0065712_10001293 3300005290 Bacteria 7578
42 Ga0065712_10068048 3300005290 Bacteria 16088
43 Ga0065712_10078230 3300005290 Bacteria 3376
44 Ga0065715_10088924 3300005293 Bacteria 28459
45 Ga0065715_10211111 3300005293 Bacteria 1314
46 Ga0065715_10253367 3300005293 Unclassified 1149
47 Ga0065707_10088203 3300005295 Bacteria 4741
48 Ga0065707_10451990 3300005295 Bacteria 799
49 Ga0065707_10525249 3300005295 Bacteria 739
50 Ga0070658_10003087 3300005327 Bacteria 13742
51 Ga0070658_10004656 3300005327 Bacteria 11161
52 Ga0070658_10006183 3300005327 Bacteria 9707
53 Ga0070658_10013021 3300005327 Bacteria 6675
54 Ga0070658_10043430 3300005327 Bacteria 3631
55 Ga0070658_10110515 3300005327 Bacteria 2277
56 Ga0070658_10135860 3300005327 Bacteria 2052
57 Ga0070658_10160620 3300005327 Bacteria 1885
58 Ga0070658_10272347 3300005327 Bacteria 1440
59 Ga0070676_10054969 3300005328 Bacteria 2348
60 Ga0070683_100018296 3300005329 Bacteria 6203
61 Ga0070683_100047351 3300005329 Bacteria 3972
62 Ga0070683_100756869 3300005329 Bacteria 931
63 Ga0070670_100001241 3300005331 Bacteria 20292
64 Ga0070670_100008380 3300005331 Bacteria 8811
65 Ga0070677_10024857 3300005333 Bacteria 2231
66 Ga0070677_10043998 3300005333 Bacteria 1775
67 Ga0070666_10017611 3300005335 Bacteria 4583
68 Ga0070666_10038616 3300005335 Bacteria 3178
69 Ga0070666_10116260 3300005335 Unclassified 1852
70 Ga0070680_100008371 3300005336 Bacteria 7920
71 Ga0068868_100014826 3300005338 Bacteria 5753
72 Ga0068868_100063143 3300005338 Bacteria 2938
73 Ga0068868_100163794 3300005338 Bacteria 1838
74 Ga0070660_100002014 3300005339 Bacteria 14009
75 Ga0070660_100003253 3300005339 Bacteria 11151
76 Ga0070660_100078332 3300005339 Bacteria 2592
77 Ga0070660_100085875 3300005339 Bacteria 2475
78 Ga0070689_100124485 3300005340 Bacteria 2062
79 Ga0070691_10023615 3300005341 Bacteria 2856
80 Ga0070687_100052376 3300005343 Bacteria 2118
81 Ga0070661_100001747 3300005344 Bacteria 15072
82 Ga0070661_100018903 3300005344 Bacteria 4907
83 Ga0070661_100028212 3300005344 Unclassified 4047
84 Ga0070661_100032230 3300005344 Bacteria 3793
85 Ga0070692_10193033 3300005345 Bacteria 1188
86 Ga0070668_100064795 3300005347 Bacteria 2833
87 Ga0070669_100003151 3300005353 Bacteria 11858
88 Ga0070675_100011196 3300005354 Bacteria 7018
89 Ga0070675_100047571 3300005354 Bacteria 3514
90 Ga0070671_100009662 3300005355 Bacteria 7749
91 Ga0070671_100121588 3300005355 Bacteria 2197
92 Ga0070671_100167476 3300005355 Bacteria 1858
93 Ga0070674_100005072 3300005356 Bacteria 7569
94 Ga0070674_100063552 3300005356 Bacteria 2584
95 Ga0070673_100007590 3300005364 Bacteria 7173
96 Ga0070673_100015973 3300005364 Bacteria 5291
97 Ga0070673_100146559 3300005364 Bacteria 1996
98 Ga0070659_100009464 3300005366 Bacteria 7159
99 Ga0070659_100387901 3300005366 Unclassified 1177
100 Ga0070667_100018740 3300005367 Bacteria 5741
101 Ga0070667_100059040 3300005367 Bacteria 3244
102 Ga0070667_100100440 3300005367 Bacteria 2499
103 Ga0070714_100079538 3300005435 Bacteria 2851
104 Ga0070710_10039981 3300005437 Bacteria 2583
105 Ga0070711_100040343 3300005439 Bacteria 3148
106 Ga0070711_100536687 3300005439 Bacteria 969
107 Ga0070705_100052916 3300005440 Bacteria 2374
108 Ga0070700_100039036 3300005441 Bacteria 2897
109 Ga0070694_100027560 3300005444 Unclassified 3690
110 Ga0070694_100176327 3300005444 Bacteria 1578
111 Ga0070694_100498588 3300005444 Bacteria 969
112 Ga0070708_100043219 3300005445 Bacteria 3959
113 Ga0070708_100163120 3300005445 Bacteria 2077
114 Ga0070708_100432244 3300005445 Bacteria 1242
115 Ga0070663_100012253 3300005455 Bacteria 5415
116 Ga0070663_100189702 3300005455 Bacteria 1599
117 Ga0070663_100319187 3300005455 Bacteria 1249
118 Ga0070663_100539348 3300005455 Bacteria 974
119 Ga0070678_100004858 3300005456 Bacteria 7677
120 Ga0070678_100162194 3300005456 Bacteria 1812
121 Ga0070662_100021633 3300005457 Bacteria 4394
122 Ga0070681_10004285 3300005458 Bacteria 13543
123 Ga0070681_10007917 3300005458 Bacteria 10399
124 Ga0070681_10022516 3300005458 Bacteria 6327
125 Ga0070681_10028372 3300005458 Bacteria 5626
126 Ga0068867_100000031 3300005459 Bacteria 85969
127 Ga0068867_100021037 3300005459 Bacteria 4653
128 Ga0068867_100067543 3300005459 Bacteria 2666
129 Ga0070706_100006506 3300005467 Bacteria 11029
130 Ga0070706_100303251 3300005467 Bacteria 1490
131 Ga0070707_100420942 3300005468 Bacteria 1296
132 Ga0070698_100000360 3300005471 Bacteria 47129
133 Ga0070698_100101436 3300005471 Bacteria 2849
134 Ga0070698_100478909 3300005471 Bacteria 1181
135 Ga0070698_100491490 3300005471 Bacteria 1165
136 Ga0070699_100008542 3300005518 Bacteria 8875
137 Ga0070699_100009432 3300005518 Bacteria 8456
138 Ga0070699_100024044 3300005518 Bacteria 5250
139 Ga0070699_100037577 3300005518 Bacteria 4192
140 Ga0070679_100015194 3300005530 Bacteria 7397
141 Ga0070679_100105860 3300005530 Bacteria 2799
142 Ga0070679_100106501 3300005530 Bacteria 2789
143 Ga0070684_100336698 3300005535 Unclassified 1387
144 Ga0070684_100590117 3300005535 Bacteria 1033
145 Ga0070697_100009047 3300005536 Bacteria 7782
146 Ga0070697_100057612 3300005536 Bacteria 3161
147 Ga0070697_100090194 3300005536 Bacteria 2533
148 Ga0070697_100096908 3300005536 Bacteria 2447
149 Ga0070697_100729774 3300005536 Bacteria 875
150 Ga0068853_100011721 3300005539 Bacteria 7124
151 Ga0068853_100759059 3300005539 Bacteria 927
152 Ga0070672_100154414 3300005543 Bacteria 1901
153 Ga0070672_100162864 3300005543 Bacteria 1852
154 Ga0070686_100010413 3300005544 Bacteria 5241
155 Ga0070695_100009516 3300005545 Bacteria 5789
156 Ga0070695_100010479 3300005545 Bacteria 5534
157 Ga0070695_100011818 3300005545 Bacteria 5224
158 Ga0070695_100417562 3300005545 Bacteria 1021
159 Ga0070696_100005007 3300005546 Bacteria 8854
160 Ga0070696_100011139 3300005546 Bacteria 6017
161 Ga0070693_100012746 3300005547 Bacteria 4263
162 Ga0070693_100271851 3300005547 Bacteria 1131
163 Ga0070693_100341616 3300005547 Bacteria 1022
164 Ga0070665_100371413 3300005548 Bacteria 1437
165 Ga0070665_100378371 3300005548 Unclassified 1423
166 Ga0070704_100003123 3300005549 Bacteria 9449
167 Ga0070704_100115276 3300005549 Bacteria 2053
168 Ga0070704_100214352 3300005549 Bacteria 1562
169 Ga0070704_100766744 3300005549 Bacteria 860
170 Ga0068855_100010091 3300005563 Bacteria 11383
171 Ga0068855_100026348 3300005563 Bacteria 6954
172 Ga0068855_100065945 3300005563 Bacteria 4221
173 Ga0068855_100884376 3300005563 Bacteria 945
174 Ga0070664_100001859 3300005564 Bacteria 16917
175 Ga0070664_100005743 3300005564 Bacteria 10004
176 Ga0068857_100028110 3300005577 Bacteria 4961
177 Ga0068857_100339349 3300005577 Bacteria 1390
178 Ga0068854_100036899 3300005578 Bacteria 3428
179 Ga0068854_100070369 3300005578 Bacteria 2557
180 Ga0068854_100162708 3300005578 Bacteria 1730
181 Ga0068854_100477050 3300005578 Bacteria 1047
182 Ga0068856_100006744 3300005614 Bacteria 11246
183 Ga0068856_100009816 3300005614 Bacteria 9298
184 Ga0068856_100084585 3300005614 Bacteria 3151
185 Ga0068856_100408432 3300005614 Bacteria 1378
186 Ga0068852_100005526 3300005616 Bacteria 9060
187 Ga0068852_100011776 3300005616 Bacteria 6604
188 Ga0068852_100012112 3300005616 Bacteria 6531
189 Ga0068852_100012336 3300005616 Bacteria 6482
190 Ga0068852_100096782 3300005616 Bacteria 2654
191 Ga0068852_100435871 3300005616 Bacteria 1295
192 Ga0068859_100231085 3300005617 Bacteria 1938
193 Ga0068864_100199184 3300005618 Bacteria 1839
194 Ga0068851_10000435 3300005834 Bacteria 18666
195 Ga0068851_10011188 3300005834 Bacteria 4203
196 Ga0068851_10068528 3300005834 Bacteria 1831
197 Ga0068870_10267937 3300005840 Bacteria 1066
198 Ga0068863_100706750 3300005841 Bacteria 1002
199 Ga0068860_100543685 3300005843 Bacteria 1163
200 Ga0081455_10280774 3300005937 Bacteria 1203
201 Ga0081538_10118502 3300005981 Bacteria 1279
202 Ga0075365_10018211 3300006038 Bacteria 4314
203 Ga0075365_10021202 3300006038 Bacteria 4048
204 Ga0075368_10020446 3300006042 Bacteria 2508
205 Ga0075363_100043761 3300006048 Bacteria 2369
206 Ga0075363_100152419 3300006048 Bacteria 1305
207 Ga0075364_10008898 3300006051 Bacteria 6014
208 Ga0070716_100019172 3300006173 Bacteria 3573
209 Ga0070716_100072625 3300006173 Bacteria 2026
210 Ga0070712_100150211 3300006175 Bacteria 1788
211 Ga0075362_10085592 3300006177 Bacteria 1457
212 Ga0075367_10068082 3300006178 Bacteria 2135
213 Ga0075369_10123157 3300006186 Bacteria 1175
214 Ga0075366_10193631 3300006195 Bacteria 1236
215 Ga0075366_10270604 3300006195 Bacteria 1037
216 Ga0097621_100014106 3300006237 Bacteria 5973
217 Ga0097621_100030594 3300006237 Bacteria 4263
218 Ga0075370_10003614 3300006353 Bacteria 7398
219 Ga0068871_100031263 3300006358 Bacteria 4197
220 Ga0068871_100567747 3300006358 Bacteria 1029
221 Ga0075428_100107410 3300006844 Bacteria 3042
222 Ga0075428_100720102 3300006844 Bacteria 1063
223 Ga0075430_100106627 3300006846 Bacteria 2337
224 Ga0075430_100278682 3300006846 Bacteria 1383
225 Ga0075431_100124180 3300006847 Bacteria 2663
226 Ga0075431_100647245 3300006847 Bacteria 1038
227 Ga0075433_10141249 3300006852 Bacteria 2140
228 Ga0075433_10221195 3300006852 Bacteria 1682
229 Ga0075433_10392391 3300006852 Bacteria 1225
230 Ga0075433_10448182 3300006852 Bacteria 1138
231 Ga0075434_100006779 3300006871 Bacteria 10528
232 Ga0075434_100031307 3300006871 Bacteria 5244
233 Ga0075434_100051193 3300006871 Bacteria 4103
234 Ga0075434_100084202 3300006871 Bacteria 3178
235 Ga0075434_100171505 3300006871 Bacteria 2190
236 Ga0075434_100624016 3300006871 Bacteria 1097
237 Ga0075429_100546923 3300006880 Bacteria 1015
238 Ga0068865_100069440 3300006881 Bacteria 2493
239 Ga0068865_100137545 3300006881 Bacteria 1838
240 Ga0068865_100380522 3300006881 Bacteria 1151
241 Ga0075436_100003079 3300006914 Bacteria 11423
242 Ga0075436_100013082 3300006914 Bacteria 5688
243 Ga0075436_100099874 3300006914 Bacteria 2021
244 Ga0075436_100102379 3300006914 Bacteria 1995
245 Ga0075436_100103059 3300006914 Bacteria 1988
246 Ga0075436_100146654 3300006914 Bacteria 1660
247 Ga0075436_100336596 3300006914 Bacteria 1086
248 Ga0075436_100691779 3300006914 Bacteria 755
249 Ga0097620_100231069 3300006931 Bacteria 1938
250 Ga0075435_100037443 3300007076 Bacteria 3863
251 Ga0075435_100079990 3300007076 Bacteria 2683
252 Ga0075435_100110225 3300007076 Bacteria 2289
253 Ga0075435_100186734 3300007076 Bacteria 1753
254 Ga0075435_100360710 3300007076 Bacteria 1246
255 Ga0075435_100551896 3300007076 Unclassified 998
256 Ga0099794_10389510 3300007265 Bacteria 727
257 Ga0099795_10038086 3300007788 Bacteria 1696
258 Ga0099795_10177452 3300007788 Bacteria 888
259 Ga0105251_10000157 3300009011 Bacteria 69461
260 Ga0105251_10089188 3300009011 Bacteria 1418
261 Ga0105244_10138845 3300009036 Bacteria 1170
262 Ga0105240_10007978 3300009093 Bacteria 15267
263 Ga0105240_10050343 3300009093 Bacteria 5253
264 Ga0105240_10624706 3300009093 Bacteria 1183
265 Ga0111539_10029117 3300009094 Bacteria 6733
266 Ga0111539_10132057 3300009094 Bacteria 2924
267 Ga0111539_10551206 3300009094 Bacteria 1343
268 Ga0105245_10435126 3300009098 Bacteria 1317
269 Ga0105247_10077517 3300009101 Bacteria 2089
270 Ga0105247_10476721 3300009101 Bacteria 905
271 Ga0114129_10008335 3300009147 Bacteria 14783
272 Ga0114129_10184466 3300009147 Bacteria 2837
273 Ga0114129_10335763 3300009147 Bacteria 2006
274 Ga0114129_10412616 3300009147 Bacteria 1778
275 Ga0114129_11492760 3300009147 Bacteria 831
276 Ga0114129_11757201 3300009147 Bacteria 755
277 Ga0105243_10063465 3300009148 Bacteria 2960
278 Ga0105241_10031258 3300009174 Bacteria 3986
279 Ga0105241_10440032 3300009174 Bacteria 1151
280 Ga0105241_10932765 3300009174 Bacteria 808
281 Ga0105242_10014349 3300009176 Bacteria 6137
282 Ga0105242_10106966 3300009176 Unclassified 2378
283 Ga0105248_10108510 3300009177 Bacteria 3130
284 Ga0105248_10246908 3300009177 Bacteria 2009
285 Ga0105237_10003909 3300009545 Bacteria 17462
286 Ga0105237_10091255 3300009545 Bacteria 3036
287 Ga0105237_10179507 3300009545 Bacteria 2117
288 Ga0105238_10013643 3300009551 Bacteria 8205
289 Ga0105238_10020173 3300009551 Bacteria 6784
290 Ga0105238_10504880 3300009551 Bacteria 1210
291 Ga0105239_10005610 3300010375 Bacteria 14674
292 Ga0105239_10336620 3300010375 Bacteria 1703
293 Ga0105246_10026306 3300011119 Unclassified 3799
294 Ga0157373_10047080 3300013100 Bacteria 3077
295 Ga0157373_10099058 3300013100 Bacteria 2051
296 Ga0157371_10000739 3300013102 Bacteria 38165
297 Ga0157371_10029805 3300013102 Bacteria 3942
298 Ga0157371_10127553 3300013102 Bacteria 1809
299 Ga0157370_10000965 3300013104 Bacteria 36401
300 Ga0157370_10004637 3300013104 Bacteria 15715
301 Ga0157370_10007365 3300013104 Bacteria 11998
302 Ga0157370_10011838 3300013104 Bacteria 9100
303 Ga0157370_10159855 3300013104 Bacteria 2096
304 Ga0157369_10001012 3300013105 Bacteria 35358
305 Ga0157369_10005380 3300013105 Bacteria 14908
306 Ga0157369_10010373 3300013105 Bacteria 10620
307 Ga0157369_10252308 3300013105 Bacteria 1841
308 Ga0157369_10473548 3300013105 Bacteria 1296
309 Ga0157369_10809158 3300013105 Bacteria 963
310 Ga0157374_10003804 3300013296 Bacteria 12691
311 Ga0157374_10011164 3300013296 Bacteria 7765
312 Ga0157374_10016646 3300013296 Bacteria 6466
313 Ga0157378_10012733 3300013297 Bacteria 7361
314 Ga0157378_10025323 3300013297 Bacteria 5225
315 Ga0157378_10111384 3300013297 Bacteria 2510
316 Ga0157378_10196650 3300013297 Bacteria 1905
317 Ga0163162_10028105 3300013306 Bacteria 5563
318 Ga0163162_10132062 3300013306 Bacteria 2606
319 Ga0163162_10413361 3300013306 Bacteria 1481
320 Ga0157372_10011957 3300013307 Bacteria 9248
321 Ga0157372_10091848 3300013307 Bacteria 3452
322 Ga0157372_10128868 3300013307 Bacteria 2910
323 Ga0157375_10049473 3300013308 Bacteria 4119
324 Ga0163163_10028824 3300014325 Bacteria 5335
325 Ga0182008_10123010 3300014497 Bacteria 1290
326 Ga0157377_10000235 3300014745 Bacteria 28671
327 Ga0157376_10081213 3300014969 Unclassified 2783
328 Ga0182006_1028847 3300015261 Bacteria 2253
329 Ga0182007_10001687 3300015262 Bacteria 11693
330 Ga0182007_10006143 3300015262 Bacteria 5187
331 Ga0182007_10073794 3300015262 Bacteria 1118
332 Ga0206356_10151721 3300020070 Unclassified 792
333 Ga0206356_10563753 3300020070 Bacteria 1095
334 Ga0206356_11575614 3300020070 Bacteria 724
335 Ga0206349_1007483 3300020075 Bacteria 688
336 Ga0206355_1615061 3300020076 Bacteria 2238
337 Ga0206351_10719405 3300020077 Bacteria 893
338 Ga0206352_10228866 3300020078 Unclassified 677
339 Ga0206352_11331274 3300020078 Bacteria 1305
340 Ga0206350_10756569 3300020080 Bacteria 2495
341 Ga0206350_11076876 3300020080 Bacteria 798
342 Ga0206353_10002810 3300020082 Bacteria 821
343 Ga0206353_11275437 3300020082 Unclassified 759
344 Ga0224712_10032476 3300022467 Bacteria 1903
345 Ga0224712_10135079 3300022467 Bacteria 1080
346 Ga0209435_102216 3300025206 Bacteria 2308
347 Ga0209566_100472 3300025225 Bacteria 28862
348 Ga0209674_100017 3300025226 Bacteria 689087
349 Ga0209674_100211 3300025226 Bacteria 58106
350 Ga0209674_102160 3300025226 Bacteria 4422
351 Ga0209672_100001 3300025228 Bacteria 2828210
352 Ga0209672_100271 3300025228 Bacteria 38041
353 Ga0209672_103474 3300025228 Bacteria 3242
354 Ga0209147_100022 3300025229 Bacteria 443906
355 Ga0209147_100121 3300025229 Bacteria 139167
356 Ga0209563_101145 3300025230 Bacteria 7447
357 Ga0207427_101579 3300025231 Bacteria 7853
358 Ga0209258_100033 3300025242 Bacteria 443845
359 Ga0209677_111067 3300025253 Bacteria 1441
360 Ga0209148_1000046 3300025254 Bacteria 443881
361 Ga0209759_1000331 3300025256 Bacteria 62167
362 Ga0209759_1000366 3300025256 Bacteria 56702
363 Ga0209759_1010528 3300025256 Bacteria 2705
364 Ga0209759_1016444 3300025256 Bacteria 1869
365 Ga0209233_1000050 3300025261 Bacteria 450736
366 Ga0209455_1000038 3300025272 Bacteria 443899
367 Ga0209130_1005176 3300025284 Bacteria 4621
368 Ga0209564_1007781 3300025295 Bacteria 5441
369 Ga0207426_1000004 3300025302 Bacteria 1047900
370 Ga0207426_1004157 3300025302 Bacteria 7237
371 Ga0207697_10003982 3300025315 Bacteria 7167
372 Ga0207656_10007085 3300025321 Bacteria 4072
373 Ga0207656_10013184 3300025321 Bacteria 3154
374 Ga0207656_10067097 3300025321 Bacteria 1587
375 Ga0207696_1064564 3300025711 Bacteria 1025
376 Ga0207655_1120899 3300025728 Bacteria 868
377 Ga0207713_1000336 3300025735 Bacteria 52391
378 Ga0207713_1012631 3300025735 Bacteria 4499
379 Ga0207682_10017545 3300025893 Bacteria 2796
380 Ga0207688_10015407 3300025901 Bacteria 4146
381 Ga0207680_10014305 3300025903 Bacteria 4101
382 Ga0207680_10038507 3300025903 Bacteria 2767
383 Ga0207680_10078446 3300025903 Bacteria 2068
384 Ga0207647_10000396 3300025904 Bacteria 35814
385 Ga0207647_10003690 3300025904 Bacteria 11445
386 Ga0207647_10026012 3300025904 Bacteria 3834
387 Ga0207647_10028846 3300025904 Bacteria 3599
388 Ga0207647_10030002 3300025904 Bacteria 3513
389 Ga0207647_10040542 3300025904 Bacteria 2932
390 Ga0207699_10027168 3300025906 Bacteria 3165
391 Ga0207645_10066014 3300025907 Bacteria 2313
392 Ga0207705_10012575 3300025909 Bacteria 6109
393 Ga0207705_10024026 3300025909 Bacteria 4349
394 Ga0207705_10175222 3300025909 Bacteria 1616
395 Ga0207705_10348320 3300025909 Bacteria 1141
396 Ga0207684_10010463 3300025910 Bacteria 8166
397 Ga0207684_10029127 3300025910 Bacteria 4704
398 Ga0207684_10214320 3300025910 Bacteria 1661
399 Ga0207684_10639638 3300025910 Bacteria 907
400 Ga0207654_10063090 3300025911 Bacteria 2173
401 Ga0207654_10092655 3300025911 Bacteria 1845
402 Ga0207654_10364327 3300025911 Unclassified 998
403 Ga0207707_10013398 3300025912 Bacteria 7149
404 Ga0207707_10041491 3300025912 Bacteria 4018
405 Ga0207707_10089484 3300025912 Bacteria 2690
406 Ga0207707_10438474 3300025912 Bacteria 1118
407 Ga0207695_10004994 3300025913 Bacteria 17834
408 Ga0207695_10007589 3300025913 Bacteria 13751
409 Ga0207695_10133103 3300025913 Bacteria 2442
410 Ga0207695_10229180 3300025913 Bacteria 1763
411 Ga0207671_10012713 3300025914 Bacteria 6752
412 Ga0207671_10218474 3300025914 Bacteria 1493
413 Ga0207693_10584217 3300025915 Bacteria 870
414 Ga0207660_10354491 3300025917 Bacteria 1176
415 Ga0207662_10234999 3300025918 Bacteria 1198
416 Ga0207657_10006089 3300025919 Bacteria 12550
417 Ga0207657_10007609 3300025919 Bacteria 11089
418 Ga0207657_10024918 3300025919 Bacteria 5528
419 Ga0207649_10001822 3300025920 Bacteria 12167
420 Ga0207649_10095757 3300025920 Bacteria 1954
421 Ga0207649_10098907 3300025920 Bacteria 1926
422 Ga0207649_10253253 3300025920 Bacteria 1269
423 Ga0207652_10075966 3300025921 Bacteria 2928
424 Ga0207652_10151951 3300025921 Bacteria 2073
425 Ga0207646_10024812 3300025922 Bacteria 5488
426 Ga0207646_10032895 3300025922 Bacteria 4690
427 Ga0207646_10108850 3300025922 Bacteria 2486
428 Ga0207681_10368747 3300025923 Unclassified 1153
429 Ga0207694_10002912 3300025924 Bacteria 13776
430 Ga0207694_10109155 3300025924 Bacteria 2199
431 Ga0207650_10001712 3300025925 Bacteria 15568
432 Ga0207650_10001913 3300025925 Bacteria 14662
433 Ga0207650_10627557 3300025925 Bacteria 905
434 Ga0207659_10055875 3300025926 Bacteria 2825
435 Ga0207659_10108350 3300025926 Bacteria 2107
436 Ga0207687_10184630 3300025927 Bacteria 1618
437 Ga0207664_10155657 3300025929 Bacteria 1945
438 Ga0207664_10944061 3300025929 Bacteria 774
439 Ga0207644_10003354 3300025931 Bacteria 10333
440 Ga0207644_10176030 3300025931 Bacteria 1674
441 Ga0207644_10639097 3300025931 Bacteria 885
442 Ga0207690_10005945 3300025932 Bacteria 7226
443 Ga0207690_10260098 3300025932 Bacteria 1344
444 Ga0207690_10321293 3300025932 Bacteria 1217
445 Ga0207706_10000853 3300025933 Bacteria 31374
446 Ga0207706_10162609 3300025933 Bacteria 1962
447 Ga0207686_10193587 3300025934 Bacteria 1451
448 Ga0207709_10009168 3300025935 Bacteria 5451
449 Ga0207670_10279091 3300025936 Bacteria 1301
450 Ga0207669_10058531 3300025937 Bacteria 2351
451 Ga0207704_10086042 3300025938 Bacteria 2049
452 Ga0207665_10032835 3300025939 Bacteria 3437
453 Ga0207665_10054478 3300025939 Bacteria 2697
454 Ga0207665_10252384 3300025939 Bacteria 1304
455 Ga0207691_10009758 3300025940 Bacteria 9215
456 Ga0207691_10012098 3300025940 Bacteria 8273
457 Ga0207711_10410838 3300025941 Unclassified 1258
458 Ga0207689_10179150 3300025942 Bacteria 1748
459 Ga0207689_10410111 3300025942 Bacteria 1130
460 Ga0207679_10018716 3300025945 Bacteria 4645
461 Ga0207679_10030199 3300025945 Bacteria 3782
462 Ga0207667_10008902 3300025949 Bacteria 11878
463 Ga0207667_10031926 3300025949 Bacteria 5680
464 Ga0207667_10035988 3300025949 Bacteria 5309
465 Ga0207667_10212428 3300025949 Unclassified 1983
466 Ga0207651_10869089 3300025960 Bacteria 802
467 Ga0207668_10087586 3300025972 Bacteria 2278
468 Ga0207640_10014227 3300025981 Bacteria 4575
469 Ga0207640_10124240 3300025981 Bacteria 1855
470 Ga0207640_10326330 3300025981 Bacteria 1224
471 Ga0207640_10861805 3300025981 Bacteria 789
472 Ga0207658_10091679 3300025986 Bacteria 2358
473 Ga0207658_10190715 3300025986 Bacteria 1703
474 Ga0207658_10216383 3300025986 Bacteria 1609
475 Ga0207677_10001053 3300026023 Bacteria 15130
476 Ga0207677_10128648 3300026023 Bacteria 1918
477 Ga0207677_10175298 3300026023 Bacteria 1681
478 Ga0207639_10000520 3300026041 Bacteria 26585
479 Ga0207639_10067478 3300026041 Bacteria 2783
480 Ga0207678_10046935 3300026067 Bacteria 3735
481 Ga0207678_10075196 3300026067 Bacteria 2893
482 Ga0207678_10100602 3300026067 Bacteria 2469
483 Ga0207678_10226518 3300026067 Bacteria 1600
484 Ga0207708_10063567 3300026075 Bacteria 2820
485 Ga0207702_10060129 3300026078 Bacteria 3238
486 Ga0207702_10095787 3300026078 Bacteria 2609
487 Ga0207702_10811355 3300026078 Unclassified 925
488 Ga0207641_10943025 3300026088 Bacteria 858
489 Ga0207648_10001189 3300026089 Bacteria 29139
490 Ga0207648_10030812 3300026089 Bacteria 4747
491 Ga0207676_10033488 3300026095 Bacteria 3882
492 Ga0207674_10038495 3300026116 Bacteria 4961
493 Ga0207674_10300735 3300026116 Bacteria 1553
494 Ga0207683_10000838 3300026121 Bacteria 28142
495 Ga0207683_10002698 3300026121 Bacteria 15506
496 Ga0207698_10000603 3300026142 Bacteria 21081
497 Ga0207698_10001098 3300026142 Bacteria 15752
498 Ga0207698_10005537 3300026142 Bacteria 7816
499 Ga0207698_10010801 3300026142 Bacteria 5890
500 Ga0207698_10022534 3300026142 Bacteria 4380
501 Ga0207698_10398314 3300026142 Bacteria 1315
502 Ga0209371_1011284 3300027312 Bacteria 2665
503 Ga0209984_1003102 3300027424 Bacteria 1885
504 Ga0209968_1011434 3300027526 Bacteria 1376
505 Ga0209970_1036755 3300027614 Bacteria 863
506 Ga0210002_1006145 3300027617 Bacteria 1807
507 Ga0210002_1011843 3300027617 Bacteria 1350
508 Ga0209983_1015181 3300027665 Bacteria 1588
509 Ga0209983_1017103 3300027665 Bacteria 1499
510 Ga0209983_1032469 3300027665 Bacteria 1116
511 Ga0209588_1021994 3300027671 Bacteria 2006
512 Ga0209971_1001003 3300027682 Bacteria 7238
513 Ga0209971_1034787 3300027682 Bacteria 1211
514 Ga0209813_10042171 3300027866 Bacteria 1394
515 Ga0209974_10002915 3300027876 Bacteria 6207
516 Ga0209974_10006328 3300027876 Bacteria 4137
517 Ga0209974_10043685 3300027876 Bacteria 1494
518 Ga0268265_10464038 3300028380 Bacteria 1186
519 Ga0268264_10497053 3300028381 Bacteria 1189
520 Ga0268264_10793808 3300028381 Bacteria 945
521 Ga0307515_10000219 3300028794 Bacteria 141532
522 Ga0265338_10000159 3300028800 Bacteria 123495
523 Ga0265338_10193381 3300028800 Bacteria 1540
524 Ga0268256_1009781 3300030500 Bacteria 3148
525 Ga0265332_10162881 3300031238 Bacteria 931
526 Ga0265340_10142989 3300031247 Bacteria 1094
527 Ga0265339_10002778 3300031249 Bacteria 12449
528 Ga0307408_100003309 3300031548 Bacteria 11082
529 Ga0307408_100027057 3300031548 Bacteria 3949
530 Ga0307408_100372028 3300031548 Bacteria 1219
531 Ga0307405_10018263 3300031731 Bacteria 3866
532 Ga0307413_10188889 3300031824 Bacteria 1477
533 Ga0307410_10155070 3300031852 Bacteria 1709
534 Ga0307410_10296962 3300031852 Bacteria 1273
535 Ga0307406_10518856 3300031901 Bacteria 969
536 Ga0307407_10019840 3300031903 Bacteria 3431
537 Ga0307407_10324002 3300031903 Bacteria 1082
538 Ga0307412_10000011 3300031911 Bacteria 405842
539 Ga0307412_10214523 3300031911 Bacteria 1471
540 Ga0307409_100056694 3300031995 Bacteria 3031
541 Ga0307409_100152197 3300031995 Bacteria 2010
542 Ga0307409_100163271 3300031995 Bacteria 1951
543 Ga0307409_100321625 3300031995 Bacteria 1448
544 Ga0307416_100028718 3300032002 Bacteria 4142
545 Ga0307416_100594523 3300032002 Bacteria 1185
546 Ga0307416_100936678 3300032002 Bacteria 968
547 Ga0307414_10007355 3300032004 Bacteria 6188
548 Ga0307411_10033971 3300032005 Bacteria 3169
549 Ga0307411_10382465 3300032005 Bacteria 1158
550 Ga0307415_100095676 3300032126 Bacteria 2163
551 Ga0307415_100834957 3300032126 Bacteria 844
552 Ga0373929_0027199 3300035085 Bacteria 1200
553 Ga0373934_0003851 3300035086 Bacteria 5519
554 Ga0373923_0182594 3300035111 Bacteria 964
555 Ga0373936_0016441 3300035113 Bacteria 2846
556 Ga0373939_0107208 3300035114 Bacteria 968
557 Ga0373945_0018911 3300035116 Bacteria 2348
558 Ga0373953_0007056 3300035117 Bacteria 3740
559 Ga0373956_0058093 3300035119 Bacteria 1748
560 Ga0373957_0001050 3300035120 Bacteria 7296
561 Ga0373955_0026251 3300035172 Bacteria 2998
562 Ga0373955_0030261 3300035172 Bacteria 2824
563 Ga0373924_0001454 3300035410 Bacteria 7699
564 Ga0373924_0007996 3300035410 Bacteria 3828
565 Ga0373935_0082656 3300035692 Bacteria 2089
566 Ga0373935_0126432 3300035692 Bacteria 1713
567 Ga0373927_0009366 3300035695 Bacteria 6569
568 Ga0373927_0032345 3300035695 Bacteria 3407
569 Ga0373927_0135661 3300035695 Bacteria 1608
570 Ga0373927_0321067 3300035695 Bacteria 1020
571 Ga0373933_0025633 3300035724 Bacteria 3382
572 Ga0373933_0045247 3300035724 Bacteria 2609
573 Ga0373947_0077381 3300035725 Bacteria 2052
574 Ga0373937_0051508 3300036401 Bacteria 3773
575 Ga0373937_0367808 3300036401 Bacteria 1363
576 Ga0373925_0032407 3300037068 Bacteria 3846
577 Ga0373925_0130053 3300037068 Bacteria 1962
578 Ga0395899_0017035 3300037312 Bacteria 5536
579 Ga0395899_0063257 3300037312 Bacteria 2722
580 Ga0395899_0081333 3300037312 Bacteria 2357
581 Ga0395900_0033748 3300037418 Bacteria 5266
582 Ga0395900_0149631 3300037418 Bacteria 2385
583 Ga0395900_0215718 3300037418 Bacteria 1936
584 Ga0395900_0244747 3300037418 Bacteria 1797
585 Ga0395900_0277990 3300037418 Bacteria 1667
586 Ga0395900_0742441 3300037418 Bacteria 912
587 Ga0395900_0865776 3300037418 Bacteria 828
588 Ga0395898_0023476 3300037466 Bacteria 6231
589 Ga0395898_0026748 3300037466 Bacteria 5798
590 Ga0395898_0053375 3300037466 Bacteria 3948
591 Ga0395898_0169894 3300037466 Bacteria 2084
592 Ga0395898_0241852 3300037466 Bacteria 1721
593 Ga0395905_0015881 3300037471 Bacteria 7152
594 Ga0395905_0041189 3300037471 Bacteria 4334
595 Ga0395905_0091083 3300037471 Bacteria 2859
596 Ga0436364_1101072 3300037853 Bacteria 919
597 Ga0395901_0127955 3300038443 Bacteria 2669
598 Ga0395901_0217475 3300038443 Bacteria 1998
599 Ga0395901_0389746 3300038443 Bacteria 1432
600 Ga0395901_0456251 3300038443 Bacteria 1306
601 Ga0242420_057203 3300038996 Bacteria 772
602 Ga0436360_0981097 3300039438 Bacteria 1574
603 Ga0436361_0875914 3300039447 Bacteria 1339
604 Ga0439438_012311 3300041405 Bacteria 2625
605 Ga0439447_005564 3300041407 Bacteria 4172
606 Ga0439466_0002347 3300041411 Bacteria 7425
607 Ga0439466_0015237 3300041411 Bacteria 2793
608 Ga0439448_0000736 3300042005 Bacteria 7912
609 Ga0439452_000093 3300042010 Bacteria 77343
610 Ga0439452_044192 3300042010 Bacteria 1040
611 Ga0450907_018903 3300042146 Bacteria 1154
612 Ga0451577_0074147 3300042876 Bacteria 3036
613 Ga0451577_0442727 3300042876 Bacteria 1180
614 Ga0466969_0002723 3300044656 Bacteria 9449
615 Ga0466969_0005664 3300044656 Bacteria 6643
616 Ga0466969_0042769 3300044656 Bacteria 2259
617 Ga0466980_0132384 3300044668 Bacteria 1679
618 Ga0453683_0007776 3300044673 Bacteria 7249
619 Ga0466965_0001313 3300044683 Bacteria 9932
620 Ga0466966_0000039 3300044684 Bacteria 97202
621 Ga0466966_0008831 3300044684 Bacteria 6673
622 Ga0466966_0014455 3300044684 Bacteria 5225
623 Ga0466966_0037177 3300044684 Bacteria 3141
624 Ga0466966_0048767 3300044684 Bacteria 2697
625 Ga0466966_0209892 3300044684 Bacteria 1177
626 Ga0466961_0000207 3300044693 Bacteria 39646
627 Ga0466961_0001899 3300044693 Bacteria 13012
628 Ga0466961_0004748 3300044693 Bacteria 8552
629 Ga0466961_0054617 3300044693 Bacteria 2547
630 Ga0466963_0016298 3300044694 Bacteria 4620
631 Ga0466963_0031487 3300044694 Bacteria 3429
632 Ga0466963_0193713 3300044694 Bacteria 1420
633 Ga0453684_0135504 3300044712 Unclassified 2949
634 Ga0466971_0003647 3300044719 Bacteria 6583
635 Ga0466971_0012794 3300044719 Bacteria 3678
636 Ga0466971_0045577 3300044719 Bacteria 1969
637 Ga0466968_0298587 3300044735 Bacteria 774
638 Ga0466970_0002943 3300044765 Bacteria 8253
639 Ga0466970_0021183 3300044765 Bacteria 3385
640 Ga0466970_0042389 3300044765 Bacteria 2420
641 Ga0466970_0050792 3300044765 Bacteria 2212
642 Ga0466957_0000515 3300044842 Bacteria 19383
643 Ga0466957_0002486 3300044842 Bacteria 9906
644 Ga0466957_0299366 3300044842 Bacteria 1080
645 Ga0466959_0004552 3300045049 Bacteria 9302
646 Ga0466959_0009026 3300045049 Bacteria 7072
647 Ga0466959_0009377 3300045049 Bacteria 6958
648 Ga0466959_0014770 3300045049 Bacteria 5684
649 Ga0466959_0100740 3300045049 Bacteria 2067
650 Ga0466959_0203789 3300045049 Bacteria 1376
651 Ga0451576_0073438 3300045051 Bacteria 3559
652 Ga0451576_0075928 3300045051 Bacteria 3497
653 Ga0451576_0206316 3300045051 Bacteria 2052
654 Ga0466958_0003175 3300045836 Bacteria 8467
655 Ga0466958_0021682 3300045836 Bacteria 3756
656 Ga0466958_0195931 3300045836 Bacteria 1285
657 Ga0466967_0661511 3300045976 Bacteria 1033
658 Ga0466967_0711420 3300045976 Bacteria 995
659 Ga0495627_004833 3300046453 Bacteria 5549
660 Ga0495592_0001021 3300046454 Bacteria 19420
661 Ga0495592_0058142 3300046454 Bacteria 2852
662 Ga0495592_0153597 3300046454 Bacteria 1590
663 Ga0495592_0258830 3300046454 Bacteria 1147
664 Ga0495603_0000430 3300046455 Bacteria 23265
665 Ga0495590_0007055 3300046457 Bacteria 4352
666 Ga0495590_0019696 3300046457 Bacteria 2401
667 Ga0495590_0065133 3300046457 Bacteria 1275
668 Ga0495629_0000184 3300046459 Bacteria 56265
669 Ga0495629_0002988 3300046459 Bacteria 12856
670 Ga0495629_0043550 3300046459 Bacteria 3151
671 Ga0495629_0144566 3300046459 Bacteria 1654
672 Ga0495629_0158760 3300046459 Bacteria 1571
673 Ga0495651_0003256 3300046462 Bacteria 12459
674 Ga0495651_0005334 3300046462 Bacteria 9807
675 Ga0495651_0363732 3300046462 Bacteria 953
676 Ga0495653_0000458 3300046463 Bacteria 31816
677 Ga0495653_0028921 3300046463 Bacteria 4430
678 Ga0495653_0037707 3300046463 Bacteria 3795
679 Ga0495653_0145713 3300046463 Bacteria 1660
680 Ga0495653_0325178 3300046463 Bacteria 995
681 Ga0495650_0000155 3300046471 Bacteria 155947
682 Ga0495650_0008029 3300046471 Bacteria 6233
683 Ga0495580_0003676 3300046472 Bacteria 13009
684 Ga0495580_0007003 3300046472 Bacteria 9090
685 Ga0495580_0019201 3300046472 Bacteria 5080
686 Ga0495580_0045774 3300046472 Bacteria 3107
687 Ga0495580_0051269 3300046472 Bacteria 2917
688 Ga0495580_0131594 3300046472 Bacteria 1735
689 Ga0495582_0100335 3300046473 Bacteria 1620
690 Ga0495605_0003642 3300046474 Bacteria 9144
691 Ga0495605_0007723 3300046474 Bacteria 6096
692 Ga0495639_0002731 3300046475 Bacteria 7674
693 Ga0495639_0004581 3300046475 Bacteria 5929
694 Ga0495662_0003851 3300046476 Bacteria 7566
695 Ga0495662_0033063 3300046476 Bacteria 2499
696 Ga0495662_0121389 3300046476 Bacteria 1283
697 Ga0495664_0009344 3300046477 Bacteria 5484
698 Ga0495584_0093221 3300046491 Bacteria 1520
699 Ga0495585_0000756 3300046492 Bacteria 28639
700 Ga0495594_0030730 3300046499 Bacteria 2909
701 Ga0495594_0132249 3300046499 Bacteria 1413
702 Ga0495596_0013516 3300046500 Bacteria 3460
703 Ga0495596_0078620 3300046500 Bacteria 1281
704 Ga0495583_0002052 3300046506 Bacteria 18249
705 Ga0495583_0023731 3300046506 Bacteria 3096
706 Ga0495606_0003521 3300046507 Bacteria 16538
707 Ga0495606_0010907 3300046507 Bacteria 7481
708 Ga0495606_0036960 3300046507 Bacteria 3320
709 Ga0495608_0019092 3300046511 Bacteria 4725
710 Ga0495608_0084089 3300046511 Bacteria 2065
711 Ga0495608_0112547 3300046511 Bacteria 1749
712 Ga0495608_0214575 3300046511 Bacteria 1209
713 Ga0495610_0013957 3300046512 Bacteria 4746
714 Ga0495610_0027577 3300046512 Bacteria 3016
715 Ga0495616_0045437 3300046513 Bacteria 2223
716 Ga0495618_0005497 3300046514 Bacteria 7715
717 Ga0495618_0051561 3300046514 Bacteria 2599
718 Ga0495628_0000612 3300046516 Bacteria 32753
719 Ga0495628_0001377 3300046516 Bacteria 22309
720 Ga0495628_0002577 3300046516 Bacteria 16323
721 Ga0495628_0008978 3300046516 Bacteria 8550
722 Ga0495628_0047491 3300046516 Bacteria 3406
723 Ga0495628_0050024 3300046516 Bacteria 3307
724 Ga0495628_0058645 3300046516 Bacteria 3023
725 Ga0495628_0096860 3300046516 Bacteria 2279
726 Ga0495628_0152777 3300046516 Bacteria 1757
727 Ga0495628_0173739 3300046516 Bacteria 1633
728 Ga0495630_0000001 3300046517 Bacteria 1687293
729 Ga0495630_0006146 3300046517 Bacteria 8516
730 Ga0495630_0021822 3300046517 Bacteria 4727
731 Ga0495630_0042233 3300046517 Bacteria 3405
732 Ga0495630_0056979 3300046517 Bacteria 2928
733 Ga0495630_0175263 3300046517 Bacteria 1634
734 Ga0495637_0006474 3300046520 Bacteria 5875
735 Ga0495648_0002413 3300046524 Bacteria 17327
736 Ga0495666_0011194 3300046526 Bacteria 4476
737 Ga0495666_0023256 3300046526 Bacteria 3064
738 Ga0495666_0101340 3300046526 Bacteria 1356
739 Ga0495666_0214938 3300046526 Bacteria 881
740 Ga0495642_0042416 3300046528 Bacteria 1853
741 Ga0495652_0001770 3300046529 Bacteria 23136
742 Ga0495652_0002873 3300046529 Bacteria 17371
743 Ga0495652_0019423 3300046529 Bacteria 6053
744 Ga0495652_0029318 3300046529 Bacteria 4835
745 Ga0495652_0030200 3300046529 Bacteria 4755
746 Ga0495652_0237329 3300046529 Bacteria 1359
747 Ga0495652_0547782 3300046529 Bacteria 796
748 Ga0495654_0062788 3300046530 Bacteria 1780
749 Ga0495665_0000741 3300046531 Bacteria 16897
750 Ga0495665_0012406 3300046531 Bacteria 4610
751 Ga0495665_0034988 3300046531 Bacteria 2685
752 Ga0495640_0012828 3300046533 Bacteria 6393
753 Ga0495640_0036400 3300046533 Bacteria 3477
754 Ga0495586_0003135 3300046535 Bacteria 8895
755 Ga0495586_0016699 3300046535 Bacteria 3904
756 Ga0495586_0025541 3300046535 Bacteria 3161
757 Ga0495586_0034512 3300046535 Bacteria 2717
758 Ga0495587_0001813 3300046536 Bacteria 14251
759 Ga0495587_0010252 3300046536 Bacteria 5973
760 Ga0495587_0088935 3300046536 Bacteria 1785
761 Ga0495597_0001849 3300046542 Bacteria 14481
762 Ga0495597_0007892 3300046542 Bacteria 5366
763 Ga0495645_0000102 3300046543 Bacteria 59126
764 Ga0495645_0000216 3300046543 Bacteria 41409
765 Ga0495645_0178563 3300046543 Bacteria 1456
766 Ga0495645_0192110 3300046543 Bacteria 1390
767 Ga0495645_0212969 3300046543 Bacteria 1304
768 Ga0495622_0011928 3300046557 Bacteria 4020
769 Ga0495622_0025958 3300046557 Bacteria 2738
770 Ga0495622_0088620 3300046557 Bacteria 1422
771 Ga0495667_0029368 3300046559 Bacteria 3701
772 Ga0495667_0121786 3300046559 Bacteria 1684
773 Ga0495668_0209375 3300046616 Bacteria 1068
774 Ga0495634_0000154 3300046642 Bacteria 61397
775 Ga0495634_0015021 3300046642 Bacteria 5567
776 Ga0495634_0027544 3300046642 Bacteria 3953
777 Ga0495634_0513238 3300046642 Bacteria 702
778 Ga0495635_0000051 3300046663 Bacteria 74756
779 Ga0495635_0006318 3300046663 Bacteria 8257
780 Ga0495635_0007827 3300046663 Bacteria 7461
781 Ga0495635_0045492 3300046663 Bacteria 3029
782 Ga0495635_0126150 3300046663 Bacteria 1745
783 Ga0495588_0133585 3300046674 Bacteria 1309
784 Ga0495657_0026574 3300046675 Bacteria 4098
785 Ga0495657_0081045 3300046675 Bacteria 2099
786 Ga0495657_0291557 3300046675 Bacteria 974
787 Ga0495599_0000176 3300046678 Bacteria 42077
788 Ga0495599_0068119 3300046678 Bacteria 2222
789 Ga0495599_0077061 3300046678 Bacteria 2082
790 Ga0495599_0291554 3300046678 Bacteria 986
791 Ga0495623_0001241 3300046679 Bacteria 17322
792 Ga0495623_0001591 3300046679 Bacteria 15289
793 Ga0495623_0138585 3300046679 Bacteria 1449
794 Ga0495646_0001764 3300046680 Bacteria 12994
795 Ga0495646_0003339 3300046680 Bacteria 9979
796 Ga0495646_0014182 3300046680 Bacteria 5066
797 Ga0495646_0020151 3300046680 Bacteria 4216
798 Ga0495646_0101339 3300046680 Bacteria 1650
799 Ga0495647_0008851 3300046681 Bacteria 3391
800 Ga0495658_0023929 3300046683 Bacteria 3247
801 Ga0495613_0010481 3300046689 Bacteria 6881
802 Ga0495613_0092657 3300046689 Bacteria 2187
803 Ga0495613_0260163 3300046689 Bacteria 1209
804 Ga0495624_0001086 3300046690 Bacteria 21490
805 Ga0495624_0034561 3300046690 Bacteria 3269
806 Ga0495671_0180625 3300046692 Bacteria 1025
807 Ga0495649_0003924 3300046694 Bacteria 9836
808 Ga0495649_0015531 3300046694 Bacteria 4332
809 Ga0495649_0026116 3300046694 Bacteria 3251
810 Ga0495649_0058880 3300046694 Bacteria 2069
811 Ga0495589_0004136 3300046794 Bacteria 7763
812 Ga0495589_0010883 3300046794 Bacteria 4726
813 Ga0495589_0104796 3300046794 Bacteria 1367
814 Ga0495589_0283342 3300046794 Bacteria 770
815 Ga0495600_0007472 3300046809 Bacteria 6689
816 Ga0495600_0011407 3300046809 Bacteria 5535
817 Ga0495600_0014208 3300046809 Bacteria 5016
818 Ga0495660_0012233 3300046810 Bacteria 4980
819 Ga0495581_0004254 3300047315 Bacteria 8253
820 Ga0495581_0013486 3300047315 Bacteria 4740
821 Ga0495581_0020822 3300047315 Bacteria 3805
822 Ga0495604_0003840 3300047317 Bacteria 11968
823 Ga0495604_0004609 3300047317 Bacteria 10920
824 Ga0495604_0037997 3300047317 Bacteria 3788
825 Ga0495604_0067069 3300047317 Bacteria 2727
826 Ga0495604_0078914 3300047317 Bacteria 2469
827 Ga0495674_0003055 3300047319 Bacteria 16277
828 Ga0495674_0003130 3300047319 Bacteria 16071
829 Ga0495674_0030343 3300047319 Bacteria 4917
830 Ga0495672_0005687 3300047320 Bacteria 9824
831 Ga0495672_0013269 3300047320 Bacteria 5691
832 Ga0495672_0199507 3300047320 Bacteria 1001
833 Ga0495676_0011001 3300047321 Bacteria 8182
834 Ga0495680_0001302 3300047322 Bacteria 27175
835 Ga0495680_0003003 3300047322 Bacteria 16822
836 Ga0495680_0021279 3300047322 Bacteria 5431
837 Ga0495680_0021591 3300047322 Bacteria 5387
838 Ga0495680_0045279 3300047322 Bacteria 3474
839 Ga0495680_0049107 3300047322 Bacteria 3308
840 Ga0495680_0125477 3300047322 Bacteria 1891
841 Ga0495683_0002414 3300047323 Bacteria 11305
842 Ga0495683_0012338 3300047323 Bacteria 4489
843 Ga0495683_0017289 3300047323 Bacteria 3740
844 Ga0495687_000029 3300047443 Bacteria 293244
845 Ga0495687_005545 3300047443 Bacteria 8004
846 Ga0495687_012506 3300047443 Bacteria 4481
847 Ga0495687_015266 3300047443 Bacteria 3914
848 Ga0495675_0014968 3300047444 Bacteria 4904
849 Ga0495675_0021231 3300047444 Bacteria 4134
850 Ga0495675_0080414 3300047444 Bacteria 2053
851 Ga0495675_0239590 3300047444 Bacteria 1092
852 Ga0495673_0000426 3300047469 Bacteria 47785
853 Ga0495673_0012569 3300047469 Bacteria 4481
854 Ga0495673_0034361 3300047469 Bacteria 2344
855 Ga0495681_0004331 3300047470 Bacteria 9713
856 Ga0495686_0001282 3300047472 Bacteria 28414
857 Ga0495686_0013767 3300047472 Bacteria 5603
858 Ga0495593_0002283 3300047673 Bacteria 11491
859 Ga0495593_0003295 3300047673 Bacteria 9674
860 Ga0495593_0008272 3300047673 Bacteria 6054
861 Ga0495593_0020592 3300047673 Bacteria 3693
862 Ga0495602_0000575 3300048088 Bacteria 34209
863 Ga0495602_0026341 3300048088 Bacteria 5608
864 Ga0495602_0101434 3300048088 Bacteria 2361
865 Ga0495602_0150249 3300048088 Bacteria 1832
866 Ga0495614_0009952 3300048089 Bacteria 4197
867 Ga0495614_0032145 3300048089 Bacteria 2259
868 Ga0495614_0133392 3300048089 Bacteria 1100
869 Ga0495626_0090571 3300048091 Bacteria 1345
870 Ga0496100_0002447 3300048903 Bacteria 9421
871 Ga0496100_0003542 3300048903 Bacteria 8152
872 Ga0496100_0015183 3300048903 Bacteria 4493
873 Ga0496100_0053719 3300048903 Bacteria 2625
874 Ga0496100_0115862 3300048903 Bacteria 1869
875 Ga0496100_0207897 3300048903 Bacteria 1430
876 Ga0496101_0003024 3300048904 Bacteria 10368
877 Ga0496101_0007849 3300048904 Bacteria 6942
878 Ga0496101_0008207 3300048904 Bacteria 6818
879 Ga0496101_0028733 3300048904 Bacteria 3885
880 Ga0496101_0631377 3300048904 Bacteria 846
881 Ga0496102_0000311 3300048905 Bacteria 61342
882 Ga0496102_0000743 3300048905 Bacteria 31908
883 Ga0496102_0031281 3300048905 Bacteria 4773
884 Ga0496102_0032709 3300048905 Bacteria 4673
885 Ga0496103_0000272 3300048906 Bacteria 49098
886 Ga0496103_0002440 3300048906 Bacteria 11693
887 Ga0496103_0151899 3300048906 Bacteria 1483
888 Ga0496104_0010707 3300048907 Bacteria 8200
889 Ga0496104_0045833 3300048907 Bacteria 4114
890 Ga0496104_0048629 3300048907 Bacteria 3998
891 Ga0496104_0604642 3300048907 Unclassified 1007
892 Ga0496104_0633370 3300048907 Bacteria 979
893 Ga0496105_0061430 3300048908 Bacteria 3100
894 Ga0496105_0182429 3300048908 Bacteria 1718
895 Ga0496106_0000003 3300048909 Bacteria 305293
896 Ga0496106_0061592 3300048909 Bacteria 2847
897 Ga0496106_0675141 3300048909 Bacteria 824
898 Ga0496107_0022179 3300048910 Bacteria 4486
899 Ga0496107_0110846 3300048910 Bacteria 2017
900 Ga0496108_0081594 3300048911 Bacteria 2741
901 Ga0496109_0007189 3300048912 Bacteria 9409
902 Ga0496109_0025770 3300048912 Bacteria 5241
903 Ga0496109_0234039 3300048912 Bacteria 1729
904 Ga0496109_0800399 3300048912 Bacteria 881
905 Ga0496110_0006170 3300048913 Bacteria 9456
906 Ga0496110_0070686 3300048913 Bacteria 3093
907 Ga0496111_0001680 3300048914 Bacteria 12890
908 Ga0496112_0003079 3300048915 Bacteria 13660
909 Ga0496112_0013812 3300048915 Bacteria 7470
910 Ga0496112_0014139 3300048915 Bacteria 7393
911 Ga0496112_0259728 3300048915 Bacteria 1686
912 Ga0496114_0031593 3300048917 Bacteria 4356
913 Ga0496114_0181049 3300048917 Bacteria 1841
914 Ga0496114_0284879 3300048917 Bacteria 1457
915 Ga0496114_0656298 3300048917 Bacteria 922
916 Ga0496115_0077818 3300048918 Bacteria 2698
917 Ga0496115_0164989 3300048918 Bacteria 1832
918 Ga0496115_0356092 3300048918 Bacteria 1193
919 Ga0496115_0611880 3300048918 Bacteria 865
920 Ga0496116_0042732 3300048919 Bacteria 3095
921 Ga0496116_0061076 3300048919 Bacteria 2441
922 Ga0496116_0114975 3300048919 Bacteria 1571
923 Ga0496116_0132466 3300048919 Bacteria 1418
924 Ga0496117_0001294 3300048920 Bacteria 36834
925 Ga0496117_0001668 3300048920 Bacteria 31030
926 Ga0496117_0004782 3300048920 Bacteria 14680
927 Ga0496117_0045296 3300048920 Bacteria 3179
928 Ga0496117_0074082 3300048920 Bacteria 2268
929 Ga0496117_0237964 3300048920 Bacteria 1001
930 Ga0496118_0003719 3300048921 Bacteria 18884
931 Ga0496118_0008066 3300048921 Bacteria 10983
932 Ga0496118_0009825 3300048921 Bacteria 9578
933 Ga0496118_0027153 3300048921 Bacteria 4852
934 Ga0496118_0033803 3300048921 Bacteria 4186
935 Ga0496118_0039900 3300048921 Bacteria 3740
936 Ga0496119_0120489 3300048922 Bacteria 1443
937 Ga0496119_0279544 3300048922 Bacteria 830
938 Ga0496121_0005839 3300048924 Bacteria 15603
939 Ga0496121_0015344 3300048924 Bacteria 8036
940 Ga0496121_0033105 3300048924 Bacteria 4684
941 Ga0496121_0110134 3300048924 Bacteria 2102
942 Ga0496121_0184620 3300048924 Bacteria 1501
943 Ga0496122_0024165 3300048925 Bacteria 5325
944 Ga0496123_0011378 3300048926 Bacteria 7719
945 Ga0496124_0045823 3300048927 Bacteria 3748
946 Ga0496125_0042195 3300048928 Bacteria 3889
947 Ga0496126_0000031 3300048929 Bacteria 373371
948 Ga0496126_0012131 3300048929 Bacteria 8846
949 Ga0496126_0048120 3300048929 Bacteria 3900
950 Ga0496126_0292276 3300048929 Bacteria 1347
951 Ga0495682_0032432 3300049460 Bacteria 1929
952 Ga0501299_041191 3300049522 Bacteria 927
953 Ga0501317_021833 3300049533 Bacteria 873
954 Ga0501033_0006804 3300049570 Bacteria 8928
955 Ga0501033_0395976 3300049570 Bacteria 964
956 Ga0501034_0170194 3300049571 Bacteria 2146
957 Ga0501036_0051302 3300049572 Bacteria 3492
958 Ga0501038_0386026 3300049574 Bacteria 1085
959 Ga0501042_0012783 3300049578 Bacteria 5697
960 Ga0501046_0039186 3300049580 Bacteria 3796
961 Ga0501048_0003630 3300049582 Bacteria 11750
962 Ga0501048_0230017 3300049582 Bacteria 1316
963 Ga0501069_0231730 3300049585 Bacteria 1075
964 Ga0501070_0033907 3300049586 Bacteria 4271
965 Ga0501071_0001355 3300049587 Bacteria 14019
966 Ga0501071_0111769 3300049587 Bacteria 2019
967 Ga0501071_0320763 3300049587 Bacteria 1177
968 Ga0501072_0053813 3300049588 Bacteria 3170
969 Ga0501072_0069380 3300049588 Bacteria 2783
970 Ga0501072_0124394 3300049588 Bacteria 2055
971 Ga0501072_0257211 3300049588 Bacteria 1390
972 Ga0501073_0127920 3300049589 Bacteria 1761
973 Ga0501074_0027381 3300049590 Bacteria 4133
974 Ga0501075_0103882 3300049591 Bacteria 2159
975 Ga0501076_0009098 3300049592 Bacteria 7312
976 Ga0501076_0356561 3300049592 Bacteria 1201
977 Ga0501076_0604442 3300049592 Bacteria 905
978 Ga0501077_0084969 3300049593 Bacteria 2006
979 Ga0501077_0145002 3300049593 Bacteria 1506
980 Ga0501225_0032214 3300049705 Bacteria 1442
981 Ga0501079_0034275 3300049741 Bacteria 3906
982 Ga0501079_0053070 3300049741 Bacteria 3128
983 Ga0501079_0433297 3300049741 Bacteria 1032
984 Ga0501080_0000704 3300049742 Bacteria 26907
985 Ga0501080_0012384 3300049742 Bacteria 7818
986 Ga0501081_0016262 3300049743 Bacteria 4917
987 Ga0501081_0093469 3300049743 Bacteria 2117
988 Ga0501044_0059358 3300049823 Bacteria 3919
989 Ga0501045_0636889 3300049824 Bacteria 788
990 nmdc:mga03683_52961_c1 3300050489 Bacteria 1697
991 nmdc:mga03n38_20976_c1 3300050490 Bacteria 2622
992 nmdc:mga00v17_10852_c1 3300050491 Bacteria 4992
993 nmdc:mga00v17_39184_c1 3300050491 Bacteria 2837
994 nmdc:mga00v17_6976_c1 3300050491 Bacteria 6011
995 nmdc:mga0yw44_120728_c1 3300050492 Bacteria 1688
996 nmdc:mga0yw44_26301_c1 3300050492 Bacteria 3322
997 nmdc:mga0yw44_66150_c1 3300050492 Bacteria 2230
998 nmdc:mga06z11_78924_c1 3300050494 Bacteria 1761
999 nmdc:mga04h51_20413_c1 3300050495 Bacteria 1978
1000 nmdc:mga07m45_128547_c1 3300050496 Bacteria 1466
1001 nmdc:mga07m45_173152_c1 3300050496 Bacteria 1255
1002 nmdc:mga07m45_17777_c1 3300050496 Bacteria 3826
1003 nmdc:mga05p37_132370_c1 3300050507 Bacteria 3060
1004 nmdc:mga05p37_15217_c1 3300050507 Bacteria 9239
1005 nmdc:mga05p37_21530_c1 3300050507 Bacteria 7810
1006 nmdc:mga05p37_281951_c1 3300050507 Bacteria 1981
1007 nmdc:mga05p37_315415_c1 3300050507 Bacteria 1852
1008 nmdc:mga09592_246465_c1 3300050508 Bacteria 1548
1009 nmdc:mga0qj67_19781_c1 3300050509 Bacteria 5148
1010 nmdc:mga0qj67_267040_c1 3300050509 Bacteria 1388
1011 nmdc:mga0qj67_500632_c1 3300050509 Bacteria 977
1012 nmdc:mga06r32_476319_c1 3300050510 Bacteria 1227
1013 nmdc:mga08y16_410436_c1 3300050511 Bacteria 1385
1014 nmdc:mga08y16_562513_c1 3300050511 Bacteria 1153
1015 nmdc:mga08y16_70042_c1 3300050511 Bacteria 3656
1016 nmdc:mga08y16_99277_c1 3300050511 Unclassified 3031
1017 nmdc:mga0n895_1012_c1 3300050512 Bacteria 20423
1018 nmdc:mga0n895_134873_c1 3300050512 Bacteria 2495
1019 nmdc:mga0n895_18197_c1 3300050512 Bacteria 6495
1020 nmdc:mga0n895_196467_c1 3300050512 Bacteria 2048
1021 nmdc:mga0n895_278479_c1 3300050512 Bacteria 1696
1022 nmdc:mga0n895_648041_c1 3300050512 Bacteria 1055
1023 nmdc:mga0n895_8049_c1 3300050512 Bacteria 9096
1024 nmdc:mga0n895_84240_c1 3300050512 Bacteria 3172
1025 nmdc:mga0n895_93158_c1 3300050512 Bacteria 3016
1026 nmdc:mga0rr50_103076_c1 3300050513 Bacteria 2245
1027 nmdc:mga0rr50_13011_c1 3300050513 Bacteria 5400
1028 nmdc:mga0rr50_325429_c1 3300050513 Bacteria 1289
1029 nmdc:mga0rr50_746954_c1 3300050513 Unclassified 835
1030 nmdc:mga0rr50_86529_c1 3300050513 Bacteria 2431
1031 nmdc:mga0rr50_9949_c1 3300050513 Bacteria 6012
1032 nmdc:mga08x19_106964_c1 3300050514 Bacteria 1861
1033 nmdc:mga08x19_133991_c1 3300050514 Bacteria 1669
1034 nmdc:mga08x19_146100_c1 3300050514 Bacteria 1599
1035 nmdc:mga08x19_2190_c1 3300050514 Bacteria 11947
1036 nmdc:mga08x19_287611_c1 3300050514 Bacteria 1140
1037 nmdc:mga08x19_29593_c1 3300050514 Bacteria 3436
1038 nmdc:mga08x19_30851_c1 3300050514 Bacteria 3369
1039 nmdc:mga08x19_317459_c1 3300050514 Bacteria 1084
1040 nmdc:mga08x19_434563_c1 3300050514 Bacteria 923
1041 nmdc:mga08x19_85798_c1 3300050514 Bacteria 2072
1042 nmdc:mga0a205_240792_c1 3300050515 Bacteria 1690
1043 nmdc:mga0a205_259789_c1 3300050515 Bacteria 1614
1044 nmdc:mga0a205_410607_c1 3300050515 Bacteria 1217
1045 nmdc:mga0a205_428606_c1 3300050515 Bacteria 1184
1046 nmdc:mga0a205_482384_c1 3300050515 Bacteria 1098
1047 nmdc:mga0a205_542809_c1 3300050515 Bacteria 1018
1048 nmdc:mga0a205_5463_c1 3300050515 Bacteria 11449
1049 Ga0495601_0002609 3300053077 Bacteria 10219
1050 Ga0495612_0021748 3300053078 Bacteria 2573
1051 Ga0495655_0029270 3300053083 Bacteria 1323
1052 Ga0495595_0005162 3300053084 Bacteria 5275
1053 Ga0495619_0018499 3300053085 Bacteria 4419
1054 Ga0500641_0004322 3300053096 Bacteria 5013
1055 Ga0500577_0000643 3300053142 Bacteria 8969
1056 Ga0501084_0199802 3300054114 Bacteria 1687
1057 Ga0501084_0550663 3300054114 Bacteria 975
1058 Ga0587085_003335 3300059506 Bacteria 1736
1059 Ga0587085_015536 3300059506 Bacteria 1090
1060 Ga0587062_030904 3300059639 Bacteria 820
1061 Ga0501082_0005433 3300060353 Bacteria 11059
1062 Ga0501082_0057150 3300060353 Bacteria 3362
1063 Ga0501082_0302479 3300060353 Bacteria 1393
1064 Ga0466962_0001368 3300061719 Bacteria 11287
1065 Ga0466962_0016467 3300061719 Bacteria 3566
1066 Ga0466962_0018570 3300061719 Bacteria 3344
1067 Ga0530510_0000443 3300061734 Bacteria 26727
1068 Ga0530510_0184217 3300061734 Bacteria 1549
1069 Ga0530510_0198607 3300061734 Bacteria 1489
1070 Ga0530510_0199114 3300061734 Bacteria 1487
1071 Ga0530510_0213823 3300061734 Bacteria 1432

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300020077 Ga0206351_10719405 Ga0206351_107194051 197
2 3300037418 Ga0395900_0244747 Ga0395900_0244747_295_927 205
3 3300006042 Ga0075368_10020446 Ga0075368_100204462 209
4 3300006048 Ga0075363_100043761 Ga0075363_1000437612 209
5 3300006051 Ga0075364_10008898 Ga0075364_100088983 209
6 3300006177 Ga0075362_10085592 Ga0075362_100855922 209
7 3300006178 Ga0075367_10068082 Ga0075367_100680822 209
8 3300006186 Ga0075369_10123157 Ga0075369_101231572 209
9 3300027866 Ga0209813_10042171 Ga0209813_100421713 209
10 3300050490 nmdc:mga03n38_20976_c1 nmdc:mga03n38_20976_c1_1858_2490 209
11 3300050491 nmdc:mga00v17_6976_c1 nmdc:mga00v17_6976_c1_3885_4517 209
12 3300050492 nmdc:mga0yw44_26301_c1 nmdc:mga0yw44_26301_c1_1915_2547 209
13 3300050494 nmdc:mga06z11_78924_c1 nmdc:mga06z11_78924_c1_973_1605 209
14 3300050495 nmdc:mga04h51_20413_c1 nmdc:mga04h51_20413_c1_1299_1931 209
15 3300050496 nmdc:mga07m45_173152_c1 nmdc:mga07m45_173152_c1_452_1084 209
16 3300005329 Ga0070683_100756869 Ga0070683_1007568691 210
17 3300005437 Ga0070710_10039981 Ga0070710_100399812 210
18 3300005535 Ga0070684_100590117 Ga0070684_1005901171 210
19 3300006038 Ga0075365_10018211 Ga0075365_100182113 210
20 3300007788 Ga0099795_10177452 Ga0099795_101774522 210
21 3300013297 Ga0157378_10111384 Ga0157378_101113842 210
22 3300020070 Ga0206356_11575614 Ga0206356_115756141 210
23 3300025915 Ga0207693_10584217 Ga0207693_105842171 210
24 3300025929 Ga0207664_10944061 Ga0207664_109440611 210
25 3300028800 Ga0265338_10193381 Ga0265338_101933811 210
26 3300031247 Ga0265340_10142989 Ga0265340_101429892 210
27 3300031249 Ga0265339_10002778 Ga0265339_100027782 210
28 3300035692 Ga0373935_0126432 Ga0373935_0126432_636_1271 210
29 3300046462 Ga0495651_0363732 Ga0495651_0363732_189_827 210
30 3300048088 Ga0495602_0150249 Ga0495602_0150249_1146_1784 210
31 3300050489 nmdc:mga03683_52961_c1 nmdc:mga03683_52961_c1_1001_1636 210
32 3300050491 nmdc:mga00v17_39184_c1 nmdc:mga00v17_39184_c1_107_742 210
33 3300050492 nmdc:mga0yw44_66150_c1 nmdc:mga0yw44_66150_c1_576_1211 210
34 3300050507 nmdc:mga05p37_132370_c1 nmdc:mga05p37_132370_c1_1359_1991 210
35 iso_pu_bacteria 2511231027 2511390943 212
36 iso_pu_bacteria 2738541337 2739055669 212
37 iso_pu_bacteria 2842871566 2842874333 212
38 iso_pu_bacteria 2928521798 2928524966 212
39 iso_pu_bacteria 2508501125 2509131795 213
40 iso_pu_bacteria 2513237150 2513954864 213
41 iso_pu_bacteria 2513237151 2513959455 213
42 iso_pu_bacteria 2513237165 2514042865 213
43 iso_pu_bacteria 2515154123 2515692314 213
44 iso_pu_bacteria 2526164713 2527079552 213
45 iso_pu_bacteria 2562617112 2563057039 213
46 iso_pu_bacteria 2599185239 2599736206 213
47 iso_pu_bacteria 2623620446 2624491237 213
48 iso_pu_bacteria 2711768613 2713480942 213
49 iso_pu_bacteria 2738541296 2738822254 213
50 iso_pu_bacteria 2738541298 2738836610 213
51 iso_pu_bacteria 2738541306 2738875940 213
52 iso_pu_bacteria 2738543002 2739187892 213
53 iso_pu_bacteria 2738543008 2739222538 213
54 iso_pu_bacteria 2744054900 2746084942 213
55 iso_pu_bacteria 2744054901 2746099605 213
56 iso_pu_bacteria 2808606379 2808943331 213
57 iso_pu_bacteria 2818991450 2819621351 213
58 iso_pu_bacteria 2818991452 2819634047 213
59 iso_pu_bacteria 2842324504 2842329867 213
60 iso_pu_bacteria 2842348783 2842354667 213
61 iso_pu_bacteria 2842454564 2842460116 213
62 iso_pu_bacteria 2860339153 2860344164 213
63 iso_pu_bacteria 2883087390 2883095413 213
64 iso_pu_bacteria 2904483920 2904488238 213
65 iso_pu_bacteria 2919527303 2919530999 213
66 iso_pu_bacteria 2919697872 2919701250 213
67 iso_pu_bacteria 2921643360 2921646172 213
68 iso_pu_bacteria 2928108538 2928109137 213
69 iso_pu_bacteria 2928135762 2928136360 213
70 iso_pu_bacteria 2928170801 2928171358 213
71 iso_pu_bacteria 2928503688 2928503858 213
72 iso_pu_bacteria 2931396565 2931402920 213
73 iso_pu_bacteria 2945934425 2945934962 213
74 iso_pu_bacteria 2981990288 2981991548 213
75 iso_pu_bacteria 2990703756 2990704481 213
76 iso_pu_bacteria 3007619802 3007623596 213
77 iso_pu_bacteria 641736151 642424869 213
78 iso_pu_bacteria 644736347 644752026 213
79 iso_pu_bacteria 8018845410 8018853771 213
80 iso_pu_bacteria 8019775933 8019778130 213
81 iso_pu_bacteria 8021120328 8021123519 213
82 iso_pu_bacteria 8055266321 8055267890 213
83 iso_pu_bacteria 8055301274 8055304381 213
84 iso_pu_bacteria 8056155041 8056160229 213
85 iso_pu_bacteria 2842324504 2842328554 214
86 iso_pu_bacteria 2842348783 2842352870 214
87 iso_pu_bacteria 2842454564 2842458785 214
88 3300005293 Ga0065715_10211111 Ga0065715_102111111 215
89 3300005335 Ga0070666_10017611 Ga0070666_100176114 215
90 3300005367 Ga0070667_100018740 Ga0070667_1000187403 215
91 3300005435 Ga0070714_100079538 Ga0070714_1000795382 215
92 3300005439 Ga0070711_100536687 Ga0070711_1005366872 215
93 3300005440 Ga0070705_100052916 Ga0070705_1000529163 215
94 3300005458 Ga0070681_10022516 Ga0070681_100225164 215
95 3300005467 Ga0070706_100303251 Ga0070706_1003032512 215
96 3300005518 Ga0070699_100037577 Ga0070699_1000375774 215
97 3300005536 Ga0070697_100057612 Ga0070697_1000576125 215
98 3300005536 Ga0070697_100729774 Ga0070697_1007297741 215
99 3300005545 Ga0070695_100011818 Ga0070695_1000118184 215
100 3300005546 Ga0070696_100005007 Ga0070696_1000050077 215
101 3300005547 Ga0070693_100341616 Ga0070693_1003416161 215
102 3300005549 Ga0070704_100214352 Ga0070704_1002143521 215
103 3300005563 Ga0068855_100884376 Ga0068855_1008843761 215
104 3300006038 Ga0075365_10021202 Ga0075365_100212024 215
105 3300006846 Ga0075430_100106627 Ga0075430_1001066273 215
106 3300006871 Ga0075434_100624016 Ga0075434_1006240162 215
107 3300006914 Ga0075436_100013082 Ga0075436_1000130825 215
108 3300006914 Ga0075436_100146654 Ga0075436_1001466542 215
109 3300025903 Ga0207680_10014305 Ga0207680_100143053 215
110 3300025912 Ga0207707_10013398 Ga0207707_100133986 215
111 3300025929 Ga0207664_10155657 Ga0207664_101556571 215
112 3300025986 Ga0207658_10190715 Ga0207658_101907152 215
113 3300027665 Ga0209983_1032469 Ga0209983_10324692 215
114 3300032002 Ga0307416_100594523 Ga0307416_1005945232 215
115 3300035085 Ga0373929_0027199 Ga0373929_0027199_488_1141 215
116 3300035111 Ga0373923_0182594 Ga0373923_0182594_261_914 215
117 3300035410 Ga0373924_0007996 Ga0373924_0007996_196_849 215
118 3300035695 Ga0373927_0321067 Ga0373927_0321067_142_795 215
119 3300036401 Ga0373937_0051508 Ga0373937_0051508_2994_3647 215
120 3300046463 Ga0495653_0145713 Ga0495653_0145713_433_1086 215
121 3300046511 Ga0495608_0214575 Ga0495608_0214575_224_877 215
122 3300046559 Ga0495667_0029368 Ga0495667_0029368_2917_3570 215
123 3300046675 Ga0495657_0291557 Ga0495657_0291557_52_705 215
124 3300047322 Ga0495680_0125477 Ga0495680_0125477_872_1525 215
125 3300049585 Ga0501069_0231730 Ga0501069_0231730_200_853 215
126 3300050492 nmdc:mga0yw44_120728_c1 nmdc:mga0yw44_120728_c1_717_1373 215
127 3300050509 nmdc:mga0qj67_19781_c1 nmdc:mga0qj67_19781_c1_2265_2918 215
128 3300050513 nmdc:mga0rr50_103076_c1 nmdc:mga0rr50_103076_c1_712_1365 215
129 3300050514 nmdc:mga08x19_106964_c1 nmdc:mga08x19_106964_c1_1048_1701 215
130 3300050514 nmdc:mga08x19_29593_c1 nmdc:mga08x19_29593_c1_2064_2717 215
131 3300050514 nmdc:mga08x19_30851_c1 nmdc:mga08x19_30851_c1_1796_2449 215
132 3300050514 nmdc:mga08x19_317459_c1 nmdc:mga08x19_317459_c1_285_938 215
133 3300050515 nmdc:mga0a205_410607_c1 nmdc:mga0a205_410607_c1_65_718 215
134 3300003578 Ga0006562J51391_1046179 Ga0006562J51391_10461791 216
135 3300003794 Ga0055531_10000317 Ga0055531_1000031731 216
136 3300005327 Ga0070658_10110515 Ga0070658_101105152 216
137 3300005329 Ga0070683_100047351 Ga0070683_1000473514 216
138 3300005344 Ga0070661_100032230 Ga0070661_1000322301 216
139 3300005355 Ga0070671_100167476 Ga0070671_1001674762 216
140 3300005439 Ga0070711_100040343 Ga0070711_1000403433 216
141 3300005455 Ga0070663_100319187 Ga0070663_1003191872 216
142 3300005563 Ga0068855_100065945 Ga0068855_1000659455 216
143 3300005578 Ga0068854_100162708 Ga0068854_1001627082 216
144 3300005578 Ga0068854_100477050 Ga0068854_1004770502 216
145 3300005614 Ga0068856_100006744 Ga0068856_1000067449 216
146 3300005614 Ga0068856_100009816 Ga0068856_1000098167 216
147 3300005616 Ga0068852_100005526 Ga0068852_1000055269 216
148 3300005937 Ga0081455_10280774 Ga0081455_102807742 216
149 3300006353 Ga0075370_10003614 Ga0075370_100036145 216
150 3300006914 Ga0075436_100003079 Ga0075436_10000307911 216
151 3300006914 Ga0075436_100336596 Ga0075436_1003365962 216
152 3300007076 Ga0075435_100186734 Ga0075435_1001867342 216
153 3300009098 Ga0105245_10435126 Ga0105245_104351262 216
154 3300009101 Ga0105247_10476721 Ga0105247_104767211 216
155 3300013100 Ga0157373_10099058 Ga0157373_100990582 216
156 3300013105 Ga0157369_10001012 Ga0157369_1000101236 216
157 3300013297 Ga0157378_10025323 Ga0157378_100253232 216
158 3300020080 Ga0206350_11076876 Ga0206350_110768761 216
159 3300025913 Ga0207695_10004994 Ga0207695_100049947 216
160 3300025920 Ga0207649_10095757 Ga0207649_100957572 216
161 3300025927 Ga0207687_10184630 Ga0207687_101846301 216
162 3300025931 Ga0207644_10176030 Ga0207644_101760301 216
163 3300025931 Ga0207644_10639097 Ga0207644_106390971 216
164 3300025936 Ga0207670_10279091 Ga0207670_102790911 216
165 3300025942 Ga0207689_10410111 Ga0207689_104101112 216
166 3300025949 Ga0207667_10008902 Ga0207667_100089022 216
167 3300025981 Ga0207640_10326330 Ga0207640_103263302 216
168 3300025981 Ga0207640_10861805 Ga0207640_108618051 216
169 3300026041 Ga0207639_10067478 Ga0207639_100674782 216
170 3300026067 Ga0207678_10046935 Ga0207678_100469352 216
171 3300026078 Ga0207702_10060129 Ga0207702_100601292 216
172 3300026088 Ga0207641_10943025 Ga0207641_109430251 216
173 3300028794 Ga0307515_10000219 Ga0307515_1000021984 216
174 3300037312 Ga0395899_0017035 Ga0395899_0017035_4754_5422 216
175 3300037312 Ga0395899_0081333 Ga0395899_0081333_48_716 216
176 3300037418 Ga0395900_0033748 Ga0395900_0033748_3295_3963 216
177 3300037466 Ga0395898_0026748 Ga0395898_0026748_2519_3187 216
178 3300038443 Ga0395901_0217475 Ga0395901_0217475_353_1009 216
179 3300038443 Ga0395901_0389746 Ga0395901_0389746_168_836 216
180 3300044656 Ga0466969_0002723 Ga0466969_0002723_6584_7252 216
181 3300044673 Ga0453683_0007776 Ga0453683_0007776_5566_6228 216
182 3300044684 Ga0466966_0000039 Ga0466966_0000039_24923_25585 216
183 3300044684 Ga0466966_0014455 Ga0466966_0014455_2496_3164 216
184 3300044693 Ga0466961_0001899 Ga0466961_0001899_4328_4996 216
185 3300044693 Ga0466961_0054617 Ga0466961_0054617_1169_1831 216
186 3300044694 Ga0466963_0016298 Ga0466963_0016298_3680_4348 216
187 3300044719 Ga0466971_0012794 Ga0466971_0012794_1243_1911 216
188 3300044765 Ga0466970_0021183 Ga0466970_0021183_369_1037 216
189 3300044842 Ga0466957_0000515 Ga0466957_0000515_11235_11903 216
190 3300045049 Ga0466959_0009377 Ga0466959_0009377_1465_2133 216
191 3300045049 Ga0466959_0100740 Ga0466959_0100740_753_1421 216
192 3300045836 Ga0466958_0003175 Ga0466958_0003175_2062_2730 216
193 3300050496 nmdc:mga07m45_17777_c1 nmdc:mga07m45_17777_c1_453_1112 216
194 3300050512 nmdc:mga0n895_134873_c1 nmdc:mga0n895_134873_c1_485_1135 216
195 3300050512 nmdc:mga0n895_18197_c1 nmdc:mga0n895_18197_c1_3728_4381 216
196 3300050513 nmdc:mga0rr50_325429_c1 nmdc:mga0rr50_325429_c1_617_1267 216
197 3300050514 nmdc:mga08x19_2190_c1 nmdc:mga08x19_2190_c1_4024_4674 216
198 3300050514 nmdc:mga08x19_287611_c1 nmdc:mga08x19_287611_c1_294_947 216
199 3300059506 Ga0587085_003335 Ga0587085_003335_12_719 216
200 3300061719 Ga0466962_0018570 Ga0466962_0018570_1307_1975 216
201 3300001979 JGI24740J21852_10001218 JGI24740J21852_100012189 217
202 3300001979 JGI24740J21852_10069483 JGI24740J21852_100694832 217
203 3300001989 JGI24739J22299_10007358 JGI24739J22299_100073582 217
204 3300001989 JGI24739J22299_10007911 JGI24739J22299_100079113 217
205 3300001989 JGI24739J22299_10010141 JGI24739J22299_100101412 217
206 3300001990 JGI24737J22298_10006425 JGI24737J22298_100064253 217
207 3300001990 JGI24737J22298_10017867 JGI24737J22298_100178673 217
208 3300001990 JGI24737J22298_10111933 JGI24737J22298_101119331 217
209 3300002067 JGI24735J21928_10000112 JGI24735J21928_1000011216 217
210 3300002067 JGI24735J21928_10003160 JGI24735J21928_100031606 217
211 3300002067 JGI24735J21928_10008835 JGI24735J21928_100088353 217
212 3300002067 JGI24735J21928_10016148 JGI24735J21928_100161482 217
213 3300002067 JGI24735J21928_10020077 JGI24735J21928_100200772 217
214 3300002067 JGI24735J21928_10041790 JGI24735J21928_100417902 217
215 3300002067 JGI24735J21928_10041859 JGI24735J21928_100418591 217
216 3300002075 JGI24738J21930_10001789 JGI24738J21930_100017894 217
217 3300002075 JGI24738J21930_10025831 JGI24738J21930_100258312 217
218 3300002705 JGI25156J39149_1000219 JGI25156J39149_10002193 217
219 3300002705 JGI25156J39149_1002857 JGI25156J39149_10028572 217
220 3300002772 JGI25164J39214_1008578 JGI25164J39214_10085782 217
221 3300003214 JGI25165J46597_1002266 JGI25165J46597_10022663 217
222 3300003479 Ga0006556J51387_1024206 Ga0006556J51387_10242061 217
223 3300003567 Ga0006554J51385_1019889 Ga0006554J51385_10198891 217
224 3300003756 Ga0055533_1000306 Ga0055533_100030616 217
225 3300003756 Ga0055533_1003661 Ga0055533_10036613 217
226 3300003758 Ga0055532_1000022 Ga0055532_1000022120 217
227 3300003758 Ga0055532_1001602 Ga0055532_10016027 217
228 3300003759 Ga0055525_1002523 Ga0055525_10025232 217
229 3300003760 Ga0055527_1000016 Ga0055527_1000016120 217
230 3300003761 Ga0055535_1000017 Ga0055535_1000017120 217
231 3300003762 Ga0055542_1000030 Ga0055542_1000030120 217
232 3300003763 Ga0055529_1000033 Ga0055529_1000033120 217
233 3300004799 Ga0058863_11823999 Ga0058863_118239991 217
234 3300004800 Ga0058861_11807144 Ga0058861_118071441 217
235 3300004801 Ga0058860_12166380 Ga0058860_121663801 217
236 3300004803 Ga0058862_10139900 Ga0058862_101399001 217
237 3300004803 Ga0058862_12455986 Ga0058862_124559862 217
238 3300005262 Ga0065165_1000489 Ga0065165_100048917 217
239 3300005290 Ga0065712_10001293 Ga0065712_100012932 217
240 3300005290 Ga0065712_10068048 Ga0065712_100680482 217
241 3300005290 Ga0065712_10078230 Ga0065712_100782304 217
242 3300005293 Ga0065715_10088924 Ga0065715_1008892425 217
243 3300005293 Ga0065715_10253367 Ga0065715_102533671 217
244 3300005295 Ga0065707_10088203 Ga0065707_100882031 217
245 3300005295 Ga0065707_10451990 Ga0065707_104519901 217
246 3300005295 Ga0065707_10525249 Ga0065707_105252491 217
247 3300005327 Ga0070658_10003087 Ga0070658_100030877 217
248 3300005327 Ga0070658_10004656 Ga0070658_1000465610 217
249 3300005327 Ga0070658_10006183 Ga0070658_100061832 217
250 3300005327 Ga0070658_10013021 Ga0070658_100130213 217
251 3300005327 Ga0070658_10043430 Ga0070658_100434303 217
252 3300005327 Ga0070658_10135860 Ga0070658_101358602 217
253 3300005327 Ga0070658_10160620 Ga0070658_101606202 217
254 3300005327 Ga0070658_10272347 Ga0070658_102723473 217
255 3300005328 Ga0070676_10054969 Ga0070676_100549692 217
256 3300005329 Ga0070683_100018296 Ga0070683_1000182965 217
257 3300005331 Ga0070670_100001241 Ga0070670_10000124117 217
258 3300005331 Ga0070670_100008380 Ga0070670_1000083802 217
259 3300005333 Ga0070677_10024857 Ga0070677_100248572 217
260 3300005333 Ga0070677_10043998 Ga0070677_100439982 217
261 3300005335 Ga0070666_10038616 Ga0070666_100386164 217
262 3300005335 Ga0070666_10116260 Ga0070666_101162601 217
263 3300005336 Ga0070680_100008371 Ga0070680_1000083713 217
264 3300005338 Ga0068868_100014826 Ga0068868_1000148264 217
265 3300005338 Ga0068868_100063143 Ga0068868_1000631433 217
266 3300005338 Ga0068868_100163794 Ga0068868_1001637942 217
267 3300005339 Ga0070660_100002014 Ga0070660_1000020144 217
268 3300005339 Ga0070660_100003253 Ga0070660_1000032536 217
269 3300005339 Ga0070660_100078332 Ga0070660_1000783323 217
270 3300005339 Ga0070660_100085875 Ga0070660_1000858751 217
271 3300005340 Ga0070689_100124485 Ga0070689_1001244852 217
272 3300005341 Ga0070691_10023615 Ga0070691_100236152 217
273 3300005343 Ga0070687_100052376 Ga0070687_1000523762 217
274 3300005344 Ga0070661_100001747 Ga0070661_1000017473 217
275 3300005344 Ga0070661_100018903 Ga0070661_1000189032 217
276 3300005344 Ga0070661_100028212 Ga0070661_1000282126 217
277 3300005345 Ga0070692_10193033 Ga0070692_101930332 217
278 3300005347 Ga0070668_100064795 Ga0070668_1000647952 217
279 3300005353 Ga0070669_100003151 Ga0070669_10000315110 217
280 3300005354 Ga0070675_100011196 Ga0070675_1000111961 217
281 3300005354 Ga0070675_100047571 Ga0070675_1000475713 217
282 3300005355 Ga0070671_100009662 Ga0070671_1000096623 217
283 3300005355 Ga0070671_100121588 Ga0070671_1001215882 217
284 3300005356 Ga0070674_100005072 Ga0070674_1000050721 217
285 3300005356 Ga0070674_100063552 Ga0070674_1000635522 217
286 3300005364 Ga0070673_100007590 Ga0070673_1000075904 217
287 3300005364 Ga0070673_100015973 Ga0070673_1000159735 217
288 3300005364 Ga0070673_100146559 Ga0070673_1001465591 217
289 3300005366 Ga0070659_100009464 Ga0070659_1000094642 217
290 3300005366 Ga0070659_100387901 Ga0070659_1003879011 217
291 3300005367 Ga0070667_100059040 Ga0070667_1000590404 217
292 3300005367 Ga0070667_100100440 Ga0070667_1001004402 217
293 3300005441 Ga0070700_100039036 Ga0070700_1000390362 217
294 3300005444 Ga0070694_100027560 Ga0070694_1000275602 217
295 3300005444 Ga0070694_100176327 Ga0070694_1001763272 217
296 3300005444 Ga0070694_100498588 Ga0070694_1004985881 217
297 3300005445 Ga0070708_100043219 Ga0070708_1000432195 217
298 3300005445 Ga0070708_100163120 Ga0070708_1001631203 217
299 3300005445 Ga0070708_100432244 Ga0070708_1004322442 217
300 3300005455 Ga0070663_100012253 Ga0070663_1000122536 217
301 3300005455 Ga0070663_100189702 Ga0070663_1001897022 217
302 3300005455 Ga0070663_100539348 Ga0070663_1005393481 217
303 3300005456 Ga0070678_100004858 Ga0070678_1000048582 217
304 3300005456 Ga0070678_100162194 Ga0070678_1001621942 217
305 3300005457 Ga0070662_100021633 Ga0070662_1000216332 217
306 3300005458 Ga0070681_10004285 Ga0070681_100042858 217
307 3300005458 Ga0070681_10007917 Ga0070681_100079174 217
308 3300005458 Ga0070681_10028372 Ga0070681_100283722 217
309 3300005459 Ga0068867_100000031 Ga0068867_1000000318 217
310 3300005459 Ga0068867_100021037 Ga0068867_1000210373 217
311 3300005459 Ga0068867_100067543 Ga0068867_1000675434 217
312 3300005467 Ga0070706_100006506 Ga0070706_1000065065 217
313 3300005468 Ga0070707_100420942 Ga0070707_1004209421 217
314 3300005471 Ga0070698_100000360 Ga0070698_10000036052 217
315 3300005471 Ga0070698_100101436 Ga0070698_1001014363 217
316 3300005471 Ga0070698_100478909 Ga0070698_1004789092 217
317 3300005471 Ga0070698_100491490 Ga0070698_1004914902 217
318 3300005518 Ga0070699_100008542 Ga0070699_1000085427 217
319 3300005518 Ga0070699_100009432 Ga0070699_1000094323 217
320 3300005518 Ga0070699_100024044 Ga0070699_1000240445 217
321 3300005530 Ga0070679_100015194 Ga0070679_1000151946 217
322 3300005530 Ga0070679_100105860 Ga0070679_1001058604 217
323 3300005530 Ga0070679_100106501 Ga0070679_1001065014 217
324 3300005535 Ga0070684_100336698 Ga0070684_1003366982 217
325 3300005536 Ga0070697_100009047 Ga0070697_1000090478 217
326 3300005536 Ga0070697_100090194 Ga0070697_1000901942 217
327 3300005536 Ga0070697_100096908 Ga0070697_1000969082 217
328 3300005539 Ga0068853_100011721 Ga0068853_1000117217 217
329 3300005539 Ga0068853_100759059 Ga0068853_1007590591 217
330 3300005543 Ga0070672_100154414 Ga0070672_1001544143 217
331 3300005543 Ga0070672_100162864 Ga0070672_1001628642 217
332 3300005544 Ga0070686_100010413 Ga0070686_1000104133 217
333 3300005545 Ga0070695_100009516 Ga0070695_1000095164 217
334 3300005545 Ga0070695_100010479 Ga0070695_1000104792 217
335 3300005545 Ga0070695_100417562 Ga0070695_1004175621 217
336 3300005546 Ga0070696_100011139 Ga0070696_1000111396 217
337 3300005547 Ga0070693_100012746 Ga0070693_1000127462 217
338 3300005547 Ga0070693_100271851 Ga0070693_1002718512 217
339 3300005548 Ga0070665_100371413 Ga0070665_1003714132 217
340 3300005548 Ga0070665_100378371 Ga0070665_1003783711 217
341 3300005549 Ga0070704_100003123 Ga0070704_1000031239 217
342 3300005549 Ga0070704_100115276 Ga0070704_1001152762 217
343 3300005549 Ga0070704_100766744 Ga0070704_1007667442 217
344 3300005563 Ga0068855_100010091 Ga0068855_1000100916 217
345 3300005563 Ga0068855_100026348 Ga0068855_1000263483 217
346 3300005564 Ga0070664_100001859 Ga0070664_1000018597 217
347 3300005564 Ga0070664_100005743 Ga0070664_1000057437 217
348 3300005577 Ga0068857_100028110 Ga0068857_1000281102 217
349 3300005577 Ga0068857_100339349 Ga0068857_1003393492 217
350 3300005578 Ga0068854_100036899 Ga0068854_1000368994 217
351 3300005578 Ga0068854_100070369 Ga0068854_1000703692 217
352 3300005614 Ga0068856_100084585 Ga0068856_1000845852 217
353 3300005614 Ga0068856_100408432 Ga0068856_1004084322 217
354 3300005616 Ga0068852_100011776 Ga0068852_1000117762 217
355 3300005616 Ga0068852_100012112 Ga0068852_1000121125 217
356 3300005616 Ga0068852_100012336 Ga0068852_1000123363 217
357 3300005616 Ga0068852_100096782 Ga0068852_1000967822 217
358 3300005616 Ga0068852_100435871 Ga0068852_1004358712 217
359 3300005617 Ga0068859_100231085 Ga0068859_1002310852 217
360 3300005618 Ga0068864_100199184 Ga0068864_1001991841 217
361 3300005834 Ga0068851_10000435 Ga0068851_1000043516 217
362 3300005834 Ga0068851_10011188 Ga0068851_100111884 217
363 3300005834 Ga0068851_10068528 Ga0068851_100685282 217
364 3300005840 Ga0068870_10267937 Ga0068870_102679371 217
365 3300005841 Ga0068863_100706750 Ga0068863_1007067502 217
366 3300005843 Ga0068860_100543685 Ga0068860_1005436852 217
367 3300005981 Ga0081538_10118502 Ga0081538_101185021 217
368 3300006048 Ga0075363_100152419 Ga0075363_1001524192 217
369 3300006173 Ga0070716_100019172 Ga0070716_1000191723 217
370 3300006173 Ga0070716_100072625 Ga0070716_1000726252 217
371 3300006175 Ga0070712_100150211 Ga0070712_1001502113 217
372 3300006195 Ga0075366_10193631 Ga0075366_101936312 217
373 3300006195 Ga0075366_10270604 Ga0075366_102706041 217
374 3300006237 Ga0097621_100014106 Ga0097621_1000141061 217
375 3300006237 Ga0097621_100030594 Ga0097621_1000305944 217
376 3300006358 Ga0068871_100031263 Ga0068871_1000312633 217
377 3300006358 Ga0068871_100567747 Ga0068871_1005677472 217
378 3300006844 Ga0075428_100107410 Ga0075428_1001074103 217
379 3300006844 Ga0075428_100720102 Ga0075428_1007201021 217
380 3300006846 Ga0075430_100278682 Ga0075430_1002786822 217
381 3300006847 Ga0075431_100124180 Ga0075431_1001241802 217
382 3300006847 Ga0075431_100647245 Ga0075431_1006472452 217
383 3300006852 Ga0075433_10141249 Ga0075433_101412492 217
384 3300006852 Ga0075433_10221195 Ga0075433_102211952 217
385 3300006852 Ga0075433_10392391 Ga0075433_103923912 217
386 3300006852 Ga0075433_10448182 Ga0075433_104481822 217
387 3300006871 Ga0075434_100006779 Ga0075434_10000677911 217
388 3300006871 Ga0075434_100031307 Ga0075434_1000313071 217
389 3300006871 Ga0075434_100051193 Ga0075434_1000511933 217
390 3300006871 Ga0075434_100084202 Ga0075434_1000842022 217
391 3300006871 Ga0075434_100171505 Ga0075434_1001715053 217
392 3300006880 Ga0075429_100546923 Ga0075429_1005469231 217
393 3300006881 Ga0068865_100069440 Ga0068865_1000694402 217
394 3300006881 Ga0068865_100137545 Ga0068865_1001375452 217
395 3300006881 Ga0068865_100380522 Ga0068865_1003805222 217
396 3300006914 Ga0075436_100099874 Ga0075436_1000998742 217
397 3300006914 Ga0075436_100102379 Ga0075436_1001023792 217
398 3300006914 Ga0075436_100103059 Ga0075436_1001030591 217
399 3300006914 Ga0075436_100691779 Ga0075436_1006917791 217
400 3300006931 Ga0097620_100231069 Ga0097620_1002310692 217
401 3300007076 Ga0075435_100037443 Ga0075435_1000374435 217
402 3300007076 Ga0075435_100079990 Ga0075435_1000799902 217
403 3300007076 Ga0075435_100110225 Ga0075435_1001102251 217
404 3300007076 Ga0075435_100360710 Ga0075435_1003607101 217
405 3300007076 Ga0075435_100551896 Ga0075435_1005518961 217
406 3300007265 Ga0099794_10389510 Ga0099794_103895101 217
407 3300007788 Ga0099795_10038086 Ga0099795_100380862 217
408 3300009011 Ga0105251_10000157 Ga0105251_1000015713 217
409 3300009011 Ga0105251_10089188 Ga0105251_100891882 217
410 3300009036 Ga0105244_10138845 Ga0105244_101388452 217
411 3300009093 Ga0105240_10007978 Ga0105240_100079785 217
412 3300009093 Ga0105240_10050343 Ga0105240_100503433 217
413 3300009093 Ga0105240_10624706 Ga0105240_106247061 217
414 3300009094 Ga0111539_10029117 Ga0111539_100291173 217
415 3300009094 Ga0111539_10132057 Ga0111539_101320572 217
416 3300009094 Ga0111539_10551206 Ga0111539_105512062 217
417 3300009101 Ga0105247_10077517 Ga0105247_100775172 217
418 3300009147 Ga0114129_10008335 Ga0114129_100083357 217
419 3300009147 Ga0114129_10184466 Ga0114129_101844662 217
420 3300009147 Ga0114129_10335763 Ga0114129_103357632 217
421 3300009147 Ga0114129_10412616 Ga0114129_104126162 217
422 3300009147 Ga0114129_11492760 Ga0114129_114927601 217
423 3300009147 Ga0114129_11757201 Ga0114129_117572011 217
424 3300009148 Ga0105243_10063465 Ga0105243_100634653 217
425 3300009174 Ga0105241_10031258 Ga0105241_100312583 217
426 3300009174 Ga0105241_10440032 Ga0105241_104400321 217
427 3300009174 Ga0105241_10932765 Ga0105241_109327651 217
428 3300009176 Ga0105242_10014349 Ga0105242_100143496 217
429 3300009176 Ga0105242_10106966 Ga0105242_101069662 217
430 3300009177 Ga0105248_10108510 Ga0105248_101085103 217
431 3300009177 Ga0105248_10246908 Ga0105248_102469082 217
432 3300009545 Ga0105237_10003909 Ga0105237_100039092 217
433 3300009545 Ga0105237_10091255 Ga0105237_100912553 217
434 3300009545 Ga0105237_10179507 Ga0105237_101795073 217
435 3300009551 Ga0105238_10013643 Ga0105238_100136436 217
436 3300009551 Ga0105238_10020173 Ga0105238_100201732 217
437 3300009551 Ga0105238_10504880 Ga0105238_105048802 217
438 3300010375 Ga0105239_10005610 Ga0105239_100056106 217
439 3300010375 Ga0105239_10336620 Ga0105239_103366201 217
440 3300011119 Ga0105246_10026306 Ga0105246_100263062 217
441 3300013100 Ga0157373_10047080 Ga0157373_100470802 217
442 3300013102 Ga0157371_10000739 Ga0157371_1000073927 217
443 3300013102 Ga0157371_10029805 Ga0157371_100298052 217
444 3300013102 Ga0157371_10127553 Ga0157371_101275532 217
445 3300013104 Ga0157370_10000965 Ga0157370_100009659 217
446 3300013104 Ga0157370_10004637 Ga0157370_1000463711 217
447 3300013104 Ga0157370_10007365 Ga0157370_100073657 217
448 3300013104 Ga0157370_10011838 Ga0157370_100118382 217
449 3300013104 Ga0157370_10159855 Ga0157370_101598552 217
450 3300013105 Ga0157369_10005380 Ga0157369_100053809 217
451 3300013105 Ga0157369_10010373 Ga0157369_1001037311 217
452 3300013105 Ga0157369_10252308 Ga0157369_102523082 217
453 3300013105 Ga0157369_10473548 Ga0157369_104735482 217
454 3300013105 Ga0157369_10809158 Ga0157369_108091581 217
455 3300013296 Ga0157374_10003804 Ga0157374_100038044 217
456 3300013296 Ga0157374_10011164 Ga0157374_100111646 217
457 3300013296 Ga0157374_10016646 Ga0157374_100166465 217
458 3300013297 Ga0157378_10012733 Ga0157378_100127331 217
459 3300013297 Ga0157378_10196650 Ga0157378_101966502 217
460 3300013306 Ga0163162_10028105 Ga0163162_100281056 217
461 3300013306 Ga0163162_10132062 Ga0163162_101320624 217
462 3300013306 Ga0163162_10413361 Ga0163162_104133612 217
463 3300013307 Ga0157372_10011957 Ga0157372_100119575 217
464 3300013307 Ga0157372_10091848 Ga0157372_100918482 217
465 3300013307 Ga0157372_10128868 Ga0157372_101288682 217
466 3300013308 Ga0157375_10049473 Ga0157375_100494733 217
467 3300014325 Ga0163163_10028824 Ga0163163_100288245 217
468 3300014497 Ga0182008_10123010 Ga0182008_101230102 217
469 3300014745 Ga0157377_10000235 Ga0157377_1000023523 217
470 3300014969 Ga0157376_10081213 Ga0157376_100812132 217
471 3300015261 Ga0182006_1028847 Ga0182006_10288473 217
472 3300015262 Ga0182007_10001687 Ga0182007_100016876 217
473 3300015262 Ga0182007_10006143 Ga0182007_100061434 217
474 3300015262 Ga0182007_10073794 Ga0182007_100737941 217
475 3300020070 Ga0206356_10151721 Ga0206356_101517211 217
476 3300020070 Ga0206356_10563753 Ga0206356_105637531 217
477 3300020075 Ga0206349_1007483 Ga0206349_10074831 217
478 3300020076 Ga0206355_1615061 Ga0206355_16150614 217
479 3300020078 Ga0206352_10228866 Ga0206352_102288661 217
480 3300020078 Ga0206352_11331274 Ga0206352_113312742 217
481 3300020080 Ga0206350_10756569 Ga0206350_107565694 217
482 3300020082 Ga0206353_10002810 Ga0206353_100028102 217
483 3300020082 Ga0206353_11275437 Ga0206353_112754371 217
484 3300022467 Ga0224712_10032476 Ga0224712_100324761 217
485 3300022467 Ga0224712_10135079 Ga0224712_101350792 217
486 3300025206 Ga0209435_102216 Ga0209435_1022162 217
487 3300025225 Ga0209566_100472 Ga0209566_1004726 217
488 3300025226 Ga0209674_100017 Ga0209674_100017274 217
489 3300025226 Ga0209674_100211 Ga0209674_10021119 217
490 3300025226 Ga0209674_102160 Ga0209674_1021602 217
491 3300025228 Ga0209672_100001 Ga0209672_1000012214 217
492 3300025228 Ga0209672_100271 Ga0209672_10027124 217
493 3300025228 Ga0209672_103474 Ga0209672_1034743 217
494 3300025229 Ga0209147_100022 Ga0209147_100022294 217
495 3300025229 Ga0209147_100121 Ga0209147_10012120 217
496 3300025230 Ga0209563_101145 Ga0209563_1011454 217
497 3300025231 Ga0207427_101579 Ga0207427_1015794 217
498 3300025242 Ga0209258_100033 Ga0209258_100033119 217
499 3300025253 Ga0209677_111067 Ga0209677_1110672 217
500 3300025254 Ga0209148_1000046 Ga0209148_1000046295 217
501 3300025256 Ga0209759_1000331 Ga0209759_100033121 217
502 3300025256 Ga0209759_1000366 Ga0209759_100036621 217
503 3300025256 Ga0209759_1010528 Ga0209759_10105284 217
504 3300025256 Ga0209759_1016444 Ga0209759_10164442 217
505 3300025261 Ga0209233_1000050 Ga0209233_1000050284 217
506 3300025272 Ga0209455_1000038 Ga0209455_1000038295 217
507 3300025284 Ga0209130_1005176 Ga0209130_10051761 217
508 3300025295 Ga0209564_1007781 Ga0209564_10077813 217
509 3300025302 Ga0207426_1000004 Ga0207426_1000004132 217
510 3300025302 Ga0207426_1004157 Ga0207426_10041571 217
511 3300025315 Ga0207697_10003982 Ga0207697_100039822 217
512 3300025321 Ga0207656_10007085 Ga0207656_100070851 217
513 3300025321 Ga0207656_10013184 Ga0207656_100131842 217
514 3300025321 Ga0207656_10067097 Ga0207656_100670972 217
515 3300025711 Ga0207696_1064564 Ga0207696_10645641 217
516 3300025728 Ga0207655_1120899 Ga0207655_11208991 217
517 3300025735 Ga0207713_1000336 Ga0207713_100033656 217
518 3300025735 Ga0207713_1012631 Ga0207713_10126312 217
519 3300025893 Ga0207682_10017545 Ga0207682_100175452 217
520 3300025901 Ga0207688_10015407 Ga0207688_100154073 217
521 3300025903 Ga0207680_10038507 Ga0207680_100385072 217
522 3300025903 Ga0207680_10078446 Ga0207680_100784461 217
523 3300025904 Ga0207647_10000396 Ga0207647_100003964 217
524 3300025904 Ga0207647_10003690 Ga0207647_100036908 217
525 3300025904 Ga0207647_10026012 Ga0207647_100260122 217
526 3300025904 Ga0207647_10028846 Ga0207647_100288462 217
527 3300025904 Ga0207647_10030002 Ga0207647_100300023 217
528 3300025904 Ga0207647_10040542 Ga0207647_100405422 217
529 3300025906 Ga0207699_10027168 Ga0207699_100271683 217
530 3300025907 Ga0207645_10066014 Ga0207645_100660142 217
531 3300025909 Ga0207705_10012575 Ga0207705_100125752 217
532 3300025909 Ga0207705_10024026 Ga0207705_100240264 217
533 3300025909 Ga0207705_10175222 Ga0207705_101752221 217
534 3300025909 Ga0207705_10348320 Ga0207705_103483201 217
535 3300025910 Ga0207684_10010463 Ga0207684_100104632 217
536 3300025910 Ga0207684_10029127 Ga0207684_100291272 217
537 3300025910 Ga0207684_10214320 Ga0207684_102143202 217
538 3300025910 Ga0207684_10639638 Ga0207684_106396382 217
539 3300025911 Ga0207654_10063090 Ga0207654_100630901 217
540 3300025911 Ga0207654_10092655 Ga0207654_100926553 217
541 3300025911 Ga0207654_10364327 Ga0207654_103643272 217
542 3300025912 Ga0207707_10041491 Ga0207707_100414912 217
543 3300025912 Ga0207707_10089484 Ga0207707_100894843 217
544 3300025912 Ga0207707_10438474 Ga0207707_104384742 217
545 3300025913 Ga0207695_10007589 Ga0207695_100075895 217
546 3300025913 Ga0207695_10133103 Ga0207695_101331031 217
547 3300025913 Ga0207695_10229180 Ga0207695_102291802 217
548 3300025914 Ga0207671_10012713 Ga0207671_100127133 217
549 3300025914 Ga0207671_10218474 Ga0207671_102184742 217
550 3300025917 Ga0207660_10354491 Ga0207660_103544911 217
551 3300025918 Ga0207662_10234999 Ga0207662_102349991 217
552 3300025919 Ga0207657_10006089 Ga0207657_100060899 217
553 3300025919 Ga0207657_10007609 Ga0207657_100076096 217
554 3300025919 Ga0207657_10024918 Ga0207657_100249183 217
555 3300025920 Ga0207649_10001822 Ga0207649_100018226 217
556 3300025920 Ga0207649_10098907 Ga0207649_100989071 217
557 3300025920 Ga0207649_10253253 Ga0207649_102532532 217
558 3300025921 Ga0207652_10075966 Ga0207652_100759662 217
559 3300025921 Ga0207652_10151951 Ga0207652_101519512 217
560 3300025922 Ga0207646_10024812 Ga0207646_100248124 217
561 3300025922 Ga0207646_10032895 Ga0207646_100328958 217
562 3300025922 Ga0207646_10108850 Ga0207646_101088501 217
563 3300025923 Ga0207681_10368747 Ga0207681_103687472 217
564 3300025924 Ga0207694_10002912 Ga0207694_100029129 217
565 3300025924 Ga0207694_10109155 Ga0207694_101091553 217
566 3300025925 Ga0207650_10001712 Ga0207650_1000171215 217
567 3300025925 Ga0207650_10001913 Ga0207650_100019133 217
568 3300025925 Ga0207650_10627557 Ga0207650_106275571 217
569 3300025926 Ga0207659_10055875 Ga0207659_100558752 217
570 3300025926 Ga0207659_10108350 Ga0207659_101083502 217
571 3300025931 Ga0207644_10003354 Ga0207644_100033542 217
572 3300025932 Ga0207690_10005945 Ga0207690_100059452 217
573 3300025932 Ga0207690_10260098 Ga0207690_102600982 217
574 3300025932 Ga0207690_10321293 Ga0207690_103212932 217
575 3300025933 Ga0207706_10000853 Ga0207706_1000085320 217
576 3300025933 Ga0207706_10162609 Ga0207706_101626092 217
577 3300025934 Ga0207686_10193587 Ga0207686_101935871 217
578 3300025935 Ga0207709_10009168 Ga0207709_100091682 217
579 3300025937 Ga0207669_10058531 Ga0207669_100585312 217
580 3300025938 Ga0207704_10086042 Ga0207704_100860422 217
581 3300025939 Ga0207665_10032835 Ga0207665_100328353 217
582 3300025939 Ga0207665_10054478 Ga0207665_100544782 217
583 3300025939 Ga0207665_10252384 Ga0207665_102523842 217
584 3300025940 Ga0207691_10009758 Ga0207691_100097585 217
585 3300025940 Ga0207691_10012098 Ga0207691_100120986 217
586 3300025941 Ga0207711_10410838 Ga0207711_104108382 217
587 3300025942 Ga0207689_10179150 Ga0207689_101791503 217
588 3300025945 Ga0207679_10018716 Ga0207679_100187162 217
589 3300025945 Ga0207679_10030199 Ga0207679_100301992 217
590 3300025949 Ga0207667_10031926 Ga0207667_100319266 217
591 3300025949 Ga0207667_10035988 Ga0207667_100359883 217
592 3300025949 Ga0207667_10212428 Ga0207667_102124282 217
593 3300025960 Ga0207651_10869089 Ga0207651_108690891 217
594 3300025972 Ga0207668_10087586 Ga0207668_100875862 217
595 3300025981 Ga0207640_10014227 Ga0207640_100142272 217
596 3300025981 Ga0207640_10124240 Ga0207640_101242402 217
597 3300025986 Ga0207658_10091679 Ga0207658_100916792 217
598 3300025986 Ga0207658_10216383 Ga0207658_102163832 217
599 3300026023 Ga0207677_10001053 Ga0207677_1000105312 217
600 3300026023 Ga0207677_10128648 Ga0207677_101286482 217
601 3300026023 Ga0207677_10175298 Ga0207677_101752983 217
602 3300026041 Ga0207639_10000520 Ga0207639_100005202 217
603 3300026067 Ga0207678_10075196 Ga0207678_100751963 217
604 3300026067 Ga0207678_10100602 Ga0207678_101006022 217
605 3300026067 Ga0207678_10226518 Ga0207678_102265182 217
606 3300026075 Ga0207708_10063567 Ga0207708_100635673 217
607 3300026078 Ga0207702_10095787 Ga0207702_100957872 217
608 3300026078 Ga0207702_10811355 Ga0207702_108113551 217
609 3300026089 Ga0207648_10001189 Ga0207648_100011898 217
610 3300026089 Ga0207648_10030812 Ga0207648_100308123 217
611 3300026095 Ga0207676_10033488 Ga0207676_100334882 217
612 3300026116 Ga0207674_10038495 Ga0207674_100384952 217
613 3300026116 Ga0207674_10300735 Ga0207674_103007352 217
614 3300026121 Ga0207683_10000838 Ga0207683_1000083830 217
615 3300026121 Ga0207683_10002698 Ga0207683_1000269816 217
616 3300026142 Ga0207698_10000603 Ga0207698_1000060315 217
617 3300026142 Ga0207698_10001098 Ga0207698_1000109811 217
618 3300026142 Ga0207698_10005537 Ga0207698_100055376 217
619 3300026142 Ga0207698_10010801 Ga0207698_100108013 217
620 3300026142 Ga0207698_10022534 Ga0207698_100225345 217
621 3300026142 Ga0207698_10398314 Ga0207698_103983142 217
622 3300027312 Ga0209371_1011284 Ga0209371_10112842 217
623 3300027424 Ga0209984_1003102 Ga0209984_10031022 217
624 3300027526 Ga0209968_1011434 Ga0209968_10114343 217
625 3300027614 Ga0209970_1036755 Ga0209970_10367551 217
626 3300027617 Ga0210002_1006145 Ga0210002_10061452 217
627 3300027617 Ga0210002_1011843 Ga0210002_10118431 217
628 3300027665 Ga0209983_1015181 Ga0209983_10151813 217
629 3300027665 Ga0209983_1017103 Ga0209983_10171032 217
630 3300027671 Ga0209588_1021994 Ga0209588_10219942 217
631 3300027682 Ga0209971_1001003 Ga0209971_10010033 217
632 3300027682 Ga0209971_1034787 Ga0209971_10347872 217
633 3300027876 Ga0209974_10002915 Ga0209974_100029156 217
634 3300027876 Ga0209974_10006328 Ga0209974_100063284 217
635 3300027876 Ga0209974_10043685 Ga0209974_100436852 217
636 3300028380 Ga0268265_10464038 Ga0268265_104640381 217
637 3300028381 Ga0268264_10497053 Ga0268264_104970532 217
638 3300028381 Ga0268264_10793808 Ga0268264_107938081 217
639 3300028800 Ga0265338_10000159 Ga0265338_1000015988 217
640 3300030500 Ga0268256_1009781 Ga0268256_10097813 217
641 3300031238 Ga0265332_10162881 Ga0265332_101628812 217
642 3300031548 Ga0307408_100003309 Ga0307408_1000033098 217
643 3300031548 Ga0307408_100027057 Ga0307408_1000270574 217
644 3300031548 Ga0307408_100372028 Ga0307408_1003720282 217
645 3300031731 Ga0307405_10018263 Ga0307405_100182635 217
646 3300031824 Ga0307413_10188889 Ga0307413_101888891 217
647 3300031852 Ga0307410_10155070 Ga0307410_101550702 217
648 3300031852 Ga0307410_10296962 Ga0307410_102969622 217
649 3300031901 Ga0307406_10518856 Ga0307406_105188561 217
650 3300031903 Ga0307407_10019840 Ga0307407_100198402 217
651 3300031903 Ga0307407_10324002 Ga0307407_103240021 217
652 3300031911 Ga0307412_10000011 Ga0307412_10000011282 217
653 3300031911 Ga0307412_10214523 Ga0307412_102145231 217
654 3300031995 Ga0307409_100056694 Ga0307409_1000566941 217
655 3300031995 Ga0307409_100152197 Ga0307409_1001521973 217
656 3300031995 Ga0307409_100163271 Ga0307409_1001632712 217
657 3300031995 Ga0307409_100321625 Ga0307409_1003216252 217
658 3300032002 Ga0307416_100028718 Ga0307416_1000287183 217
659 3300032002 Ga0307416_100936678 Ga0307416_1009366781 217
660 3300032004 Ga0307414_10007355 Ga0307414_100073555 217
661 3300032005 Ga0307411_10033971 Ga0307411_100339712 217
662 3300032005 Ga0307411_10382465 Ga0307411_103824652 217
663 3300032126 Ga0307415_100095676 Ga0307415_1000956762 217
664 3300032126 Ga0307415_100834957 Ga0307415_1008349571 217
665 3300035086 Ga0373934_0003851 Ga0373934_0003851_2920_3573 217
666 3300035113 Ga0373936_0016441 Ga0373936_0016441_1436_2089 217
667 3300035114 Ga0373939_0107208 Ga0373939_0107208_300_953 217
668 3300035116 Ga0373945_0018911 Ga0373945_0018911_1661_2314 217
669 3300035117 Ga0373953_0007056 Ga0373953_0007056_1065_1718 217
670 3300035119 Ga0373956_0058093 Ga0373956_0058093_295_948 217
671 3300035120 Ga0373957_0001050 Ga0373957_0001050_3900_4592 217
672 3300035172 Ga0373955_0026251 Ga0373955_0026251_1659_2312 217
673 3300035172 Ga0373955_0030261 Ga0373955_0030261_1851_2543 217
674 3300035410 Ga0373924_0001454 Ga0373924_0001454_5370_6023 217
675 3300035692 Ga0373935_0082656 Ga0373935_0082656_526_1179 217
676 3300035695 Ga0373927_0009366 Ga0373927_0009366_4519_5172 217
677 3300035695 Ga0373927_0032345 Ga0373927_0032345_2140_2793 217
678 3300035695 Ga0373927_0135661 Ga0373927_0135661_740_1393 217
679 3300035724 Ga0373933_0025633 Ga0373933_0025633_2408_3100 217
680 3300035724 Ga0373933_0045247 Ga0373933_0045247_323_976 217
681 3300035725 Ga0373947_0077381 Ga0373947_0077381_1146_1799 217
682 3300036401 Ga0373937_0367808 Ga0373937_0367808_86_739 217
683 3300037068 Ga0373925_0032407 Ga0373925_0032407_2871_3524 217
684 3300037068 Ga0373925_0130053 Ga0373925_0130053_959_1723 217
685 3300037312 Ga0395899_0063257 Ga0395899_0063257_678_1346 217
686 3300037418 Ga0395900_0149631 Ga0395900_0149631_1078_1746 217
687 3300037418 Ga0395900_0215718 Ga0395900_0215718_75_737 217
688 3300037418 Ga0395900_0277990 Ga0395900_0277990_772_1434 217
689 3300037418 Ga0395900_0742441 Ga0395900_0742441_242_895 217
690 3300037418 Ga0395900_0865776 Ga0395900_0865776_75_737 217
691 3300037466 Ga0395898_0023476 Ga0395898_0023476_1264_1932 217
692 3300037466 Ga0395898_0053375 Ga0395898_0053375_3148_3810 217
693 3300037466 Ga0395898_0169894 Ga0395898_0169894_782_1444 217
694 3300037466 Ga0395898_0241852 Ga0395898_0241852_329_982 217
695 3300037471 Ga0395905_0015881 Ga0395905_0015881_1929_2594 217
696 3300037471 Ga0395905_0041189 Ga0395905_0041189_129_785 217
697 3300037471 Ga0395905_0091083 Ga0395905_0091083_1763_2422 217
698 3300037853 Ga0436364_1101072 Ga0436364_1101072_112_771 217
699 3300038443 Ga0395901_0127955 Ga0395901_0127955_1200_1862 217
700 3300038443 Ga0395901_0456251 Ga0395901_0456251_621_1289 217
701 3300038996 Ga0242420_057203 Ga0242420_057203_51_704 217
702 3300039438 Ga0436360_0981097 Ga0436360_0981097_848_1540 217
703 3300039447 Ga0436361_0875914 Ga0436361_0875914_105_758 217
704 3300041405 Ga0439438_012311 Ga0439438_012311_1477_2130 217
705 3300041407 Ga0439447_005564 Ga0439447_005564_2469_3122 217
706 3300041411 Ga0439466_0002347 Ga0439466_0002347_6657_7310 217
707 3300041411 Ga0439466_0015237 Ga0439466_0015237_664_1317 217
708 3300042005 Ga0439448_0000736 Ga0439448_0000736_3637_4290 217
709 3300042010 Ga0439452_000093 Ga0439452_000093_42251_42904 217
710 3300042010 Ga0439452_044192 Ga0439452_044192_297_953 217
711 3300042146 Ga0450907_018903 Ga0450907_018903_366_1019 217
712 3300042876 Ga0451577_0074147 Ga0451577_0074147_2065_2721 217
713 3300042876 Ga0451577_0442727 Ga0451577_0442727_164_817 217
714 3300044656 Ga0466969_0005664 Ga0466969_0005664_520_1176 217
715 3300044656 Ga0466969_0042769 Ga0466969_0042769_1129_1782 217
716 3300044668 Ga0466980_0132384 Ga0466980_0132384_459_1112 217
717 3300044683 Ga0466965_0001313 Ga0466965_0001313_8747_9400 217
718 3300044684 Ga0466966_0008831 Ga0466966_0008831_1622_2284 217
719 3300044684 Ga0466966_0037177 Ga0466966_0037177_493_1149 217
720 3300044684 Ga0466966_0048767 Ga0466966_0048767_1813_2466 217
721 3300044684 Ga0466966_0209892 Ga0466966_0209892_305_964 217
722 3300044693 Ga0466961_0000207 Ga0466961_0000207_14508_15164 217
723 3300044693 Ga0466961_0004748 Ga0466961_0004748_6370_7023 217
724 3300044694 Ga0466963_0031487 Ga0466963_0031487_2626_3279 217
725 3300044694 Ga0466963_0193713 Ga0466963_0193713_641_1294 217
726 3300044712 Ga0453684_0135504 Ga0453684_0135504_1673_2329 217
727 3300044719 Ga0466971_0003647 Ga0466971_0003647_1164_1817 217
728 3300044719 Ga0466971_0045577 Ga0466971_0045577_263_916 217
729 3300044735 Ga0466968_0298587 Ga0466968_0298587_75_728 217
730 3300044765 Ga0466970_0002943 Ga0466970_0002943_1442_2095 217
731 3300044765 Ga0466970_0042389 Ga0466970_0042389_488_1141 217
732 3300044765 Ga0466970_0050792 Ga0466970_0050792_1287_1943 217
733 3300044842 Ga0466957_0002486 Ga0466957_0002486_6474_7127 217
734 3300044842 Ga0466957_0299366 Ga0466957_0299366_194_847 217
735 3300045049 Ga0466959_0004552 Ga0466959_0004552_1677_2330 217
736 3300045049 Ga0466959_0009026 Ga0466959_0009026_2073_2735 217
737 3300045049 Ga0466959_0014770 Ga0466959_0014770_67_723 217
738 3300045049 Ga0466959_0203789 Ga0466959_0203789_463_1116 217
739 3300045051 Ga0451576_0073438 Ga0451576_0073438_916_1674 217
740 3300045051 Ga0451576_0075928 Ga0451576_0075928_306_959 217
741 3300045051 Ga0451576_0206316 Ga0451576_0206316_1183_1836 217
742 3300045836 Ga0466958_0021682 Ga0466958_0021682_1930_2583 217
743 3300045836 Ga0466958_0195931 Ga0466958_0195931_278_940 217
744 3300045976 Ga0466967_0661511 Ga0466967_0661511_52_717 217
745 3300045976 Ga0466967_0711420 Ga0466967_0711420_197_862 217
746 3300046453 Ga0495627_004833 Ga0495627_004833_203_856 217
747 3300046454 Ga0495592_0001021 Ga0495592_0001021_13521_14186 217
748 3300046454 Ga0495592_0058142 Ga0495592_0058142_828_1487 217
749 3300046454 Ga0495592_0153597 Ga0495592_0153597_880_1536 217
750 3300046454 Ga0495592_0258830 Ga0495592_0258830_434_1087 217
751 3300046455 Ga0495603_0000430 Ga0495603_0000430_14470_15123 217
752 3300046457 Ga0495590_0007055 Ga0495590_0007055_10_669 217
753 3300046457 Ga0495590_0019696 Ga0495590_0019696_1257_1913 217
754 3300046457 Ga0495590_0065133 Ga0495590_0065133_31_699 217
755 3300046459 Ga0495629_0000184 Ga0495629_0000184_8211_8864 217
756 3300046459 Ga0495629_0002988 Ga0495629_0002988_21_680 217
757 3300046459 Ga0495629_0043550 Ga0495629_0043550_179_907 217
758 3300046459 Ga0495629_0144566 Ga0495629_0144566_741_1394 217
759 3300046459 Ga0495629_0158760 Ga0495629_0158760_256_939 217
760 3300046462 Ga0495651_0003256 Ga0495651_0003256_6933_7586 217
761 3300046462 Ga0495651_0005334 Ga0495651_0005334_3440_4093 217
762 3300046463 Ga0495653_0000458 Ga0495653_0000458_6098_6754 217
763 3300046463 Ga0495653_0028921 Ga0495653_0028921_1998_2651 217
764 3300046463 Ga0495653_0037707 Ga0495653_0037707_2590_3243 217
765 3300046463 Ga0495653_0325178 Ga0495653_0325178_195_854 217
766 3300046471 Ga0495650_0000155 Ga0495650_0000155_122537_123190 217
767 3300046471 Ga0495650_0008029 Ga0495650_0008029_1964_2671 217
768 3300046472 Ga0495580_0003676 Ga0495580_0003676_11387_12040 217
769 3300046472 Ga0495580_0007003 Ga0495580_0007003_6391_7134 217
770 3300046472 Ga0495580_0019201 Ga0495580_0019201_2608_3261 217
771 3300046472 Ga0495580_0045774 Ga0495580_0045774_2324_2977 217
772 3300046472 Ga0495580_0051269 Ga0495580_0051269_929_1582 217
773 3300046472 Ga0495580_0131594 Ga0495580_0131594_1062_1715 217
774 3300046473 Ga0495582_0100335 Ga0495582_0100335_667_1320 217
775 3300046474 Ga0495605_0003642 Ga0495605_0003642_4463_5206 217
776 3300046474 Ga0495605_0007723 Ga0495605_0007723_21_680 217
777 3300046475 Ga0495639_0002731 Ga0495639_0002731_5741_6394 217
778 3300046475 Ga0495639_0004581 Ga0495639_0004581_2929_3582 217
779 3300046476 Ga0495662_0003851 Ga0495662_0003851_1076_1729 217
780 3300046476 Ga0495662_0033063 Ga0495662_0033063_501_1154 217
781 3300046476 Ga0495662_0121389 Ga0495662_0121389_544_1200 217
782 3300046477 Ga0495664_0009344 Ga0495664_0009344_2484_3137 217
783 3300046491 Ga0495584_0093221 Ga0495584_0093221_848_1504 217
784 3300046492 Ga0495585_0000756 Ga0495585_0000756_23542_24195 217
785 3300046499 Ga0495594_0030730 Ga0495594_0030730_754_1407 217
786 3300046499 Ga0495594_0132249 Ga0495594_0132249_43_696 217
787 3300046500 Ga0495596_0013516 Ga0495596_0013516_1567_2220 217
788 3300046500 Ga0495596_0078620 Ga0495596_0078620_94_750 217
789 3300046506 Ga0495583_0002052 Ga0495583_0002052_8891_9634 217
790 3300046506 Ga0495583_0023731 Ga0495583_0023731_795_1448 217
791 3300046507 Ga0495606_0003521 Ga0495606_0003521_2557_3213 217
792 3300046507 Ga0495606_0010907 Ga0495606_0010907_1929_2588 217
793 3300046507 Ga0495606_0036960 Ga0495606_0036960_1952_2608 217
794 3300046511 Ga0495608_0019092 Ga0495608_0019092_1659_2312 217
795 3300046511 Ga0495608_0084089 Ga0495608_0084089_883_1536 217
796 3300046511 Ga0495608_0112547 Ga0495608_0112547_801_1460 217
797 3300046512 Ga0495610_0013957 Ga0495610_0013957_4013_4666 217
798 3300046512 Ga0495610_0027577 Ga0495610_0027577_19_678 217
799 3300046513 Ga0495616_0045437 Ga0495616_0045437_846_1589 217
800 3300046514 Ga0495618_0005497 Ga0495618_0005497_5245_5898 217
801 3300046514 Ga0495618_0051561 Ga0495618_0051561_1799_2458 217
802 3300046516 Ga0495628_0000612 Ga0495628_0000612_14561_15214 217
803 3300046516 Ga0495628_0001377 Ga0495628_0001377_16098_16763 217
804 3300046516 Ga0495628_0002577 Ga0495628_0002577_2746_3399 217
805 3300046516 Ga0495628_0008978 Ga0495628_0008978_2407_3063 217
806 3300046516 Ga0495628_0047491 Ga0495628_0047491_1082_1735 217
807 3300046516 Ga0495628_0050024 Ga0495628_0050024_277_930 217
808 3300046516 Ga0495628_0058645 Ga0495628_0058645_1495_2154 217
809 3300046516 Ga0495628_0096860 Ga0495628_0096860_1302_1955 217
810 3300046516 Ga0495628_0152777 Ga0495628_0152777_486_1139 217
811 3300046516 Ga0495628_0173739 Ga0495628_0173739_437_1090 217
812 3300046517 Ga0495630_0000001 Ga0495630_0000001_562330_562983 217
813 3300046517 Ga0495630_0006146 Ga0495630_0006146_3349_4002 217
814 3300046517 Ga0495630_0021822 Ga0495630_0021822_1343_2002 217
815 3300046517 Ga0495630_0042233 Ga0495630_0042233_323_976 217
816 3300046517 Ga0495630_0056979 Ga0495630_0056979_1189_1845 217
817 3300046517 Ga0495630_0175263 Ga0495630_0175263_283_975 217
818 3300046520 Ga0495637_0006474 Ga0495637_0006474_2639_3292 217
819 3300046524 Ga0495648_0002413 Ga0495648_0002413_12476_13135 217
820 3300046526 Ga0495666_0011194 Ga0495666_0011194_195_854 217
821 3300046526 Ga0495666_0023256 Ga0495666_0023256_1765_2418 217
822 3300046526 Ga0495666_0101340 Ga0495666_0101340_560_1213 217
823 3300046526 Ga0495666_0214938 Ga0495666_0214938_143_796 217
824 3300046528 Ga0495642_0042416 Ga0495642_0042416_100_753 217
825 3300046529 Ga0495652_0001770 Ga0495652_0001770_17401_18066 217
826 3300046529 Ga0495652_0002873 Ga0495652_0002873_7896_8549 217
827 3300046529 Ga0495652_0019423 Ga0495652_0019423_1148_1807 217
828 3300046529 Ga0495652_0029318 Ga0495652_0029318_1721_2377 217
829 3300046529 Ga0495652_0030200 Ga0495652_0030200_803_1456 217
830 3300046529 Ga0495652_0237329 Ga0495652_0237329_16_669 217
831 3300046529 Ga0495652_0547782 Ga0495652_0547782_72_728 217
832 3300046530 Ga0495654_0062788 Ga0495654_0062788_953_1606 217
833 3300046531 Ga0495665_0000741 Ga0495665_0000741_5474_6130 217
834 3300046531 Ga0495665_0012406 Ga0495665_0012406_3530_4189 217
835 3300046531 Ga0495665_0034988 Ga0495665_0034988_1845_2498 217
836 3300046533 Ga0495640_0012828 Ga0495640_0012828_2296_2955 217
837 3300046533 Ga0495640_0036400 Ga0495640_0036400_801_1454 217
838 3300046535 Ga0495586_0003135 Ga0495586_0003135_6378_7031 217
839 3300046535 Ga0495586_0016699 Ga0495586_0016699_157_816 217
840 3300046535 Ga0495586_0025541 Ga0495586_0025541_1299_1952 217
841 3300046535 Ga0495586_0034512 Ga0495586_0034512_1421_2074 217
842 3300046536 Ga0495587_0001813 Ga0495587_0001813_11424_12077 217
843 3300046536 Ga0495587_0010252 Ga0495587_0010252_2174_2827 217
844 3300046536 Ga0495587_0088935 Ga0495587_0088935_810_1463 217
845 3300046542 Ga0495597_0001849 Ga0495597_0001849_10960_11616 217
846 3300046542 Ga0495597_0007892 Ga0495597_0007892_768_1421 217
847 3300046543 Ga0495645_0000102 Ga0495645_0000102_34059_34712 217
848 3300046543 Ga0495645_0000216 Ga0495645_0000216_4501_5166 217
849 3300046543 Ga0495645_0178563 Ga0495645_0178563_551_1207 217
850 3300046543 Ga0495645_0192110 Ga0495645_0192110_175_828 217
851 3300046543 Ga0495645_0212969 Ga0495645_0212969_559_1212 217
852 3300046557 Ga0495622_0011928 Ga0495622_0011928_939_1592 217
853 3300046557 Ga0495622_0025958 Ga0495622_0025958_1345_1998 217
854 3300046557 Ga0495622_0088620 Ga0495622_0088620_49_792 217
855 3300046559 Ga0495667_0121786 Ga0495667_0121786_582_1235 217
856 3300046616 Ga0495668_0209375 Ga0495668_0209375_305_961 217
857 3300046642 Ga0495634_0000154 Ga0495634_0000154_45255_45908 217
858 3300046642 Ga0495634_0015021 Ga0495634_0015021_4114_4767 217
859 3300046642 Ga0495634_0027544 Ga0495634_0027544_195_854 217
860 3300046642 Ga0495634_0513238 Ga0495634_0513238_32_688 217
861 3300046663 Ga0495635_0000051 Ga0495635_0000051_52391_53044 217
862 3300046663 Ga0495635_0006318 Ga0495635_0006318_794_1447 217
863 3300046663 Ga0495635_0007827 Ga0495635_0007827_4009_4665 217
864 3300046663 Ga0495635_0045492 Ga0495635_0045492_1115_1768 217
865 3300046663 Ga0495635_0126150 Ga0495635_0126150_270_929 217
866 3300046674 Ga0495588_0133585 Ga0495588_0133585_198_851 217
867 3300046675 Ga0495657_0026574 Ga0495657_0026574_2289_2948 217
868 3300046675 Ga0495657_0081045 Ga0495657_0081045_687_1340 217
869 3300046678 Ga0495599_0000176 Ga0495599_0000176_31518_32183 217
870 3300046678 Ga0495599_0068119 Ga0495599_0068119_1546_2202 217
871 3300046678 Ga0495599_0077061 Ga0495599_0077061_588_1241 217
872 3300046678 Ga0495599_0291554 Ga0495599_0291554_308_961 217
873 3300046679 Ga0495623_0001241 Ga0495623_0001241_11630_12283 217
874 3300046679 Ga0495623_0001591 Ga0495623_0001591_12715_13374 217
875 3300046679 Ga0495623_0138585 Ga0495623_0138585_634_1287 217
876 3300046680 Ga0495646_0001764 Ga0495646_0001764_3797_4453 217
877 3300046680 Ga0495646_0003339 Ga0495646_0003339_6931_7584 217
878 3300046680 Ga0495646_0014182 Ga0495646_0014182_4229_4882 217
879 3300046680 Ga0495646_0020151 Ga0495646_0020151_1797_2456 217
880 3300046680 Ga0495646_0101339 Ga0495646_0101339_947_1600 217
881 3300046681 Ga0495647_0008851 Ga0495647_0008851_675_1328 217
882 3300046683 Ga0495658_0023929 Ga0495658_0023929_86_739 217
883 3300046689 Ga0495613_0010481 Ga0495613_0010481_2020_2673 217
884 3300046689 Ga0495613_0092657 Ga0495613_0092657_1291_1944 217
885 3300046689 Ga0495613_0260163 Ga0495613_0260163_433_1086 217
886 3300046690 Ga0495624_0001086 Ga0495624_0001086_6592_7248 217
887 3300046690 Ga0495624_0034561 Ga0495624_0034561_1911_2564 217
888 3300046692 Ga0495671_0180625 Ga0495671_0180625_331_984 217
889 3300046694 Ga0495649_0003924 Ga0495649_0003924_8972_9628 217
890 3300046694 Ga0495649_0015531 Ga0495649_0015531_2586_3245 217
891 3300046694 Ga0495649_0026116 Ga0495649_0026116_421_1080 217
892 3300046694 Ga0495649_0058880 Ga0495649_0058880_1315_2058 217
893 3300046794 Ga0495589_0004136 Ga0495589_0004136_4664_5317 217
894 3300046794 Ga0495589_0010883 Ga0495589_0010883_60_716 217
895 3300046794 Ga0495589_0104796 Ga0495589_0104796_53_712 217
896 3300046794 Ga0495589_0283342 Ga0495589_0283342_30_686 217
897 3300046809 Ga0495600_0007472 Ga0495600_0007472_1151_1804 217
898 3300046809 Ga0495600_0011407 Ga0495600_0011407_3226_3885 217
899 3300046809 Ga0495600_0014208 Ga0495600_0014208_2148_2801 217
900 3300046810 Ga0495660_0012233 Ga0495660_0012233_860_1513 217
901 3300047315 Ga0495581_0004254 Ga0495581_0004254_5378_6031 217
902 3300047315 Ga0495581_0013486 Ga0495581_0013486_393_1052 217
903 3300047315 Ga0495581_0020822 Ga0495581_0020822_2551_3204 217
904 3300047317 Ga0495604_0003840 Ga0495604_0003840_3360_4016 217
905 3300047317 Ga0495604_0004609 Ga0495604_0004609_8135_8788 217
906 3300047317 Ga0495604_0037997 Ga0495604_0037997_1626_2279 217
907 3300047317 Ga0495604_0067069 Ga0495604_0067069_1149_1808 217
908 3300047317 Ga0495604_0078914 Ga0495604_0078914_1075_1728 217
909 3300047319 Ga0495674_0003055 Ga0495674_0003055_6338_6991 217
910 3300047319 Ga0495674_0003130 Ga0495674_0003130_10131_10784 217
911 3300047319 Ga0495674_0030343 Ga0495674_0030343_2383_3036 217
912 3300047320 Ga0495672_0005687 Ga0495672_0005687_702_1355 217
913 3300047320 Ga0495672_0013269 Ga0495672_0013269_4857_5600 217
914 3300047320 Ga0495672_0199507 Ga0495672_0199507_108_764 217
915 3300047321 Ga0495676_0011001 Ga0495676_0011001_305_964 217
916 3300047322 Ga0495680_0001302 Ga0495680_0001302_1180_1833 217
917 3300047322 Ga0495680_0003003 Ga0495680_0003003_8020_8673 217
918 3300047322 Ga0495680_0021279 Ga0495680_0021279_1065_1718 217
919 3300047322 Ga0495680_0021591 Ga0495680_0021591_4651_5307 217
920 3300047322 Ga0495680_0045279 Ga0495680_0045279_647_1300 217
921 3300047322 Ga0495680_0049107 Ga0495680_0049107_482_1138 217
922 3300047323 Ga0495683_0002414 Ga0495683_0002414_6490_7146 217
923 3300047323 Ga0495683_0012338 Ga0495683_0012338_3405_4064 217
924 3300047323 Ga0495683_0017289 Ga0495683_0017289_236_895 217
925 3300047443 Ga0495687_000029 Ga0495687_000029_8140_8796 217
926 3300047443 Ga0495687_005545 Ga0495687_005545_286_939 217
927 3300047443 Ga0495687_012506 Ga0495687_012506_2535_3194 217
928 3300047443 Ga0495687_015266 Ga0495687_015266_2169_2912 217
929 3300047444 Ga0495675_0014968 Ga0495675_0014968_1655_2308 217
930 3300047444 Ga0495675_0021231 Ga0495675_0021231_2150_2803 217
931 3300047444 Ga0495675_0080414 Ga0495675_0080414_422_1081 217
932 3300047444 Ga0495675_0239590 Ga0495675_0239590_261_914 217
933 3300047469 Ga0495673_0000426 Ga0495673_0000426_13239_13892 217
934 3300047469 Ga0495673_0012569 Ga0495673_0012569_3660_4313 217
935 3300047469 Ga0495673_0034361 Ga0495673_0034361_1005_1748 217
936 3300047470 Ga0495681_0004331 Ga0495681_0004331_7709_8362 217
937 3300047472 Ga0495686_0001282 Ga0495686_0001282_4359_5012 217
938 3300047472 Ga0495686_0013767 Ga0495686_0013767_388_1041 217
939 3300047673 Ga0495593_0002283 Ga0495593_0002283_41_697 217
940 3300047673 Ga0495593_0003295 Ga0495593_0003295_1713_2366 217
941 3300047673 Ga0495593_0008272 Ga0495593_0008272_4116_4775 217
942 3300047673 Ga0495593_0020592 Ga0495593_0020592_2006_2659 217
943 3300048088 Ga0495602_0000575 Ga0495602_0000575_10801_11457 217
944 3300048088 Ga0495602_0026341 Ga0495602_0026341_2905_3564 217
945 3300048088 Ga0495602_0101434 Ga0495602_0101434_607_1260 217
946 3300048089 Ga0495614_0009952 Ga0495614_0009952_776_1435 217
947 3300048089 Ga0495614_0032145 Ga0495614_0032145_150_806 217
948 3300048089 Ga0495614_0133392 Ga0495614_0133392_220_873 217
949 3300048091 Ga0495626_0090571 Ga0495626_0090571_310_969 217
950 3300048903 Ga0496100_0002447 Ga0496100_0002447_7044_7697 217
951 3300048903 Ga0496100_0003542 Ga0496100_0003542_539_1192 217
952 3300048903 Ga0496100_0015183 Ga0496100_0015183_2747_3403 217
953 3300048903 Ga0496100_0053719 Ga0496100_0053719_992_1654 217
954 3300048903 Ga0496100_0115862 Ga0496100_0115862_29_691 217
955 3300048903 Ga0496100_0207897 Ga0496100_0207897_734_1390 217
956 3300048904 Ga0496101_0003024 Ga0496101_0003024_2724_3377 217
957 3300048904 Ga0496101_0007849 Ga0496101_0007849_1294_1947 217
958 3300048904 Ga0496101_0008207 Ga0496101_0008207_2827_3483 217
959 3300048904 Ga0496101_0028733 Ga0496101_0028733_1456_2118 217
960 3300048904 Ga0496101_0631377 Ga0496101_0631377_180_833 217
961 3300048905 Ga0496102_0000311 Ga0496102_0000311_21484_22137 217
962 3300048905 Ga0496102_0000743 Ga0496102_0000743_24276_24929 217
963 3300048905 Ga0496102_0031281 Ga0496102_0031281_2947_3600 217
964 3300048905 Ga0496102_0032709 Ga0496102_0032709_604_1260 217
965 3300048906 Ga0496103_0000272 Ga0496103_0000272_15479_16132 217
966 3300048906 Ga0496103_0002440 Ga0496103_0002440_4189_4842 217
967 3300048906 Ga0496103_0151899 Ga0496103_0151899_571_1227 217
968 3300048907 Ga0496104_0010707 Ga0496104_0010707_4544_5206 217
969 3300048907 Ga0496104_0045833 Ga0496104_0045833_2672_3325 217
970 3300048907 Ga0496104_0048629 Ga0496104_0048629_2134_2790 217
971 3300048907 Ga0496104_0604642 Ga0496104_0604642_218_874 217
972 3300048907 Ga0496104_0633370 Ga0496104_0633370_17_679 217
973 3300048908 Ga0496105_0061430 Ga0496105_0061430_1660_2316 217
974 3300048908 Ga0496105_0182429 Ga0496105_0182429_165_827 217
975 3300048909 Ga0496106_0000003 Ga0496106_0000003_144525_145178 217
976 3300048909 Ga0496106_0061592 Ga0496106_0061592_699_1352 217
977 3300048909 Ga0496106_0675141 Ga0496106_0675141_114_770 217
978 3300048910 Ga0496107_0022179 Ga0496107_0022179_219_875 217
979 3300048910 Ga0496107_0110846 Ga0496107_0110846_676_1329 217
980 3300048911 Ga0496108_0081594 Ga0496108_0081594_1820_2476 217
981 3300048912 Ga0496109_0007189 Ga0496109_0007189_7948_8601 217
982 3300048912 Ga0496109_0025770 Ga0496109_0025770_4234_4890 217
983 3300048912 Ga0496109_0234039 Ga0496109_0234039_508_1164 217
984 3300048912 Ga0496109_0800399 Ga0496109_0800399_27_686 217
985 3300048913 Ga0496110_0006170 Ga0496110_0006170_2761_3414 217
986 3300048913 Ga0496110_0070686 Ga0496110_0070686_630_1286 217
987 3300048914 Ga0496111_0001680 Ga0496111_0001680_4090_4746 217
988 3300048915 Ga0496112_0003079 Ga0496112_0003079_66_824 217
989 3300048915 Ga0496112_0013812 Ga0496112_0013812_5892_6545 217
990 3300048915 Ga0496112_0014139 Ga0496112_0014139_6237_6893 217
991 3300048915 Ga0496112_0259728 Ga0496112_0259728_769_1425 217
992 3300048917 Ga0496114_0031593 Ga0496114_0031593_2416_3069 217
993 3300048917 Ga0496114_0181049 Ga0496114_0181049_22_675 217
994 3300048917 Ga0496114_0284879 Ga0496114_0284879_537_1190 217
995 3300048917 Ga0496114_0656298 Ga0496114_0656298_135_788 217
996 3300048918 Ga0496115_0077818 Ga0496115_0077818_73_732 217
997 3300048918 Ga0496115_0164989 Ga0496115_0164989_926_1579 217
998 3300048918 Ga0496115_0356092 Ga0496115_0356092_344_997 217
999 3300048918 Ga0496115_0611880 Ga0496115_0611880_95_754 217
1000 3300048919 Ga0496116_0042732 Ga0496116_0042732_232_885 217
1001 3300048919 Ga0496116_0061076 Ga0496116_0061076_567_1223 217
1002 3300048919 Ga0496116_0114975 Ga0496116_0114975_700_1359 217
1003 3300048919 Ga0496116_0132466 Ga0496116_0132466_235_894 217
1004 3300048920 Ga0496117_0001294 Ga0496117_0001294_28742_29395 217
1005 3300048920 Ga0496117_0001668 Ga0496117_0001668_7886_8539 217
1006 3300048920 Ga0496117_0004782 Ga0496117_0004782_7642_8295 217
1007 3300048920 Ga0496117_0045296 Ga0496117_0045296_2286_2942 217
1008 3300048920 Ga0496117_0074082 Ga0496117_0074082_636_1295 217
1009 3300048920 Ga0496117_0237964 Ga0496117_0237964_250_909 217
1010 3300048921 Ga0496118_0003719 Ga0496118_0003719_5228_5881 217
1011 3300048921 Ga0496118_0008066 Ga0496118_0008066_8038_8691 217
1012 3300048921 Ga0496118_0009825 Ga0496118_0009825_3120_3773 217
1013 3300048921 Ga0496118_0027153 Ga0496118_0027153_1157_1816 217
1014 3300048921 Ga0496118_0033803 Ga0496118_0033803_3049_3708 217
1015 3300048921 Ga0496118_0039900 Ga0496118_0039900_2579_3235 217
1016 3300048922 Ga0496119_0120489 Ga0496119_0120489_777_1433 217
1017 3300048922 Ga0496119_0279544 Ga0496119_0279544_81_734 217
1018 3300048924 Ga0496121_0005839 Ga0496121_0005839_13318_13971 217
1019 3300048924 Ga0496121_0015344 Ga0496121_0015344_3565_4221 217
1020 3300048924 Ga0496121_0033105 Ga0496121_0033105_3020_3673 217
1021 3300048924 Ga0496121_0110134 Ga0496121_0110134_471_1124 217
1022 3300048924 Ga0496121_0184620 Ga0496121_0184620_447_1100 217
1023 3300048925 Ga0496122_0024165 Ga0496122_0024165_62_718 217
1024 3300048926 Ga0496123_0011378 Ga0496123_0011378_5892_6548 217
1025 3300048927 Ga0496124_0045823 Ga0496124_0045823_2726_3382 217
1026 3300048928 Ga0496125_0042195 Ga0496125_0042195_355_1011 217
1027 3300048929 Ga0496126_0000031 Ga0496126_0000031_72879_73532 217
1028 3300048929 Ga0496126_0012131 Ga0496126_0012131_5574_6227 217
1029 3300048929 Ga0496126_0048120 Ga0496126_0048120_871_1527 217
1030 3300048929 Ga0496126_0292276 Ga0496126_0292276_356_1012 217
1031 3300049460 Ga0495682_0032432 Ga0495682_0032432_776_1519 217
1032 3300049522 Ga0501299_041191 Ga0501299_041191_26_682 217
1033 3300049533 Ga0501317_021833 Ga0501317_021833_196_858 217
1034 3300049570 Ga0501033_0006804 Ga0501033_0006804_1788_2444 217
1035 3300049570 Ga0501033_0395976 Ga0501033_0395976_30_683 217
1036 3300049571 Ga0501034_0170194 Ga0501034_0170194_148_804 217
1037 3300049572 Ga0501036_0051302 Ga0501036_0051302_1390_2046 217
1038 3300049574 Ga0501038_0386026 Ga0501038_0386026_288_944 217
1039 3300049578 Ga0501042_0012783 Ga0501042_0012783_1969_2625 217
1040 3300049580 Ga0501046_0039186 Ga0501046_0039186_1947_2603 217
1041 3300049582 Ga0501048_0003630 Ga0501048_0003630_3345_4001 217
1042 3300049582 Ga0501048_0230017 Ga0501048_0230017_299_952 217
1043 3300049586 Ga0501070_0033907 Ga0501070_0033907_271_927 217
1044 3300049587 Ga0501071_0001355 Ga0501071_0001355_1074_1727 217
1045 3300049587 Ga0501071_0111769 Ga0501071_0111769_85_741 217
1046 3300049587 Ga0501071_0320763 Ga0501071_0320763_305_958 217
1047 3300049588 Ga0501072_0053813 Ga0501072_0053813_545_1201 217
1048 3300049588 Ga0501072_0069380 Ga0501072_0069380_1740_2393 217
1049 3300049588 Ga0501072_0124394 Ga0501072_0124394_41_694 217
1050 3300049588 Ga0501072_0257211 Ga0501072_0257211_634_1296 217
1051 3300049589 Ga0501073_0127920 Ga0501073_0127920_660_1313 217
1052 3300049590 Ga0501074_0027381 Ga0501074_0027381_1166_1822 217
1053 3300049591 Ga0501075_0103882 Ga0501075_0103882_559_1212 217
1054 3300049592 Ga0501076_0009098 Ga0501076_0009098_1717_2370 217
1055 3300049592 Ga0501076_0356561 Ga0501076_0356561_172_825 217
1056 3300049592 Ga0501076_0604442 Ga0501076_0604442_205_864 217
1057 3300049593 Ga0501077_0084969 Ga0501077_0084969_1091_1753 217
1058 3300049593 Ga0501077_0145002 Ga0501077_0145002_173_826 217
1059 3300049705 Ga0501225_0032214 Ga0501225_0032214_618_1274 217
1060 3300049741 Ga0501079_0034275 Ga0501079_0034275_3105_3758 217
1061 3300049741 Ga0501079_0053070 Ga0501079_0053070_1978_2631 217
1062 3300049741 Ga0501079_0433297 Ga0501079_0433297_240_959 217
1063 3300049742 Ga0501080_0000704 Ga0501080_0000704_24378_25031 217
1064 3300049742 Ga0501080_0012384 Ga0501080_0012384_3198_3854 217
1065 3300049743 Ga0501081_0016262 Ga0501081_0016262_2550_3203 217
1066 3300049743 Ga0501081_0093469 Ga0501081_0093469_886_1542 217
1067 3300049823 Ga0501044_0059358 Ga0501044_0059358_952_1608 217
1068 3300049824 Ga0501045_0636889 Ga0501045_0636889_115_768 217
1069 3300050491 nmdc:mga00v17_10852_c1 nmdc:mga00v17_10852_c1_741_1400 217
1070 3300050496 nmdc:mga07m45_128547_c1 nmdc:mga07m45_128547_c1_771_1430 217
1071 3300050507 nmdc:mga05p37_15217_c1 nmdc:mga05p37_15217_c1_5436_6098 217
1072 3300050507 nmdc:mga05p37_21530_c1 nmdc:mga05p37_21530_c1_1684_2343 217
1073 3300050507 nmdc:mga05p37_281951_c1 nmdc:mga05p37_281951_c1_1296_1952 217
1074 3300050507 nmdc:mga05p37_315415_c1 nmdc:mga05p37_315415_c1_571_1227 217
1075 3300050508 nmdc:mga09592_246465_c1 nmdc:mga09592_246465_c1_184_840 217
1076 3300050509 nmdc:mga0qj67_267040_c1 nmdc:mga0qj67_267040_c1_489_1145 217
1077 3300050509 nmdc:mga0qj67_500632_c1 nmdc:mga0qj67_500632_c1_245_901 217
1078 3300050510 nmdc:mga06r32_476319_c1 nmdc:mga06r32_476319_c1_330_986 217
1079 3300050511 nmdc:mga08y16_410436_c1 nmdc:mga08y16_410436_c1_344_1000 217
1080 3300050511 nmdc:mga08y16_562513_c1 nmdc:mga08y16_562513_c1_464_1141 217
1081 3300050511 nmdc:mga08y16_70042_c1 nmdc:mga08y16_70042_c1_2417_3073 217
1082 3300050511 nmdc:mga08y16_99277_c1 nmdc:mga08y16_99277_c1_2216_2872 217
1083 3300050512 nmdc:mga0n895_1012_c1 nmdc:mga0n895_1012_c1_14477_15133 217
1084 3300050512 nmdc:mga0n895_196467_c1 nmdc:mga0n895_196467_c1_995_1648 217
1085 3300050512 nmdc:mga0n895_278479_c1 nmdc:mga0n895_278479_c1_756_1412 217
1086 3300050512 nmdc:mga0n895_648041_c1 nmdc:mga0n895_648041_c1_235_1020 217
1087 3300050512 nmdc:mga0n895_8049_c1 nmdc:mga0n895_8049_c1_2098_2856 217
1088 3300050512 nmdc:mga0n895_84240_c1 nmdc:mga0n895_84240_c1_1756_2412 217
1089 3300050512 nmdc:mga0n895_93158_c1 nmdc:mga0n895_93158_c1_141_794 217
1090 3300050513 nmdc:mga0rr50_13011_c1 nmdc:mga0rr50_13011_c1_3788_4444 217
1091 3300050513 nmdc:mga0rr50_746954_c1 nmdc:mga0rr50_746954_c1_116_772 217
1092 3300050513 nmdc:mga0rr50_86529_c1 nmdc:mga0rr50_86529_c1_440_1093 217
1093 3300050513 nmdc:mga0rr50_9949_c1 nmdc:mga0rr50_9949_c1_4842_5600 217
1094 3300050514 nmdc:mga08x19_133991_c1 nmdc:mga08x19_133991_c1_671_1324 217
1095 3300050514 nmdc:mga08x19_146100_c1 nmdc:mga08x19_146100_c1_141_794 217
1096 3300050514 nmdc:mga08x19_434563_c1 nmdc:mga08x19_434563_c1_78_836 217
1097 3300050514 nmdc:mga08x19_85798_c1 nmdc:mga08x19_85798_c1_1351_2004 217
1098 3300050515 nmdc:mga0a205_240792_c1 nmdc:mga0a205_240792_c1_77_733 217
1099 3300050515 nmdc:mga0a205_259789_c1 nmdc:mga0a205_259789_c1_50_703 217
1100 3300050515 nmdc:mga0a205_428606_c1 nmdc:mga0a205_428606_c1_455_1108 217
1101 3300050515 nmdc:mga0a205_482384_c1 nmdc:mga0a205_482384_c1_235_891 217
1102 3300050515 nmdc:mga0a205_542809_c1 nmdc:mga0a205_542809_c1_175_831 217
1103 3300050515 nmdc:mga0a205_5463_c1 nmdc:mga0a205_5463_c1_7036_7692 217
1104 3300053077 Ga0495601_0002609 Ga0495601_0002609_1719_2372 217
1105 3300053078 Ga0495612_0021748 Ga0495612_0021748_216_911 217
1106 3300053083 Ga0495655_0029270 Ga0495655_0029270_561_1220 217
1107 3300053084 Ga0495595_0005162 Ga0495595_0005162_2381_3034 217
1108 3300053085 Ga0495619_0018499 Ga0495619_0018499_2814_3467 217
1109 3300053096 Ga0500641_0004322 Ga0500641_0004322_2990_3649 217
1110 3300053142 Ga0500577_0000643 Ga0500577_0000643_1988_2647 217
1111 3300054114 Ga0501084_0199802 Ga0501084_0199802_906_1565 217
1112 3300054114 Ga0501084_0550663 Ga0501084_0550663_306_959 217
1113 3300059506 Ga0587085_015536 Ga0587085_015536_202_861 217
1114 3300059639 Ga0587062_030904 Ga0587062_030904_77_730 217
1115 3300060353 Ga0501082_0005433 Ga0501082_0005433_6438_7094 217
1116 3300060353 Ga0501082_0057150 Ga0501082_0057150_822_1484 217
1117 3300060353 Ga0501082_0302479 Ga0501082_0302479_52_705 217
1118 3300061719 Ga0466962_0001368 Ga0466962_0001368_7131_7784 217
1119 3300061719 Ga0466962_0016467 Ga0466962_0016467_206_859 217
1120 3300061734 Ga0530510_0000443 Ga0530510_0000443_4891_5544 217
1121 3300061734 Ga0530510_0184217 Ga0530510_0184217_566_1228 217
1122 3300061734 Ga0530510_0198607 Ga0530510_0198607_282_935 217
1123 3300061734 Ga0530510_0199114 Ga0530510_0199114_810_1463 217
1124 3300061734 Ga0530510_0213823 Ga0530510_0213823_364_1083 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

49

187

0.97

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

207

246

0.96

PF08534

Redoxin

Redoxin

48

205

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.967 3 217
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9632 3 217
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9623 3 217
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9539 3 217
5ykj-assembly1.cif.gz_A structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems 0.9435 3 214
ID Description Score Start End Superfamily
af_P34227_199_260_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9796 153 214 3.30.1020.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9635 5 106 3.40.30.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9609 153 216 3.30.1020.10
af_P34227_199_260_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9491 153 214 3.30.1020.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9467 153 216 3.30.1020.10

Feature Viewer

pLDDT pTM Quality
91 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map