F490284
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1114 | 452 | 2228 | 89 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0178205|Ga0451577_0178205_469_804 |
| Length | 111 |
| Sequence | MKKLWHFSGTLAYLLKILKTNYMAKISMVAREVKRARLTKKYAAKRAQLKADGDYVGLSRLPRNSNPNRMHNRCKLTGRPRGYMRQFGISRITFREMASAGLLPGVKKASW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 12 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 13 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 15 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 19 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 20 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 21 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 22 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 27 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 28 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 31 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 81 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 82 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 83 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 127 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 133 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 182 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 183 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 190 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 194 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 196 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 197 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 199 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 200 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 201 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 203 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 205 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 206 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 207 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 208 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 209 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 211 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 212 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 214 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 215 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 216 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 217 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 218 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 222 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 223 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 224 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 225 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 227 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 228 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 235 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 237 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 238 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 239 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 240 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 241 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 242 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 243 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 244 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 245 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 246 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 247 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 248 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 249 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 250 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 251 | 3300041442 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT | Metatranscriptome | Rhizoplane |
| 252 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 253 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 254 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 261 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041464 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT | Metatranscriptome | Rhizoplane |
| 263 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 265 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 266 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 267 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 268 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 269 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 270 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 271 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 272 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 273 | 3300041508 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT | Metatranscriptome | Unclassified |
| 274 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 275 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 276 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 277 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 278 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 279 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 280 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 281 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 282 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 283 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 284 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 285 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 286 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 287 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 288 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 351 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 352 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 353 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 354 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 355 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 356 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 357 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 358 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 359 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 360 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 361 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 362 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 363 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 364 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 365 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 366 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300049163 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 377 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 409 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 410 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 411 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 412 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 413 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 414 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 415 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 416 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 417 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 419 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 420 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 421 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 422 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 423 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 424 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 425 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 426 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 427 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 428 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 429 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 430 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 431 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 432 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 433 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 434 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 435 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 436 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 437 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 438 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 439 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 440 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 441 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.59 |
| Metatranscriptomes | 17.41 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.83 |
| Nodule | 0.54 |
| Rhizoplane | 3.5 |
| Rhizosphere | 83.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451577_0178205 | 3300042876 | Bacteria | 1916 |
| 2 | SwRhRL2b_contig_1391765 | 2162886007 | Bacteria | 1163 |
| 3 | SwRhRL2b_contig_2038936 | 2162886007 | Bacteria | 3057 |
| 4 | SwRhRL2b_contig_2621326 | 2162886007 | Bacteria | 1429 |
| 5 | 2214878535 | 2209111006 | Bacteria | 1511 |
| 6 | JGI24736J21556_1006132 | 3300001904 | Bacteria | 2027 |
| 7 | JGI24740J21852_10022671 | 3300001979 | Bacteria | 2157 |
| 8 | JGI24739J22299_10026719 | 3300001989 | Bacteria | 2023 |
| 9 | JGI24737J22298_10001191 | 3300001990 | Bacteria | 9175 |
| 10 | JGI24737J22298_10001354 | 3300001990 | Bacteria | 8678 |
| 11 | JGI24737J22298_10015413 | 3300001990 | Bacteria | 2474 |
| 12 | JGI24743J22301_10059010 | 3300001991 | Bacteria | 789 |
| 13 | JGI24735J21928_10000003 | 3300002067 | Bacteria | 385983 |
| 14 | JGI24735J21928_10001634 | 3300002067 | Bacteria | 7935 |
| 15 | JGI24744J21845_10004519 | 3300002077 | Bacteria | 2874 |
| 16 | JGI25162J39368_1001033 | 3300002737 | Bacteria | 17196 |
| 17 | JGI25157J39369_1003626 | 3300002741 | Bacteria | 3071 |
| 18 | JGI25157J39369_1021922 | 3300002741 | Bacteria | 757 |
| 19 | JGI25164J39214_1001287 | 3300002772 | Bacteria | 6416 |
| 20 | JGI25150J39212_1000005 | 3300002774 | Bacteria | 311800 |
| 21 | JGI25151J46595_10000004 | 3300003187 | Bacteria | 494006 |
| 22 | JGI25165J46597_1000678 | 3300003214 | Bacteria | 27401 |
| 23 | JGI25153J46596_10000004 | 3300003215 | Bacteria | 494006 |
| 24 | rootH1_10027299 | 3300003316 | Bacteria | 5608 |
| 25 | rootH2_10026380 | 3300003320 | Bacteria | 6469 |
| 26 | rootH1_10031050 | 3300003323 | Bacteria | 1887 |
| 27 | rootH1_10127399 | 3300003323 | Bacteria | 5374 |
| 28 | Ga0006562J51391_1003423 | 3300003578 | Bacteria | 13910 |
| 29 | Ga0006562J51391_1011740 | 3300003578 | Bacteria | 7760 |
| 30 | Ga0032354_1086718 | 3300003693 | Bacteria | 2098 |
| 31 | Ga0055536_1000004 | 3300003781 | Bacteria | 411108 |
| 32 | Ga0055534_1007293 | 3300003784 | Bacteria | 2655 |
| 33 | Ga0055530_10000817 | 3300003791 | Bacteria | 25836 |
| 34 | Ga0058860_10114316 | 3300004801 | Bacteria | 13584 |
| 35 | Ga0058860_10168396 | 3300004801 | Bacteria | 5311 |
| 36 | Ga0058862_12658366 | 3300004803 | Bacteria | 706 |
| 37 | Ga0065714_10040382 | 3300005288 | Bacteria | 588 |
| 38 | Ga0065714_10040779 | 3300005288 | Bacteria | 563 |
| 39 | Ga0065714_10107298 | 3300005288 | Bacteria | 1534 |
| 40 | Ga0065714_10173528 | 3300005288 | Bacteria | 993 |
| 41 | Ga0065714_10221279 | 3300005288 | Bacteria | 829 |
| 42 | Ga0065714_10353854 | 3300005288 | Bacteria | 621 |
| 43 | Ga0065714_10539759 | 3300005288 | Bacteria | 503 |
| 44 | Ga0065704_10004895 | 3300005289 | Bacteria | 3134 |
| 45 | Ga0065704_10025200 | 3300005289 | Bacteria | 1399 |
| 46 | Ga0065704_10025682 | 3300005289 | Bacteria | 1117 |
| 47 | Ga0065704_10084598 | 3300005289 | Bacteria | 3318 |
| 48 | Ga0065704_10086392 | 3300005289 | Bacteria | 3122 |
| 49 | Ga0065704_10103057 | 3300005289 | Bacteria | 2184 |
| 50 | Ga0065704_10117941 | 3300005289 | Bacteria | 1825 |
| 51 | Ga0065704_10120513 | 3300005289 | Bacteria | 1781 |
| 52 | Ga0065712_10346876 | 3300005290 | Bacteria | 747 |
| 53 | Ga0065715_10036812 | 3300005293 | Bacteria | 920 |
| 54 | Ga0065715_10050529 | 3300005293 | Bacteria | 684 |
| 55 | Ga0065715_10313424 | 3300005293 | Bacteria | 1012 |
| 56 | Ga0065715_10383148 | 3300005293 | Bacteria | 901 |
| 57 | Ga0065715_10594734 | 3300005293 | Bacteria | 711 |
| 58 | Ga0065715_10960039 | 3300005293 | Bacteria | 556 |
| 59 | Ga0065715_11046998 | 3300005293 | Bacteria | 533 |
| 60 | Ga0065707_10812159 | 3300005295 | Bacteria | 595 |
| 61 | Ga0070658_10000153 | 3300005327 | Bacteria | 60625 |
| 62 | Ga0070658_10017037 | 3300005327 | Bacteria | 5815 |
| 63 | Ga0070658_11009790 | 3300005327 | Bacteria | 724 |
| 64 | Ga0070658_11689079 | 3300005327 | Bacteria | 548 |
| 65 | Ga0070676_10000312 | 3300005328 | Bacteria | 21945 |
| 66 | Ga0070683_100016581 | 3300005329 | Bacteria | 6501 |
| 67 | Ga0070683_101606167 | 3300005329 | Bacteria | 625 |
| 68 | Ga0070670_100462742 | 3300005331 | Bacteria | 1125 |
| 69 | Ga0068869_100334597 | 3300005334 | Bacteria | 1231 |
| 70 | Ga0070682_100000768 | 3300005337 | Bacteria | 18980 |
| 71 | Ga0070682_100016944 | 3300005337 | Bacteria | 4241 |
| 72 | Ga0070682_101864756 | 3300005337 | Bacteria | 526 |
| 73 | Ga0068868_100075253 | 3300005338 | Bacteria | 2698 |
| 74 | Ga0068868_100542515 | 3300005338 | Bacteria | 1024 |
| 75 | Ga0070660_100037879 | 3300005339 | Bacteria | 3657 |
| 76 | Ga0070660_100077147 | 3300005339 | Bacteria | 2611 |
| 77 | Ga0070661_101790661 | 3300005344 | Bacteria | 521 |
| 78 | Ga0070668_100087717 | 3300005347 | Bacteria | 2448 |
| 79 | Ga0070669_100220816 | 3300005353 | Unclassified | 1498 |
| 80 | Ga0070669_100549346 | 3300005353 | Bacteria | 963 |
| 81 | Ga0070671_100072627 | 3300005355 | Bacteria | 2874 |
| 82 | Ga0070671_101700508 | 3300005355 | Bacteria | 560 |
| 83 | Ga0070673_100071544 | 3300005364 | Bacteria | 2787 |
| 84 | Ga0070673_101458771 | 3300005364 | Bacteria | 645 |
| 85 | Ga0070659_100000375 | 3300005366 | Bacteria | 33764 |
| 86 | Ga0070659_100008718 | 3300005366 | Bacteria | 7421 |
| 87 | Ga0070659_100059763 | 3300005366 | Bacteria | 3009 |
| 88 | Ga0070667_100668488 | 3300005367 | Bacteria | 960 |
| 89 | Ga0070667_100748238 | 3300005367 | Bacteria | 906 |
| 90 | Ga0070710_11256102 | 3300005437 | Bacteria | 549 |
| 91 | Ga0070700_101068945 | 3300005441 | Bacteria | 667 |
| 92 | Ga0070700_101808060 | 3300005441 | Bacteria | 526 |
| 93 | Ga0070663_100193699 | 3300005455 | Bacteria | 1583 |
| 94 | Ga0070663_100366341 | 3300005455 | Bacteria | 1170 |
| 95 | Ga0070678_100001208 | 3300005456 | Bacteria | 13700 |
| 96 | Ga0070678_100700213 | 3300005456 | Bacteria | 913 |
| 97 | Ga0070662_100000074 | 3300005457 | Bacteria | 54943 |
| 98 | Ga0068867_100001333 | 3300005459 | Bacteria | 17102 |
| 99 | Ga0070685_10022774 | 3300005466 | Bacteria | 3420 |
| 100 | Ga0070685_11318106 | 3300005466 | Bacteria | 552 |
| 101 | Ga0070685_11403748 | 3300005466 | Bacteria | 536 |
| 102 | Ga0070679_100507017 | 3300005530 | Bacteria | 1150 |
| 103 | Ga0070684_100023266 | 3300005535 | Bacteria | 5179 |
| 104 | Ga0068853_100047949 | 3300005539 | Bacteria | 3667 |
| 105 | Ga0068853_100103368 | 3300005539 | Bacteria | 2522 |
| 106 | Ga0068853_100135737 | 3300005539 | Bacteria | 2205 |
| 107 | Ga0068853_102162152 | 3300005539 | Bacteria | 539 |
| 108 | Ga0070672_100588415 | 3300005543 | Bacteria | 968 |
| 109 | Ga0070693_100077579 | 3300005547 | Bacteria | 1972 |
| 110 | Ga0070693_100735546 | 3300005547 | Bacteria | 726 |
| 111 | Ga0070665_100000372 | 3300005548 | Bacteria | 66748 |
| 112 | Ga0068855_100136893 | 3300005563 | Bacteria | 2793 |
| 113 | Ga0068855_100610858 | 3300005563 | Bacteria | 1175 |
| 114 | Ga0068855_100614523 | 3300005563 | Bacteria | 1171 |
| 115 | Ga0068855_101246797 | 3300005563 | Bacteria | 771 |
| 116 | Ga0068855_102200323 | 3300005563 | Bacteria | 554 |
| 117 | Ga0068857_100038490 | 3300005577 | Bacteria | 4236 |
| 118 | Ga0068857_100950569 | 3300005577 | Bacteria | 826 |
| 119 | Ga0068857_101388224 | 3300005577 | Bacteria | 683 |
| 120 | Ga0068854_100102342 | 3300005578 | Bacteria | 2149 |
| 121 | Ga0068856_100004718 | 3300005614 | Bacteria | 13531 |
| 122 | Ga0068856_101236713 | 3300005614 | Bacteria | 763 |
| 123 | Ga0068852_100014590 | 3300005616 | Bacteria | 6055 |
| 124 | Ga0068852_100126825 | 3300005616 | Bacteria | 2345 |
| 125 | Ga0068852_102153316 | 3300005616 | Bacteria | 579 |
| 126 | Ga0068861_101702480 | 3300005719 | Bacteria | 624 |
| 127 | Ga0068851_10000177 | 3300005834 | Bacteria | 31928 |
| 128 | Ga0068870_10131307 | 3300005840 | Bacteria | 1455 |
| 129 | Ga0068858_100232757 | 3300005842 | Bacteria | 1747 |
| 130 | Ga0075363_100573991 | 3300006048 | Bacteria | 674 |
| 131 | Ga0075364_11083637 | 3300006051 | Bacteria | 544 |
| 132 | Ga0070716_100099735 | 3300006173 | Bacteria | 1778 |
| 133 | Ga0075362_10019709 | 3300006177 | Bacteria | 2809 |
| 134 | Ga0075427_10091689 | 3300006194 | Bacteria | 558 |
| 135 | Ga0075366_10000284 | 3300006195 | Bacteria | 22680 |
| 136 | Ga0075366_10038131 | 3300006195 | Bacteria | 2838 |
| 137 | Ga0075366_10309057 | 3300006195 | Bacteria | 968 |
| 138 | Ga0097621_100007799 | 3300006237 | Bacteria | 7678 |
| 139 | Ga0097621_100105361 | 3300006237 | Bacteria | 2377 |
| 140 | Ga0075370_10041535 | 3300006353 | Bacteria | 2596 |
| 141 | Ga0075370_10051332 | 3300006353 | Bacteria | 2339 |
| 142 | Ga0068871_100000141 | 3300006358 | Bacteria | 46656 |
| 143 | Ga0068871_100017988 | 3300006358 | Bacteria | 5361 |
| 144 | Ga0068865_100000917 | 3300006881 | Bacteria | 16715 |
| 145 | Ga0068865_100239427 | 3300006881 | Bacteria | 1427 |
| 146 | Ga0099824_1003374 | 3300006942 | Bacteria | 23361 |
| 147 | Ga0079104_1000280 | 3300006946 | Bacteria | 65859 |
| 148 | Ga0099826_10000125 | 3300006948 | Bacteria | 34471 |
| 149 | Ga0105251_10027494 | 3300009011 | Bacteria | 2883 |
| 150 | Ga0105251_10187951 | 3300009011 | Bacteria | 930 |
| 151 | Ga0105251_10362266 | 3300009011 | Bacteria | 663 |
| 152 | Ga0105251_10609668 | 3300009011 | Bacteria | 519 |
| 153 | Ga0105244_10000005 | 3300009036 | Bacteria | 481412 |
| 154 | Ga0105244_10017933 | 3300009036 | Bacteria | 3985 |
| 155 | Ga0105244_10021607 | 3300009036 | Bacteria | 3557 |
| 156 | Ga0105250_10010102 | 3300009092 | Bacteria | 3941 |
| 157 | Ga0105240_10041987 | 3300009093 | Bacteria | 5831 |
| 158 | Ga0105240_10442980 | 3300009093 | Bacteria | 1455 |
| 159 | Ga0105240_10635498 | 3300009093 | Bacteria | 1172 |
| 160 | Ga0105240_11252228 | 3300009093 | Bacteria | 784 |
| 161 | Ga0105240_11703708 | 3300009093 | Bacteria | 658 |
| 162 | Ga0105240_12585689 | 3300009093 | Bacteria | 524 |
| 163 | Ga0105240_12724179 | 3300009093 | Bacteria | 509 |
| 164 | Ga0111539_13514179 | 3300009094 | Bacteria | 503 |
| 165 | Ga0105245_10361405 | 3300009098 | Bacteria | 1441 |
| 166 | Ga0105245_10363352 | 3300009098 | Bacteria | 1437 |
| 167 | Ga0105247_10604263 | 3300009101 | Bacteria | 814 |
| 168 | Ga0105243_10000009 | 3300009148 | Bacteria | 354419 |
| 169 | Ga0105243_10077834 | 3300009148 | Bacteria | 2699 |
| 170 | Ga0105243_10085327 | 3300009148 | Bacteria | 2588 |
| 171 | Ga0105241_10009907 | 3300009174 | Bacteria | 7004 |
| 172 | Ga0105241_10139680 | 3300009174 | Bacteria | 1971 |
| 173 | Ga0105242_10045059 | 3300009176 | Bacteria | 3574 |
| 174 | Ga0105242_10066602 | 3300009176 | Bacteria | 2975 |
| 175 | Ga0105242_10066640 | 3300009176 | Bacteria | 2975 |
| 176 | Ga0105242_10083836 | 3300009176 | Bacteria | 2670 |
| 177 | Ga0105242_10781079 | 3300009176 | Bacteria | 943 |
| 178 | Ga0105237_10022954 | 3300009545 | Bacteria | 6399 |
| 179 | Ga0105237_10055807 | 3300009545 | Bacteria | 3956 |
| 180 | Ga0105237_10187238 | 3300009545 | Bacteria | 2070 |
| 181 | Ga0105237_10264787 | 3300009545 | Bacteria | 1722 |
| 182 | Ga0105237_10294383 | 3300009545 | Bacteria | 1626 |
| 183 | Ga0105237_11657314 | 3300009545 | Bacteria | 647 |
| 184 | Ga0105237_11731455 | 3300009545 | Bacteria | 632 |
| 185 | Ga0105238_10017754 | 3300009551 | Bacteria | 7234 |
| 186 | Ga0105238_10328852 | 3300009551 | Bacteria | 1515 |
| 187 | Ga0105238_10639563 | 3300009551 | Bacteria | 1073 |
| 188 | Ga0105249_10086789 | 3300009553 | Bacteria | 2918 |
| 189 | Ga0105249_10152965 | 3300009553 | Unclassified | 2223 |
| 190 | Ga0105239_10000011 | 3300010375 | Bacteria | 337500 |
| 191 | Ga0105239_10004149 | 3300010375 | Bacteria | 17397 |
| 192 | Ga0105239_10051636 | 3300010375 | Bacteria | 4507 |
| 193 | Ga0105239_10274203 | 3300010375 | Bacteria | 1898 |
| 194 | Ga0105239_12917918 | 3300010375 | Bacteria | 558 |
| 195 | Ga0105246_10286675 | 3300011119 | Bacteria | 1323 |
| 196 | Ga0105246_10663353 | 3300011119 | Bacteria | 909 |
| 197 | Ga0157339_1068994 | 3300012505 | Bacteria | 506 |
| 198 | Ga0157373_10001369 | 3300013100 | Bacteria | 18710 |
| 199 | Ga0157373_10014797 | 3300013100 | Bacteria | 5716 |
| 200 | Ga0157373_10018712 | 3300013100 | Bacteria | 5041 |
| 201 | Ga0157373_10021916 | 3300013100 | Bacteria | 4636 |
| 202 | Ga0157373_10056873 | 3300013100 | Bacteria | 2776 |
| 203 | Ga0157373_10454258 | 3300013100 | Bacteria | 922 |
| 204 | Ga0157373_10945416 | 3300013100 | Bacteria | 641 |
| 205 | Ga0157371_10000041 | 3300013102 | Bacteria | 203957 |
| 206 | Ga0157371_10000091 | 3300013102 | Bacteria | 144664 |
| 207 | Ga0157371_10001664 | 3300013102 | Bacteria | 22687 |
| 208 | Ga0157371_10001678 | 3300013102 | Bacteria | 22612 |
| 209 | Ga0157371_10011325 | 3300013102 | Bacteria | 6881 |
| 210 | Ga0157371_10152177 | 3300013102 | Bacteria | 1650 |
| 211 | Ga0157371_10923752 | 3300013102 | Bacteria | 663 |
| 212 | Ga0157370_10019720 | 3300013104 | Bacteria | 6751 |
| 213 | Ga0157370_10019865 | 3300013104 | Bacteria | 6722 |
| 214 | Ga0157370_10050897 | 3300013104 | Bacteria | 3958 |
| 215 | Ga0157370_10061399 | 3300013104 | Bacteria | 3567 |
| 216 | Ga0157370_10082740 | 3300013104 | Bacteria | 3019 |
| 217 | Ga0157370_10103183 | 3300013104 | Bacteria | 2670 |
| 218 | Ga0157370_10136293 | 3300013104 | Bacteria | 2288 |
| 219 | Ga0157370_10198056 | 3300013104 | Bacteria | 1864 |
| 220 | Ga0157370_10205503 | 3300013104 | Bacteria | 1826 |
| 221 | Ga0157370_10241805 | 3300013104 | Bacteria | 1670 |
| 222 | Ga0157370_10433480 | 3300013104 | Bacteria | 1209 |
| 223 | Ga0157370_10461645 | 3300013104 | Bacteria | 1167 |
| 224 | Ga0157370_10491794 | 3300013104 | Bacteria | 1127 |
| 225 | Ga0157370_10581815 | 3300013104 | Bacteria | 1026 |
| 226 | Ga0157370_10823713 | 3300013104 | Bacteria | 844 |
| 227 | Ga0157370_11746104 | 3300013104 | Bacteria | 558 |
| 228 | Ga0157370_11758029 | 3300013104 | Bacteria | 556 |
| 229 | Ga0157369_10000023 | 3300013105 | Bacteria | 226955 |
| 230 | Ga0157369_10000613 | 3300013105 | Bacteria | 46357 |
| 231 | Ga0157369_10007412 | 3300013105 | Bacteria | 12631 |
| 232 | Ga0157369_10010007 | 3300013105 | Bacteria | 10831 |
| 233 | Ga0157369_10011350 | 3300013105 | Bacteria | 10117 |
| 234 | Ga0157369_10068434 | 3300013105 | Bacteria | 3815 |
| 235 | Ga0157369_10134645 | 3300013105 | Bacteria | 2616 |
| 236 | Ga0157374_10080845 | 3300013296 | Bacteria | 3083 |
| 237 | Ga0157374_10083204 | 3300013296 | Bacteria | 3040 |
| 238 | Ga0157374_10109918 | 3300013296 | Bacteria | 2651 |
| 239 | Ga0157374_12941374 | 3300013296 | Bacteria | 503 |
| 240 | Ga0157378_10008303 | 3300013297 | Bacteria | 9048 |
| 241 | Ga0157378_10163750 | 3300013297 | Bacteria | 2082 |
| 242 | Ga0157378_10207177 | 3300013297 | Bacteria | 1858 |
| 243 | Ga0157378_10377844 | 3300013297 | Bacteria | 1391 |
| 244 | Ga0157378_11992814 | 3300013297 | Bacteria | 630 |
| 245 | Ga0163162_10001202 | 3300013306 | Bacteria | 24155 |
| 246 | Ga0163162_10022452 | 3300013306 | Bacteria | 6216 |
| 247 | Ga0163162_10043233 | 3300013306 | Bacteria | 4511 |
| 248 | Ga0163162_10079118 | 3300013306 | Bacteria | 3353 |
| 249 | Ga0163162_10469381 | 3300013306 | Bacteria | 1390 |
| 250 | Ga0163162_12180192 | 3300013306 | Bacteria | 636 |
| 251 | Ga0157372_10001364 | 3300013307 | Bacteria | 26417 |
| 252 | Ga0157372_10011651 | 3300013307 | Bacteria | 9360 |
| 253 | Ga0157372_11168352 | 3300013307 | Bacteria | 890 |
| 254 | Ga0157372_12894872 | 3300013307 | Bacteria | 550 |
| 255 | Ga0157375_10066260 | 3300013308 | Bacteria | 3604 |
| 256 | Ga0157375_10099282 | 3300013308 | Bacteria | 2990 |
| 257 | Ga0157375_10111014 | 3300013308 | Bacteria | 2840 |
| 258 | Ga0157375_10448617 | 3300013308 | Bacteria | 1455 |
| 259 | Ga0157375_10629371 | 3300013308 | Bacteria | 1230 |
| 260 | Ga0163163_10506767 | 3300014325 | Bacteria | 1269 |
| 261 | Ga0163163_12180082 | 3300014325 | Bacteria | 613 |
| 262 | Ga0157380_10141735 | 3300014326 | Bacteria | 2066 |
| 263 | Ga0182008_10000003 | 3300014497 | Bacteria | 456880 |
| 264 | Ga0182008_10000600 | 3300014497 | Bacteria | 26471 |
| 265 | Ga0182008_10480849 | 3300014497 | Bacteria | 680 |
| 266 | Ga0182008_10503206 | 3300014497 | Bacteria | 666 |
| 267 | Ga0157377_10016958 | 3300014745 | Bacteria | 3758 |
| 268 | Ga0157376_10225806 | 3300014969 | Bacteria | 1737 |
| 269 | Ga0157376_10782151 | 3300014969 | Bacteria | 966 |
| 270 | Ga0157376_11196307 | 3300014969 | Bacteria | 788 |
| 271 | Ga0157376_11681224 | 3300014969 | Bacteria | 670 |
| 272 | Ga0157376_11909493 | 3300014969 | Bacteria | 631 |
| 273 | Ga0182006_1000001 | 3300015261 | Bacteria | 1091090 |
| 274 | Ga0182006_1013176 | 3300015261 | Bacteria | 3594 |
| 275 | Ga0182006_1032965 | 3300015261 | Bacteria | 2079 |
| 276 | Ga0182006_1062258 | 3300015261 | Bacteria | 1404 |
| 277 | Ga0182006_1070319 | 3300015261 | Bacteria | 1299 |
| 278 | Ga0182006_1130340 | 3300015261 | Bacteria | 866 |
| 279 | Ga0182006_1131768 | 3300015261 | Bacteria | 860 |
| 280 | Ga0182007_10000002 | 3300015262 | Bacteria | 564661 |
| 281 | Ga0182007_10012229 | 3300015262 | Bacteria | 3309 |
| 282 | Ga0182007_10043758 | 3300015262 | Bacteria | 1487 |
| 283 | Ga0183373_1004 | 3300015682 | Bacteria | 537398 |
| 284 | Ga0163161_10000039 | 3300017792 | Bacteria | 148130 |
| 285 | Ga0163161_10085599 | 3300017792 | Bacteria | 2325 |
| 286 | Ga0163161_10087878 | 3300017792 | Bacteria | 2297 |
| 287 | Ga0163161_10276760 | 3300017792 | Bacteria | 1315 |
| 288 | Ga0163161_10660535 | 3300017792 | Bacteria | 867 |
| 289 | Ga0163161_11145722 | 3300017792 | Bacteria | 670 |
| 290 | Ga0163161_11341130 | 3300017792 | Bacteria | 623 |
| 291 | Ga0163161_11535214 | 3300017792 | Bacteria | 585 |
| 292 | Ga0163161_12048240 | 3300017792 | Bacteria | 509 |
| 293 | Ga0197907_10083044 | 3300020069 | Bacteria | 810 |
| 294 | Ga0206356_10776358 | 3300020070 | Bacteria | 2064 |
| 295 | Ga0206349_1760011 | 3300020075 | Bacteria | 913 |
| 296 | Ga0206351_10267476 | 3300020077 | Bacteria | 15418 |
| 297 | Ga0206352_10304197 | 3300020078 | Bacteria | 3582 |
| 298 | Ga0206350_10037838 | 3300020080 | Bacteria | 1766 |
| 299 | Ga0206350_11510146 | 3300020080 | Bacteria | 5619 |
| 300 | Ga0206354_11620711 | 3300020081 | Bacteria | 1691 |
| 301 | Ga0206353_10538520 | 3300020082 | Bacteria | 1988 |
| 302 | Ga0206353_11557329 | 3300020082 | Bacteria | 534 |
| 303 | Ga0154015_1410599 | 3300020610 | Bacteria | 3445 |
| 304 | Ga0154015_1680355 | 3300020610 | Bacteria | 1226 |
| 305 | Ga0213872_10006418 | 3300021361 | Bacteria | 5910 |
| 306 | Ga0224712_10012850 | 3300022467 | Bacteria | 2649 |
| 307 | Ga0224712_10038295 | 3300022467 | Bacteria | 1790 |
| 308 | Ga0209563_107301 | 3300025230 | Bacteria | 1826 |
| 309 | Ga0207427_100025 | 3300025231 | Bacteria | 433726 |
| 310 | Ga0209437_100010 | 3300025233 | Bacteria | 838447 |
| 311 | Ga0207425_1000008 | 3300025245 | Bacteria | 618024 |
| 312 | Ga0209026_1000610 | 3300025250 | Bacteria | 22917 |
| 313 | Ga0209026_1003238 | 3300025250 | Bacteria | 5483 |
| 314 | Ga0209129_1000040 | 3300025258 | Bacteria | 313043 |
| 315 | Ga0209233_1000017 | 3300025261 | Bacteria | 898076 |
| 316 | Ga0209233_1001079 | 3300025261 | Bacteria | 11257 |
| 317 | Ga0209233_1003581 | 3300025261 | Bacteria | 5451 |
| 318 | Ga0209675_1000115 | 3300025291 | Bacteria | 111981 |
| 319 | Ga0209676_1000009 | 3300025292 | Bacteria | 981719 |
| 320 | Ga0209025_1000020 | 3300025294 | Bacteria | 618024 |
| 321 | Ga0209758_1000022 | 3300025297 | Bacteria | 618024 |
| 322 | Ga0209050_1000048 | 3300025298 | Bacteria | 371553 |
| 323 | Ga0207656_10002394 | 3300025321 | Bacteria | 6311 |
| 324 | Ga0207696_1020048 | 3300025711 | Bacteria | 2162 |
| 325 | Ga0207655_1000016 | 3300025728 | Bacteria | 551476 |
| 326 | Ga0207655_1000038 | 3300025728 | Bacteria | 348340 |
| 327 | Ga0207655_1058892 | 3300025728 | Bacteria | 1498 |
| 328 | Ga0207647_10000171 | 3300025904 | Bacteria | 51875 |
| 329 | Ga0207647_10017185 | 3300025904 | Bacteria | 4922 |
| 330 | Ga0207647_10022768 | 3300025904 | Bacteria | 4156 |
| 331 | Ga0207645_10000035 | 3300025907 | Bacteria | 89345 |
| 332 | Ga0207643_10138010 | 3300025908 | Bacteria | 1455 |
| 333 | Ga0207705_10000108 | 3300025909 | Bacteria | 93501 |
| 334 | Ga0207705_10104158 | 3300025909 | Bacteria | 2090 |
| 335 | Ga0207705_10131644 | 3300025909 | Bacteria | 1862 |
| 336 | Ga0207705_10330934 | 3300025909 | Bacteria | 1171 |
| 337 | Ga0207705_11087995 | 3300025909 | Bacteria | 616 |
| 338 | Ga0207705_11167483 | 3300025909 | Bacteria | 591 |
| 339 | Ga0207654_10091095 | 3300025911 | Bacteria | 1859 |
| 340 | Ga0207654_11275353 | 3300025911 | Bacteria | 536 |
| 341 | Ga0207695_10000053 | 3300025913 | Bacteria | 396740 |
| 342 | Ga0207695_10084356 | 3300025913 | Bacteria | 3208 |
| 343 | Ga0207695_10276587 | 3300025913 | Bacteria | 1573 |
| 344 | Ga0207695_11495245 | 3300025913 | Bacteria | 556 |
| 345 | Ga0207671_10017153 | 3300025914 | Bacteria | 5595 |
| 346 | Ga0207671_10039460 | 3300025914 | Bacteria | 3496 |
| 347 | Ga0207671_10228749 | 3300025914 | Bacteria | 1458 |
| 348 | Ga0207671_10236880 | 3300025914 | Bacteria | 1433 |
| 349 | Ga0207671_11522095 | 3300025914 | Bacteria | 516 |
| 350 | Ga0207657_10023513 | 3300025919 | Bacteria | 5737 |
| 351 | Ga0207657_10025871 | 3300025919 | Bacteria | 5405 |
| 352 | Ga0207657_10038645 | 3300025919 | Bacteria | 4247 |
| 353 | Ga0207657_10463205 | 3300025919 | Bacteria | 994 |
| 354 | Ga0207649_11457607 | 3300025920 | Bacteria | 542 |
| 355 | Ga0207652_10101465 | 3300025921 | Bacteria | 2542 |
| 356 | Ga0207681_10350064 | 3300025923 | Unclassified | 1182 |
| 357 | Ga0207681_10549683 | 3300025923 | Bacteria | 950 |
| 358 | Ga0207694_10009649 | 3300025924 | Bacteria | 7276 |
| 359 | Ga0207694_10210432 | 3300025924 | Bacteria | 1584 |
| 360 | Ga0207694_10238583 | 3300025924 | Bacteria | 1486 |
| 361 | Ga0207650_11891571 | 3300025925 | Bacteria | 504 |
| 362 | Ga0207687_10427676 | 3300025927 | Bacteria | 1094 |
| 363 | Ga0207664_10627311 | 3300025929 | Bacteria | 966 |
| 364 | Ga0207690_10002170 | 3300025932 | Bacteria | 11970 |
| 365 | Ga0207690_10014765 | 3300025932 | Bacteria | 4724 |
| 366 | Ga0207706_10293082 | 3300025933 | Bacteria | 1418 |
| 367 | Ga0207686_10035366 | 3300025934 | Bacteria | 2998 |
| 368 | Ga0207686_10962536 | 3300025934 | Bacteria | 691 |
| 369 | Ga0207709_10000026 | 3300025935 | Bacteria | 354467 |
| 370 | Ga0207709_10000084 | 3300025935 | Bacteria | 161002 |
| 371 | Ga0207709_10045783 | 3300025935 | Bacteria | 2651 |
| 372 | Ga0207669_11730187 | 3300025937 | Bacteria | 534 |
| 373 | Ga0207704_10000036 | 3300025938 | Bacteria | 94574 |
| 374 | Ga0207691_10434847 | 3300025940 | Bacteria | 1117 |
| 375 | Ga0207661_10011066 | 3300025944 | Bacteria | 6521 |
| 376 | Ga0207661_11566363 | 3300025944 | Bacteria | 603 |
| 377 | Ga0207667_10112632 | 3300025949 | Bacteria | 2806 |
| 378 | Ga0207667_10489647 | 3300025949 | Bacteria | 1248 |
| 379 | Ga0207667_10602320 | 3300025949 | Bacteria | 1108 |
| 380 | Ga0207667_11137603 | 3300025949 | Bacteria | 762 |
| 381 | Ga0207667_11416086 | 3300025949 | Bacteria | 668 |
| 382 | Ga0207651_10032626 | 3300025960 | Bacteria | 3348 |
| 383 | Ga0207712_10050092 | 3300025961 | Bacteria | 2914 |
| 384 | Ga0207712_10232294 | 3300025961 | Unclassified | 1481 |
| 385 | Ga0207712_11634522 | 3300025961 | Bacteria | 577 |
| 386 | Ga0207668_10226545 | 3300025972 | Bacteria | 1504 |
| 387 | Ga0207668_11593901 | 3300025972 | Unclassified | 589 |
| 388 | Ga0207677_10193616 | 3300026023 | Bacteria | 1610 |
| 389 | Ga0207677_10783953 | 3300026023 | Bacteria | 852 |
| 390 | Ga0207639_10046024 | 3300026041 | Bacteria | 3290 |
| 391 | Ga0207639_10366613 | 3300026041 | Bacteria | 1290 |
| 392 | Ga0207639_10433554 | 3300026041 | Bacteria | 1190 |
| 393 | Ga0207639_10759718 | 3300026041 | Bacteria | 902 |
| 394 | Ga0207678_10078056 | 3300026067 | Bacteria | 2836 |
| 395 | Ga0207708_11618914 | 3300026075 | Bacteria | 569 |
| 396 | Ga0207702_10024936 | 3300026078 | Bacteria | 4962 |
| 397 | Ga0207648_10000333 | 3300026089 | Bacteria | 51656 |
| 398 | Ga0207648_12072307 | 3300026089 | Bacteria | 530 |
| 399 | Ga0207676_12499757 | 3300026095 | Bacteria | 513 |
| 400 | Ga0207674_10016950 | 3300026116 | Bacteria | 7956 |
| 401 | Ga0207674_10347462 | 3300026116 | Bacteria | 1434 |
| 402 | Ga0207674_10477422 | 3300026116 | Bacteria | 1205 |
| 403 | Ga0207675_102582209 | 3300026118 | Bacteria | 518 |
| 404 | Ga0207683_10000982 | 3300026121 | Bacteria | 26175 |
| 405 | Ga0207683_10225777 | 3300026121 | Bacteria | 1707 |
| 406 | Ga0207698_10011872 | 3300026142 | Bacteria | 5671 |
| 407 | Ga0207698_10101413 | 3300026142 | Bacteria | 2387 |
| 408 | Ga0209281_1000337 | 3300027111 | Bacteria | 79938 |
| 409 | Ga0209489_111364 | 3300027361 | Bacteria | 9138 |
| 410 | Ga0209984_1008899 | 3300027424 | Bacteria | 1269 |
| 411 | Ga0209995_1020587 | 3300027471 | Bacteria | 1091 |
| 412 | Ga0209968_1000671 | 3300027526 | Bacteria | 5278 |
| 413 | Ga0209968_1083787 | 3300027526 | Bacteria | 575 |
| 414 | Ga0209999_1033339 | 3300027543 | Bacteria | 958 |
| 415 | Ga0209982_1056554 | 3300027552 | Bacteria | 636 |
| 416 | Ga0210002_1001591 | 3300027617 | Bacteria | 3225 |
| 417 | Ga0209282_1028939 | 3300027666 | Bacteria | 3426 |
| 418 | Ga0209966_1031903 | 3300027695 | Bacteria | 1070 |
| 419 | Ga0268266_10000658 | 3300028379 | Bacteria | 46741 |
| 420 | Ga0268264_10410213 | 3300028381 | Bacteria | 1304 |
| 421 | Ga0265318_10147131 | 3300028577 | Bacteria | 864 |
| 422 | Ga0265336_10163785 | 3300028666 | Bacteria | 661 |
| 423 | Ga0307517_10012583 | 3300028786 | Bacteria | 11593 |
| 424 | Ga0307515_10028989 | 3300028794 | Bacteria | 9379 |
| 425 | Ga0307515_10403780 | 3300028794 | Bacteria | 991 |
| 426 | Ga0265338_10001162 | 3300028800 | Bacteria | 43495 |
| 427 | Ga0265338_10007954 | 3300028800 | Bacteria | 12991 |
| 428 | Ga0316176_1208558 | 3300030732 | Bacteria | 529 |
| 429 | Ga0316179_1109740 | 3300030734 | Bacteria | 3245 |
| 430 | Ga0316182_1045167 | 3300030745 | Bacteria | 1412 |
| 431 | Ga0265332_10298127 | 3300031238 | Bacteria | 666 |
| 432 | Ga0265325_10085944 | 3300031241 | Bacteria | 1557 |
| 433 | Ga0265327_10004316 | 3300031251 | Bacteria | 12681 |
| 434 | Ga0265327_10019355 | 3300031251 | Bacteria | 4188 |
| 435 | Ga0265327_10163448 | 3300031251 | Bacteria | 1027 |
| 436 | Ga0265327_10356138 | 3300031251 | Bacteria | 639 |
| 437 | Ga0265316_10002446 | 3300031344 | Bacteria | 19266 |
| 438 | Ga0265316_10317853 | 3300031344 | Bacteria | 1131 |
| 439 | Ga0307513_10153709 | 3300031456 | Bacteria | 2205 |
| 440 | Ga0307509_10498984 | 3300031507 | Bacteria | 902 |
| 441 | Ga0307408_100056125 | 3300031548 | Bacteria | 2855 |
| 442 | Ga0307408_100926672 | 3300031548 | Bacteria | 799 |
| 443 | Ga0307408_102170990 | 3300031548 | Bacteria | 536 |
| 444 | Ga0316579_10079495 | 3300031691 | Bacteria | 1560 |
| 445 | Ga0265342_10082046 | 3300031712 | Bacteria | 1861 |
| 446 | Ga0265342_10146276 | 3300031712 | Bacteria | 1315 |
| 447 | Ga0265342_10260322 | 3300031712 | Bacteria | 923 |
| 448 | Ga0265342_10448363 | 3300031712 | Bacteria | 662 |
| 449 | Ga0316576_10001965 | 3300031727 | Bacteria | 11485 |
| 450 | Ga0316576_10038081 | 3300031727 | Bacteria | 3446 |
| 451 | Ga0316576_10052895 | 3300031727 | Bacteria | 2958 |
| 452 | Ga0316576_10164563 | 3300031727 | Bacteria | 1673 |
| 453 | Ga0316576_10258615 | 3300031727 | Bacteria | 1306 |
| 454 | Ga0316576_10400296 | 3300031727 | Bacteria | 1017 |
| 455 | Ga0316576_10421965 | 3300031727 | Bacteria | 987 |
| 456 | Ga0316576_10562728 | 3300031727 | Bacteria | 835 |
| 457 | Ga0316576_10599487 | 3300031727 | Bacteria | 804 |
| 458 | Ga0316576_10744439 | 3300031727 | Bacteria | 708 |
| 459 | Ga0316576_11002327 | 3300031727 | Bacteria | 595 |
| 460 | Ga0316576_11174883 | 3300031727 | Bacteria | 542 |
| 461 | Ga0316578_10261755 | 3300031728 | Bacteria | 1037 |
| 462 | Ga0307405_10000005 | 3300031731 | Bacteria | 376536 |
| 463 | Ga0307405_10000006 | 3300031731 | Bacteria | 361477 |
| 464 | Ga0307405_10041034 | 3300031731 | Bacteria | 2806 |
| 465 | Ga0307405_10197523 | 3300031731 | Bacteria | 1458 |
| 466 | Ga0307405_10285692 | 3300031731 | Bacteria | 1244 |
| 467 | Ga0307405_11376350 | 3300031731 | Bacteria | 616 |
| 468 | Ga0316577_10008426 | 3300031733 | Bacteria | 5526 |
| 469 | Ga0316577_10361873 | 3300031733 | Bacteria | 824 |
| 470 | Ga0316577_10543555 | 3300031733 | Bacteria | 661 |
| 471 | Ga0316577_10840365 | 3300031733 | Bacteria | 521 |
| 472 | Ga0307413_10001014 | 3300031824 | Bacteria | 10155 |
| 473 | Ga0307413_10001307 | 3300031824 | Bacteria | 9311 |
| 474 | Ga0307413_10040535 | 3300031824 | Bacteria | 2718 |
| 475 | Ga0307413_10657550 | 3300031824 | Bacteria | 865 |
| 476 | Ga0307413_11181026 | 3300031824 | Bacteria | 665 |
| 477 | Ga0307413_11541395 | 3300031824 | Bacteria | 589 |
| 478 | Ga0307410_10000034 | 3300031852 | Bacteria | 48449 |
| 479 | Ga0307410_10396019 | 3300031852 | Bacteria | 1115 |
| 480 | Ga0307406_10000004 | 3300031901 | Bacteria | 179772 |
| 481 | Ga0307406_10361121 | 3300031901 | Bacteria | 1138 |
| 482 | Ga0307407_10000003 | 3300031903 | Bacteria | 271723 |
| 483 | Ga0307407_10000196 | 3300031903 | Bacteria | 18233 |
| 484 | Ga0307412_10000088 | 3300031911 | Bacteria | 82058 |
| 485 | Ga0307412_10002740 | 3300031911 | Bacteria | 9804 |
| 486 | Ga0307412_10053164 | 3300031911 | Bacteria | 2684 |
| 487 | Ga0307412_10268629 | 3300031911 | Bacteria | 1333 |
| 488 | Ga0307412_10312732 | 3300031911 | Bacteria | 1246 |
| 489 | Ga0307412_10401220 | 3300031911 | Bacteria | 1116 |
| 490 | Ga0307412_10643817 | 3300031911 | Bacteria | 903 |
| 491 | Ga0307409_100028055 | 3300031995 | Bacteria | 4003 |
| 492 | Ga0307416_100000002 | 3300032002 | Bacteria | 509907 |
| 493 | Ga0307416_100000006 | 3300032002 | Bacteria | 466074 |
| 494 | Ga0307416_100010892 | 3300032002 | Bacteria | 6031 |
| 495 | Ga0307414_10000011 | 3300032004 | Bacteria | 338253 |
| 496 | Ga0307414_10000030 | 3300032004 | Bacteria | 187373 |
| 497 | Ga0307414_10000673 | 3300032004 | Bacteria | 17502 |
| 498 | Ga0307414_10000927 | 3300032004 | Bacteria | 15015 |
| 499 | Ga0307414_10007281 | 3300032004 | Bacteria | 6215 |
| 500 | Ga0307414_10009268 | 3300032004 | Bacteria | 5644 |
| 501 | Ga0307414_10009965 | 3300032004 | Bacteria | 5484 |
| 502 | Ga0307414_10011571 | 3300032004 | Bacteria | 5180 |
| 503 | Ga0307414_10011719 | 3300032004 | Bacteria | 5154 |
| 504 | Ga0307414_10014563 | 3300032004 | Bacteria | 4720 |
| 505 | Ga0307414_10024140 | 3300032004 | Bacteria | 3871 |
| 506 | Ga0307414_10042491 | 3300032004 | Bacteria | 3089 |
| 507 | Ga0307414_10080701 | 3300032004 | Bacteria | 2379 |
| 508 | Ga0307414_10123751 | 3300032004 | Bacteria | 1993 |
| 509 | Ga0307414_10212613 | 3300032004 | Bacteria | 1582 |
| 510 | Ga0307414_10286969 | 3300032004 | Bacteria | 1386 |
| 511 | Ga0307414_10471367 | 3300032004 | Bacteria | 1105 |
| 512 | Ga0307414_10490184 | 3300032004 | Bacteria | 1085 |
| 513 | Ga0307414_10547897 | 3300032004 | Bacteria | 1030 |
| 514 | Ga0307414_10732583 | 3300032004 | Bacteria | 897 |
| 515 | Ga0307414_10735928 | 3300032004 | Bacteria | 895 |
| 516 | Ga0307414_10960370 | 3300032004 | Bacteria | 785 |
| 517 | Ga0307414_11661410 | 3300032004 | Bacteria | 596 |
| 518 | Ga0307411_10000004 | 3300032005 | Bacteria | 460327 |
| 519 | Ga0307411_10119322 | 3300032005 | Bacteria | 1905 |
| 520 | Ga0307411_10153223 | 3300032005 | Bacteria | 1716 |
| 521 | Ga0307411_10166804 | 3300032005 | Bacteria | 1656 |
| 522 | Ga0307411_10976680 | 3300032005 | Bacteria | 757 |
| 523 | Ga0316585_10002058 | 3300032137 | Bacteria | 5395 |
| 524 | Ga0316580_10109645 | 3300032139 | Bacteria | 845 |
| 525 | Ga0316580_10187250 | 3300032139 | Bacteria | 637 |
| 526 | Ga0316593_10000201 | 3300032168 | Bacteria | 9314 |
| 527 | Ga0316593_10000279 | 3300032168 | Bacteria | 8591 |
| 528 | Ga0316593_10001741 | 3300032168 | Bacteria | 4931 |
| 529 | Ga0316593_10008603 | 3300032168 | Bacteria | 2851 |
| 530 | Ga0316593_10025704 | 3300032168 | Bacteria | 1877 |
| 531 | Ga0316593_10044098 | 3300032168 | Bacteria | 1492 |
| 532 | Ga0316593_10077390 | 3300032168 | Bacteria | 1157 |
| 533 | Ga0316593_10106176 | 3300032168 | Bacteria | 1000 |
| 534 | Ga0316593_10118432 | 3300032168 | Bacteria | 950 |
| 535 | Ga0316593_10140339 | 3300032168 | Bacteria | 875 |
| 536 | Ga0316593_10164998 | 3300032168 | Bacteria | 810 |
| 537 | Ga0316593_10200655 | 3300032168 | Bacteria | 737 |
| 538 | Ga0316593_10321660 | 3300032168 | Bacteria | 588 |
| 539 | Ga0316593_10342474 | 3300032168 | Bacteria | 571 |
| 540 | Ga0316593_10400875 | 3300032168 | Bacteria | 530 |
| 541 | Ga0316593_10404845 | 3300032168 | Bacteria | 528 |
| 542 | Ga0307507_10000034 | 3300033179 | Bacteria | 188697 |
| 543 | Ga0307510_10003892 | 3300033180 | Bacteria | 17498 |
| 544 | Ga0307510_10035700 | 3300033180 | Bacteria | 5546 |
| 545 | Ga0316592_1000131 | 3300033524 | Bacteria | 8112 |
| 546 | Ga0316592_1001542 | 3300033524 | Bacteria | 3743 |
| 547 | Ga0316592_1002393 | 3300033524 | Bacteria | 3237 |
| 548 | Ga0316592_1002839 | 3300033524 | Bacteria | 3046 |
| 549 | Ga0316592_1022509 | 3300033524 | Bacteria | 1348 |
| 550 | Ga0316592_1026061 | 3300033524 | Bacteria | 1262 |
| 551 | Ga0316592_1035568 | 3300033524 | Bacteria | 1093 |
| 552 | Ga0316592_1063561 | 3300033524 | Bacteria | 830 |
| 553 | Ga0316592_1067956 | 3300033524 | Bacteria | 804 |
| 554 | Ga0316586_1018347 | 3300033527 | Bacteria | 1135 |
| 555 | Ga0316586_1072843 | 3300033527 | Bacteria | 634 |
| 556 | Ga0316586_1076105 | 3300033527 | Bacteria | 622 |
| 557 | Ga0316586_1119418 | 3300033527 | Bacteria | 513 |
| 558 | Ga0316588_1000479 | 3300033528 | Bacteria | 5421 |
| 559 | Ga0316588_1023041 | 3300033528 | Bacteria | 1426 |
| 560 | Ga0316588_1094304 | 3300033528 | Bacteria | 747 |
| 561 | Ga0316588_1124404 | 3300033528 | Bacteria | 654 |
| 562 | Ga0316587_1096422 | 3300033529 | Bacteria | 567 |
| 563 | Ga0316596_1000052 | 3300033541 | Bacteria | 12700 |
| 564 | Ga0316596_1000106 | 3300033541 | Bacteria | 10634 |
| 565 | Ga0316596_1001043 | 3300033541 | Bacteria | 5368 |
| 566 | Ga0316596_1002456 | 3300033541 | Bacteria | 3957 |
| 567 | Ga0316596_1002626 | 3300033541 | Bacteria | 3852 |
| 568 | Ga0316596_1003921 | 3300033541 | Bacteria | 3297 |
| 569 | Ga0316596_1009524 | 3300033541 | Bacteria | 2331 |
| 570 | Ga0316596_1016458 | 3300033541 | Bacteria | 1853 |
| 571 | Ga0316596_1022355 | 3300033541 | Bacteria | 1616 |
| 572 | Ga0316596_1025349 | 3300033541 | Bacteria | 1526 |
| 573 | Ga0316596_1028216 | 3300033541 | Bacteria | 1450 |
| 574 | Ga0316596_1029155 | 3300033541 | Bacteria | 1428 |
| 575 | Ga0316596_1029434 | 3300033541 | Bacteria | 1422 |
| 576 | Ga0316596_1044495 | 3300033541 | Bacteria | 1170 |
| 577 | Ga0316596_1046954 | 3300033541 | Bacteria | 1141 |
| 578 | Ga0316596_1061147 | 3300033541 | Bacteria | 1005 |
| 579 | Ga0316596_1071909 | 3300033541 | Bacteria | 926 |
| 580 | Ga0316596_1102484 | 3300033541 | Bacteria | 775 |
| 581 | Ga0316596_1116222 | 3300033541 | Bacteria | 727 |
| 582 | Ga0316596_1127939 | 3300033541 | Bacteria | 693 |
| 583 | Ga0316596_1179504 | 3300033541 | Bacteria | 586 |
| 584 | Ga0316596_1217684 | 3300033541 | Bacteria | 534 |
| 585 | Ga0316596_1239773 | 3300033541 | Bacteria | 510 |
| 586 | Ga0373941_0018629 | 3300035115 | Bacteria | 1920 |
| 587 | Ga0316574_0007562 | 3300035398 | Bacteria | 5965 |
| 588 | Ga0316574_0034560 | 3300035398 | Bacteria | 3083 |
| 589 | Ga0316574_0065061 | 3300035398 | Bacteria | 2295 |
| 590 | Ga0316574_0097562 | 3300035398 | Bacteria | 1879 |
| 591 | Ga0316574_0104645 | 3300035398 | Bacteria | 1812 |
| 592 | Ga0316574_0191354 | 3300035398 | Bacteria | 1316 |
| 593 | Ga0316574_0488456 | 3300035398 | Bacteria | 769 |
| 594 | Ga0316574_0631092 | 3300035398 | Bacteria | 660 |
| 595 | Ga0373937_0174104 | 3300036401 | Bacteria | 2020 |
| 596 | Ga0316582_0108981 | 3300036647 | Bacteria | 1841 |
| 597 | Ga0316584_0015050 | 3300036712 | Bacteria | 5526 |
| 598 | Ga0316584_0020615 | 3300036712 | Bacteria | 4783 |
| 599 | Ga0316584_0037517 | 3300036712 | Bacteria | 3601 |
| 600 | Ga0316584_0065628 | 3300036712 | Bacteria | 2719 |
| 601 | Ga0316584_0078998 | 3300036712 | Bacteria | 2464 |
| 602 | Ga0316584_0132919 | 3300036712 | Bacteria | 1858 |
| 603 | Ga0316584_0439094 | 3300036712 | Bacteria | 925 |
| 604 | Ga0316584_0484118 | 3300036712 | Bacteria | 871 |
| 605 | Ga0316584_0572670 | 3300036712 | Bacteria | 786 |
| 606 | Ga0316584_1078963 | 3300036712 | Bacteria | 534 |
| 607 | Ga0395899_0000034 | 3300037312 | Bacteria | 302623 |
| 608 | Ga0395899_0100582 | 3300037312 | Bacteria | 2088 |
| 609 | Ga0395899_0126981 | 3300037312 | Bacteria | 1823 |
| 610 | Ga0395900_0000346 | 3300037418 | Bacteria | 68020 |
| 611 | Ga0395900_0001482 | 3300037418 | Bacteria | 28015 |
| 612 | Ga0395900_0006693 | 3300037418 | Bacteria | 11974 |
| 613 | Ga0395898_0706147 | 3300037466 | Bacteria | 950 |
| 614 | Ga0395905_0000528 | 3300037471 | Bacteria | 52404 |
| 615 | Ga0395905_0002993 | 3300037471 | Bacteria | 18335 |
| 616 | Ga0316581_0099290 | 3300037588 | Bacteria | 897 |
| 617 | Ga0395901_0000351 | 3300038443 | Bacteria | 56004 |
| 618 | Ga0395901_0007776 | 3300038443 | Bacteria | 10816 |
| 619 | Ga0395901_1203652 | 3300038443 | Bacteria | 723 |
| 620 | Ga0400490_55178 | 3300038726 | Bacteria | 1529 |
| 621 | Ga0400483_035362 | 3300039062 | Bacteria | 41412 |
| 622 | Ga0400483_129488 | 3300039062 | Bacteria | 1479 |
| 623 | Ga0400489_16856 | 3300039093 | Bacteria | 1164 |
| 624 | Ga0400489_59783 | 3300039093 | Bacteria | 3534 |
| 625 | Ga0436361_0433548 | 3300039447 | Bacteria | 14679 |
| 626 | Ga0439447_000447 | 3300041407 | Bacteria | 15369 |
| 627 | Ga0439466_0004165 | 3300041411 | Bacteria | 5582 |
| 628 | Ga0439466_0031119 | 3300041411 | Bacteria | 1827 |
| 629 | Ga0439465_0000032 | 3300041413 | Bacteria | 28481 |
| 630 | Ga0451788_05134 | 3300041442 | Bacteria | 1363 |
| 631 | Ga0451788_07398 | 3300041442 | Bacteria | 800 |
| 632 | Ga0451788_19850 | 3300041442 | Bacteria | 533 |
| 633 | Ga0451790_06615 | 3300041444 | Bacteria | 741 |
| 634 | Ga0451790_18342 | 3300041444 | Bacteria | 625 |
| 635 | Ga0451790_24640 | 3300041444 | Bacteria | 610 |
| 636 | Ga0451790_32630 | 3300041444 | Bacteria | 892 |
| 637 | Ga0451790_34212 | 3300041444 | Bacteria | 1648 |
| 638 | Ga0451790_46109 | 3300041444 | Bacteria | 653 |
| 639 | Ga0451790_49048 | 3300041444 | Bacteria | 550 |
| 640 | Ga0451794_08054 | 3300041446 | Bacteria | 890 |
| 641 | Ga0451794_09376 | 3300041446 | Bacteria | 512 |
| 642 | Ga0451794_51626 | 3300041446 | Bacteria | 999 |
| 643 | Ga0451791_0955004 | 3300041451 | Bacteria | 967 |
| 644 | Ga0451791_1675939 | 3300041451 | Bacteria | 2636 |
| 645 | Ga0451797_0517437 | 3300041453 | Bacteria | 553 |
| 646 | Ga0451797_0548848 | 3300041453 | Bacteria | 753 |
| 647 | Ga0451797_1089683 | 3300041453 | Bacteria | 649 |
| 648 | Ga0451795_0372407 | 3300041456 | Bacteria | 996 |
| 649 | Ga0451795_0626751 | 3300041456 | Bacteria | 604 |
| 650 | Ga0451798_0408742 | 3300041458 | Bacteria | 634 |
| 651 | Ga0451800_0124714 | 3300041459 | Bacteria | 620 |
| 652 | Ga0451802_0657423 | 3300041460 | Bacteria | 626 |
| 653 | Ga0451802_1561053 | 3300041460 | Bacteria | 889 |
| 654 | Ga0451805_041937 | 3300041461 | Bacteria | 507 |
| 655 | Ga0451805_049097 | 3300041461 | Bacteria | 539 |
| 656 | Ga0451806_282812 | 3300041462 | Bacteria | 506 |
| 657 | Ga0451808_27891 | 3300041464 | Bacteria | 659 |
| 658 | Ga0451807_1712141 | 3300041486 | Bacteria | 734 |
| 659 | Ga0451833_0789018 | 3300041491 | Bacteria | 915 |
| 660 | Ga0451837_1056715 | 3300041494 | Bacteria | 8321 |
| 661 | Ga0451837_1663720 | 3300041494 | Unclassified | 657 |
| 662 | Ga0451839_1324400 | 3300041496 | Bacteria | 526 |
| 663 | Ga0451841_0723652 | 3300041498 | Bacteria | 962 |
| 664 | Ga0451841_1044112 | 3300041498 | Bacteria | 619 |
| 665 | Ga0451845_0433051 | 3300041501 | Bacteria | 774 |
| 666 | Ga0451846_10542 | 3300041502 | Bacteria | 729 |
| 667 | Ga0451847_0392278 | 3300041503 | Bacteria | 820 |
| 668 | Ga0451850_42284 | 3300041506 | Bacteria | 801 |
| 669 | Ga0451851_1170285 | 3300041507 | Bacteria | 663 |
| 670 | Ga0451852_13332 | 3300041508 | Bacteria | 9060 |
| 671 | Ga0451843_0778330 | 3300041509 | Bacteria | 504 |
| 672 | Ga0451843_0938722 | 3300041509 | Bacteria | 587 |
| 673 | Ga0451843_0973795 | 3300041509 | Bacteria | 531 |
| 674 | Ga0451843_1238084 | 3300041509 | Unclassified | 814 |
| 675 | Ga0451843_1481279 | 3300041509 | Bacteria | 591 |
| 676 | Ga0451855_0120142 | 3300041511 | Bacteria | 1190 |
| 677 | Ga0451853_2539583 | 3300041512 | Bacteria | 1109 |
| 678 | Ga0452271_61575 | 3300041916 | Bacteria | 693 |
| 679 | Ga0439445_0001316 | 3300042004 | Bacteria | 5367 |
| 680 | Ga0439445_0041163 | 3300042004 | Bacteria | 1228 |
| 681 | Ga0439448_0031796 | 3300042005 | Bacteria | 1677 |
| 682 | Ga0439432_062281 | 3300042006 | Bacteria | 1148 |
| 683 | Ga0439432_094647 | 3300042006 | Bacteria | 897 |
| 684 | Ga0450905_008908 | 3300042142 | Bacteria | 1377 |
| 685 | Ga0439446_0103210 | 3300042156 | Bacteria | 904 |
| 686 | Ga0451577_0000092 | 3300042876 | Bacteria | 198898 |
| 687 | Ga0451577_0000433 | 3300042876 | Bacteria | 74789 |
| 688 | Ga0451577_0004463 | 3300042876 | Bacteria | 14775 |
| 689 | Ga0451577_0005144 | 3300042876 | Bacteria | 13458 |
| 690 | Ga0451577_0054888 | 3300042876 | Bacteria | 3556 |
| 691 | Ga0451577_0059569 | 3300042876 | Bacteria | 3404 |
| 692 | Ga0451577_0080589 | 3300042876 | Bacteria | 2903 |
| 693 | Ga0451577_0106452 | 3300042876 | Bacteria | 2507 |
| 694 | Ga0451577_0126458 | 3300042876 | Bacteria | 2290 |
| 695 | Ga0451577_0132072 | 3300042876 | Bacteria | 2240 |
| 696 | Ga0451577_0159725 | 3300042876 | Bacteria | 2029 |
| 697 | Ga0451577_0163253 | 3300042876 | Bacteria | 2007 |
| 698 | Ga0451577_0200564 | 3300042876 | Bacteria | 1801 |
| 699 | Ga0451577_0204287 | 3300042876 | Bacteria | 1783 |
| 700 | Ga0451577_0288217 | 3300042876 | Bacteria | 1488 |
| 701 | Ga0451577_0462777 | 3300042876 | Bacteria | 1152 |
| 702 | Ga0451577_0565645 | 3300042876 | Bacteria | 1032 |
| 703 | Ga0451577_0612796 | 3300042876 | Unclassified | 988 |
| 704 | Ga0451577_0716104 | 3300042876 | Bacteria | 906 |
| 705 | Ga0451577_0749427 | 3300042876 | Bacteria | 883 |
| 706 | Ga0451577_0761496 | 3300042876 | Bacteria | 875 |
| 707 | Ga0453683_0000055 | 3300044673 | Bacteria | 192588 |
| 708 | Ga0453683_0000522 | 3300044673 | Bacteria | 43145 |
| 709 | Ga0453683_0006727 | 3300044673 | Bacteria | 7859 |
| 710 | Ga0453683_0007526 | 3300044673 | Bacteria | 7375 |
| 711 | Ga0453683_0009005 | 3300044673 | Bacteria | 6671 |
| 712 | Ga0453683_0014569 | 3300044673 | Bacteria | 5101 |
| 713 | Ga0453683_0034450 | 3300044673 | Bacteria | 3192 |
| 714 | Ga0453683_0037310 | 3300044673 | Bacteria | 3058 |
| 715 | Ga0453683_0042864 | 3300044673 | Bacteria | 2841 |
| 716 | Ga0453683_0077545 | 3300044673 | Bacteria | 2081 |
| 717 | Ga0453683_0083828 | 3300044673 | Unclassified | 1997 |
| 718 | Ga0453683_0087298 | 3300044673 | Bacteria | 1955 |
| 719 | Ga0453683_0229162 | 3300044673 | Bacteria | 1182 |
| 720 | Ga0453683_0239477 | 3300044673 | Bacteria | 1155 |
| 721 | Ga0453683_0352781 | 3300044673 | Bacteria | 945 |
| 722 | Ga0453683_0363438 | 3300044673 | Unclassified | 930 |
| 723 | Ga0453683_0368994 | 3300044673 | Unclassified | 923 |
| 724 | Ga0453683_0873184 | 3300044673 | Bacteria | 594 |
| 725 | Ga0453683_0999230 | 3300044673 | Bacteria | 555 |
| 726 | Ga0466961_0863405 | 3300044693 | Bacteria | 539 |
| 727 | Ga0453684_0000413 | 3300044712 | Bacteria | 174924 |
| 728 | Ga0453684_0000440 | 3300044712 | Bacteria | 169397 |
| 729 | Ga0453684_0000506 | 3300044712 | Bacteria | 152143 |
| 730 | Ga0453684_0001193 | 3300044712 | Bacteria | 80343 |
| 731 | Ga0453684_0001382 | 3300044712 | Bacteria | 70292 |
| 732 | Ga0453684_0001549 | 3300044712 | Bacteria | 64220 |
| 733 | Ga0453684_0012598 | 3300044712 | Bacteria | 13911 |
| 734 | Ga0453684_0025154 | 3300044712 | Bacteria | 8657 |
| 735 | Ga0453684_0032953 | 3300044712 | Bacteria | 7234 |
| 736 | Ga0453684_0038585 | 3300044712 | Bacteria | 6526 |
| 737 | Ga0453684_0043553 | 3300044712 | Bacteria | 6030 |
| 738 | Ga0453684_0047532 | 3300044712 | Bacteria | 5689 |
| 739 | Ga0453684_0054508 | 3300044712 | Bacteria | 5208 |
| 740 | Ga0453684_0055899 | 3300044712 | Bacteria | 5126 |
| 741 | Ga0453684_0056141 | 3300044712 | Bacteria | 5111 |
| 742 | Ga0453684_0062135 | 3300044712 | Bacteria | 4786 |
| 743 | Ga0453684_0068294 | 3300044712 | Bacteria | 4514 |
| 744 | Ga0453684_0079180 | 3300044712 | Bacteria | 4108 |
| 745 | Ga0453684_0086715 | 3300044712 | Bacteria | 3883 |
| 746 | Ga0453684_0087955 | 3300044712 | Bacteria | 3848 |
| 747 | Ga0453684_0108947 | 3300044712 | Bacteria | 3370 |
| 748 | Ga0453684_0125131 | 3300044712 | Bacteria | 3095 |
| 749 | Ga0453684_0133883 | 3300044712 | Bacteria | 2970 |
| 750 | Ga0453684_0172588 | 3300044712 | Bacteria | 2546 |
| 751 | Ga0453684_0261448 | 3300044712 | Bacteria | 1982 |
| 752 | Ga0453684_0278356 | 3300044712 | Bacteria | 1909 |
| 753 | Ga0453684_0313358 | 3300044712 | Bacteria | 1779 |
| 754 | Ga0453684_0335008 | 3300044712 | Bacteria | 1710 |
| 755 | Ga0453684_0377094 | 3300044712 | Bacteria | 1593 |
| 756 | Ga0453684_0397650 | 3300044712 | Bacteria | 1544 |
| 757 | Ga0453684_0438662 | 3300044712 | Bacteria | 1456 |
| 758 | Ga0453684_0558870 | 3300044712 | Bacteria | 1259 |
| 759 | Ga0453684_0721544 | 3300044712 | Bacteria | 1081 |
| 760 | Ga0453684_0932542 | 3300044712 | Bacteria | 928 |
| 761 | Ga0453684_1136154 | 3300044712 | Bacteria | 823 |
| 762 | Ga0453684_2280040 | 3300044712 | Bacteria | 539 |
| 763 | Ga0453684_2372640 | 3300044712 | Bacteria | 526 |
| 764 | Ga0453684_2473736 | 3300044712 | Bacteria | 513 |
| 765 | Ga0453684_2531396 | 3300044712 | Unclassified | 506 |
| 766 | Ga0466959_0173896 | 3300045049 | Bacteria | 1509 |
| 767 | Ga0451576_0000113 | 3300045051 | Bacteria | 208644 |
| 768 | Ga0451576_0000204 | 3300045051 | Bacteria | 149459 |
| 769 | Ga0451576_0003461 | 3300045051 | Bacteria | 21644 |
| 770 | Ga0451576_0011813 | 3300045051 | Bacteria | 9886 |
| 771 | Ga0451576_0017866 | 3300045051 | Bacteria | 7791 |
| 772 | Ga0451576_0027225 | 3300045051 | Bacteria | 6142 |
| 773 | Ga0451576_0032623 | 3300045051 | Bacteria | 5541 |
| 774 | Ga0451576_0034310 | 3300045051 | Bacteria | 5390 |
| 775 | Ga0451576_0040065 | 3300045051 | Bacteria | 4960 |
| 776 | Ga0451576_0053102 | 3300045051 | Bacteria | 4246 |
| 777 | Ga0451576_0056132 | 3300045051 | Bacteria | 4119 |
| 778 | Ga0451576_0057514 | 3300045051 | Bacteria | 4065 |
| 779 | Ga0451576_0062248 | 3300045051 | Bacteria | 3890 |
| 780 | Ga0451576_0087954 | 3300045051 | Bacteria | 3232 |
| 781 | Ga0451576_0125877 | 3300045051 | Bacteria | 2670 |
| 782 | Ga0451576_0207257 | 3300045051 | Bacteria | 2047 |
| 783 | Ga0451576_0294905 | 3300045051 | Bacteria | 1695 |
| 784 | Ga0451576_0609488 | 3300045051 | Unclassified | 1147 |
| 785 | Ga0451576_1626804 | 3300045051 | Bacteria | 670 |
| 786 | Ga0451576_1945411 | 3300045051 | Unclassified | 606 |
| 787 | Ga0451576_1992218 | 3300045051 | Bacteria | 598 |
| 788 | Ga0451576_1999458 | 3300045051 | Bacteria | 597 |
| 789 | Ga0495627_000022 | 3300046453 | Bacteria | 254672 |
| 790 | Ga0495627_021677 | 3300046453 | Bacteria | 2126 |
| 791 | Ga0495592_0284949 | 3300046454 | Bacteria | 1079 |
| 792 | Ga0495590_0000627 | 3300046457 | Bacteria | 16440 |
| 793 | Ga0495629_0160521 | 3300046459 | Bacteria | 1561 |
| 794 | Ga0495629_1086477 | 3300046459 | Bacteria | 518 |
| 795 | Ga0495638_0049204 | 3300046460 | Bacteria | 2636 |
| 796 | Ga0495638_0115270 | 3300046460 | Bacteria | 1593 |
| 797 | Ga0495638_0140267 | 3300046460 | Bacteria | 1411 |
| 798 | Ga0495638_0242959 | 3300046460 | Bacteria | 996 |
| 799 | Ga0495641_0155360 | 3300046461 | Bacteria | 1023 |
| 800 | Ga0495641_0488362 | 3300046461 | Bacteria | 561 |
| 801 | Ga0495651_0101584 | 3300046462 | Bacteria | 2140 |
| 802 | Ga0495650_0000023 | 3300046471 | Bacteria | 527763 |
| 803 | Ga0495650_0028243 | 3300046471 | Bacteria | 2580 |
| 804 | Ga0495650_0202031 | 3300046471 | Bacteria | 690 |
| 805 | Ga0495662_0056763 | 3300046476 | Bacteria | 1891 |
| 806 | Ga0495585_0000476 | 3300046492 | Bacteria | 38316 |
| 807 | Ga0495585_0001907 | 3300046492 | Bacteria | 15677 |
| 808 | Ga0495596_0004903 | 3300046500 | Bacteria | 6419 |
| 809 | Ga0495596_0032305 | 3300046500 | Bacteria | 2088 |
| 810 | Ga0495607_0014863 | 3300046501 | Bacteria | 5059 |
| 811 | Ga0495607_0220096 | 3300046501 | Bacteria | 929 |
| 812 | Ga0495607_0461885 | 3300046501 | Bacteria | 568 |
| 813 | Ga0495583_0113021 | 3300046506 | Bacteria | 1149 |
| 814 | Ga0495583_0153266 | 3300046506 | Bacteria | 954 |
| 815 | Ga0495606_0010457 | 3300046507 | Bacteria | 7698 |
| 816 | Ga0495606_0021702 | 3300046507 | Bacteria | 4698 |
| 817 | Ga0495606_0034482 | 3300046507 | Bacteria | 3474 |
| 818 | Ga0495606_0048690 | 3300046507 | Bacteria | 2785 |
| 819 | Ga0495606_0049499 | 3300046507 | Bacteria | 2755 |
| 820 | Ga0495606_0124370 | 3300046507 | Bacteria | 1540 |
| 821 | Ga0495606_0352579 | 3300046507 | Bacteria | 780 |
| 822 | Ga0495606_0619122 | 3300046507 | Bacteria | 528 |
| 823 | Ga0495610_0000005 | 3300046512 | Bacteria | 924111 |
| 824 | Ga0495610_0001849 | 3300046512 | Bacteria | 18351 |
| 825 | Ga0495610_0008200 | 3300046512 | Bacteria | 6805 |
| 826 | Ga0495610_0196577 | 3300046512 | Bacteria | 829 |
| 827 | Ga0495610_0379923 | 3300046512 | Bacteria | 525 |
| 828 | Ga0495616_0004967 | 3300046513 | Bacteria | 8301 |
| 829 | Ga0495616_0006047 | 3300046513 | Bacteria | 7376 |
| 830 | Ga0495616_0082935 | 3300046513 | Bacteria | 1530 |
| 831 | Ga0495618_0406134 | 3300046514 | Bacteria | 832 |
| 832 | Ga0495628_1255351 | 3300046516 | Bacteria | 501 |
| 833 | Ga0495631_0004390 | 3300046518 | Bacteria | 7515 |
| 834 | Ga0495631_0462435 | 3300046518 | Bacteria | 540 |
| 835 | Ga0495632_0007484 | 3300046519 | Bacteria | 6852 |
| 836 | Ga0495632_0191975 | 3300046519 | Bacteria | 933 |
| 837 | Ga0495637_0027540 | 3300046520 | Bacteria | 2541 |
| 838 | Ga0495637_0043937 | 3300046520 | Bacteria | 1905 |
| 839 | Ga0495643_0000294 | 3300046522 | Bacteria | 70329 |
| 840 | Ga0495643_0017021 | 3300046522 | Bacteria | 4260 |
| 841 | Ga0495643_0089150 | 3300046522 | Bacteria | 1593 |
| 842 | Ga0495643_0346172 | 3300046522 | Bacteria | 666 |
| 843 | Ga0495644_0001340 | 3300046523 | Bacteria | 10069 |
| 844 | Ga0495648_0063660 | 3300046524 | Bacteria | 2176 |
| 845 | Ga0495663_0001345 | 3300046525 | Bacteria | 7769 |
| 846 | Ga0495663_0012337 | 3300046525 | Bacteria | 2380 |
| 847 | Ga0495663_0362949 | 3300046525 | Bacteria | 529 |
| 848 | Ga0495642_0199691 | 3300046528 | Bacteria | 872 |
| 849 | Ga0495652_0185319 | 3300046529 | Bacteria | 1593 |
| 850 | Ga0495652_0712477 | 3300046529 | Bacteria | 674 |
| 851 | Ga0495652_0839351 | 3300046529 | Bacteria | 609 |
| 852 | Ga0495654_0000003 | 3300046530 | Bacteria | 863485 |
| 853 | Ga0495654_0010358 | 3300046530 | Bacteria | 5073 |
| 854 | Ga0495654_0031697 | 3300046530 | Bacteria | 2683 |
| 855 | Ga0495640_0072274 | 3300046533 | Bacteria | 2312 |
| 856 | Ga0495586_0241388 | 3300046535 | Unclassified | 1030 |
| 857 | Ga0495598_0366777 | 3300046537 | Bacteria | 557 |
| 858 | Ga0495609_0000003 | 3300046538 | Bacteria | 711547 |
| 859 | Ga0495609_0007815 | 3300046538 | Bacteria | 5295 |
| 860 | Ga0495609_0027693 | 3300046538 | Bacteria | 2588 |
| 861 | Ga0495609_0037227 | 3300046538 | Bacteria | 2195 |
| 862 | Ga0495621_0153670 | 3300046539 | Unclassified | 906 |
| 863 | Ga0495645_0972863 | 3300046543 | Bacteria | 500 |
| 864 | Ga0495622_0145610 | 3300046557 | Bacteria | 1074 |
| 865 | Ga0495633_0000072 | 3300046558 | Bacteria | 131197 |
| 866 | Ga0495633_0003150 | 3300046558 | Bacteria | 11168 |
| 867 | Ga0495633_0013345 | 3300046558 | Bacteria | 4333 |
| 868 | Ga0495633_0015633 | 3300046558 | Bacteria | 3934 |
| 869 | Ga0495633_0210516 | 3300046558 | Bacteria | 891 |
| 870 | Ga0495633_0376909 | 3300046558 | Bacteria | 642 |
| 871 | Ga0495633_0517884 | 3300046558 | Bacteria | 537 |
| 872 | Ga0495668_0000165 | 3300046616 | Bacteria | 98016 |
| 873 | Ga0495668_0194258 | 3300046616 | Bacteria | 1111 |
| 874 | Ga0495634_0400484 | 3300046642 | Bacteria | 815 |
| 875 | Ga0495611_0181608 | 3300046648 | Bacteria | 983 |
| 876 | Ga0495625_0000096 | 3300046660 | Bacteria | 142609 |
| 877 | Ga0495625_0000308 | 3300046660 | Bacteria | 74661 |
| 878 | Ga0495625_0001933 | 3300046660 | Bacteria | 23424 |
| 879 | Ga0495625_0052360 | 3300046660 | Bacteria | 2923 |
| 880 | Ga0495625_0052735 | 3300046660 | Bacteria | 2911 |
| 881 | Ga0495625_0595165 | 3300046660 | Bacteria | 664 |
| 882 | Ga0495625_0678839 | 3300046660 | Bacteria | 610 |
| 883 | Ga0495661_0029023 | 3300046665 | Bacteria | 3534 |
| 884 | Ga0495661_0085204 | 3300046665 | Bacteria | 1811 |
| 885 | Ga0495661_0557674 | 3300046665 | Bacteria | 541 |
| 886 | Ga0495599_0166783 | 3300046678 | Bacteria | 1360 |
| 887 | Ga0495669_0338445 | 3300046684 | Bacteria | 727 |
| 888 | Ga0495669_0439608 | 3300046684 | Bacteria | 633 |
| 889 | Ga0495670_0188908 | 3300046691 | Bacteria | 1089 |
| 890 | Ga0495670_0494052 | 3300046691 | Bacteria | 664 |
| 891 | Ga0495671_0061380 | 3300046692 | Bacteria | 1854 |
| 892 | Ga0495671_0536382 | 3300046692 | Bacteria | 557 |
| 893 | Ga0495649_0000105 | 3300046694 | Bacteria | 74750 |
| 894 | Ga0495649_0104095 | 3300046694 | Bacteria | 1507 |
| 895 | Ga0495589_0072429 | 3300046794 | Bacteria | 1683 |
| 896 | Ga0495660_0024916 | 3300046810 | Bacteria | 3403 |
| 897 | Ga0495660_0035007 | 3300046810 | Bacteria | 2807 |
| 898 | Ga0495604_0218419 | 3300047317 | Bacteria | 1314 |
| 899 | Ga0495674_0697615 | 3300047319 | Unclassified | 797 |
| 900 | Ga0495680_0187885 | 3300047322 | Bacteria | 1487 |
| 901 | Ga0495683_0017548 | 3300047323 | Bacteria | 3709 |
| 902 | Ga0495683_0153279 | 3300047323 | Bacteria | 1071 |
| 903 | Ga0495687_000233 | 3300047443 | Bacteria | 77056 |
| 904 | Ga0495687_007622 | 3300047443 | Bacteria | 6340 |
| 905 | Ga0495677_0294842 | 3300047445 | Bacteria | 637 |
| 906 | Ga0495679_020659 | 3300047446 | Bacteria | 2290 |
| 907 | Ga0495685_056387 | 3300047447 | Bacteria | 1328 |
| 908 | Ga0495673_0026477 | 3300047469 | Bacteria | 2772 |
| 909 | Ga0495673_0176259 | 3300047469 | Bacteria | 812 |
| 910 | Ga0495684_0115271 | 3300047471 | Bacteria | 2026 |
| 911 | Ga0495686_0004601 | 3300047472 | Bacteria | 11246 |
| 912 | Ga0495686_0034321 | 3300047472 | Bacteria | 3268 |
| 913 | Ga0495686_0063660 | 3300047472 | Bacteria | 2285 |
| 914 | Ga0495686_0087827 | 3300047472 | Bacteria | 1891 |
| 915 | Ga0495686_0219736 | 3300047472 | Bacteria | 1081 |
| 916 | Ga0495686_0337332 | 3300047472 | Bacteria | 822 |
| 917 | Ga0495686_0395132 | 3300047472 | Bacteria | 743 |
| 918 | Ga0495593_0118263 | 3300047673 | Bacteria | 1350 |
| 919 | Ga0495602_0572585 | 3300048088 | Bacteria | 780 |
| 920 | Ga0495614_0016505 | 3300048089 | Bacteria | 3213 |
| 921 | Ga0496103_0247774 | 3300048906 | Bacteria | 1146 |
| 922 | Ga0496105_0297810 | 3300048908 | Bacteria | 1297 |
| 923 | Ga0496105_0632892 | 3300048908 | Bacteria | 827 |
| 924 | Ga0496113_0026121 | 3300048916 | Bacteria | 4172 |
| 925 | Ga0496114_0299048 | 3300048917 | Bacteria | 1421 |
| 926 | Ga0496115_0024014 | 3300048918 | Bacteria | 4736 |
| 927 | Ga0496115_0192438 | 3300048918 | Bacteria | 1685 |
| 928 | Ga0496115_0562502 | 3300048918 | Bacteria | 910 |
| 929 | Ga0496115_0564860 | 3300048918 | Bacteria | 908 |
| 930 | Ga0496115_0624065 | 3300048918 | Bacteria | 855 |
| 931 | Ga0496116_0000024 | 3300048919 | Bacteria | 471420 |
| 932 | Ga0496116_0000029 | 3300048919 | Bacteria | 422187 |
| 933 | Ga0496116_0030225 | 3300048919 | Bacteria | 3895 |
| 934 | Ga0496117_0000007 | 3300048920 | Bacteria | 720505 |
| 935 | Ga0496117_0001863 | 3300048920 | Bacteria | 28457 |
| 936 | Ga0496117_0099930 | 3300048920 | Bacteria | 1839 |
| 937 | Ga0496118_0000252 | 3300048921 | Bacteria | 94470 |
| 938 | Ga0496118_0033058 | 3300048921 | Bacteria | 4251 |
| 939 | Ga0496119_0000007 | 3300048922 | Bacteria | 475920 |
| 940 | Ga0496120_0007422 | 3300048923 | Bacteria | 8154 |
| 941 | Ga0496121_0014632 | 3300048924 | Bacteria | 8299 |
| 942 | Ga0496121_0640182 | 3300048924 | Bacteria | 649 |
| 943 | Ga0496122_0008592 | 3300048925 | Bacteria | 10970 |
| 944 | Ga0496122_0063397 | 3300048925 | Bacteria | 2697 |
| 945 | Ga0496122_0199187 | 3300048925 | Bacteria | 1173 |
| 946 | Ga0496123_0029360 | 3300048926 | Bacteria | 4049 |
| 947 | Ga0496123_0041623 | 3300048926 | Bacteria | 3181 |
| 948 | Ga0496124_0013719 | 3300048927 | Bacteria | 7890 |
| 949 | Ga0496124_0035036 | 3300048927 | Bacteria | 4396 |
| 950 | Ga0496124_0075016 | 3300048927 | Bacteria | 2795 |
| 951 | Ga0496124_0382692 | 3300048927 | Bacteria | 983 |
| 952 | Ga0496125_0000018 | 3300048928 | Bacteria | 482390 |
| 953 | Ga0496125_0000031 | 3300048928 | Bacteria | 365156 |
| 954 | Ga0496126_0024337 | 3300048929 | Bacteria | 5847 |
| 955 | Ga0496126_0115769 | 3300048929 | Bacteria | 2330 |
| 956 | Ga0496126_0234619 | 3300048929 | Bacteria | 1535 |
| 957 | Ga0501309_013116 | 3300049129 | Bacteria | 1099 |
| 958 | Ga0501310_000150 | 3300049130 | Bacteria | 6818 |
| 959 | Ga0501310_052159 | 3300049130 | Bacteria | 594 |
| 960 | Ga0501310_058494 | 3300049130 | Bacteria | 571 |
| 961 | Ga0501341_00148 | 3300049131 | Bacteria | 2345 |
| 962 | Ga0501343_000882 | 3300049132 | Bacteria | 1912 |
| 963 | Ga0501343_001312 | 3300049132 | Bacteria | 1665 |
| 964 | Ga0501344_02798 | 3300049133 | Bacteria | 911 |
| 965 | Ga0501305_004819 | 3300049161 | Bacteria | 1607 |
| 966 | Ga0501307_005377 | 3300049162 | Bacteria | 1348 |
| 967 | Ga0501307_015314 | 3300049162 | Bacteria | 946 |
| 968 | Ga0501342_00756 | 3300049163 | Bacteria | 924 |
| 969 | Ga0495678_011400 | 3300049459 | Bacteria | 4260 |
| 970 | Ga0495682_0007252 | 3300049460 | Bacteria | 4426 |
| 971 | Ga0495682_0034802 | 3300049460 | Bacteria | 1857 |
| 972 | Ga0501291_160291 | 3300049514 | Bacteria | 514 |
| 973 | Ga0501311_002317 | 3300049527 | Bacteria | 1809 |
| 974 | Ga0501311_046567 | 3300049527 | Bacteria | 670 |
| 975 | Ga0501311_087684 | 3300049527 | Bacteria | 537 |
| 976 | Ga0501314_000001 | 3300049530 | Bacteria | 13837 |
| 977 | Ga0501315_001224 | 3300049531 | Bacteria | 2127 |
| 978 | Ga0501315_049531 | 3300049531 | Bacteria | 657 |
| 979 | Ga0501316_012746 | 3300049532 | Bacteria | 986 |
| 980 | Ga0501316_057983 | 3300049532 | Bacteria | 568 |
| 981 | Ga0501317_000248 | 3300049533 | Bacteria | 3386 |
| 982 | Ga0501317_004963 | 3300049533 | Bacteria | 1407 |
| 983 | Ga0501317_013448 | 3300049533 | Bacteria | 1024 |
| 984 | Ga0501317_054344 | 3300049533 | Bacteria | 643 |
| 985 | Ga0501319_000002 | 3300049535 | Bacteria | 13675 |
| 986 | Ga0501319_000013 | 3300049535 | Bacteria | 7475 |
| 987 | Ga0501320_000101 | 3300049536 | Bacteria | 3800 |
| 988 | Ga0501320_001086 | 3300049536 | Bacteria | 1872 |
| 989 | Ga0501320_002561 | 3300049536 | Bacteria | 1465 |
| 990 | Ga0501320_002568 | 3300049536 | Bacteria | 1464 |
| 991 | Ga0501320_003510 | 3300049536 | Bacteria | 1335 |
| 992 | Ga0501320_014417 | 3300049536 | Bacteria | 854 |
| 993 | Ga0501320_030445 | 3300049536 | Bacteria | 669 |
| 994 | Ga0501321_000885 | 3300049537 | Bacteria | 2168 |
| 995 | Ga0501321_005576 | 3300049537 | Bacteria | 1250 |
| 996 | Ga0501321_007433 | 3300049537 | Bacteria | 1138 |
| 997 | Ga0501321_023337 | 3300049537 | Bacteria | 784 |
| 998 | Ga0501323_000002 | 3300049539 | Bacteria | 14311 |
| 999 | Ga0501323_001127 | 3300049539 | Bacteria | 2270 |
| 1000 | Ga0501323_028392 | 3300049539 | Bacteria | 775 |
| 1001 | Ga0501324_000002 | 3300049540 | Bacteria | 14212 |
| 1002 | Ga0501325_000286 | 3300049541 | Bacteria | 2190 |
| 1003 | Ga0501326_00056 | 3300049542 | Bacteria | 3508 |
| 1004 | Ga0501327_00944 | 3300049543 | Bacteria | 1310 |
| 1005 | Ga0501327_01047 | 3300049543 | Bacteria | 1267 |
| 1006 | Ga0501327_05091 | 3300049543 | Unclassified | 768 |
| 1007 | Ga0501328_06523 | 3300049544 | Bacteria | 607 |
| 1008 | Ga0501328_08669 | 3300049544 | Bacteria | 556 |
| 1009 | Ga0501329_00788 | 3300049545 | Bacteria | 1240 |
| 1010 | Ga0501329_01481 | 3300049545 | Bacteria | 1032 |
| 1011 | Ga0501329_03606 | 3300049545 | Bacteria | 794 |
| 1012 | Ga0501329_14337 | 3300049545 | Bacteria | 529 |
| 1013 | Ga0501330_000098 | 3300049546 | Bacteria | 2661 |
| 1014 | Ga0501330_003276 | 3300049546 | Bacteria | 958 |
| 1015 | Ga0501330_005826 | 3300049546 | Bacteria | 794 |
| 1016 | Ga0501330_008060 | 3300049546 | Unclassified | 717 |
| 1017 | Ga0501331_00043 | 3300049547 | Bacteria | 3363 |
| 1018 | Ga0501332_07091 | 3300049548 | Bacteria | 711 |
| 1019 | Ga0501333_001376 | 3300049549 | Bacteria | 1306 |
| 1020 | Ga0501333_015054 | 3300049549 | Bacteria | 584 |
| 1021 | Ga0501334_00034 | 3300049550 | Bacteria | 4194 |
| 1022 | Ga0501334_00766 | 3300049550 | Bacteria | 1605 |
| 1023 | Ga0501334_04718 | 3300049550 | Bacteria | 882 |
| 1024 | Ga0501334_04908 | 3300049550 | Bacteria | 872 |
| 1025 | Ga0501334_13708 | 3300049550 | Bacteria | 609 |
| 1026 | Ga0501335_000048 | 3300049551 | Bacteria | 4932 |
| 1027 | Ga0501335_000133 | 3300049551 | Bacteria | 3704 |
| 1028 | Ga0501335_038046 | 3300049551 | Bacteria | 561 |
| 1029 | Ga0501336_002550 | 3300049552 | Bacteria | 1175 |
| 1030 | Ga0501336_008383 | 3300049552 | Bacteria | 799 |
| 1031 | Ga0501336_011449 | 3300049552 | Bacteria | 723 |
| 1032 | Ga0501336_035032 | 3300049552 | Bacteria | 505 |
| 1033 | Ga0501337_000033 | 3300049553 | Bacteria | 5041 |
| 1034 | Ga0501337_000486 | 3300049553 | Bacteria | 1947 |
| 1035 | Ga0501337_004812 | 3300049553 | Bacteria | 891 |
| 1036 | Ga0501338_05037 | 3300049554 | Bacteria | 812 |
| 1037 | Ga0501338_09963 | 3300049554 | Bacteria | 637 |
| 1038 | Ga0501340_001237 | 3300049556 | Bacteria | 1348 |
| 1039 | Ga0501340_002116 | 3300049556 | Bacteria | 1131 |
| 1040 | Ga0501340_006596 | 3300049556 | Bacteria | 783 |
| 1041 | Ga0501033_0095233 | 3300049570 | Bacteria | 2176 |
| 1042 | Ga0501034_0125981 | 3300049571 | Bacteria | 2547 |
| 1043 | Ga0501034_0636321 | 3300049571 | Bacteria | 969 |
| 1044 | Ga0501036_0362242 | 3300049572 | Bacteria | 1211 |
| 1045 | Ga0501039_0719974 | 3300049575 | Bacteria | 780 |
| 1046 | Ga0501043_0748300 | 3300049579 | Bacteria | 711 |
| 1047 | Ga0501047_0037417 | 3300049581 | Bacteria | 4693 |
| 1048 | Ga0501223_000581 | 3300049663 | Bacteria | 8828 |
| 1049 | Ga0501238_000015 | 3300049671 | Bacteria | 31964 |
| 1050 | Ga0501238_071420 | 3300049671 | Bacteria | 539 |
| 1051 | Ga0501249_019696 | 3300049679 | Bacteria | 1465 |
| 1052 | Ga0501249_034752 | 3300049679 | Bacteria | 1131 |
| 1053 | Ga0501251_001173 | 3300049681 | Bacteria | 2420 |
| 1054 | Ga0501241_000002 | 3300049758 | Bacteria | 194532 |
| 1055 | Ga0501241_002715 | 3300049758 | Bacteria | 3407 |
| 1056 | Ga0501266_000002 | 3300049763 | Bacteria | 459947 |
| 1057 | Ga0501269_000004 | 3300049766 | Bacteria | 91854 |
| 1058 | Ga0501269_001937 | 3300049766 | Bacteria | 2612 |
| 1059 | Ga0501271_071016 | 3300049768 | Bacteria | 504 |
| 1060 | Ga0501280_000239 | 3300049776 | Bacteria | 13899 |
| 1061 | Ga0501280_059225 | 3300049776 | Bacteria | 662 |
| 1062 | Ga0501035_0018430 | 3300049822 | Bacteria | 6432 |
| 1063 | nmdc:mga03683_18140_c1 | 3300050489 | Bacteria | 2672 |
| 1064 | nmdc:mga00v17_939552_c1 | 3300050491 | Bacteria | 546 |
| 1065 | nmdc:mga0k408_24179_c1 | 3300050493 | Bacteria | 3433 |
| 1066 | nmdc:mga0k408_349_c1 | 3300050493 | Bacteria | 23383 |
| 1067 | nmdc:mga0k408_378984_c1 | 3300050493 | Bacteria | 843 |
| 1068 | nmdc:mga07m45_270409_c1 | 3300050496 | Bacteria | 989 |
| 1069 | nmdc:mga07m45_38113_c1 | 3300050496 | Bacteria | 2682 |
| 1070 | Ga0500635_0005612 | 3300053080 | Bacteria | 3303 |
| 1071 | Ga0500646_0007145 | 3300053090 | Bacteria | 2848 |
| 1072 | Ga0500646_0021012 | 3300053090 | Bacteria | 1737 |
| 1073 | Ga0500647_0264730 | 3300053091 | Bacteria | 750 |
| 1074 | Ga0500647_0339823 | 3300053091 | Bacteria | 629 |
| 1075 | Ga0500651_0569790 | 3300053093 | Bacteria | 617 |
| 1076 | Ga0500641_0000168 | 3300053096 | Bacteria | 24462 |
| 1077 | Ga0500641_0006404 | 3300053096 | Bacteria | 4180 |
| 1078 | Ga0500594_0037129 | 3300053118 | Bacteria | 1314 |
| 1079 | Ga0500608_016071 | 3300053122 | Bacteria | 3374 |
| 1080 | Ga0500608_075213 | 3300053122 | Bacteria | 1601 |
| 1081 | Ga0500618_000005 | 3300053125 | Bacteria | 253092 |
| 1082 | Ga0500618_012806 | 3300053125 | Bacteria | 2186 |
| 1083 | Ga0500642_0495421 | 3300053130 | Bacteria | 517 |
| 1084 | Ga0500652_333618 | 3300053131 | Bacteria | 578 |
| 1085 | Ga0500658_0000002 | 3300053134 | Bacteria | 548440 |
| 1086 | Ga0500559_0010320 | 3300053136 | Bacteria | 4015 |
| 1087 | Ga0500559_0042408 | 3300053136 | Bacteria | 1985 |
| 1088 | Ga0500559_0567032 | 3300053136 | Bacteria | 517 |
| 1089 | Ga0500573_0412418 | 3300053140 | Bacteria | 636 |
| 1090 | Ga0500579_161976 | 3300053143 | Bacteria | 940 |
| 1091 | Ga0500588_0154830 | 3300053146 | Bacteria | 831 |
| 1092 | Ga0500619_103271 | 3300053154 | Bacteria | 968 |
| 1093 | Ga0500622_0000385 | 3300053156 | Bacteria | 42685 |
| 1094 | Ga0500622_0163807 | 3300053156 | Bacteria | 1040 |
| 1095 | Ga0500627_0221552 | 3300053158 | Bacteria | 844 |
| 1096 | Ga0500627_0308908 | 3300053158 | Bacteria | 689 |
| 1097 | Ga0500584_021185 | 3300053726 | Bacteria | 3019 |
| 1098 | Ga0587070_001656 | 3300059491 | Bacteria | 2356 |
| 1099 | Ga0587073_0014997 | 3300059492 | Bacteria | 1389 |
| 1100 | Ga0587073_0063709 | 3300059492 | Bacteria | 872 |
| 1101 | Ga0587077_039243 | 3300059493 | Bacteria | 943 |
| 1102 | Ga0587080_002246 | 3300059503 | Bacteria | 2247 |
| 1103 | Ga0587083_0013249 | 3300059505 | Bacteria | 1401 |
| 1104 | Ga0587083_0065881 | 3300059505 | Bacteria | 829 |
| 1105 | Ga0587091_101864 | 3300059511 | Bacteria | 674 |
| 1106 | Ga0587094_028037 | 3300059513 | Bacteria | 858 |
| 1107 | Ga0587098_001742 | 3300059604 | Bacteria | 1730 |
| 1108 | Ga0587106_104451 | 3300059605 | Bacteria | 583 |
| 1109 | Ga0587068_028699 | 3300059641 | Bacteria | 953 |
| 1110 | Ga0587076_000823 | 3300059645 | Bacteria | 2847 |
| 1111 | Ga0587076_012245 | 3300059645 | Bacteria | 1278 |
| 1112 | Ga0587076_162302 | 3300059645 | Bacteria | 550 |
| 1113 | Ga0587079_016619 | 3300059647 | Bacteria | 1265 |
| 1114 | Ga0587079_097608 | 3300059647 | Bacteria | 697 |
| 1115 | Ga0451577_0178205 | |||
| 1116 | SwRhRL2b_contig_1391765 | |||
| 1117 | SwRhRL2b_contig_2038936 | |||
| 1118 | SwRhRL2b_contig_2621326 | |||
| 1119 | 2214878535 | |||
| 1120 | JGI24736J21556_1006132 | |||
| 1121 | JGI24740J21852_10022671 | |||
| 1122 | JGI24739J22299_10026719 | |||
| 1123 | JGI24737J22298_10001191 | |||
| 1124 | JGI24737J22298_10001354 | |||
| 1125 | JGI24737J22298_10015413 | |||
| 1126 | JGI24743J22301_10059010 | |||
| 1127 | JGI24735J21928_10000003 | |||
| 1128 | JGI24735J21928_10001634 | |||
| 1129 | JGI24744J21845_10004519 | |||
| 1130 | JGI25162J39368_1001033 | |||
| 1131 | JGI25157J39369_1003626 | |||
| 1132 | JGI25157J39369_1021922 | |||
| 1133 | JGI25164J39214_1001287 | |||
| 1134 | JGI25150J39212_1000005 | |||
| 1135 | JGI25151J46595_10000004 | |||
| 1136 | JGI25165J46597_1000678 | |||
| 1137 | JGI25153J46596_10000004 | |||
| 1138 | rootH1_10027299 | |||
| 1139 | rootH2_10026380 | |||
| 1140 | rootH1_10031050 | |||
| 1141 | rootH1_10127399 | |||
| 1142 | Ga0006562J51391_1003423 | |||
| 1143 | Ga0006562J51391_1011740 | |||
| 1144 | Ga0032354_1086718 | |||
| 1145 | Ga0055536_1000004 | |||
| 1146 | Ga0055534_1007293 | |||
| 1147 | Ga0055530_10000817 | |||
| 1148 | Ga0058860_10114316 | |||
| 1149 | Ga0058860_10168396 | |||
| 1150 | Ga0058862_12658366 | |||
| 1151 | Ga0065714_10040382 | |||
| 1152 | Ga0065714_10040779 | |||
| 1153 | Ga0065714_10107298 | |||
| 1154 | Ga0065714_10173528 | |||
| 1155 | Ga0065714_10221279 | |||
| 1156 | Ga0065714_10353854 | |||
| 1157 | Ga0065714_10539759 | |||
| 1158 | Ga0065704_10004895 | |||
| 1159 | Ga0065704_10025200 | |||
| 1160 | Ga0065704_10025682 | |||
| 1161 | Ga0065704_10084598 | |||
| 1162 | Ga0065704_10086392 | |||
| 1163 | Ga0065704_10103057 | |||
| 1164 | Ga0065704_10117941 | |||
| 1165 | Ga0065704_10120513 | |||
| 1166 | Ga0065712_10346876 | |||
| 1167 | Ga0065715_10036812 | |||
| 1168 | Ga0065715_10050529 | |||
| 1169 | Ga0065715_10313424 | |||
| 1170 | Ga0065715_10383148 | |||
| 1171 | Ga0065715_10594734 | |||
| 1172 | Ga0065715_10960039 | |||
| 1173 | Ga0065715_11046998 | |||
| 1174 | Ga0065707_10812159 | |||
| 1175 | Ga0070658_10000153 | |||
| 1176 | Ga0070658_10017037 | |||
| 1177 | Ga0070658_11009790 | |||
| 1178 | Ga0070658_11689079 | |||
| 1179 | Ga0070676_10000312 | |||
| 1180 | Ga0070683_100016581 | |||
| 1181 | Ga0070683_101606167 | |||
| 1182 | Ga0070670_100462742 | |||
| 1183 | Ga0068869_100334597 | |||
| 1184 | Ga0070682_100000768 | |||
| 1185 | Ga0070682_100016944 | |||
| 1186 | Ga0070682_101864756 | |||
| 1187 | Ga0068868_100075253 | |||
| 1188 | Ga0068868_100542515 | |||
| 1189 | Ga0070660_100037879 | |||
| 1190 | Ga0070660_100077147 | |||
| 1191 | Ga0070661_101790661 | |||
| 1192 | Ga0070668_100087717 | |||
| 1193 | Ga0070669_100220816 | |||
| 1194 | Ga0070669_100549346 | |||
| 1195 | Ga0070671_100072627 | |||
| 1196 | Ga0070671_101700508 | |||
| 1197 | Ga0070673_100071544 | |||
| 1198 | Ga0070673_101458771 | |||
| 1199 | Ga0070659_100000375 | |||
| 1200 | Ga0070659_100008718 | |||
| 1201 | Ga0070659_100059763 | |||
| 1202 | Ga0070667_100668488 | |||
| 1203 | Ga0070667_100748238 | |||
| 1204 | Ga0070710_11256102 | |||
| 1205 | Ga0070700_101068945 | |||
| 1206 | Ga0070700_101808060 | |||
| 1207 | Ga0070663_100193699 | |||
| 1208 | Ga0070663_100366341 | |||
| 1209 | Ga0070678_100001208 | |||
| 1210 | Ga0070678_100700213 | |||
| 1211 | Ga0070662_100000074 | |||
| 1212 | Ga0068867_100001333 | |||
| 1213 | Ga0070685_10022774 | |||
| 1214 | Ga0070685_11318106 | |||
| 1215 | Ga0070685_11403748 | |||
| 1216 | Ga0070679_100507017 | |||
| 1217 | Ga0070684_100023266 | |||
| 1218 | Ga0068853_100047949 | |||
| 1219 | Ga0068853_100103368 | |||
| 1220 | Ga0068853_100135737 | |||
| 1221 | Ga0068853_102162152 | |||
| 1222 | Ga0070672_100588415 | |||
| 1223 | Ga0070693_100077579 | |||
| 1224 | Ga0070693_100735546 | |||
| 1225 | Ga0070665_100000372 | |||
| 1226 | Ga0068855_100136893 | |||
| 1227 | Ga0068855_100610858 | |||
| 1228 | Ga0068855_100614523 | |||
| 1229 | Ga0068855_101246797 | |||
| 1230 | Ga0068855_102200323 | |||
| 1231 | Ga0068857_100038490 | |||
| 1232 | Ga0068857_100950569 | |||
| 1233 | Ga0068857_101388224 | |||
| 1234 | Ga0068854_100102342 | |||
| 1235 | Ga0068856_100004718 | |||
| 1236 | Ga0068856_101236713 | |||
| 1237 | Ga0068852_100014590 | |||
| 1238 | Ga0068852_100126825 | |||
| 1239 | Ga0068852_102153316 | |||
| 1240 | Ga0068861_101702480 | |||
| 1241 | Ga0068851_10000177 | |||
| 1242 | Ga0068870_10131307 | |||
| 1243 | Ga0068858_100232757 | |||
| 1244 | Ga0075363_100573991 | |||
| 1245 | Ga0075364_11083637 | |||
| 1246 | Ga0070716_100099735 | |||
| 1247 | Ga0075362_10019709 | |||
| 1248 | Ga0075427_10091689 | |||
| 1249 | Ga0075366_10000284 | |||
| 1250 | Ga0075366_10038131 | |||
| 1251 | Ga0075366_10309057 | |||
| 1252 | Ga0097621_100007799 | |||
| 1253 | Ga0097621_100105361 | |||
| 1254 | Ga0075370_10041535 | |||
| 1255 | Ga0075370_10051332 | |||
| 1256 | Ga0068871_100000141 | |||
| 1257 | Ga0068871_100017988 | |||
| 1258 | Ga0068865_100000917 | |||
| 1259 | Ga0068865_100239427 | |||
| 1260 | Ga0099824_1003374 | |||
| 1261 | Ga0079104_1000280 | |||
| 1262 | Ga0099826_10000125 | |||
| 1263 | Ga0105251_10027494 | |||
| 1264 | Ga0105251_10187951 | |||
| 1265 | Ga0105251_10362266 | |||
| 1266 | Ga0105251_10609668 | |||
| 1267 | Ga0105244_10000005 | |||
| 1268 | Ga0105244_10017933 | |||
| 1269 | Ga0105244_10021607 | |||
| 1270 | Ga0105250_10010102 | |||
| 1271 | Ga0105240_10041987 | |||
| 1272 | Ga0105240_10442980 | |||
| 1273 | Ga0105240_10635498 | |||
| 1274 | Ga0105240_11252228 | |||
| 1275 | Ga0105240_11703708 | |||
| 1276 | Ga0105240_12585689 | |||
| 1277 | Ga0105240_12724179 | |||
| 1278 | Ga0111539_13514179 | |||
| 1279 | Ga0105245_10361405 | |||
| 1280 | Ga0105245_10363352 | |||
| 1281 | Ga0105247_10604263 | |||
| 1282 | Ga0105243_10000009 | |||
| 1283 | Ga0105243_10077834 | |||
| 1284 | Ga0105243_10085327 | |||
| 1285 | Ga0105241_10009907 | |||
| 1286 | Ga0105241_10139680 | |||
| 1287 | Ga0105242_10045059 | |||
| 1288 | Ga0105242_10066602 | |||
| 1289 | Ga0105242_10066640 | |||
| 1290 | Ga0105242_10083836 | |||
| 1291 | Ga0105242_10781079 | |||
| 1292 | Ga0105237_10022954 | |||
| 1293 | Ga0105237_10055807 | |||
| 1294 | Ga0105237_10187238 | |||
| 1295 | Ga0105237_10264787 | |||
| 1296 | Ga0105237_10294383 | |||
| 1297 | Ga0105237_11657314 | |||
| 1298 | Ga0105237_11731455 | |||
| 1299 | Ga0105238_10017754 | |||
| 1300 | Ga0105238_10328852 | |||
| 1301 | Ga0105238_10639563 | |||
| 1302 | Ga0105249_10086789 | |||
| 1303 | Ga0105249_10152965 | |||
| 1304 | Ga0105239_10000011 | |||
| 1305 | Ga0105239_10004149 | |||
| 1306 | Ga0105239_10051636 | |||
| 1307 | Ga0105239_10274203 | |||
| 1308 | Ga0105239_12917918 | |||
| 1309 | Ga0105246_10286675 | |||
| 1310 | Ga0105246_10663353 | |||
| 1311 | Ga0157339_1068994 | |||
| 1312 | Ga0157373_10001369 | |||
| 1313 | Ga0157373_10014797 | |||
| 1314 | Ga0157373_10018712 | |||
| 1315 | Ga0157373_10021916 | |||
| 1316 | Ga0157373_10056873 | |||
| 1317 | Ga0157373_10454258 | |||
| 1318 | Ga0157373_10945416 | |||
| 1319 | Ga0157371_10000041 | |||
| 1320 | Ga0157371_10000091 | |||
| 1321 | Ga0157371_10001664 | |||
| 1322 | Ga0157371_10001678 | |||
| 1323 | Ga0157371_10011325 | |||
| 1324 | Ga0157371_10152177 | |||
| 1325 | Ga0157371_10923752 | |||
| 1326 | Ga0157370_10019720 | |||
| 1327 | Ga0157370_10019865 | |||
| 1328 | Ga0157370_10050897 | |||
| 1329 | Ga0157370_10061399 | |||
| 1330 | Ga0157370_10082740 | |||
| 1331 | Ga0157370_10103183 | |||
| 1332 | Ga0157370_10136293 | |||
| 1333 | Ga0157370_10198056 | |||
| 1334 | Ga0157370_10205503 | |||
| 1335 | Ga0157370_10241805 | |||
| 1336 | Ga0157370_10433480 | |||
| 1337 | Ga0157370_10461645 | |||
| 1338 | Ga0157370_10491794 | |||
| 1339 | Ga0157370_10581815 | |||
| 1340 | Ga0157370_10823713 | |||
| 1341 | Ga0157370_11746104 | |||
| 1342 | Ga0157370_11758029 | |||
| 1343 | Ga0157369_10000023 | |||
| 1344 | Ga0157369_10000613 | |||
| 1345 | Ga0157369_10007412 | |||
| 1346 | Ga0157369_10010007 | |||
| 1347 | Ga0157369_10011350 | |||
| 1348 | Ga0157369_10068434 | |||
| 1349 | Ga0157369_10134645 | |||
| 1350 | Ga0157374_10080845 | |||
| 1351 | Ga0157374_10083204 | |||
| 1352 | Ga0157374_10109918 | |||
| 1353 | Ga0157374_12941374 | |||
| 1354 | Ga0157378_10008303 | |||
| 1355 | Ga0157378_10163750 | |||
| 1356 | Ga0157378_10207177 | |||
| 1357 | Ga0157378_10377844 | |||
| 1358 | Ga0157378_11992814 | |||
| 1359 | Ga0163162_10001202 | |||
| 1360 | Ga0163162_10022452 | |||
| 1361 | Ga0163162_10043233 | |||
| 1362 | Ga0163162_10079118 | |||
| 1363 | Ga0163162_10469381 | |||
| 1364 | Ga0163162_12180192 | |||
| 1365 | Ga0157372_10001364 | |||
| 1366 | Ga0157372_10011651 | |||
| 1367 | Ga0157372_11168352 | |||
| 1368 | Ga0157372_12894872 | |||
| 1369 | Ga0157375_10066260 | |||
| 1370 | Ga0157375_10099282 | |||
| 1371 | Ga0157375_10111014 | |||
| 1372 | Ga0157375_10448617 | |||
| 1373 | Ga0157375_10629371 | |||
| 1374 | Ga0163163_10506767 | |||
| 1375 | Ga0163163_12180082 | |||
| 1376 | Ga0157380_10141735 | |||
| 1377 | Ga0182008_10000003 | |||
| 1378 | Ga0182008_10000600 | |||
| 1379 | Ga0182008_10480849 | |||
| 1380 | Ga0182008_10503206 | |||
| 1381 | Ga0157377_10016958 | |||
| 1382 | Ga0157376_10225806 | |||
| 1383 | Ga0157376_10782151 | |||
| 1384 | Ga0157376_11196307 | |||
| 1385 | Ga0157376_11681224 | |||
| 1386 | Ga0157376_11909493 | |||
| 1387 | Ga0182006_1000001 | |||
| 1388 | Ga0182006_1013176 | |||
| 1389 | Ga0182006_1032965 | |||
| 1390 | Ga0182006_1062258 | |||
| 1391 | Ga0182006_1070319 | |||
| 1392 | Ga0182006_1130340 | |||
| 1393 | Ga0182006_1131768 | |||
| 1394 | Ga0182007_10000002 | |||
| 1395 | Ga0182007_10012229 | |||
| 1396 | Ga0182007_10043758 | |||
| 1397 | Ga0183373_1004 | |||
| 1398 | Ga0163161_10000039 | |||
| 1399 | Ga0163161_10085599 | |||
| 1400 | Ga0163161_10087878 | |||
| 1401 | Ga0163161_10276760 | |||
| 1402 | Ga0163161_10660535 | |||
| 1403 | Ga0163161_11145722 | |||
| 1404 | Ga0163161_11341130 | |||
| 1405 | Ga0163161_11535214 | |||
| 1406 | Ga0163161_12048240 | |||
| 1407 | Ga0197907_10083044 | |||
| 1408 | Ga0206356_10776358 | |||
| 1409 | Ga0206349_1760011 | |||
| 1410 | Ga0206351_10267476 | |||
| 1411 | Ga0206352_10304197 | |||
| 1412 | Ga0206350_10037838 | |||
| 1413 | Ga0206350_11510146 | |||
| 1414 | Ga0206354_11620711 | |||
| 1415 | Ga0206353_10538520 | |||
| 1416 | Ga0206353_11557329 | |||
| 1417 | Ga0154015_1410599 | |||
| 1418 | Ga0154015_1680355 | |||
| 1419 | Ga0213872_10006418 | |||
| 1420 | Ga0224712_10012850 | |||
| 1421 | Ga0224712_10038295 | |||
| 1422 | Ga0209563_107301 | |||
| 1423 | Ga0207427_100025 | |||
| 1424 | Ga0209437_100010 | |||
| 1425 | Ga0207425_1000008 | |||
| 1426 | Ga0209026_1000610 | |||
| 1427 | Ga0209026_1003238 | |||
| 1428 | Ga0209129_1000040 | |||
| 1429 | Ga0209233_1000017 | |||
| 1430 | Ga0209233_1001079 | |||
| 1431 | Ga0209233_1003581 | |||
| 1432 | Ga0209675_1000115 | |||
| 1433 | Ga0209676_1000009 | |||
| 1434 | Ga0209025_1000020 | |||
| 1435 | Ga0209758_1000022 | |||
| 1436 | Ga0209050_1000048 | |||
| 1437 | Ga0207656_10002394 | |||
| 1438 | Ga0207696_1020048 | |||
| 1439 | Ga0207655_1000016 | |||
| 1440 | Ga0207655_1000038 | |||
| 1441 | Ga0207655_1058892 | |||
| 1442 | Ga0207647_10000171 | |||
| 1443 | Ga0207647_10017185 | |||
| 1444 | Ga0207647_10022768 | |||
| 1445 | Ga0207645_10000035 | |||
| 1446 | Ga0207643_10138010 | |||
| 1447 | Ga0207705_10000108 | |||
| 1448 | Ga0207705_10104158 | |||
| 1449 | Ga0207705_10131644 | |||
| 1450 | Ga0207705_10330934 | |||
| 1451 | Ga0207705_11087995 | |||
| 1452 | Ga0207705_11167483 | |||
| 1453 | Ga0207654_10091095 | |||
| 1454 | Ga0207654_11275353 | |||
| 1455 | Ga0207695_10000053 | |||
| 1456 | Ga0207695_10084356 | |||
| 1457 | Ga0207695_10276587 | |||
| 1458 | Ga0207695_11495245 | |||
| 1459 | Ga0207671_10017153 | |||
| 1460 | Ga0207671_10039460 | |||
| 1461 | Ga0207671_10228749 | |||
| 1462 | Ga0207671_10236880 | |||
| 1463 | Ga0207671_11522095 | |||
| 1464 | Ga0207657_10023513 | |||
| 1465 | Ga0207657_10025871 | |||
| 1466 | Ga0207657_10038645 | |||
| 1467 | Ga0207657_10463205 | |||
| 1468 | Ga0207649_11457607 | |||
| 1469 | Ga0207652_10101465 | |||
| 1470 | Ga0207681_10350064 | |||
| 1471 | Ga0207681_10549683 | |||
| 1472 | Ga0207694_10009649 | |||
| 1473 | Ga0207694_10210432 | |||
| 1474 | Ga0207694_10238583 | |||
| 1475 | Ga0207650_11891571 | |||
| 1476 | Ga0207687_10427676 | |||
| 1477 | Ga0207664_10627311 | |||
| 1478 | Ga0207690_10002170 | |||
| 1479 | Ga0207690_10014765 | |||
| 1480 | Ga0207706_10293082 | |||
| 1481 | Ga0207686_10035366 | |||
| 1482 | Ga0207686_10962536 | |||
| 1483 | Ga0207709_10000026 | |||
| 1484 | Ga0207709_10000084 | |||
| 1485 | Ga0207709_10045783 | |||
| 1486 | Ga0207669_11730187 | |||
| 1487 | Ga0207704_10000036 | |||
| 1488 | Ga0207691_10434847 | |||
| 1489 | Ga0207661_10011066 | |||
| 1490 | Ga0207661_11566363 | |||
| 1491 | Ga0207667_10112632 | |||
| 1492 | Ga0207667_10489647 | |||
| 1493 | Ga0207667_10602320 | |||
| 1494 | Ga0207667_11137603 | |||
| 1495 | Ga0207667_11416086 | |||
| 1496 | Ga0207651_10032626 | |||
| 1497 | Ga0207712_10050092 | |||
| 1498 | Ga0207712_10232294 | |||
| 1499 | Ga0207712_11634522 | |||
| 1500 | Ga0207668_10226545 | |||
| 1501 | Ga0207668_11593901 | |||
| 1502 | Ga0207677_10193616 | |||
| 1503 | Ga0207677_10783953 | |||
| 1504 | Ga0207639_10046024 | |||
| 1505 | Ga0207639_10366613 | |||
| 1506 | Ga0207639_10433554 | |||
| 1507 | Ga0207639_10759718 | |||
| 1508 | Ga0207678_10078056 | |||
| 1509 | Ga0207708_11618914 | |||
| 1510 | Ga0207702_10024936 | |||
| 1511 | Ga0207648_10000333 | |||
| 1512 | Ga0207648_12072307 | |||
| 1513 | Ga0207676_12499757 | |||
| 1514 | Ga0207674_10016950 | |||
| 1515 | Ga0207674_10347462 | |||
| 1516 | Ga0207674_10477422 | |||
| 1517 | Ga0207675_102582209 | |||
| 1518 | Ga0207683_10000982 | |||
| 1519 | Ga0207683_10225777 | |||
| 1520 | Ga0207698_10011872 | |||
| 1521 | Ga0207698_10101413 | |||
| 1522 | Ga0209281_1000337 | |||
| 1523 | Ga0209489_111364 | |||
| 1524 | Ga0209984_1008899 | |||
| 1525 | Ga0209995_1020587 | |||
| 1526 | Ga0209968_1000671 | |||
| 1527 | Ga0209968_1083787 | |||
| 1528 | Ga0209999_1033339 | |||
| 1529 | Ga0209982_1056554 | |||
| 1530 | Ga0210002_1001591 | |||
| 1531 | Ga0209282_1028939 | |||
| 1532 | Ga0209966_1031903 | |||
| 1533 | Ga0268266_10000658 | |||
| 1534 | Ga0268264_10410213 | |||
| 1535 | Ga0265318_10147131 | |||
| 1536 | Ga0265336_10163785 | |||
| 1537 | Ga0307517_10012583 | |||
| 1538 | Ga0307515_10028989 | |||
| 1539 | Ga0307515_10403780 | |||
| 1540 | Ga0265338_10001162 | |||
| 1541 | Ga0265338_10007954 | |||
| 1542 | Ga0316176_1208558 | |||
| 1543 | Ga0316179_1109740 | |||
| 1544 | Ga0316182_1045167 | |||
| 1545 | Ga0265332_10298127 | |||
| 1546 | Ga0265325_10085944 | |||
| 1547 | Ga0265327_10004316 | |||
| 1548 | Ga0265327_10019355 | |||
| 1549 | Ga0265327_10163448 | |||
| 1550 | Ga0265327_10356138 | |||
| 1551 | Ga0265316_10002446 | |||
| 1552 | Ga0265316_10317853 | |||
| 1553 | Ga0307513_10153709 | |||
| 1554 | Ga0307509_10498984 | |||
| 1555 | Ga0307408_100056125 | |||
| 1556 | Ga0307408_100926672 | |||
| 1557 | Ga0307408_102170990 | |||
| 1558 | Ga0316579_10079495 | |||
| 1559 | Ga0265342_10082046 | |||
| 1560 | Ga0265342_10146276 | |||
| 1561 | Ga0265342_10260322 | |||
| 1562 | Ga0265342_10448363 | |||
| 1563 | Ga0316576_10001965 | |||
| 1564 | Ga0316576_10038081 | |||
| 1565 | Ga0316576_10052895 | |||
| 1566 | Ga0316576_10164563 | |||
| 1567 | Ga0316576_10258615 | |||
| 1568 | Ga0316576_10400296 | |||
| 1569 | Ga0316576_10421965 | |||
| 1570 | Ga0316576_10562728 | |||
| 1571 | Ga0316576_10599487 | |||
| 1572 | Ga0316576_10744439 | |||
| 1573 | Ga0316576_11002327 | |||
| 1574 | Ga0316576_11174883 | |||
| 1575 | Ga0316578_10261755 | |||
| 1576 | Ga0307405_10000005 | |||
| 1577 | Ga0307405_10000006 | |||
| 1578 | Ga0307405_10041034 | |||
| 1579 | Ga0307405_10197523 | |||
| 1580 | Ga0307405_10285692 | |||
| 1581 | Ga0307405_11376350 | |||
| 1582 | Ga0316577_10008426 | |||
| 1583 | Ga0316577_10361873 | |||
| 1584 | Ga0316577_10543555 | |||
| 1585 | Ga0316577_10840365 | |||
| 1586 | Ga0307413_10001014 | |||
| 1587 | Ga0307413_10001307 | |||
| 1588 | Ga0307413_10040535 | |||
| 1589 | Ga0307413_10657550 | |||
| 1590 | Ga0307413_11181026 | |||
| 1591 | Ga0307413_11541395 | |||
| 1592 | Ga0307410_10000034 | |||
| 1593 | Ga0307410_10396019 | |||
| 1594 | Ga0307406_10000004 | |||
| 1595 | Ga0307406_10361121 | |||
| 1596 | Ga0307407_10000003 | |||
| 1597 | Ga0307407_10000196 | |||
| 1598 | Ga0307412_10000088 | |||
| 1599 | Ga0307412_10002740 | |||
| 1600 | Ga0307412_10053164 | |||
| 1601 | Ga0307412_10268629 | |||
| 1602 | Ga0307412_10312732 | |||
| 1603 | Ga0307412_10401220 | |||
| 1604 | Ga0307412_10643817 | |||
| 1605 | Ga0307409_100028055 | |||
| 1606 | Ga0307416_100000002 | |||
| 1607 | Ga0307416_100000006 | |||
| 1608 | Ga0307416_100010892 | |||
| 1609 | Ga0307414_10000011 | |||
| 1610 | Ga0307414_10000030 | |||
| 1611 | Ga0307414_10000673 | |||
| 1612 | Ga0307414_10000927 | |||
| 1613 | Ga0307414_10007281 | |||
| 1614 | Ga0307414_10009268 | |||
| 1615 | Ga0307414_10009965 | |||
| 1616 | Ga0307414_10011571 | |||
| 1617 | Ga0307414_10011719 | |||
| 1618 | Ga0307414_10014563 | |||
| 1619 | Ga0307414_10024140 | |||
| 1620 | Ga0307414_10042491 | |||
| 1621 | Ga0307414_10080701 | |||
| 1622 | Ga0307414_10123751 | |||
| 1623 | Ga0307414_10212613 | |||
| 1624 | Ga0307414_10286969 | |||
| 1625 | Ga0307414_10471367 | |||
| 1626 | Ga0307414_10490184 | |||
| 1627 | Ga0307414_10547897 | |||
| 1628 | Ga0307414_10732583 | |||
| 1629 | Ga0307414_10735928 | |||
| 1630 | Ga0307414_10960370 | |||
| 1631 | Ga0307414_11661410 | |||
| 1632 | Ga0307411_10000004 | |||
| 1633 | Ga0307411_10119322 | |||
| 1634 | Ga0307411_10153223 | |||
| 1635 | Ga0307411_10166804 | |||
| 1636 | Ga0307411_10976680 | |||
| 1637 | Ga0316585_10002058 | |||
| 1638 | Ga0316580_10109645 | |||
| 1639 | Ga0316580_10187250 | |||
| 1640 | Ga0316593_10000201 | |||
| 1641 | Ga0316593_10000279 | |||
| 1642 | Ga0316593_10001741 | |||
| 1643 | Ga0316593_10008603 | |||
| 1644 | Ga0316593_10025704 | |||
| 1645 | Ga0316593_10044098 | |||
| 1646 | Ga0316593_10077390 | |||
| 1647 | Ga0316593_10106176 | |||
| 1648 | Ga0316593_10118432 | |||
| 1649 | Ga0316593_10140339 | |||
| 1650 | Ga0316593_10164998 | |||
| 1651 | Ga0316593_10200655 | |||
| 1652 | Ga0316593_10321660 | |||
| 1653 | Ga0316593_10342474 | |||
| 1654 | Ga0316593_10400875 | |||
| 1655 | Ga0316593_10404845 | |||
| 1656 | Ga0307507_10000034 | |||
| 1657 | Ga0307510_10003892 | |||
| 1658 | Ga0307510_10035700 | |||
| 1659 | Ga0316592_1000131 | |||
| 1660 | Ga0316592_1001542 | |||
| 1661 | Ga0316592_1002393 | |||
| 1662 | Ga0316592_1002839 | |||
| 1663 | Ga0316592_1022509 | |||
| 1664 | Ga0316592_1026061 | |||
| 1665 | Ga0316592_1035568 | |||
| 1666 | Ga0316592_1063561 | |||
| 1667 | Ga0316592_1067956 | |||
| 1668 | Ga0316586_1018347 | |||
| 1669 | Ga0316586_1072843 | |||
| 1670 | Ga0316586_1076105 | |||
| 1671 | Ga0316586_1119418 | |||
| 1672 | Ga0316588_1000479 | |||
| 1673 | Ga0316588_1023041 | |||
| 1674 | Ga0316588_1094304 | |||
| 1675 | Ga0316588_1124404 | |||
| 1676 | Ga0316587_1096422 | |||
| 1677 | Ga0316596_1000052 | |||
| 1678 | Ga0316596_1000106 | |||
| 1679 | Ga0316596_1001043 | |||
| 1680 | Ga0316596_1002456 | |||
| 1681 | Ga0316596_1002626 | |||
| 1682 | Ga0316596_1003921 | |||
| 1683 | Ga0316596_1009524 | |||
| 1684 | Ga0316596_1016458 | |||
| 1685 | Ga0316596_1022355 | |||
| 1686 | Ga0316596_1025349 | |||
| 1687 | Ga0316596_1028216 | |||
| 1688 | Ga0316596_1029155 | |||
| 1689 | Ga0316596_1029434 | |||
| 1690 | Ga0316596_1044495 | |||
| 1691 | Ga0316596_1046954 | |||
| 1692 | Ga0316596_1061147 | |||
| 1693 | Ga0316596_1071909 | |||
| 1694 | Ga0316596_1102484 | |||
| 1695 | Ga0316596_1116222 | |||
| 1696 | Ga0316596_1127939 | |||
| 1697 | Ga0316596_1179504 | |||
| 1698 | Ga0316596_1217684 | |||
| 1699 | Ga0316596_1239773 | |||
| 1700 | Ga0373941_0018629 | |||
| 1701 | Ga0316574_0007562 | |||
| 1702 | Ga0316574_0034560 | |||
| 1703 | Ga0316574_0065061 | |||
| 1704 | Ga0316574_0097562 | |||
| 1705 | Ga0316574_0104645 | |||
| 1706 | Ga0316574_0191354 | |||
| 1707 | Ga0316574_0488456 | |||
| 1708 | Ga0316574_0631092 | |||
| 1709 | Ga0373937_0174104 | |||
| 1710 | Ga0316582_0108981 | |||
| 1711 | Ga0316584_0015050 | |||
| 1712 | Ga0316584_0020615 | |||
| 1713 | Ga0316584_0037517 | |||
| 1714 | Ga0316584_0065628 | |||
| 1715 | Ga0316584_0078998 | |||
| 1716 | Ga0316584_0132919 | |||
| 1717 | Ga0316584_0439094 | |||
| 1718 | Ga0316584_0484118 | |||
| 1719 | Ga0316584_0572670 | |||
| 1720 | Ga0316584_1078963 | |||
| 1721 | Ga0395899_0000034 | |||
| 1722 | Ga0395899_0100582 | |||
| 1723 | Ga0395899_0126981 | |||
| 1724 | Ga0395900_0000346 | |||
| 1725 | Ga0395900_0001482 | |||
| 1726 | Ga0395900_0006693 | |||
| 1727 | Ga0395898_0706147 | |||
| 1728 | Ga0395905_0000528 | |||
| 1729 | Ga0395905_0002993 | |||
| 1730 | Ga0316581_0099290 | |||
| 1731 | Ga0395901_0000351 | |||
| 1732 | Ga0395901_0007776 | |||
| 1733 | Ga0395901_1203652 | |||
| 1734 | Ga0400490_55178 | |||
| 1735 | Ga0400483_035362 | |||
| 1736 | Ga0400483_129488 | |||
| 1737 | Ga0400489_16856 | |||
| 1738 | Ga0400489_59783 | |||
| 1739 | Ga0436361_0433548 | |||
| 1740 | Ga0439447_000447 | |||
| 1741 | Ga0439466_0004165 | |||
| 1742 | Ga0439466_0031119 | |||
| 1743 | Ga0439465_0000032 | |||
| 1744 | Ga0451788_05134 | |||
| 1745 | Ga0451788_07398 | |||
| 1746 | Ga0451788_19850 | |||
| 1747 | Ga0451790_06615 | |||
| 1748 | Ga0451790_18342 | |||
| 1749 | Ga0451790_24640 | |||
| 1750 | Ga0451790_32630 | |||
| 1751 | Ga0451790_34212 | |||
| 1752 | Ga0451790_46109 | |||
| 1753 | Ga0451790_49048 | |||
| 1754 | Ga0451794_08054 | |||
| 1755 | Ga0451794_09376 | |||
| 1756 | Ga0451794_51626 | |||
| 1757 | Ga0451791_0955004 | |||
| 1758 | Ga0451791_1675939 | |||
| 1759 | Ga0451797_0517437 | |||
| 1760 | Ga0451797_0548848 | |||
| 1761 | Ga0451797_1089683 | |||
| 1762 | Ga0451795_0372407 | |||
| 1763 | Ga0451795_0626751 | |||
| 1764 | Ga0451798_0408742 | |||
| 1765 | Ga0451800_0124714 | |||
| 1766 | Ga0451802_0657423 | |||
| 1767 | Ga0451802_1561053 | |||
| 1768 | Ga0451805_041937 | |||
| 1769 | Ga0451805_049097 | |||
| 1770 | Ga0451806_282812 | |||
| 1771 | Ga0451808_27891 | |||
| 1772 | Ga0451807_1712141 | |||
| 1773 | Ga0451833_0789018 | |||
| 1774 | Ga0451837_1056715 | |||
| 1775 | Ga0451837_1663720 | |||
| 1776 | Ga0451839_1324400 | |||
| 1777 | Ga0451841_0723652 | |||
| 1778 | Ga0451841_1044112 | |||
| 1779 | Ga0451845_0433051 | |||
| 1780 | Ga0451846_10542 | |||
| 1781 | Ga0451847_0392278 | |||
| 1782 | Ga0451850_42284 | |||
| 1783 | Ga0451851_1170285 | |||
| 1784 | Ga0451852_13332 | |||
| 1785 | Ga0451843_0778330 | |||
| 1786 | Ga0451843_0938722 | |||
| 1787 | Ga0451843_0973795 | |||
| 1788 | Ga0451843_1238084 | |||
| 1789 | Ga0451843_1481279 | |||
| 1790 | Ga0451855_0120142 | |||
| 1791 | Ga0451853_2539583 | |||
| 1792 | Ga0452271_61575 | |||
| 1793 | Ga0439445_0001316 | |||
| 1794 | Ga0439445_0041163 | |||
| 1795 | Ga0439448_0031796 | |||
| 1796 | Ga0439432_062281 | |||
| 1797 | Ga0439432_094647 | |||
| 1798 | Ga0450905_008908 | |||
| 1799 | Ga0439446_0103210 | |||
| 1800 | Ga0451577_0000092 | |||
| 1801 | Ga0451577_0000433 | |||
| 1802 | Ga0451577_0004463 | |||
| 1803 | Ga0451577_0005144 | |||
| 1804 | Ga0451577_0054888 | |||
| 1805 | Ga0451577_0059569 | |||
| 1806 | Ga0451577_0080589 | |||
| 1807 | Ga0451577_0106452 | |||
| 1808 | Ga0451577_0126458 | |||
| 1809 | Ga0451577_0132072 | |||
| 1810 | Ga0451577_0159725 | |||
| 1811 | Ga0451577_0163253 | |||
| 1812 | Ga0451577_0200564 | |||
| 1813 | Ga0451577_0204287 | |||
| 1814 | Ga0451577_0288217 | |||
| 1815 | Ga0451577_0462777 | |||
| 1816 | Ga0451577_0565645 | |||
| 1817 | Ga0451577_0612796 | |||
| 1818 | Ga0451577_0716104 | |||
| 1819 | Ga0451577_0749427 | |||
| 1820 | Ga0451577_0761496 | |||
| 1821 | Ga0453683_0000055 | |||
| 1822 | Ga0453683_0000522 | |||
| 1823 | Ga0453683_0006727 | |||
| 1824 | Ga0453683_0007526 | |||
| 1825 | Ga0453683_0009005 | |||
| 1826 | Ga0453683_0014569 | |||
| 1827 | Ga0453683_0034450 | |||
| 1828 | Ga0453683_0037310 | |||
| 1829 | Ga0453683_0042864 | |||
| 1830 | Ga0453683_0077545 | |||
| 1831 | Ga0453683_0083828 | |||
| 1832 | Ga0453683_0087298 | |||
| 1833 | Ga0453683_0229162 | |||
| 1834 | Ga0453683_0239477 | |||
| 1835 | Ga0453683_0352781 | |||
| 1836 | Ga0453683_0363438 | |||
| 1837 | Ga0453683_0368994 | |||
| 1838 | Ga0453683_0873184 | |||
| 1839 | Ga0453683_0999230 | |||
| 1840 | Ga0466961_0863405 | |||
| 1841 | Ga0453684_0000413 | |||
| 1842 | Ga0453684_0000440 | |||
| 1843 | Ga0453684_0000506 | |||
| 1844 | Ga0453684_0001193 | |||
| 1845 | Ga0453684_0001382 | |||
| 1846 | Ga0453684_0001549 | |||
| 1847 | Ga0453684_0012598 | |||
| 1848 | Ga0453684_0025154 | |||
| 1849 | Ga0453684_0032953 | |||
| 1850 | Ga0453684_0038585 | |||
| 1851 | Ga0453684_0043553 | |||
| 1852 | Ga0453684_0047532 | |||
| 1853 | Ga0453684_0054508 | |||
| 1854 | Ga0453684_0055899 | |||
| 1855 | Ga0453684_0056141 | |||
| 1856 | Ga0453684_0062135 | |||
| 1857 | Ga0453684_0068294 | |||
| 1858 | Ga0453684_0079180 | |||
| 1859 | Ga0453684_0086715 | |||
| 1860 | Ga0453684_0087955 | |||
| 1861 | Ga0453684_0108947 | |||
| 1862 | Ga0453684_0125131 | |||
| 1863 | Ga0453684_0133883 | |||
| 1864 | Ga0453684_0172588 | |||
| 1865 | Ga0453684_0261448 | |||
| 1866 | Ga0453684_0278356 | |||
| 1867 | Ga0453684_0313358 | |||
| 1868 | Ga0453684_0335008 | |||
| 1869 | Ga0453684_0377094 | |||
| 1870 | Ga0453684_0397650 | |||
| 1871 | Ga0453684_0438662 | |||
| 1872 | Ga0453684_0558870 | |||
| 1873 | Ga0453684_0721544 | |||
| 1874 | Ga0453684_0932542 | |||
| 1875 | Ga0453684_1136154 | |||
| 1876 | Ga0453684_2280040 | |||
| 1877 | Ga0453684_2372640 | |||
| 1878 | Ga0453684_2473736 | |||
| 1879 | Ga0453684_2531396 | |||
| 1880 | Ga0466959_0173896 | |||
| 1881 | Ga0451576_0000113 | |||
| 1882 | Ga0451576_0000204 | |||
| 1883 | Ga0451576_0003461 | |||
| 1884 | Ga0451576_0011813 | |||
| 1885 | Ga0451576_0017866 | |||
| 1886 | Ga0451576_0027225 | |||
| 1887 | Ga0451576_0032623 | |||
| 1888 | Ga0451576_0034310 | |||
| 1889 | Ga0451576_0040065 | |||
| 1890 | Ga0451576_0053102 | |||
| 1891 | Ga0451576_0056132 | |||
| 1892 | Ga0451576_0057514 | |||
| 1893 | Ga0451576_0062248 | |||
| 1894 | Ga0451576_0087954 | |||
| 1895 | Ga0451576_0125877 | |||
| 1896 | Ga0451576_0207257 | |||
| 1897 | Ga0451576_0294905 | |||
| 1898 | Ga0451576_0609488 | |||
| 1899 | Ga0451576_1626804 | |||
| 1900 | Ga0451576_1945411 | |||
| 1901 | Ga0451576_1992218 | |||
| 1902 | Ga0451576_1999458 | |||
| 1903 | Ga0495627_000022 | |||
| 1904 | Ga0495627_021677 | |||
| 1905 | Ga0495592_0284949 | |||
| 1906 | Ga0495590_0000627 | |||
| 1907 | Ga0495629_0160521 | |||
| 1908 | Ga0495629_1086477 | |||
| 1909 | Ga0495638_0049204 | |||
| 1910 | Ga0495638_0115270 | |||
| 1911 | Ga0495638_0140267 | |||
| 1912 | Ga0495638_0242959 | |||
| 1913 | Ga0495641_0155360 | |||
| 1914 | Ga0495641_0488362 | |||
| 1915 | Ga0495651_0101584 | |||
| 1916 | Ga0495650_0000023 | |||
| 1917 | Ga0495650_0028243 | |||
| 1918 | Ga0495650_0202031 | |||
| 1919 | Ga0495662_0056763 | |||
| 1920 | Ga0495585_0000476 | |||
| 1921 | Ga0495585_0001907 | |||
| 1922 | Ga0495596_0004903 | |||
| 1923 | Ga0495596_0032305 | |||
| 1924 | Ga0495607_0014863 | |||
| 1925 | Ga0495607_0220096 | |||
| 1926 | Ga0495607_0461885 | |||
| 1927 | Ga0495583_0113021 | |||
| 1928 | Ga0495583_0153266 | |||
| 1929 | Ga0495606_0010457 | |||
| 1930 | Ga0495606_0021702 | |||
| 1931 | Ga0495606_0034482 | |||
| 1932 | Ga0495606_0048690 | |||
| 1933 | Ga0495606_0049499 | |||
| 1934 | Ga0495606_0124370 | |||
| 1935 | Ga0495606_0352579 | |||
| 1936 | Ga0495606_0619122 | |||
| 1937 | Ga0495610_0000005 | |||
| 1938 | Ga0495610_0001849 | |||
| 1939 | Ga0495610_0008200 | |||
| 1940 | Ga0495610_0196577 | |||
| 1941 | Ga0495610_0379923 | |||
| 1942 | Ga0495616_0004967 | |||
| 1943 | Ga0495616_0006047 | |||
| 1944 | Ga0495616_0082935 | |||
| 1945 | Ga0495618_0406134 | |||
| 1946 | Ga0495628_1255351 | |||
| 1947 | Ga0495631_0004390 | |||
| 1948 | Ga0495631_0462435 | |||
| 1949 | Ga0495632_0007484 | |||
| 1950 | Ga0495632_0191975 | |||
| 1951 | Ga0495637_0027540 | |||
| 1952 | Ga0495637_0043937 | |||
| 1953 | Ga0495643_0000294 | |||
| 1954 | Ga0495643_0017021 | |||
| 1955 | Ga0495643_0089150 | |||
| 1956 | Ga0495643_0346172 | |||
| 1957 | Ga0495644_0001340 | |||
| 1958 | Ga0495648_0063660 | |||
| 1959 | Ga0495663_0001345 | |||
| 1960 | Ga0495663_0012337 | |||
| 1961 | Ga0495663_0362949 | |||
| 1962 | Ga0495642_0199691 | |||
| 1963 | Ga0495652_0185319 | |||
| 1964 | Ga0495652_0712477 | |||
| 1965 | Ga0495652_0839351 | |||
| 1966 | Ga0495654_0000003 | |||
| 1967 | Ga0495654_0010358 | |||
| 1968 | Ga0495654_0031697 | |||
| 1969 | Ga0495640_0072274 | |||
| 1970 | Ga0495586_0241388 | |||
| 1971 | Ga0495598_0366777 | |||
| 1972 | Ga0495609_0000003 | |||
| 1973 | Ga0495609_0007815 | |||
| 1974 | Ga0495609_0027693 | |||
| 1975 | Ga0495609_0037227 | |||
| 1976 | Ga0495621_0153670 | |||
| 1977 | Ga0495645_0972863 | |||
| 1978 | Ga0495622_0145610 | |||
| 1979 | Ga0495633_0000072 | |||
| 1980 | Ga0495633_0003150 | |||
| 1981 | Ga0495633_0013345 | |||
| 1982 | Ga0495633_0015633 | |||
| 1983 | Ga0495633_0210516 | |||
| 1984 | Ga0495633_0376909 | |||
| 1985 | Ga0495633_0517884 | |||
| 1986 | Ga0495668_0000165 | |||
| 1987 | Ga0495668_0194258 | |||
| 1988 | Ga0495634_0400484 | |||
| 1989 | Ga0495611_0181608 | |||
| 1990 | Ga0495625_0000096 | |||
| 1991 | Ga0495625_0000308 | |||
| 1992 | Ga0495625_0001933 | |||
| 1993 | Ga0495625_0052360 | |||
| 1994 | Ga0495625_0052735 | |||
| 1995 | Ga0495625_0595165 | |||
| 1996 | Ga0495625_0678839 | |||
| 1997 | Ga0495661_0029023 | |||
| 1998 | Ga0495661_0085204 | |||
| 1999 | Ga0495661_0557674 | |||
| 2000 | Ga0495599_0166783 | |||
| 2001 | Ga0495669_0338445 | |||
| 2002 | Ga0495669_0439608 | |||
| 2003 | Ga0495670_0188908 | |||
| 2004 | Ga0495670_0494052 | |||
| 2005 | Ga0495671_0061380 | |||
| 2006 | Ga0495671_0536382 | |||
| 2007 | Ga0495649_0000105 | |||
| 2008 | Ga0495649_0104095 | |||
| 2009 | Ga0495589_0072429 | |||
| 2010 | Ga0495660_0024916 | |||
| 2011 | Ga0495660_0035007 | |||
| 2012 | Ga0495604_0218419 | |||
| 2013 | Ga0495674_0697615 | |||
| 2014 | Ga0495680_0187885 | |||
| 2015 | Ga0495683_0017548 | |||
| 2016 | Ga0495683_0153279 | |||
| 2017 | Ga0495687_000233 | |||
| 2018 | Ga0495687_007622 | |||
| 2019 | Ga0495677_0294842 | |||
| 2020 | Ga0495679_020659 | |||
| 2021 | Ga0495685_056387 | |||
| 2022 | Ga0495673_0026477 | |||
| 2023 | Ga0495673_0176259 | |||
| 2024 | Ga0495684_0115271 | |||
| 2025 | Ga0495686_0004601 | |||
| 2026 | Ga0495686_0034321 | |||
| 2027 | Ga0495686_0063660 | |||
| 2028 | Ga0495686_0087827 | |||
| 2029 | Ga0495686_0219736 | |||
| 2030 | Ga0495686_0337332 | |||
| 2031 | Ga0495686_0395132 | |||
| 2032 | Ga0495593_0118263 | |||
| 2033 | Ga0495602_0572585 | |||
| 2034 | Ga0495614_0016505 | |||
| 2035 | Ga0496103_0247774 | |||
| 2036 | Ga0496105_0297810 | |||
| 2037 | Ga0496105_0632892 | |||
| 2038 | Ga0496113_0026121 | |||
| 2039 | Ga0496114_0299048 | |||
| 2040 | Ga0496115_0024014 | |||
| 2041 | Ga0496115_0192438 | |||
| 2042 | Ga0496115_0562502 | |||
| 2043 | Ga0496115_0564860 | |||
| 2044 | Ga0496115_0624065 | |||
| 2045 | Ga0496116_0000024 | |||
| 2046 | Ga0496116_0000029 | |||
| 2047 | Ga0496116_0030225 | |||
| 2048 | Ga0496117_0000007 | |||
| 2049 | Ga0496117_0001863 | |||
| 2050 | Ga0496117_0099930 | |||
| 2051 | Ga0496118_0000252 | |||
| 2052 | Ga0496118_0033058 | |||
| 2053 | Ga0496119_0000007 | |||
| 2054 | Ga0496120_0007422 | |||
| 2055 | Ga0496121_0014632 | |||
| 2056 | Ga0496121_0640182 | |||
| 2057 | Ga0496122_0008592 | |||
| 2058 | Ga0496122_0063397 | |||
| 2059 | Ga0496122_0199187 | |||
| 2060 | Ga0496123_0029360 | |||
| 2061 | Ga0496123_0041623 | |||
| 2062 | Ga0496124_0013719 | |||
| 2063 | Ga0496124_0035036 | |||
| 2064 | Ga0496124_0075016 | |||
| 2065 | Ga0496124_0382692 | |||
| 2066 | Ga0496125_0000018 | |||
| 2067 | Ga0496125_0000031 | |||
| 2068 | Ga0496126_0024337 | |||
| 2069 | Ga0496126_0115769 | |||
| 2070 | Ga0496126_0234619 | |||
| 2071 | Ga0501309_013116 | |||
| 2072 | Ga0501310_000150 | |||
| 2073 | Ga0501310_052159 | |||
| 2074 | Ga0501310_058494 | |||
| 2075 | Ga0501341_00148 | |||
| 2076 | Ga0501343_000882 | |||
| 2077 | Ga0501343_001312 | |||
| 2078 | Ga0501344_02798 | |||
| 2079 | Ga0501305_004819 | |||
| 2080 | Ga0501307_005377 | |||
| 2081 | Ga0501307_015314 | |||
| 2082 | Ga0501342_00756 | |||
| 2083 | Ga0495678_011400 | |||
| 2084 | Ga0495682_0007252 | |||
| 2085 | Ga0495682_0034802 | |||
| 2086 | Ga0501291_160291 | |||
| 2087 | Ga0501311_002317 | |||
| 2088 | Ga0501311_046567 | |||
| 2089 | Ga0501311_087684 | |||
| 2090 | Ga0501314_000001 | |||
| 2091 | Ga0501315_001224 | |||
| 2092 | Ga0501315_049531 | |||
| 2093 | Ga0501316_012746 | |||
| 2094 | Ga0501316_057983 | |||
| 2095 | Ga0501317_000248 | |||
| 2096 | Ga0501317_004963 | |||
| 2097 | Ga0501317_013448 | |||
| 2098 | Ga0501317_054344 | |||
| 2099 | Ga0501319_000002 | |||
| 2100 | Ga0501319_000013 | |||
| 2101 | Ga0501320_000101 | |||
| 2102 | Ga0501320_001086 | |||
| 2103 | Ga0501320_002561 | |||
| 2104 | Ga0501320_002568 | |||
| 2105 | Ga0501320_003510 | |||
| 2106 | Ga0501320_014417 | |||
| 2107 | Ga0501320_030445 | |||
| 2108 | Ga0501321_000885 | |||
| 2109 | Ga0501321_005576 | |||
| 2110 | Ga0501321_007433 | |||
| 2111 | Ga0501321_023337 | |||
| 2112 | Ga0501323_000002 | |||
| 2113 | Ga0501323_001127 | |||
| 2114 | Ga0501323_028392 | |||
| 2115 | Ga0501324_000002 | |||
| 2116 | Ga0501325_000286 | |||
| 2117 | Ga0501326_00056 | |||
| 2118 | Ga0501327_00944 | |||
| 2119 | Ga0501327_01047 | |||
| 2120 | Ga0501327_05091 | |||
| 2121 | Ga0501328_06523 | |||
| 2122 | Ga0501328_08669 | |||
| 2123 | Ga0501329_00788 | |||
| 2124 | Ga0501329_01481 | |||
| 2125 | Ga0501329_03606 | |||
| 2126 | Ga0501329_14337 | |||
| 2127 | Ga0501330_000098 | |||
| 2128 | Ga0501330_003276 | |||
| 2129 | Ga0501330_005826 | |||
| 2130 | Ga0501330_008060 | |||
| 2131 | Ga0501331_00043 | |||
| 2132 | Ga0501332_07091 | |||
| 2133 | Ga0501333_001376 | |||
| 2134 | Ga0501333_015054 | |||
| 2135 | Ga0501334_00034 | |||
| 2136 | Ga0501334_00766 | |||
| 2137 | Ga0501334_04718 | |||
| 2138 | Ga0501334_04908 | |||
| 2139 | Ga0501334_13708 | |||
| 2140 | Ga0501335_000048 | |||
| 2141 | Ga0501335_000133 | |||
| 2142 | Ga0501335_038046 | |||
| 2143 | Ga0501336_002550 | |||
| 2144 | Ga0501336_008383 | |||
| 2145 | Ga0501336_011449 | |||
| 2146 | Ga0501336_035032 | |||
| 2147 | Ga0501337_000033 | |||
| 2148 | Ga0501337_000486 | |||
| 2149 | Ga0501337_004812 | |||
| 2150 | Ga0501338_05037 | |||
| 2151 | Ga0501338_09963 | |||
| 2152 | Ga0501340_001237 | |||
| 2153 | Ga0501340_002116 | |||
| 2154 | Ga0501340_006596 | |||
| 2155 | Ga0501033_0095233 | |||
| 2156 | Ga0501034_0125981 | |||
| 2157 | Ga0501034_0636321 | |||
| 2158 | Ga0501036_0362242 | |||
| 2159 | Ga0501039_0719974 | |||
| 2160 | Ga0501043_0748300 | |||
| 2161 | Ga0501047_0037417 | |||
| 2162 | Ga0501223_000581 | |||
| 2163 | Ga0501238_000015 | |||
| 2164 | Ga0501238_071420 | |||
| 2165 | Ga0501249_019696 | |||
| 2166 | Ga0501249_034752 | |||
| 2167 | Ga0501251_001173 | |||
| 2168 | Ga0501241_000002 | |||
| 2169 | Ga0501241_002715 | |||
| 2170 | Ga0501266_000002 | |||
| 2171 | Ga0501269_000004 | |||
| 2172 | Ga0501269_001937 | |||
| 2173 | Ga0501271_071016 | |||
| 2174 | Ga0501280_000239 | |||
| 2175 | Ga0501280_059225 | |||
| 2176 | Ga0501035_0018430 | |||
| 2177 | nmdc:mga03683_18140_c1 | |||
| 2178 | nmdc:mga00v17_939552_c1 | |||
| 2179 | nmdc:mga0k408_24179_c1 | |||
| 2180 | nmdc:mga0k408_349_c1 | |||
| 2181 | nmdc:mga0k408_378984_c1 | |||
| 2182 | nmdc:mga07m45_270409_c1 | |||
| 2183 | nmdc:mga07m45_38113_c1 | |||
| 2184 | Ga0500635_0005612 | |||
| 2185 | Ga0500646_0007145 | |||
| 2186 | Ga0500646_0021012 | |||
| 2187 | Ga0500647_0264730 | |||
| 2188 | Ga0500647_0339823 | |||
| 2189 | Ga0500651_0569790 | |||
| 2190 | Ga0500641_0000168 | |||
| 2191 | Ga0500641_0006404 | |||
| 2192 | Ga0500594_0037129 | |||
| 2193 | Ga0500608_016071 | |||
| 2194 | Ga0500608_075213 | |||
| 2195 | Ga0500618_000005 | |||
| 2196 | Ga0500618_012806 | |||
| 2197 | Ga0500642_0495421 | |||
| 2198 | Ga0500652_333618 | |||
| 2199 | Ga0500658_0000002 | |||
| 2200 | Ga0500559_0010320 | |||
| 2201 | Ga0500559_0042408 | |||
| 2202 | Ga0500559_0567032 | |||
| 2203 | Ga0500573_0412418 | |||
| 2204 | Ga0500579_161976 | |||
| 2205 | Ga0500588_0154830 | |||
| 2206 | Ga0500619_103271 | |||
| 2207 | Ga0500622_0000385 | |||
| 2208 | Ga0500622_0163807 | |||
| 2209 | Ga0500627_0221552 | |||
| 2210 | Ga0500627_0308908 | |||
| 2211 | Ga0500584_021185 | |||
| 2212 | Ga0587070_001656 | |||
| 2213 | Ga0587073_0014997 | |||
| 2214 | Ga0587073_0063709 | |||
| 2215 | Ga0587077_039243 | |||
| 2216 | Ga0587080_002246 | |||
| 2217 | Ga0587083_0013249 | |||
| 2218 | Ga0587083_0065881 | |||
| 2219 | Ga0587091_101864 | |||
| 2220 | Ga0587094_028037 | |||
| 2221 | Ga0587098_001742 | |||
| 2222 | Ga0587106_104451 | |||
| 2223 | Ga0587068_028699 | |||
| 2224 | Ga0587076_000823 | |||
| 2225 | Ga0587076_012245 | |||
| 2226 | Ga0587076_162302 | |||
| 2227 | Ga0587079_016619 | |||
| 2228 | Ga0587079_097608 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy