F490284

General Info

Members Datasets Scaffolds Average Seq Length
1114 452 2228 89

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0178205|Ga0451577_0178205_469_804
Length 111
Sequence MKKLWHFSGTLAYLLKILKTNYMAKISMVAREVKRARLTKKYAAKRAQLKADGDYVGLSRLPRNSNPNRMHNRCKLTGRPRGYMRQFGISRITFREMASAGLLPGVKKASW

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
22 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
27 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
81 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
82 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
127 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
132 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
133 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
134 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
135 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
182 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
183 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
190 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
194 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
195 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
196 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
197 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
198 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
199 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
200 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
201 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
202 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
203 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
204 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
205 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
206 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
209 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
210 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
211 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
212 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
213 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
214 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
217 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
218 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
224 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
225 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
227 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
228 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
234 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
235 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
236 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
237 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
238 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
239 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
240 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
241 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
242 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
243 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
244 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
245 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
246 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
247 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
248 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
249 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
250 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
251 3300041442 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT Metatranscriptome Rhizoplane
252 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
253 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
254 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
255 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
256 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
257 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
258 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
259 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
260 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
261 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
262 3300041464 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT Metatranscriptome Rhizoplane
263 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
264 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
265 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
266 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
267 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
268 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
269 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
270 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
271 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
272 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
273 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
274 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
275 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
276 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
277 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
278 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
279 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
280 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
281 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
282 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
283 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
284 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
285 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
286 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
287 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
288 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
289 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
290 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
291 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
292 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
293 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
294 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
295 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
296 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
297 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
298 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
299 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
300 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
301 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
302 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
303 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
304 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
305 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
306 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
307 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
308 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
309 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
310 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
311 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
312 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
313 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
314 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
315 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
316 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
317 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
318 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
319 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
320 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
321 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
322 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
323 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
324 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
325 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
326 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
327 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
328 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
329 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
330 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
331 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
332 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
333 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
334 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
335 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
336 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
337 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
338 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
339 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
340 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
341 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
342 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
343 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
344 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
345 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
346 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
347 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
348 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
349 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
350 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
351 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
352 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
353 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
354 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
355 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
356 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
357 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
358 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
359 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
360 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
361 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
362 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
363 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
364 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
365 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
366 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
375 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
376 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
377 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
409 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
410 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
411 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
412 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
413 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
414 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
415 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
416 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
417 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
418 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
419 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
420 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
421 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
422 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
423 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
424 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
425 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
426 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
427 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
428 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
429 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
430 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
431 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
432 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
433 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
434 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
435 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
436 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
437 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
438 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
439 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
440 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
441 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.59
Metatranscriptomes 17.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.83
Nodule 0.54
Rhizoplane 3.5
Rhizosphere 83.75
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0178205 3300042876 Bacteria 1916
2 SwRhRL2b_contig_1391765 2162886007 Bacteria 1163
3 SwRhRL2b_contig_2038936 2162886007 Bacteria 3057
4 SwRhRL2b_contig_2621326 2162886007 Bacteria 1429
5 2214878535 2209111006 Bacteria 1511
6 JGI24736J21556_1006132 3300001904 Bacteria 2027
7 JGI24740J21852_10022671 3300001979 Bacteria 2157
8 JGI24739J22299_10026719 3300001989 Bacteria 2023
9 JGI24737J22298_10001191 3300001990 Bacteria 9175
10 JGI24737J22298_10001354 3300001990 Bacteria 8678
11 JGI24737J22298_10015413 3300001990 Bacteria 2474
12 JGI24743J22301_10059010 3300001991 Bacteria 789
13 JGI24735J21928_10000003 3300002067 Bacteria 385983
14 JGI24735J21928_10001634 3300002067 Bacteria 7935
15 JGI24744J21845_10004519 3300002077 Bacteria 2874
16 JGI25162J39368_1001033 3300002737 Bacteria 17196
17 JGI25157J39369_1003626 3300002741 Bacteria 3071
18 JGI25157J39369_1021922 3300002741 Bacteria 757
19 JGI25164J39214_1001287 3300002772 Bacteria 6416
20 JGI25150J39212_1000005 3300002774 Bacteria 311800
21 JGI25151J46595_10000004 3300003187 Bacteria 494006
22 JGI25165J46597_1000678 3300003214 Bacteria 27401
23 JGI25153J46596_10000004 3300003215 Bacteria 494006
24 rootH1_10027299 3300003316 Bacteria 5608
25 rootH2_10026380 3300003320 Bacteria 6469
26 rootH1_10031050 3300003323 Bacteria 1887
27 rootH1_10127399 3300003323 Bacteria 5374
28 Ga0006562J51391_1003423 3300003578 Bacteria 13910
29 Ga0006562J51391_1011740 3300003578 Bacteria 7760
30 Ga0032354_1086718 3300003693 Bacteria 2098
31 Ga0055536_1000004 3300003781 Bacteria 411108
32 Ga0055534_1007293 3300003784 Bacteria 2655
33 Ga0055530_10000817 3300003791 Bacteria 25836
34 Ga0058860_10114316 3300004801 Bacteria 13584
35 Ga0058860_10168396 3300004801 Bacteria 5311
36 Ga0058862_12658366 3300004803 Bacteria 706
37 Ga0065714_10040382 3300005288 Bacteria 588
38 Ga0065714_10040779 3300005288 Bacteria 563
39 Ga0065714_10107298 3300005288 Bacteria 1534
40 Ga0065714_10173528 3300005288 Bacteria 993
41 Ga0065714_10221279 3300005288 Bacteria 829
42 Ga0065714_10353854 3300005288 Bacteria 621
43 Ga0065714_10539759 3300005288 Bacteria 503
44 Ga0065704_10004895 3300005289 Bacteria 3134
45 Ga0065704_10025200 3300005289 Bacteria 1399
46 Ga0065704_10025682 3300005289 Bacteria 1117
47 Ga0065704_10084598 3300005289 Bacteria 3318
48 Ga0065704_10086392 3300005289 Bacteria 3122
49 Ga0065704_10103057 3300005289 Bacteria 2184
50 Ga0065704_10117941 3300005289 Bacteria 1825
51 Ga0065704_10120513 3300005289 Bacteria 1781
52 Ga0065712_10346876 3300005290 Bacteria 747
53 Ga0065715_10036812 3300005293 Bacteria 920
54 Ga0065715_10050529 3300005293 Bacteria 684
55 Ga0065715_10313424 3300005293 Bacteria 1012
56 Ga0065715_10383148 3300005293 Bacteria 901
57 Ga0065715_10594734 3300005293 Bacteria 711
58 Ga0065715_10960039 3300005293 Bacteria 556
59 Ga0065715_11046998 3300005293 Bacteria 533
60 Ga0065707_10812159 3300005295 Bacteria 595
61 Ga0070658_10000153 3300005327 Bacteria 60625
62 Ga0070658_10017037 3300005327 Bacteria 5815
63 Ga0070658_11009790 3300005327 Bacteria 724
64 Ga0070658_11689079 3300005327 Bacteria 548
65 Ga0070676_10000312 3300005328 Bacteria 21945
66 Ga0070683_100016581 3300005329 Bacteria 6501
67 Ga0070683_101606167 3300005329 Bacteria 625
68 Ga0070670_100462742 3300005331 Bacteria 1125
69 Ga0068869_100334597 3300005334 Bacteria 1231
70 Ga0070682_100000768 3300005337 Bacteria 18980
71 Ga0070682_100016944 3300005337 Bacteria 4241
72 Ga0070682_101864756 3300005337 Bacteria 526
73 Ga0068868_100075253 3300005338 Bacteria 2698
74 Ga0068868_100542515 3300005338 Bacteria 1024
75 Ga0070660_100037879 3300005339 Bacteria 3657
76 Ga0070660_100077147 3300005339 Bacteria 2611
77 Ga0070661_101790661 3300005344 Bacteria 521
78 Ga0070668_100087717 3300005347 Bacteria 2448
79 Ga0070669_100220816 3300005353 Unclassified 1498
80 Ga0070669_100549346 3300005353 Bacteria 963
81 Ga0070671_100072627 3300005355 Bacteria 2874
82 Ga0070671_101700508 3300005355 Bacteria 560
83 Ga0070673_100071544 3300005364 Bacteria 2787
84 Ga0070673_101458771 3300005364 Bacteria 645
85 Ga0070659_100000375 3300005366 Bacteria 33764
86 Ga0070659_100008718 3300005366 Bacteria 7421
87 Ga0070659_100059763 3300005366 Bacteria 3009
88 Ga0070667_100668488 3300005367 Bacteria 960
89 Ga0070667_100748238 3300005367 Bacteria 906
90 Ga0070710_11256102 3300005437 Bacteria 549
91 Ga0070700_101068945 3300005441 Bacteria 667
92 Ga0070700_101808060 3300005441 Bacteria 526
93 Ga0070663_100193699 3300005455 Bacteria 1583
94 Ga0070663_100366341 3300005455 Bacteria 1170
95 Ga0070678_100001208 3300005456 Bacteria 13700
96 Ga0070678_100700213 3300005456 Bacteria 913
97 Ga0070662_100000074 3300005457 Bacteria 54943
98 Ga0068867_100001333 3300005459 Bacteria 17102
99 Ga0070685_10022774 3300005466 Bacteria 3420
100 Ga0070685_11318106 3300005466 Bacteria 552
101 Ga0070685_11403748 3300005466 Bacteria 536
102 Ga0070679_100507017 3300005530 Bacteria 1150
103 Ga0070684_100023266 3300005535 Bacteria 5179
104 Ga0068853_100047949 3300005539 Bacteria 3667
105 Ga0068853_100103368 3300005539 Bacteria 2522
106 Ga0068853_100135737 3300005539 Bacteria 2205
107 Ga0068853_102162152 3300005539 Bacteria 539
108 Ga0070672_100588415 3300005543 Bacteria 968
109 Ga0070693_100077579 3300005547 Bacteria 1972
110 Ga0070693_100735546 3300005547 Bacteria 726
111 Ga0070665_100000372 3300005548 Bacteria 66748
112 Ga0068855_100136893 3300005563 Bacteria 2793
113 Ga0068855_100610858 3300005563 Bacteria 1175
114 Ga0068855_100614523 3300005563 Bacteria 1171
115 Ga0068855_101246797 3300005563 Bacteria 771
116 Ga0068855_102200323 3300005563 Bacteria 554
117 Ga0068857_100038490 3300005577 Bacteria 4236
118 Ga0068857_100950569 3300005577 Bacteria 826
119 Ga0068857_101388224 3300005577 Bacteria 683
120 Ga0068854_100102342 3300005578 Bacteria 2149
121 Ga0068856_100004718 3300005614 Bacteria 13531
122 Ga0068856_101236713 3300005614 Bacteria 763
123 Ga0068852_100014590 3300005616 Bacteria 6055
124 Ga0068852_100126825 3300005616 Bacteria 2345
125 Ga0068852_102153316 3300005616 Bacteria 579
126 Ga0068861_101702480 3300005719 Bacteria 624
127 Ga0068851_10000177 3300005834 Bacteria 31928
128 Ga0068870_10131307 3300005840 Bacteria 1455
129 Ga0068858_100232757 3300005842 Bacteria 1747
130 Ga0075363_100573991 3300006048 Bacteria 674
131 Ga0075364_11083637 3300006051 Bacteria 544
132 Ga0070716_100099735 3300006173 Bacteria 1778
133 Ga0075362_10019709 3300006177 Bacteria 2809
134 Ga0075427_10091689 3300006194 Bacteria 558
135 Ga0075366_10000284 3300006195 Bacteria 22680
136 Ga0075366_10038131 3300006195 Bacteria 2838
137 Ga0075366_10309057 3300006195 Bacteria 968
138 Ga0097621_100007799 3300006237 Bacteria 7678
139 Ga0097621_100105361 3300006237 Bacteria 2377
140 Ga0075370_10041535 3300006353 Bacteria 2596
141 Ga0075370_10051332 3300006353 Bacteria 2339
142 Ga0068871_100000141 3300006358 Bacteria 46656
143 Ga0068871_100017988 3300006358 Bacteria 5361
144 Ga0068865_100000917 3300006881 Bacteria 16715
145 Ga0068865_100239427 3300006881 Bacteria 1427
146 Ga0099824_1003374 3300006942 Bacteria 23361
147 Ga0079104_1000280 3300006946 Bacteria 65859
148 Ga0099826_10000125 3300006948 Bacteria 34471
149 Ga0105251_10027494 3300009011 Bacteria 2883
150 Ga0105251_10187951 3300009011 Bacteria 930
151 Ga0105251_10362266 3300009011 Bacteria 663
152 Ga0105251_10609668 3300009011 Bacteria 519
153 Ga0105244_10000005 3300009036 Bacteria 481412
154 Ga0105244_10017933 3300009036 Bacteria 3985
155 Ga0105244_10021607 3300009036 Bacteria 3557
156 Ga0105250_10010102 3300009092 Bacteria 3941
157 Ga0105240_10041987 3300009093 Bacteria 5831
158 Ga0105240_10442980 3300009093 Bacteria 1455
159 Ga0105240_10635498 3300009093 Bacteria 1172
160 Ga0105240_11252228 3300009093 Bacteria 784
161 Ga0105240_11703708 3300009093 Bacteria 658
162 Ga0105240_12585689 3300009093 Bacteria 524
163 Ga0105240_12724179 3300009093 Bacteria 509
164 Ga0111539_13514179 3300009094 Bacteria 503
165 Ga0105245_10361405 3300009098 Bacteria 1441
166 Ga0105245_10363352 3300009098 Bacteria 1437
167 Ga0105247_10604263 3300009101 Bacteria 814
168 Ga0105243_10000009 3300009148 Bacteria 354419
169 Ga0105243_10077834 3300009148 Bacteria 2699
170 Ga0105243_10085327 3300009148 Bacteria 2588
171 Ga0105241_10009907 3300009174 Bacteria 7004
172 Ga0105241_10139680 3300009174 Bacteria 1971
173 Ga0105242_10045059 3300009176 Bacteria 3574
174 Ga0105242_10066602 3300009176 Bacteria 2975
175 Ga0105242_10066640 3300009176 Bacteria 2975
176 Ga0105242_10083836 3300009176 Bacteria 2670
177 Ga0105242_10781079 3300009176 Bacteria 943
178 Ga0105237_10022954 3300009545 Bacteria 6399
179 Ga0105237_10055807 3300009545 Bacteria 3956
180 Ga0105237_10187238 3300009545 Bacteria 2070
181 Ga0105237_10264787 3300009545 Bacteria 1722
182 Ga0105237_10294383 3300009545 Bacteria 1626
183 Ga0105237_11657314 3300009545 Bacteria 647
184 Ga0105237_11731455 3300009545 Bacteria 632
185 Ga0105238_10017754 3300009551 Bacteria 7234
186 Ga0105238_10328852 3300009551 Bacteria 1515
187 Ga0105238_10639563 3300009551 Bacteria 1073
188 Ga0105249_10086789 3300009553 Bacteria 2918
189 Ga0105249_10152965 3300009553 Unclassified 2223
190 Ga0105239_10000011 3300010375 Bacteria 337500
191 Ga0105239_10004149 3300010375 Bacteria 17397
192 Ga0105239_10051636 3300010375 Bacteria 4507
193 Ga0105239_10274203 3300010375 Bacteria 1898
194 Ga0105239_12917918 3300010375 Bacteria 558
195 Ga0105246_10286675 3300011119 Bacteria 1323
196 Ga0105246_10663353 3300011119 Bacteria 909
197 Ga0157339_1068994 3300012505 Bacteria 506
198 Ga0157373_10001369 3300013100 Bacteria 18710
199 Ga0157373_10014797 3300013100 Bacteria 5716
200 Ga0157373_10018712 3300013100 Bacteria 5041
201 Ga0157373_10021916 3300013100 Bacteria 4636
202 Ga0157373_10056873 3300013100 Bacteria 2776
203 Ga0157373_10454258 3300013100 Bacteria 922
204 Ga0157373_10945416 3300013100 Bacteria 641
205 Ga0157371_10000041 3300013102 Bacteria 203957
206 Ga0157371_10000091 3300013102 Bacteria 144664
207 Ga0157371_10001664 3300013102 Bacteria 22687
208 Ga0157371_10001678 3300013102 Bacteria 22612
209 Ga0157371_10011325 3300013102 Bacteria 6881
210 Ga0157371_10152177 3300013102 Bacteria 1650
211 Ga0157371_10923752 3300013102 Bacteria 663
212 Ga0157370_10019720 3300013104 Bacteria 6751
213 Ga0157370_10019865 3300013104 Bacteria 6722
214 Ga0157370_10050897 3300013104 Bacteria 3958
215 Ga0157370_10061399 3300013104 Bacteria 3567
216 Ga0157370_10082740 3300013104 Bacteria 3019
217 Ga0157370_10103183 3300013104 Bacteria 2670
218 Ga0157370_10136293 3300013104 Bacteria 2288
219 Ga0157370_10198056 3300013104 Bacteria 1864
220 Ga0157370_10205503 3300013104 Bacteria 1826
221 Ga0157370_10241805 3300013104 Bacteria 1670
222 Ga0157370_10433480 3300013104 Bacteria 1209
223 Ga0157370_10461645 3300013104 Bacteria 1167
224 Ga0157370_10491794 3300013104 Bacteria 1127
225 Ga0157370_10581815 3300013104 Bacteria 1026
226 Ga0157370_10823713 3300013104 Bacteria 844
227 Ga0157370_11746104 3300013104 Bacteria 558
228 Ga0157370_11758029 3300013104 Bacteria 556
229 Ga0157369_10000023 3300013105 Bacteria 226955
230 Ga0157369_10000613 3300013105 Bacteria 46357
231 Ga0157369_10007412 3300013105 Bacteria 12631
232 Ga0157369_10010007 3300013105 Bacteria 10831
233 Ga0157369_10011350 3300013105 Bacteria 10117
234 Ga0157369_10068434 3300013105 Bacteria 3815
235 Ga0157369_10134645 3300013105 Bacteria 2616
236 Ga0157374_10080845 3300013296 Bacteria 3083
237 Ga0157374_10083204 3300013296 Bacteria 3040
238 Ga0157374_10109918 3300013296 Bacteria 2651
239 Ga0157374_12941374 3300013296 Bacteria 503
240 Ga0157378_10008303 3300013297 Bacteria 9048
241 Ga0157378_10163750 3300013297 Bacteria 2082
242 Ga0157378_10207177 3300013297 Bacteria 1858
243 Ga0157378_10377844 3300013297 Bacteria 1391
244 Ga0157378_11992814 3300013297 Bacteria 630
245 Ga0163162_10001202 3300013306 Bacteria 24155
246 Ga0163162_10022452 3300013306 Bacteria 6216
247 Ga0163162_10043233 3300013306 Bacteria 4511
248 Ga0163162_10079118 3300013306 Bacteria 3353
249 Ga0163162_10469381 3300013306 Bacteria 1390
250 Ga0163162_12180192 3300013306 Bacteria 636
251 Ga0157372_10001364 3300013307 Bacteria 26417
252 Ga0157372_10011651 3300013307 Bacteria 9360
253 Ga0157372_11168352 3300013307 Bacteria 890
254 Ga0157372_12894872 3300013307 Bacteria 550
255 Ga0157375_10066260 3300013308 Bacteria 3604
256 Ga0157375_10099282 3300013308 Bacteria 2990
257 Ga0157375_10111014 3300013308 Bacteria 2840
258 Ga0157375_10448617 3300013308 Bacteria 1455
259 Ga0157375_10629371 3300013308 Bacteria 1230
260 Ga0163163_10506767 3300014325 Bacteria 1269
261 Ga0163163_12180082 3300014325 Bacteria 613
262 Ga0157380_10141735 3300014326 Bacteria 2066
263 Ga0182008_10000003 3300014497 Bacteria 456880
264 Ga0182008_10000600 3300014497 Bacteria 26471
265 Ga0182008_10480849 3300014497 Bacteria 680
266 Ga0182008_10503206 3300014497 Bacteria 666
267 Ga0157377_10016958 3300014745 Bacteria 3758
268 Ga0157376_10225806 3300014969 Bacteria 1737
269 Ga0157376_10782151 3300014969 Bacteria 966
270 Ga0157376_11196307 3300014969 Bacteria 788
271 Ga0157376_11681224 3300014969 Bacteria 670
272 Ga0157376_11909493 3300014969 Bacteria 631
273 Ga0182006_1000001 3300015261 Bacteria 1091090
274 Ga0182006_1013176 3300015261 Bacteria 3594
275 Ga0182006_1032965 3300015261 Bacteria 2079
276 Ga0182006_1062258 3300015261 Bacteria 1404
277 Ga0182006_1070319 3300015261 Bacteria 1299
278 Ga0182006_1130340 3300015261 Bacteria 866
279 Ga0182006_1131768 3300015261 Bacteria 860
280 Ga0182007_10000002 3300015262 Bacteria 564661
281 Ga0182007_10012229 3300015262 Bacteria 3309
282 Ga0182007_10043758 3300015262 Bacteria 1487
283 Ga0183373_1004 3300015682 Bacteria 537398
284 Ga0163161_10000039 3300017792 Bacteria 148130
285 Ga0163161_10085599 3300017792 Bacteria 2325
286 Ga0163161_10087878 3300017792 Bacteria 2297
287 Ga0163161_10276760 3300017792 Bacteria 1315
288 Ga0163161_10660535 3300017792 Bacteria 867
289 Ga0163161_11145722 3300017792 Bacteria 670
290 Ga0163161_11341130 3300017792 Bacteria 623
291 Ga0163161_11535214 3300017792 Bacteria 585
292 Ga0163161_12048240 3300017792 Bacteria 509
293 Ga0197907_10083044 3300020069 Bacteria 810
294 Ga0206356_10776358 3300020070 Bacteria 2064
295 Ga0206349_1760011 3300020075 Bacteria 913
296 Ga0206351_10267476 3300020077 Bacteria 15418
297 Ga0206352_10304197 3300020078 Bacteria 3582
298 Ga0206350_10037838 3300020080 Bacteria 1766
299 Ga0206350_11510146 3300020080 Bacteria 5619
300 Ga0206354_11620711 3300020081 Bacteria 1691
301 Ga0206353_10538520 3300020082 Bacteria 1988
302 Ga0206353_11557329 3300020082 Bacteria 534
303 Ga0154015_1410599 3300020610 Bacteria 3445
304 Ga0154015_1680355 3300020610 Bacteria 1226
305 Ga0213872_10006418 3300021361 Bacteria 5910
306 Ga0224712_10012850 3300022467 Bacteria 2649
307 Ga0224712_10038295 3300022467 Bacteria 1790
308 Ga0209563_107301 3300025230 Bacteria 1826
309 Ga0207427_100025 3300025231 Bacteria 433726
310 Ga0209437_100010 3300025233 Bacteria 838447
311 Ga0207425_1000008 3300025245 Bacteria 618024
312 Ga0209026_1000610 3300025250 Bacteria 22917
313 Ga0209026_1003238 3300025250 Bacteria 5483
314 Ga0209129_1000040 3300025258 Bacteria 313043
315 Ga0209233_1000017 3300025261 Bacteria 898076
316 Ga0209233_1001079 3300025261 Bacteria 11257
317 Ga0209233_1003581 3300025261 Bacteria 5451
318 Ga0209675_1000115 3300025291 Bacteria 111981
319 Ga0209676_1000009 3300025292 Bacteria 981719
320 Ga0209025_1000020 3300025294 Bacteria 618024
321 Ga0209758_1000022 3300025297 Bacteria 618024
322 Ga0209050_1000048 3300025298 Bacteria 371553
323 Ga0207656_10002394 3300025321 Bacteria 6311
324 Ga0207696_1020048 3300025711 Bacteria 2162
325 Ga0207655_1000016 3300025728 Bacteria 551476
326 Ga0207655_1000038 3300025728 Bacteria 348340
327 Ga0207655_1058892 3300025728 Bacteria 1498
328 Ga0207647_10000171 3300025904 Bacteria 51875
329 Ga0207647_10017185 3300025904 Bacteria 4922
330 Ga0207647_10022768 3300025904 Bacteria 4156
331 Ga0207645_10000035 3300025907 Bacteria 89345
332 Ga0207643_10138010 3300025908 Bacteria 1455
333 Ga0207705_10000108 3300025909 Bacteria 93501
334 Ga0207705_10104158 3300025909 Bacteria 2090
335 Ga0207705_10131644 3300025909 Bacteria 1862
336 Ga0207705_10330934 3300025909 Bacteria 1171
337 Ga0207705_11087995 3300025909 Bacteria 616
338 Ga0207705_11167483 3300025909 Bacteria 591
339 Ga0207654_10091095 3300025911 Bacteria 1859
340 Ga0207654_11275353 3300025911 Bacteria 536
341 Ga0207695_10000053 3300025913 Bacteria 396740
342 Ga0207695_10084356 3300025913 Bacteria 3208
343 Ga0207695_10276587 3300025913 Bacteria 1573
344 Ga0207695_11495245 3300025913 Bacteria 556
345 Ga0207671_10017153 3300025914 Bacteria 5595
346 Ga0207671_10039460 3300025914 Bacteria 3496
347 Ga0207671_10228749 3300025914 Bacteria 1458
348 Ga0207671_10236880 3300025914 Bacteria 1433
349 Ga0207671_11522095 3300025914 Bacteria 516
350 Ga0207657_10023513 3300025919 Bacteria 5737
351 Ga0207657_10025871 3300025919 Bacteria 5405
352 Ga0207657_10038645 3300025919 Bacteria 4247
353 Ga0207657_10463205 3300025919 Bacteria 994
354 Ga0207649_11457607 3300025920 Bacteria 542
355 Ga0207652_10101465 3300025921 Bacteria 2542
356 Ga0207681_10350064 3300025923 Unclassified 1182
357 Ga0207681_10549683 3300025923 Bacteria 950
358 Ga0207694_10009649 3300025924 Bacteria 7276
359 Ga0207694_10210432 3300025924 Bacteria 1584
360 Ga0207694_10238583 3300025924 Bacteria 1486
361 Ga0207650_11891571 3300025925 Bacteria 504
362 Ga0207687_10427676 3300025927 Bacteria 1094
363 Ga0207664_10627311 3300025929 Bacteria 966
364 Ga0207690_10002170 3300025932 Bacteria 11970
365 Ga0207690_10014765 3300025932 Bacteria 4724
366 Ga0207706_10293082 3300025933 Bacteria 1418
367 Ga0207686_10035366 3300025934 Bacteria 2998
368 Ga0207686_10962536 3300025934 Bacteria 691
369 Ga0207709_10000026 3300025935 Bacteria 354467
370 Ga0207709_10000084 3300025935 Bacteria 161002
371 Ga0207709_10045783 3300025935 Bacteria 2651
372 Ga0207669_11730187 3300025937 Bacteria 534
373 Ga0207704_10000036 3300025938 Bacteria 94574
374 Ga0207691_10434847 3300025940 Bacteria 1117
375 Ga0207661_10011066 3300025944 Bacteria 6521
376 Ga0207661_11566363 3300025944 Bacteria 603
377 Ga0207667_10112632 3300025949 Bacteria 2806
378 Ga0207667_10489647 3300025949 Bacteria 1248
379 Ga0207667_10602320 3300025949 Bacteria 1108
380 Ga0207667_11137603 3300025949 Bacteria 762
381 Ga0207667_11416086 3300025949 Bacteria 668
382 Ga0207651_10032626 3300025960 Bacteria 3348
383 Ga0207712_10050092 3300025961 Bacteria 2914
384 Ga0207712_10232294 3300025961 Unclassified 1481
385 Ga0207712_11634522 3300025961 Bacteria 577
386 Ga0207668_10226545 3300025972 Bacteria 1504
387 Ga0207668_11593901 3300025972 Unclassified 589
388 Ga0207677_10193616 3300026023 Bacteria 1610
389 Ga0207677_10783953 3300026023 Bacteria 852
390 Ga0207639_10046024 3300026041 Bacteria 3290
391 Ga0207639_10366613 3300026041 Bacteria 1290
392 Ga0207639_10433554 3300026041 Bacteria 1190
393 Ga0207639_10759718 3300026041 Bacteria 902
394 Ga0207678_10078056 3300026067 Bacteria 2836
395 Ga0207708_11618914 3300026075 Bacteria 569
396 Ga0207702_10024936 3300026078 Bacteria 4962
397 Ga0207648_10000333 3300026089 Bacteria 51656
398 Ga0207648_12072307 3300026089 Bacteria 530
399 Ga0207676_12499757 3300026095 Bacteria 513
400 Ga0207674_10016950 3300026116 Bacteria 7956
401 Ga0207674_10347462 3300026116 Bacteria 1434
402 Ga0207674_10477422 3300026116 Bacteria 1205
403 Ga0207675_102582209 3300026118 Bacteria 518
404 Ga0207683_10000982 3300026121 Bacteria 26175
405 Ga0207683_10225777 3300026121 Bacteria 1707
406 Ga0207698_10011872 3300026142 Bacteria 5671
407 Ga0207698_10101413 3300026142 Bacteria 2387
408 Ga0209281_1000337 3300027111 Bacteria 79938
409 Ga0209489_111364 3300027361 Bacteria 9138
410 Ga0209984_1008899 3300027424 Bacteria 1269
411 Ga0209995_1020587 3300027471 Bacteria 1091
412 Ga0209968_1000671 3300027526 Bacteria 5278
413 Ga0209968_1083787 3300027526 Bacteria 575
414 Ga0209999_1033339 3300027543 Bacteria 958
415 Ga0209982_1056554 3300027552 Bacteria 636
416 Ga0210002_1001591 3300027617 Bacteria 3225
417 Ga0209282_1028939 3300027666 Bacteria 3426
418 Ga0209966_1031903 3300027695 Bacteria 1070
419 Ga0268266_10000658 3300028379 Bacteria 46741
420 Ga0268264_10410213 3300028381 Bacteria 1304
421 Ga0265318_10147131 3300028577 Bacteria 864
422 Ga0265336_10163785 3300028666 Bacteria 661
423 Ga0307517_10012583 3300028786 Bacteria 11593
424 Ga0307515_10028989 3300028794 Bacteria 9379
425 Ga0307515_10403780 3300028794 Bacteria 991
426 Ga0265338_10001162 3300028800 Bacteria 43495
427 Ga0265338_10007954 3300028800 Bacteria 12991
428 Ga0316176_1208558 3300030732 Bacteria 529
429 Ga0316179_1109740 3300030734 Bacteria 3245
430 Ga0316182_1045167 3300030745 Bacteria 1412
431 Ga0265332_10298127 3300031238 Bacteria 666
432 Ga0265325_10085944 3300031241 Bacteria 1557
433 Ga0265327_10004316 3300031251 Bacteria 12681
434 Ga0265327_10019355 3300031251 Bacteria 4188
435 Ga0265327_10163448 3300031251 Bacteria 1027
436 Ga0265327_10356138 3300031251 Bacteria 639
437 Ga0265316_10002446 3300031344 Bacteria 19266
438 Ga0265316_10317853 3300031344 Bacteria 1131
439 Ga0307513_10153709 3300031456 Bacteria 2205
440 Ga0307509_10498984 3300031507 Bacteria 902
441 Ga0307408_100056125 3300031548 Bacteria 2855
442 Ga0307408_100926672 3300031548 Bacteria 799
443 Ga0307408_102170990 3300031548 Bacteria 536
444 Ga0316579_10079495 3300031691 Bacteria 1560
445 Ga0265342_10082046 3300031712 Bacteria 1861
446 Ga0265342_10146276 3300031712 Bacteria 1315
447 Ga0265342_10260322 3300031712 Bacteria 923
448 Ga0265342_10448363 3300031712 Bacteria 662
449 Ga0316576_10001965 3300031727 Bacteria 11485
450 Ga0316576_10038081 3300031727 Bacteria 3446
451 Ga0316576_10052895 3300031727 Bacteria 2958
452 Ga0316576_10164563 3300031727 Bacteria 1673
453 Ga0316576_10258615 3300031727 Bacteria 1306
454 Ga0316576_10400296 3300031727 Bacteria 1017
455 Ga0316576_10421965 3300031727 Bacteria 987
456 Ga0316576_10562728 3300031727 Bacteria 835
457 Ga0316576_10599487 3300031727 Bacteria 804
458 Ga0316576_10744439 3300031727 Bacteria 708
459 Ga0316576_11002327 3300031727 Bacteria 595
460 Ga0316576_11174883 3300031727 Bacteria 542
461 Ga0316578_10261755 3300031728 Bacteria 1037
462 Ga0307405_10000005 3300031731 Bacteria 376536
463 Ga0307405_10000006 3300031731 Bacteria 361477
464 Ga0307405_10041034 3300031731 Bacteria 2806
465 Ga0307405_10197523 3300031731 Bacteria 1458
466 Ga0307405_10285692 3300031731 Bacteria 1244
467 Ga0307405_11376350 3300031731 Bacteria 616
468 Ga0316577_10008426 3300031733 Bacteria 5526
469 Ga0316577_10361873 3300031733 Bacteria 824
470 Ga0316577_10543555 3300031733 Bacteria 661
471 Ga0316577_10840365 3300031733 Bacteria 521
472 Ga0307413_10001014 3300031824 Bacteria 10155
473 Ga0307413_10001307 3300031824 Bacteria 9311
474 Ga0307413_10040535 3300031824 Bacteria 2718
475 Ga0307413_10657550 3300031824 Bacteria 865
476 Ga0307413_11181026 3300031824 Bacteria 665
477 Ga0307413_11541395 3300031824 Bacteria 589
478 Ga0307410_10000034 3300031852 Bacteria 48449
479 Ga0307410_10396019 3300031852 Bacteria 1115
480 Ga0307406_10000004 3300031901 Bacteria 179772
481 Ga0307406_10361121 3300031901 Bacteria 1138
482 Ga0307407_10000003 3300031903 Bacteria 271723
483 Ga0307407_10000196 3300031903 Bacteria 18233
484 Ga0307412_10000088 3300031911 Bacteria 82058
485 Ga0307412_10002740 3300031911 Bacteria 9804
486 Ga0307412_10053164 3300031911 Bacteria 2684
487 Ga0307412_10268629 3300031911 Bacteria 1333
488 Ga0307412_10312732 3300031911 Bacteria 1246
489 Ga0307412_10401220 3300031911 Bacteria 1116
490 Ga0307412_10643817 3300031911 Bacteria 903
491 Ga0307409_100028055 3300031995 Bacteria 4003
492 Ga0307416_100000002 3300032002 Bacteria 509907
493 Ga0307416_100000006 3300032002 Bacteria 466074
494 Ga0307416_100010892 3300032002 Bacteria 6031
495 Ga0307414_10000011 3300032004 Bacteria 338253
496 Ga0307414_10000030 3300032004 Bacteria 187373
497 Ga0307414_10000673 3300032004 Bacteria 17502
498 Ga0307414_10000927 3300032004 Bacteria 15015
499 Ga0307414_10007281 3300032004 Bacteria 6215
500 Ga0307414_10009268 3300032004 Bacteria 5644
501 Ga0307414_10009965 3300032004 Bacteria 5484
502 Ga0307414_10011571 3300032004 Bacteria 5180
503 Ga0307414_10011719 3300032004 Bacteria 5154
504 Ga0307414_10014563 3300032004 Bacteria 4720
505 Ga0307414_10024140 3300032004 Bacteria 3871
506 Ga0307414_10042491 3300032004 Bacteria 3089
507 Ga0307414_10080701 3300032004 Bacteria 2379
508 Ga0307414_10123751 3300032004 Bacteria 1993
509 Ga0307414_10212613 3300032004 Bacteria 1582
510 Ga0307414_10286969 3300032004 Bacteria 1386
511 Ga0307414_10471367 3300032004 Bacteria 1105
512 Ga0307414_10490184 3300032004 Bacteria 1085
513 Ga0307414_10547897 3300032004 Bacteria 1030
514 Ga0307414_10732583 3300032004 Bacteria 897
515 Ga0307414_10735928 3300032004 Bacteria 895
516 Ga0307414_10960370 3300032004 Bacteria 785
517 Ga0307414_11661410 3300032004 Bacteria 596
518 Ga0307411_10000004 3300032005 Bacteria 460327
519 Ga0307411_10119322 3300032005 Bacteria 1905
520 Ga0307411_10153223 3300032005 Bacteria 1716
521 Ga0307411_10166804 3300032005 Bacteria 1656
522 Ga0307411_10976680 3300032005 Bacteria 757
523 Ga0316585_10002058 3300032137 Bacteria 5395
524 Ga0316580_10109645 3300032139 Bacteria 845
525 Ga0316580_10187250 3300032139 Bacteria 637
526 Ga0316593_10000201 3300032168 Bacteria 9314
527 Ga0316593_10000279 3300032168 Bacteria 8591
528 Ga0316593_10001741 3300032168 Bacteria 4931
529 Ga0316593_10008603 3300032168 Bacteria 2851
530 Ga0316593_10025704 3300032168 Bacteria 1877
531 Ga0316593_10044098 3300032168 Bacteria 1492
532 Ga0316593_10077390 3300032168 Bacteria 1157
533 Ga0316593_10106176 3300032168 Bacteria 1000
534 Ga0316593_10118432 3300032168 Bacteria 950
535 Ga0316593_10140339 3300032168 Bacteria 875
536 Ga0316593_10164998 3300032168 Bacteria 810
537 Ga0316593_10200655 3300032168 Bacteria 737
538 Ga0316593_10321660 3300032168 Bacteria 588
539 Ga0316593_10342474 3300032168 Bacteria 571
540 Ga0316593_10400875 3300032168 Bacteria 530
541 Ga0316593_10404845 3300032168 Bacteria 528
542 Ga0307507_10000034 3300033179 Bacteria 188697
543 Ga0307510_10003892 3300033180 Bacteria 17498
544 Ga0307510_10035700 3300033180 Bacteria 5546
545 Ga0316592_1000131 3300033524 Bacteria 8112
546 Ga0316592_1001542 3300033524 Bacteria 3743
547 Ga0316592_1002393 3300033524 Bacteria 3237
548 Ga0316592_1002839 3300033524 Bacteria 3046
549 Ga0316592_1022509 3300033524 Bacteria 1348
550 Ga0316592_1026061 3300033524 Bacteria 1262
551 Ga0316592_1035568 3300033524 Bacteria 1093
552 Ga0316592_1063561 3300033524 Bacteria 830
553 Ga0316592_1067956 3300033524 Bacteria 804
554 Ga0316586_1018347 3300033527 Bacteria 1135
555 Ga0316586_1072843 3300033527 Bacteria 634
556 Ga0316586_1076105 3300033527 Bacteria 622
557 Ga0316586_1119418 3300033527 Bacteria 513
558 Ga0316588_1000479 3300033528 Bacteria 5421
559 Ga0316588_1023041 3300033528 Bacteria 1426
560 Ga0316588_1094304 3300033528 Bacteria 747
561 Ga0316588_1124404 3300033528 Bacteria 654
562 Ga0316587_1096422 3300033529 Bacteria 567
563 Ga0316596_1000052 3300033541 Bacteria 12700
564 Ga0316596_1000106 3300033541 Bacteria 10634
565 Ga0316596_1001043 3300033541 Bacteria 5368
566 Ga0316596_1002456 3300033541 Bacteria 3957
567 Ga0316596_1002626 3300033541 Bacteria 3852
568 Ga0316596_1003921 3300033541 Bacteria 3297
569 Ga0316596_1009524 3300033541 Bacteria 2331
570 Ga0316596_1016458 3300033541 Bacteria 1853
571 Ga0316596_1022355 3300033541 Bacteria 1616
572 Ga0316596_1025349 3300033541 Bacteria 1526
573 Ga0316596_1028216 3300033541 Bacteria 1450
574 Ga0316596_1029155 3300033541 Bacteria 1428
575 Ga0316596_1029434 3300033541 Bacteria 1422
576 Ga0316596_1044495 3300033541 Bacteria 1170
577 Ga0316596_1046954 3300033541 Bacteria 1141
578 Ga0316596_1061147 3300033541 Bacteria 1005
579 Ga0316596_1071909 3300033541 Bacteria 926
580 Ga0316596_1102484 3300033541 Bacteria 775
581 Ga0316596_1116222 3300033541 Bacteria 727
582 Ga0316596_1127939 3300033541 Bacteria 693
583 Ga0316596_1179504 3300033541 Bacteria 586
584 Ga0316596_1217684 3300033541 Bacteria 534
585 Ga0316596_1239773 3300033541 Bacteria 510
586 Ga0373941_0018629 3300035115 Bacteria 1920
587 Ga0316574_0007562 3300035398 Bacteria 5965
588 Ga0316574_0034560 3300035398 Bacteria 3083
589 Ga0316574_0065061 3300035398 Bacteria 2295
590 Ga0316574_0097562 3300035398 Bacteria 1879
591 Ga0316574_0104645 3300035398 Bacteria 1812
592 Ga0316574_0191354 3300035398 Bacteria 1316
593 Ga0316574_0488456 3300035398 Bacteria 769
594 Ga0316574_0631092 3300035398 Bacteria 660
595 Ga0373937_0174104 3300036401 Bacteria 2020
596 Ga0316582_0108981 3300036647 Bacteria 1841
597 Ga0316584_0015050 3300036712 Bacteria 5526
598 Ga0316584_0020615 3300036712 Bacteria 4783
599 Ga0316584_0037517 3300036712 Bacteria 3601
600 Ga0316584_0065628 3300036712 Bacteria 2719
601 Ga0316584_0078998 3300036712 Bacteria 2464
602 Ga0316584_0132919 3300036712 Bacteria 1858
603 Ga0316584_0439094 3300036712 Bacteria 925
604 Ga0316584_0484118 3300036712 Bacteria 871
605 Ga0316584_0572670 3300036712 Bacteria 786
606 Ga0316584_1078963 3300036712 Bacteria 534
607 Ga0395899_0000034 3300037312 Bacteria 302623
608 Ga0395899_0100582 3300037312 Bacteria 2088
609 Ga0395899_0126981 3300037312 Bacteria 1823
610 Ga0395900_0000346 3300037418 Bacteria 68020
611 Ga0395900_0001482 3300037418 Bacteria 28015
612 Ga0395900_0006693 3300037418 Bacteria 11974
613 Ga0395898_0706147 3300037466 Bacteria 950
614 Ga0395905_0000528 3300037471 Bacteria 52404
615 Ga0395905_0002993 3300037471 Bacteria 18335
616 Ga0316581_0099290 3300037588 Bacteria 897
617 Ga0395901_0000351 3300038443 Bacteria 56004
618 Ga0395901_0007776 3300038443 Bacteria 10816
619 Ga0395901_1203652 3300038443 Bacteria 723
620 Ga0400490_55178 3300038726 Bacteria 1529
621 Ga0400483_035362 3300039062 Bacteria 41412
622 Ga0400483_129488 3300039062 Bacteria 1479
623 Ga0400489_16856 3300039093 Bacteria 1164
624 Ga0400489_59783 3300039093 Bacteria 3534
625 Ga0436361_0433548 3300039447 Bacteria 14679
626 Ga0439447_000447 3300041407 Bacteria 15369
627 Ga0439466_0004165 3300041411 Bacteria 5582
628 Ga0439466_0031119 3300041411 Bacteria 1827
629 Ga0439465_0000032 3300041413 Bacteria 28481
630 Ga0451788_05134 3300041442 Bacteria 1363
631 Ga0451788_07398 3300041442 Bacteria 800
632 Ga0451788_19850 3300041442 Bacteria 533
633 Ga0451790_06615 3300041444 Bacteria 741
634 Ga0451790_18342 3300041444 Bacteria 625
635 Ga0451790_24640 3300041444 Bacteria 610
636 Ga0451790_32630 3300041444 Bacteria 892
637 Ga0451790_34212 3300041444 Bacteria 1648
638 Ga0451790_46109 3300041444 Bacteria 653
639 Ga0451790_49048 3300041444 Bacteria 550
640 Ga0451794_08054 3300041446 Bacteria 890
641 Ga0451794_09376 3300041446 Bacteria 512
642 Ga0451794_51626 3300041446 Bacteria 999
643 Ga0451791_0955004 3300041451 Bacteria 967
644 Ga0451791_1675939 3300041451 Bacteria 2636
645 Ga0451797_0517437 3300041453 Bacteria 553
646 Ga0451797_0548848 3300041453 Bacteria 753
647 Ga0451797_1089683 3300041453 Bacteria 649
648 Ga0451795_0372407 3300041456 Bacteria 996
649 Ga0451795_0626751 3300041456 Bacteria 604
650 Ga0451798_0408742 3300041458 Bacteria 634
651 Ga0451800_0124714 3300041459 Bacteria 620
652 Ga0451802_0657423 3300041460 Bacteria 626
653 Ga0451802_1561053 3300041460 Bacteria 889
654 Ga0451805_041937 3300041461 Bacteria 507
655 Ga0451805_049097 3300041461 Bacteria 539
656 Ga0451806_282812 3300041462 Bacteria 506
657 Ga0451808_27891 3300041464 Bacteria 659
658 Ga0451807_1712141 3300041486 Bacteria 734
659 Ga0451833_0789018 3300041491 Bacteria 915
660 Ga0451837_1056715 3300041494 Bacteria 8321
661 Ga0451837_1663720 3300041494 Unclassified 657
662 Ga0451839_1324400 3300041496 Bacteria 526
663 Ga0451841_0723652 3300041498 Bacteria 962
664 Ga0451841_1044112 3300041498 Bacteria 619
665 Ga0451845_0433051 3300041501 Bacteria 774
666 Ga0451846_10542 3300041502 Bacteria 729
667 Ga0451847_0392278 3300041503 Bacteria 820
668 Ga0451850_42284 3300041506 Bacteria 801
669 Ga0451851_1170285 3300041507 Bacteria 663
670 Ga0451852_13332 3300041508 Bacteria 9060
671 Ga0451843_0778330 3300041509 Bacteria 504
672 Ga0451843_0938722 3300041509 Bacteria 587
673 Ga0451843_0973795 3300041509 Bacteria 531
674 Ga0451843_1238084 3300041509 Unclassified 814
675 Ga0451843_1481279 3300041509 Bacteria 591
676 Ga0451855_0120142 3300041511 Bacteria 1190
677 Ga0451853_2539583 3300041512 Bacteria 1109
678 Ga0452271_61575 3300041916 Bacteria 693
679 Ga0439445_0001316 3300042004 Bacteria 5367
680 Ga0439445_0041163 3300042004 Bacteria 1228
681 Ga0439448_0031796 3300042005 Bacteria 1677
682 Ga0439432_062281 3300042006 Bacteria 1148
683 Ga0439432_094647 3300042006 Bacteria 897
684 Ga0450905_008908 3300042142 Bacteria 1377
685 Ga0439446_0103210 3300042156 Bacteria 904
686 Ga0451577_0000092 3300042876 Bacteria 198898
687 Ga0451577_0000433 3300042876 Bacteria 74789
688 Ga0451577_0004463 3300042876 Bacteria 14775
689 Ga0451577_0005144 3300042876 Bacteria 13458
690 Ga0451577_0054888 3300042876 Bacteria 3556
691 Ga0451577_0059569 3300042876 Bacteria 3404
692 Ga0451577_0080589 3300042876 Bacteria 2903
693 Ga0451577_0106452 3300042876 Bacteria 2507
694 Ga0451577_0126458 3300042876 Bacteria 2290
695 Ga0451577_0132072 3300042876 Bacteria 2240
696 Ga0451577_0159725 3300042876 Bacteria 2029
697 Ga0451577_0163253 3300042876 Bacteria 2007
698 Ga0451577_0200564 3300042876 Bacteria 1801
699 Ga0451577_0204287 3300042876 Bacteria 1783
700 Ga0451577_0288217 3300042876 Bacteria 1488
701 Ga0451577_0462777 3300042876 Bacteria 1152
702 Ga0451577_0565645 3300042876 Bacteria 1032
703 Ga0451577_0612796 3300042876 Unclassified 988
704 Ga0451577_0716104 3300042876 Bacteria 906
705 Ga0451577_0749427 3300042876 Bacteria 883
706 Ga0451577_0761496 3300042876 Bacteria 875
707 Ga0453683_0000055 3300044673 Bacteria 192588
708 Ga0453683_0000522 3300044673 Bacteria 43145
709 Ga0453683_0006727 3300044673 Bacteria 7859
710 Ga0453683_0007526 3300044673 Bacteria 7375
711 Ga0453683_0009005 3300044673 Bacteria 6671
712 Ga0453683_0014569 3300044673 Bacteria 5101
713 Ga0453683_0034450 3300044673 Bacteria 3192
714 Ga0453683_0037310 3300044673 Bacteria 3058
715 Ga0453683_0042864 3300044673 Bacteria 2841
716 Ga0453683_0077545 3300044673 Bacteria 2081
717 Ga0453683_0083828 3300044673 Unclassified 1997
718 Ga0453683_0087298 3300044673 Bacteria 1955
719 Ga0453683_0229162 3300044673 Bacteria 1182
720 Ga0453683_0239477 3300044673 Bacteria 1155
721 Ga0453683_0352781 3300044673 Bacteria 945
722 Ga0453683_0363438 3300044673 Unclassified 930
723 Ga0453683_0368994 3300044673 Unclassified 923
724 Ga0453683_0873184 3300044673 Bacteria 594
725 Ga0453683_0999230 3300044673 Bacteria 555
726 Ga0466961_0863405 3300044693 Bacteria 539
727 Ga0453684_0000413 3300044712 Bacteria 174924
728 Ga0453684_0000440 3300044712 Bacteria 169397
729 Ga0453684_0000506 3300044712 Bacteria 152143
730 Ga0453684_0001193 3300044712 Bacteria 80343
731 Ga0453684_0001382 3300044712 Bacteria 70292
732 Ga0453684_0001549 3300044712 Bacteria 64220
733 Ga0453684_0012598 3300044712 Bacteria 13911
734 Ga0453684_0025154 3300044712 Bacteria 8657
735 Ga0453684_0032953 3300044712 Bacteria 7234
736 Ga0453684_0038585 3300044712 Bacteria 6526
737 Ga0453684_0043553 3300044712 Bacteria 6030
738 Ga0453684_0047532 3300044712 Bacteria 5689
739 Ga0453684_0054508 3300044712 Bacteria 5208
740 Ga0453684_0055899 3300044712 Bacteria 5126
741 Ga0453684_0056141 3300044712 Bacteria 5111
742 Ga0453684_0062135 3300044712 Bacteria 4786
743 Ga0453684_0068294 3300044712 Bacteria 4514
744 Ga0453684_0079180 3300044712 Bacteria 4108
745 Ga0453684_0086715 3300044712 Bacteria 3883
746 Ga0453684_0087955 3300044712 Bacteria 3848
747 Ga0453684_0108947 3300044712 Bacteria 3370
748 Ga0453684_0125131 3300044712 Bacteria 3095
749 Ga0453684_0133883 3300044712 Bacteria 2970
750 Ga0453684_0172588 3300044712 Bacteria 2546
751 Ga0453684_0261448 3300044712 Bacteria 1982
752 Ga0453684_0278356 3300044712 Bacteria 1909
753 Ga0453684_0313358 3300044712 Bacteria 1779
754 Ga0453684_0335008 3300044712 Bacteria 1710
755 Ga0453684_0377094 3300044712 Bacteria 1593
756 Ga0453684_0397650 3300044712 Bacteria 1544
757 Ga0453684_0438662 3300044712 Bacteria 1456
758 Ga0453684_0558870 3300044712 Bacteria 1259
759 Ga0453684_0721544 3300044712 Bacteria 1081
760 Ga0453684_0932542 3300044712 Bacteria 928
761 Ga0453684_1136154 3300044712 Bacteria 823
762 Ga0453684_2280040 3300044712 Bacteria 539
763 Ga0453684_2372640 3300044712 Bacteria 526
764 Ga0453684_2473736 3300044712 Bacteria 513
765 Ga0453684_2531396 3300044712 Unclassified 506
766 Ga0466959_0173896 3300045049 Bacteria 1509
767 Ga0451576_0000113 3300045051 Bacteria 208644
768 Ga0451576_0000204 3300045051 Bacteria 149459
769 Ga0451576_0003461 3300045051 Bacteria 21644
770 Ga0451576_0011813 3300045051 Bacteria 9886
771 Ga0451576_0017866 3300045051 Bacteria 7791
772 Ga0451576_0027225 3300045051 Bacteria 6142
773 Ga0451576_0032623 3300045051 Bacteria 5541
774 Ga0451576_0034310 3300045051 Bacteria 5390
775 Ga0451576_0040065 3300045051 Bacteria 4960
776 Ga0451576_0053102 3300045051 Bacteria 4246
777 Ga0451576_0056132 3300045051 Bacteria 4119
778 Ga0451576_0057514 3300045051 Bacteria 4065
779 Ga0451576_0062248 3300045051 Bacteria 3890
780 Ga0451576_0087954 3300045051 Bacteria 3232
781 Ga0451576_0125877 3300045051 Bacteria 2670
782 Ga0451576_0207257 3300045051 Bacteria 2047
783 Ga0451576_0294905 3300045051 Bacteria 1695
784 Ga0451576_0609488 3300045051 Unclassified 1147
785 Ga0451576_1626804 3300045051 Bacteria 670
786 Ga0451576_1945411 3300045051 Unclassified 606
787 Ga0451576_1992218 3300045051 Bacteria 598
788 Ga0451576_1999458 3300045051 Bacteria 597
789 Ga0495627_000022 3300046453 Bacteria 254672
790 Ga0495627_021677 3300046453 Bacteria 2126
791 Ga0495592_0284949 3300046454 Bacteria 1079
792 Ga0495590_0000627 3300046457 Bacteria 16440
793 Ga0495629_0160521 3300046459 Bacteria 1561
794 Ga0495629_1086477 3300046459 Bacteria 518
795 Ga0495638_0049204 3300046460 Bacteria 2636
796 Ga0495638_0115270 3300046460 Bacteria 1593
797 Ga0495638_0140267 3300046460 Bacteria 1411
798 Ga0495638_0242959 3300046460 Bacteria 996
799 Ga0495641_0155360 3300046461 Bacteria 1023
800 Ga0495641_0488362 3300046461 Bacteria 561
801 Ga0495651_0101584 3300046462 Bacteria 2140
802 Ga0495650_0000023 3300046471 Bacteria 527763
803 Ga0495650_0028243 3300046471 Bacteria 2580
804 Ga0495650_0202031 3300046471 Bacteria 690
805 Ga0495662_0056763 3300046476 Bacteria 1891
806 Ga0495585_0000476 3300046492 Bacteria 38316
807 Ga0495585_0001907 3300046492 Bacteria 15677
808 Ga0495596_0004903 3300046500 Bacteria 6419
809 Ga0495596_0032305 3300046500 Bacteria 2088
810 Ga0495607_0014863 3300046501 Bacteria 5059
811 Ga0495607_0220096 3300046501 Bacteria 929
812 Ga0495607_0461885 3300046501 Bacteria 568
813 Ga0495583_0113021 3300046506 Bacteria 1149
814 Ga0495583_0153266 3300046506 Bacteria 954
815 Ga0495606_0010457 3300046507 Bacteria 7698
816 Ga0495606_0021702 3300046507 Bacteria 4698
817 Ga0495606_0034482 3300046507 Bacteria 3474
818 Ga0495606_0048690 3300046507 Bacteria 2785
819 Ga0495606_0049499 3300046507 Bacteria 2755
820 Ga0495606_0124370 3300046507 Bacteria 1540
821 Ga0495606_0352579 3300046507 Bacteria 780
822 Ga0495606_0619122 3300046507 Bacteria 528
823 Ga0495610_0000005 3300046512 Bacteria 924111
824 Ga0495610_0001849 3300046512 Bacteria 18351
825 Ga0495610_0008200 3300046512 Bacteria 6805
826 Ga0495610_0196577 3300046512 Bacteria 829
827 Ga0495610_0379923 3300046512 Bacteria 525
828 Ga0495616_0004967 3300046513 Bacteria 8301
829 Ga0495616_0006047 3300046513 Bacteria 7376
830 Ga0495616_0082935 3300046513 Bacteria 1530
831 Ga0495618_0406134 3300046514 Bacteria 832
832 Ga0495628_1255351 3300046516 Bacteria 501
833 Ga0495631_0004390 3300046518 Bacteria 7515
834 Ga0495631_0462435 3300046518 Bacteria 540
835 Ga0495632_0007484 3300046519 Bacteria 6852
836 Ga0495632_0191975 3300046519 Bacteria 933
837 Ga0495637_0027540 3300046520 Bacteria 2541
838 Ga0495637_0043937 3300046520 Bacteria 1905
839 Ga0495643_0000294 3300046522 Bacteria 70329
840 Ga0495643_0017021 3300046522 Bacteria 4260
841 Ga0495643_0089150 3300046522 Bacteria 1593
842 Ga0495643_0346172 3300046522 Bacteria 666
843 Ga0495644_0001340 3300046523 Bacteria 10069
844 Ga0495648_0063660 3300046524 Bacteria 2176
845 Ga0495663_0001345 3300046525 Bacteria 7769
846 Ga0495663_0012337 3300046525 Bacteria 2380
847 Ga0495663_0362949 3300046525 Bacteria 529
848 Ga0495642_0199691 3300046528 Bacteria 872
849 Ga0495652_0185319 3300046529 Bacteria 1593
850 Ga0495652_0712477 3300046529 Bacteria 674
851 Ga0495652_0839351 3300046529 Bacteria 609
852 Ga0495654_0000003 3300046530 Bacteria 863485
853 Ga0495654_0010358 3300046530 Bacteria 5073
854 Ga0495654_0031697 3300046530 Bacteria 2683
855 Ga0495640_0072274 3300046533 Bacteria 2312
856 Ga0495586_0241388 3300046535 Unclassified 1030
857 Ga0495598_0366777 3300046537 Bacteria 557
858 Ga0495609_0000003 3300046538 Bacteria 711547
859 Ga0495609_0007815 3300046538 Bacteria 5295
860 Ga0495609_0027693 3300046538 Bacteria 2588
861 Ga0495609_0037227 3300046538 Bacteria 2195
862 Ga0495621_0153670 3300046539 Unclassified 906
863 Ga0495645_0972863 3300046543 Bacteria 500
864 Ga0495622_0145610 3300046557 Bacteria 1074
865 Ga0495633_0000072 3300046558 Bacteria 131197
866 Ga0495633_0003150 3300046558 Bacteria 11168
867 Ga0495633_0013345 3300046558 Bacteria 4333
868 Ga0495633_0015633 3300046558 Bacteria 3934
869 Ga0495633_0210516 3300046558 Bacteria 891
870 Ga0495633_0376909 3300046558 Bacteria 642
871 Ga0495633_0517884 3300046558 Bacteria 537
872 Ga0495668_0000165 3300046616 Bacteria 98016
873 Ga0495668_0194258 3300046616 Bacteria 1111
874 Ga0495634_0400484 3300046642 Bacteria 815
875 Ga0495611_0181608 3300046648 Bacteria 983
876 Ga0495625_0000096 3300046660 Bacteria 142609
877 Ga0495625_0000308 3300046660 Bacteria 74661
878 Ga0495625_0001933 3300046660 Bacteria 23424
879 Ga0495625_0052360 3300046660 Bacteria 2923
880 Ga0495625_0052735 3300046660 Bacteria 2911
881 Ga0495625_0595165 3300046660 Bacteria 664
882 Ga0495625_0678839 3300046660 Bacteria 610
883 Ga0495661_0029023 3300046665 Bacteria 3534
884 Ga0495661_0085204 3300046665 Bacteria 1811
885 Ga0495661_0557674 3300046665 Bacteria 541
886 Ga0495599_0166783 3300046678 Bacteria 1360
887 Ga0495669_0338445 3300046684 Bacteria 727
888 Ga0495669_0439608 3300046684 Bacteria 633
889 Ga0495670_0188908 3300046691 Bacteria 1089
890 Ga0495670_0494052 3300046691 Bacteria 664
891 Ga0495671_0061380 3300046692 Bacteria 1854
892 Ga0495671_0536382 3300046692 Bacteria 557
893 Ga0495649_0000105 3300046694 Bacteria 74750
894 Ga0495649_0104095 3300046694 Bacteria 1507
895 Ga0495589_0072429 3300046794 Bacteria 1683
896 Ga0495660_0024916 3300046810 Bacteria 3403
897 Ga0495660_0035007 3300046810 Bacteria 2807
898 Ga0495604_0218419 3300047317 Bacteria 1314
899 Ga0495674_0697615 3300047319 Unclassified 797
900 Ga0495680_0187885 3300047322 Bacteria 1487
901 Ga0495683_0017548 3300047323 Bacteria 3709
902 Ga0495683_0153279 3300047323 Bacteria 1071
903 Ga0495687_000233 3300047443 Bacteria 77056
904 Ga0495687_007622 3300047443 Bacteria 6340
905 Ga0495677_0294842 3300047445 Bacteria 637
906 Ga0495679_020659 3300047446 Bacteria 2290
907 Ga0495685_056387 3300047447 Bacteria 1328
908 Ga0495673_0026477 3300047469 Bacteria 2772
909 Ga0495673_0176259 3300047469 Bacteria 812
910 Ga0495684_0115271 3300047471 Bacteria 2026
911 Ga0495686_0004601 3300047472 Bacteria 11246
912 Ga0495686_0034321 3300047472 Bacteria 3268
913 Ga0495686_0063660 3300047472 Bacteria 2285
914 Ga0495686_0087827 3300047472 Bacteria 1891
915 Ga0495686_0219736 3300047472 Bacteria 1081
916 Ga0495686_0337332 3300047472 Bacteria 822
917 Ga0495686_0395132 3300047472 Bacteria 743
918 Ga0495593_0118263 3300047673 Bacteria 1350
919 Ga0495602_0572585 3300048088 Bacteria 780
920 Ga0495614_0016505 3300048089 Bacteria 3213
921 Ga0496103_0247774 3300048906 Bacteria 1146
922 Ga0496105_0297810 3300048908 Bacteria 1297
923 Ga0496105_0632892 3300048908 Bacteria 827
924 Ga0496113_0026121 3300048916 Bacteria 4172
925 Ga0496114_0299048 3300048917 Bacteria 1421
926 Ga0496115_0024014 3300048918 Bacteria 4736
927 Ga0496115_0192438 3300048918 Bacteria 1685
928 Ga0496115_0562502 3300048918 Bacteria 910
929 Ga0496115_0564860 3300048918 Bacteria 908
930 Ga0496115_0624065 3300048918 Bacteria 855
931 Ga0496116_0000024 3300048919 Bacteria 471420
932 Ga0496116_0000029 3300048919 Bacteria 422187
933 Ga0496116_0030225 3300048919 Bacteria 3895
934 Ga0496117_0000007 3300048920 Bacteria 720505
935 Ga0496117_0001863 3300048920 Bacteria 28457
936 Ga0496117_0099930 3300048920 Bacteria 1839
937 Ga0496118_0000252 3300048921 Bacteria 94470
938 Ga0496118_0033058 3300048921 Bacteria 4251
939 Ga0496119_0000007 3300048922 Bacteria 475920
940 Ga0496120_0007422 3300048923 Bacteria 8154
941 Ga0496121_0014632 3300048924 Bacteria 8299
942 Ga0496121_0640182 3300048924 Bacteria 649
943 Ga0496122_0008592 3300048925 Bacteria 10970
944 Ga0496122_0063397 3300048925 Bacteria 2697
945 Ga0496122_0199187 3300048925 Bacteria 1173
946 Ga0496123_0029360 3300048926 Bacteria 4049
947 Ga0496123_0041623 3300048926 Bacteria 3181
948 Ga0496124_0013719 3300048927 Bacteria 7890
949 Ga0496124_0035036 3300048927 Bacteria 4396
950 Ga0496124_0075016 3300048927 Bacteria 2795
951 Ga0496124_0382692 3300048927 Bacteria 983
952 Ga0496125_0000018 3300048928 Bacteria 482390
953 Ga0496125_0000031 3300048928 Bacteria 365156
954 Ga0496126_0024337 3300048929 Bacteria 5847
955 Ga0496126_0115769 3300048929 Bacteria 2330
956 Ga0496126_0234619 3300048929 Bacteria 1535
957 Ga0501309_013116 3300049129 Bacteria 1099
958 Ga0501310_000150 3300049130 Bacteria 6818
959 Ga0501310_052159 3300049130 Bacteria 594
960 Ga0501310_058494 3300049130 Bacteria 571
961 Ga0501341_00148 3300049131 Bacteria 2345
962 Ga0501343_000882 3300049132 Bacteria 1912
963 Ga0501343_001312 3300049132 Bacteria 1665
964 Ga0501344_02798 3300049133 Bacteria 911
965 Ga0501305_004819 3300049161 Bacteria 1607
966 Ga0501307_005377 3300049162 Bacteria 1348
967 Ga0501307_015314 3300049162 Bacteria 946
968 Ga0501342_00756 3300049163 Bacteria 924
969 Ga0495678_011400 3300049459 Bacteria 4260
970 Ga0495682_0007252 3300049460 Bacteria 4426
971 Ga0495682_0034802 3300049460 Bacteria 1857
972 Ga0501291_160291 3300049514 Bacteria 514
973 Ga0501311_002317 3300049527 Bacteria 1809
974 Ga0501311_046567 3300049527 Bacteria 670
975 Ga0501311_087684 3300049527 Bacteria 537
976 Ga0501314_000001 3300049530 Bacteria 13837
977 Ga0501315_001224 3300049531 Bacteria 2127
978 Ga0501315_049531 3300049531 Bacteria 657
979 Ga0501316_012746 3300049532 Bacteria 986
980 Ga0501316_057983 3300049532 Bacteria 568
981 Ga0501317_000248 3300049533 Bacteria 3386
982 Ga0501317_004963 3300049533 Bacteria 1407
983 Ga0501317_013448 3300049533 Bacteria 1024
984 Ga0501317_054344 3300049533 Bacteria 643
985 Ga0501319_000002 3300049535 Bacteria 13675
986 Ga0501319_000013 3300049535 Bacteria 7475
987 Ga0501320_000101 3300049536 Bacteria 3800
988 Ga0501320_001086 3300049536 Bacteria 1872
989 Ga0501320_002561 3300049536 Bacteria 1465
990 Ga0501320_002568 3300049536 Bacteria 1464
991 Ga0501320_003510 3300049536 Bacteria 1335
992 Ga0501320_014417 3300049536 Bacteria 854
993 Ga0501320_030445 3300049536 Bacteria 669
994 Ga0501321_000885 3300049537 Bacteria 2168
995 Ga0501321_005576 3300049537 Bacteria 1250
996 Ga0501321_007433 3300049537 Bacteria 1138
997 Ga0501321_023337 3300049537 Bacteria 784
998 Ga0501323_000002 3300049539 Bacteria 14311
999 Ga0501323_001127 3300049539 Bacteria 2270
1000 Ga0501323_028392 3300049539 Bacteria 775
1001 Ga0501324_000002 3300049540 Bacteria 14212
1002 Ga0501325_000286 3300049541 Bacteria 2190
1003 Ga0501326_00056 3300049542 Bacteria 3508
1004 Ga0501327_00944 3300049543 Bacteria 1310
1005 Ga0501327_01047 3300049543 Bacteria 1267
1006 Ga0501327_05091 3300049543 Unclassified 768
1007 Ga0501328_06523 3300049544 Bacteria 607
1008 Ga0501328_08669 3300049544 Bacteria 556
1009 Ga0501329_00788 3300049545 Bacteria 1240
1010 Ga0501329_01481 3300049545 Bacteria 1032
1011 Ga0501329_03606 3300049545 Bacteria 794
1012 Ga0501329_14337 3300049545 Bacteria 529
1013 Ga0501330_000098 3300049546 Bacteria 2661
1014 Ga0501330_003276 3300049546 Bacteria 958
1015 Ga0501330_005826 3300049546 Bacteria 794
1016 Ga0501330_008060 3300049546 Unclassified 717
1017 Ga0501331_00043 3300049547 Bacteria 3363
1018 Ga0501332_07091 3300049548 Bacteria 711
1019 Ga0501333_001376 3300049549 Bacteria 1306
1020 Ga0501333_015054 3300049549 Bacteria 584
1021 Ga0501334_00034 3300049550 Bacteria 4194
1022 Ga0501334_00766 3300049550 Bacteria 1605
1023 Ga0501334_04718 3300049550 Bacteria 882
1024 Ga0501334_04908 3300049550 Bacteria 872
1025 Ga0501334_13708 3300049550 Bacteria 609
1026 Ga0501335_000048 3300049551 Bacteria 4932
1027 Ga0501335_000133 3300049551 Bacteria 3704
1028 Ga0501335_038046 3300049551 Bacteria 561
1029 Ga0501336_002550 3300049552 Bacteria 1175
1030 Ga0501336_008383 3300049552 Bacteria 799
1031 Ga0501336_011449 3300049552 Bacteria 723
1032 Ga0501336_035032 3300049552 Bacteria 505
1033 Ga0501337_000033 3300049553 Bacteria 5041
1034 Ga0501337_000486 3300049553 Bacteria 1947
1035 Ga0501337_004812 3300049553 Bacteria 891
1036 Ga0501338_05037 3300049554 Bacteria 812
1037 Ga0501338_09963 3300049554 Bacteria 637
1038 Ga0501340_001237 3300049556 Bacteria 1348
1039 Ga0501340_002116 3300049556 Bacteria 1131
1040 Ga0501340_006596 3300049556 Bacteria 783
1041 Ga0501033_0095233 3300049570 Bacteria 2176
1042 Ga0501034_0125981 3300049571 Bacteria 2547
1043 Ga0501034_0636321 3300049571 Bacteria 969
1044 Ga0501036_0362242 3300049572 Bacteria 1211
1045 Ga0501039_0719974 3300049575 Bacteria 780
1046 Ga0501043_0748300 3300049579 Bacteria 711
1047 Ga0501047_0037417 3300049581 Bacteria 4693
1048 Ga0501223_000581 3300049663 Bacteria 8828
1049 Ga0501238_000015 3300049671 Bacteria 31964
1050 Ga0501238_071420 3300049671 Bacteria 539
1051 Ga0501249_019696 3300049679 Bacteria 1465
1052 Ga0501249_034752 3300049679 Bacteria 1131
1053 Ga0501251_001173 3300049681 Bacteria 2420
1054 Ga0501241_000002 3300049758 Bacteria 194532
1055 Ga0501241_002715 3300049758 Bacteria 3407
1056 Ga0501266_000002 3300049763 Bacteria 459947
1057 Ga0501269_000004 3300049766 Bacteria 91854
1058 Ga0501269_001937 3300049766 Bacteria 2612
1059 Ga0501271_071016 3300049768 Bacteria 504
1060 Ga0501280_000239 3300049776 Bacteria 13899
1061 Ga0501280_059225 3300049776 Bacteria 662
1062 Ga0501035_0018430 3300049822 Bacteria 6432
1063 nmdc:mga03683_18140_c1 3300050489 Bacteria 2672
1064 nmdc:mga00v17_939552_c1 3300050491 Bacteria 546
1065 nmdc:mga0k408_24179_c1 3300050493 Bacteria 3433
1066 nmdc:mga0k408_349_c1 3300050493 Bacteria 23383
1067 nmdc:mga0k408_378984_c1 3300050493 Bacteria 843
1068 nmdc:mga07m45_270409_c1 3300050496 Bacteria 989
1069 nmdc:mga07m45_38113_c1 3300050496 Bacteria 2682
1070 Ga0500635_0005612 3300053080 Bacteria 3303
1071 Ga0500646_0007145 3300053090 Bacteria 2848
1072 Ga0500646_0021012 3300053090 Bacteria 1737
1073 Ga0500647_0264730 3300053091 Bacteria 750
1074 Ga0500647_0339823 3300053091 Bacteria 629
1075 Ga0500651_0569790 3300053093 Bacteria 617
1076 Ga0500641_0000168 3300053096 Bacteria 24462
1077 Ga0500641_0006404 3300053096 Bacteria 4180
1078 Ga0500594_0037129 3300053118 Bacteria 1314
1079 Ga0500608_016071 3300053122 Bacteria 3374
1080 Ga0500608_075213 3300053122 Bacteria 1601
1081 Ga0500618_000005 3300053125 Bacteria 253092
1082 Ga0500618_012806 3300053125 Bacteria 2186
1083 Ga0500642_0495421 3300053130 Bacteria 517
1084 Ga0500652_333618 3300053131 Bacteria 578
1085 Ga0500658_0000002 3300053134 Bacteria 548440
1086 Ga0500559_0010320 3300053136 Bacteria 4015
1087 Ga0500559_0042408 3300053136 Bacteria 1985
1088 Ga0500559_0567032 3300053136 Bacteria 517
1089 Ga0500573_0412418 3300053140 Bacteria 636
1090 Ga0500579_161976 3300053143 Bacteria 940
1091 Ga0500588_0154830 3300053146 Bacteria 831
1092 Ga0500619_103271 3300053154 Bacteria 968
1093 Ga0500622_0000385 3300053156 Bacteria 42685
1094 Ga0500622_0163807 3300053156 Bacteria 1040
1095 Ga0500627_0221552 3300053158 Bacteria 844
1096 Ga0500627_0308908 3300053158 Bacteria 689
1097 Ga0500584_021185 3300053726 Bacteria 3019
1098 Ga0587070_001656 3300059491 Bacteria 2356
1099 Ga0587073_0014997 3300059492 Bacteria 1389
1100 Ga0587073_0063709 3300059492 Bacteria 872
1101 Ga0587077_039243 3300059493 Bacteria 943
1102 Ga0587080_002246 3300059503 Bacteria 2247
1103 Ga0587083_0013249 3300059505 Bacteria 1401
1104 Ga0587083_0065881 3300059505 Bacteria 829
1105 Ga0587091_101864 3300059511 Bacteria 674
1106 Ga0587094_028037 3300059513 Bacteria 858
1107 Ga0587098_001742 3300059604 Bacteria 1730
1108 Ga0587106_104451 3300059605 Bacteria 583
1109 Ga0587068_028699 3300059641 Bacteria 953
1110 Ga0587076_000823 3300059645 Bacteria 2847
1111 Ga0587076_012245 3300059645 Bacteria 1278
1112 Ga0587076_162302 3300059645 Bacteria 550
1113 Ga0587079_016619 3300059647 Bacteria 1265
1114 Ga0587079_097608 3300059647 Bacteria 697
1115 Ga0451577_0178205
1116 SwRhRL2b_contig_1391765
1117 SwRhRL2b_contig_2038936
1118 SwRhRL2b_contig_2621326
1119 2214878535
1120 JGI24736J21556_1006132
1121 JGI24740J21852_10022671
1122 JGI24739J22299_10026719
1123 JGI24737J22298_10001191
1124 JGI24737J22298_10001354
1125 JGI24737J22298_10015413
1126 JGI24743J22301_10059010
1127 JGI24735J21928_10000003
1128 JGI24735J21928_10001634
1129 JGI24744J21845_10004519
1130 JGI25162J39368_1001033
1131 JGI25157J39369_1003626
1132 JGI25157J39369_1021922
1133 JGI25164J39214_1001287
1134 JGI25150J39212_1000005
1135 JGI25151J46595_10000004
1136 JGI25165J46597_1000678
1137 JGI25153J46596_10000004
1138 rootH1_10027299
1139 rootH2_10026380
1140 rootH1_10031050
1141 rootH1_10127399
1142 Ga0006562J51391_1003423
1143 Ga0006562J51391_1011740
1144 Ga0032354_1086718
1145 Ga0055536_1000004
1146 Ga0055534_1007293
1147 Ga0055530_10000817
1148 Ga0058860_10114316
1149 Ga0058860_10168396
1150 Ga0058862_12658366
1151 Ga0065714_10040382
1152 Ga0065714_10040779
1153 Ga0065714_10107298
1154 Ga0065714_10173528
1155 Ga0065714_10221279
1156 Ga0065714_10353854
1157 Ga0065714_10539759
1158 Ga0065704_10004895
1159 Ga0065704_10025200
1160 Ga0065704_10025682
1161 Ga0065704_10084598
1162 Ga0065704_10086392
1163 Ga0065704_10103057
1164 Ga0065704_10117941
1165 Ga0065704_10120513
1166 Ga0065712_10346876
1167 Ga0065715_10036812
1168 Ga0065715_10050529
1169 Ga0065715_10313424
1170 Ga0065715_10383148
1171 Ga0065715_10594734
1172 Ga0065715_10960039
1173 Ga0065715_11046998
1174 Ga0065707_10812159
1175 Ga0070658_10000153
1176 Ga0070658_10017037
1177 Ga0070658_11009790
1178 Ga0070658_11689079
1179 Ga0070676_10000312
1180 Ga0070683_100016581
1181 Ga0070683_101606167
1182 Ga0070670_100462742
1183 Ga0068869_100334597
1184 Ga0070682_100000768
1185 Ga0070682_100016944
1186 Ga0070682_101864756
1187 Ga0068868_100075253
1188 Ga0068868_100542515
1189 Ga0070660_100037879
1190 Ga0070660_100077147
1191 Ga0070661_101790661
1192 Ga0070668_100087717
1193 Ga0070669_100220816
1194 Ga0070669_100549346
1195 Ga0070671_100072627
1196 Ga0070671_101700508
1197 Ga0070673_100071544
1198 Ga0070673_101458771
1199 Ga0070659_100000375
1200 Ga0070659_100008718
1201 Ga0070659_100059763
1202 Ga0070667_100668488
1203 Ga0070667_100748238
1204 Ga0070710_11256102
1205 Ga0070700_101068945
1206 Ga0070700_101808060
1207 Ga0070663_100193699
1208 Ga0070663_100366341
1209 Ga0070678_100001208
1210 Ga0070678_100700213
1211 Ga0070662_100000074
1212 Ga0068867_100001333
1213 Ga0070685_10022774
1214 Ga0070685_11318106
1215 Ga0070685_11403748
1216 Ga0070679_100507017
1217 Ga0070684_100023266
1218 Ga0068853_100047949
1219 Ga0068853_100103368
1220 Ga0068853_100135737
1221 Ga0068853_102162152
1222 Ga0070672_100588415
1223 Ga0070693_100077579
1224 Ga0070693_100735546
1225 Ga0070665_100000372
1226 Ga0068855_100136893
1227 Ga0068855_100610858
1228 Ga0068855_100614523
1229 Ga0068855_101246797
1230 Ga0068855_102200323
1231 Ga0068857_100038490
1232 Ga0068857_100950569
1233 Ga0068857_101388224
1234 Ga0068854_100102342
1235 Ga0068856_100004718
1236 Ga0068856_101236713
1237 Ga0068852_100014590
1238 Ga0068852_100126825
1239 Ga0068852_102153316
1240 Ga0068861_101702480
1241 Ga0068851_10000177
1242 Ga0068870_10131307
1243 Ga0068858_100232757
1244 Ga0075363_100573991
1245 Ga0075364_11083637
1246 Ga0070716_100099735
1247 Ga0075362_10019709
1248 Ga0075427_10091689
1249 Ga0075366_10000284
1250 Ga0075366_10038131
1251 Ga0075366_10309057
1252 Ga0097621_100007799
1253 Ga0097621_100105361
1254 Ga0075370_10041535
1255 Ga0075370_10051332
1256 Ga0068871_100000141
1257 Ga0068871_100017988
1258 Ga0068865_100000917
1259 Ga0068865_100239427
1260 Ga0099824_1003374
1261 Ga0079104_1000280
1262 Ga0099826_10000125
1263 Ga0105251_10027494
1264 Ga0105251_10187951
1265 Ga0105251_10362266
1266 Ga0105251_10609668
1267 Ga0105244_10000005
1268 Ga0105244_10017933
1269 Ga0105244_10021607
1270 Ga0105250_10010102
1271 Ga0105240_10041987
1272 Ga0105240_10442980
1273 Ga0105240_10635498
1274 Ga0105240_11252228
1275 Ga0105240_11703708
1276 Ga0105240_12585689
1277 Ga0105240_12724179
1278 Ga0111539_13514179
1279 Ga0105245_10361405
1280 Ga0105245_10363352
1281 Ga0105247_10604263
1282 Ga0105243_10000009
1283 Ga0105243_10077834
1284 Ga0105243_10085327
1285 Ga0105241_10009907
1286 Ga0105241_10139680
1287 Ga0105242_10045059
1288 Ga0105242_10066602
1289 Ga0105242_10066640
1290 Ga0105242_10083836
1291 Ga0105242_10781079
1292 Ga0105237_10022954
1293 Ga0105237_10055807
1294 Ga0105237_10187238
1295 Ga0105237_10264787
1296 Ga0105237_10294383
1297 Ga0105237_11657314
1298 Ga0105237_11731455
1299 Ga0105238_10017754
1300 Ga0105238_10328852
1301 Ga0105238_10639563
1302 Ga0105249_10086789
1303 Ga0105249_10152965
1304 Ga0105239_10000011
1305 Ga0105239_10004149
1306 Ga0105239_10051636
1307 Ga0105239_10274203
1308 Ga0105239_12917918
1309 Ga0105246_10286675
1310 Ga0105246_10663353
1311 Ga0157339_1068994
1312 Ga0157373_10001369
1313 Ga0157373_10014797
1314 Ga0157373_10018712
1315 Ga0157373_10021916
1316 Ga0157373_10056873
1317 Ga0157373_10454258
1318 Ga0157373_10945416
1319 Ga0157371_10000041
1320 Ga0157371_10000091
1321 Ga0157371_10001664
1322 Ga0157371_10001678
1323 Ga0157371_10011325
1324 Ga0157371_10152177
1325 Ga0157371_10923752
1326 Ga0157370_10019720
1327 Ga0157370_10019865
1328 Ga0157370_10050897
1329 Ga0157370_10061399
1330 Ga0157370_10082740
1331 Ga0157370_10103183
1332 Ga0157370_10136293
1333 Ga0157370_10198056
1334 Ga0157370_10205503
1335 Ga0157370_10241805
1336 Ga0157370_10433480
1337 Ga0157370_10461645
1338 Ga0157370_10491794
1339 Ga0157370_10581815
1340 Ga0157370_10823713
1341 Ga0157370_11746104
1342 Ga0157370_11758029
1343 Ga0157369_10000023
1344 Ga0157369_10000613
1345 Ga0157369_10007412
1346 Ga0157369_10010007
1347 Ga0157369_10011350
1348 Ga0157369_10068434
1349 Ga0157369_10134645
1350 Ga0157374_10080845
1351 Ga0157374_10083204
1352 Ga0157374_10109918
1353 Ga0157374_12941374
1354 Ga0157378_10008303
1355 Ga0157378_10163750
1356 Ga0157378_10207177
1357 Ga0157378_10377844
1358 Ga0157378_11992814
1359 Ga0163162_10001202
1360 Ga0163162_10022452
1361 Ga0163162_10043233
1362 Ga0163162_10079118
1363 Ga0163162_10469381
1364 Ga0163162_12180192
1365 Ga0157372_10001364
1366 Ga0157372_10011651
1367 Ga0157372_11168352
1368 Ga0157372_12894872
1369 Ga0157375_10066260
1370 Ga0157375_10099282
1371 Ga0157375_10111014
1372 Ga0157375_10448617
1373 Ga0157375_10629371
1374 Ga0163163_10506767
1375 Ga0163163_12180082
1376 Ga0157380_10141735
1377 Ga0182008_10000003
1378 Ga0182008_10000600
1379 Ga0182008_10480849
1380 Ga0182008_10503206
1381 Ga0157377_10016958
1382 Ga0157376_10225806
1383 Ga0157376_10782151
1384 Ga0157376_11196307
1385 Ga0157376_11681224
1386 Ga0157376_11909493
1387 Ga0182006_1000001
1388 Ga0182006_1013176
1389 Ga0182006_1032965
1390 Ga0182006_1062258
1391 Ga0182006_1070319
1392 Ga0182006_1130340
1393 Ga0182006_1131768
1394 Ga0182007_10000002
1395 Ga0182007_10012229
1396 Ga0182007_10043758
1397 Ga0183373_1004
1398 Ga0163161_10000039
1399 Ga0163161_10085599
1400 Ga0163161_10087878
1401 Ga0163161_10276760
1402 Ga0163161_10660535
1403 Ga0163161_11145722
1404 Ga0163161_11341130
1405 Ga0163161_11535214
1406 Ga0163161_12048240
1407 Ga0197907_10083044
1408 Ga0206356_10776358
1409 Ga0206349_1760011
1410 Ga0206351_10267476
1411 Ga0206352_10304197
1412 Ga0206350_10037838
1413 Ga0206350_11510146
1414 Ga0206354_11620711
1415 Ga0206353_10538520
1416 Ga0206353_11557329
1417 Ga0154015_1410599
1418 Ga0154015_1680355
1419 Ga0213872_10006418
1420 Ga0224712_10012850
1421 Ga0224712_10038295
1422 Ga0209563_107301
1423 Ga0207427_100025
1424 Ga0209437_100010
1425 Ga0207425_1000008
1426 Ga0209026_1000610
1427 Ga0209026_1003238
1428 Ga0209129_1000040
1429 Ga0209233_1000017
1430 Ga0209233_1001079
1431 Ga0209233_1003581
1432 Ga0209675_1000115
1433 Ga0209676_1000009
1434 Ga0209025_1000020
1435 Ga0209758_1000022
1436 Ga0209050_1000048
1437 Ga0207656_10002394
1438 Ga0207696_1020048
1439 Ga0207655_1000016
1440 Ga0207655_1000038
1441 Ga0207655_1058892
1442 Ga0207647_10000171
1443 Ga0207647_10017185
1444 Ga0207647_10022768
1445 Ga0207645_10000035
1446 Ga0207643_10138010
1447 Ga0207705_10000108
1448 Ga0207705_10104158
1449 Ga0207705_10131644
1450 Ga0207705_10330934
1451 Ga0207705_11087995
1452 Ga0207705_11167483
1453 Ga0207654_10091095
1454 Ga0207654_11275353
1455 Ga0207695_10000053
1456 Ga0207695_10084356
1457 Ga0207695_10276587
1458 Ga0207695_11495245
1459 Ga0207671_10017153
1460 Ga0207671_10039460
1461 Ga0207671_10228749
1462 Ga0207671_10236880
1463 Ga0207671_11522095
1464 Ga0207657_10023513
1465 Ga0207657_10025871
1466 Ga0207657_10038645
1467 Ga0207657_10463205
1468 Ga0207649_11457607
1469 Ga0207652_10101465
1470 Ga0207681_10350064
1471 Ga0207681_10549683
1472 Ga0207694_10009649
1473 Ga0207694_10210432
1474 Ga0207694_10238583
1475 Ga0207650_11891571
1476 Ga0207687_10427676
1477 Ga0207664_10627311
1478 Ga0207690_10002170
1479 Ga0207690_10014765
1480 Ga0207706_10293082
1481 Ga0207686_10035366
1482 Ga0207686_10962536
1483 Ga0207709_10000026
1484 Ga0207709_10000084
1485 Ga0207709_10045783
1486 Ga0207669_11730187
1487 Ga0207704_10000036
1488 Ga0207691_10434847
1489 Ga0207661_10011066
1490 Ga0207661_11566363
1491 Ga0207667_10112632
1492 Ga0207667_10489647
1493 Ga0207667_10602320
1494 Ga0207667_11137603
1495 Ga0207667_11416086
1496 Ga0207651_10032626
1497 Ga0207712_10050092
1498 Ga0207712_10232294
1499 Ga0207712_11634522
1500 Ga0207668_10226545
1501 Ga0207668_11593901
1502 Ga0207677_10193616
1503 Ga0207677_10783953
1504 Ga0207639_10046024
1505 Ga0207639_10366613
1506 Ga0207639_10433554
1507 Ga0207639_10759718
1508 Ga0207678_10078056
1509 Ga0207708_11618914
1510 Ga0207702_10024936
1511 Ga0207648_10000333
1512 Ga0207648_12072307
1513 Ga0207676_12499757
1514 Ga0207674_10016950
1515 Ga0207674_10347462
1516 Ga0207674_10477422
1517 Ga0207675_102582209
1518 Ga0207683_10000982
1519 Ga0207683_10225777
1520 Ga0207698_10011872
1521 Ga0207698_10101413
1522 Ga0209281_1000337
1523 Ga0209489_111364
1524 Ga0209984_1008899
1525 Ga0209995_1020587
1526 Ga0209968_1000671
1527 Ga0209968_1083787
1528 Ga0209999_1033339
1529 Ga0209982_1056554
1530 Ga0210002_1001591
1531 Ga0209282_1028939
1532 Ga0209966_1031903
1533 Ga0268266_10000658
1534 Ga0268264_10410213
1535 Ga0265318_10147131
1536 Ga0265336_10163785
1537 Ga0307517_10012583
1538 Ga0307515_10028989
1539 Ga0307515_10403780
1540 Ga0265338_10001162
1541 Ga0265338_10007954
1542 Ga0316176_1208558
1543 Ga0316179_1109740
1544 Ga0316182_1045167
1545 Ga0265332_10298127
1546 Ga0265325_10085944
1547 Ga0265327_10004316
1548 Ga0265327_10019355
1549 Ga0265327_10163448
1550 Ga0265327_10356138
1551 Ga0265316_10002446
1552 Ga0265316_10317853
1553 Ga0307513_10153709
1554 Ga0307509_10498984
1555 Ga0307408_100056125
1556 Ga0307408_100926672
1557 Ga0307408_102170990
1558 Ga0316579_10079495
1559 Ga0265342_10082046
1560 Ga0265342_10146276
1561 Ga0265342_10260322
1562 Ga0265342_10448363
1563 Ga0316576_10001965
1564 Ga0316576_10038081
1565 Ga0316576_10052895
1566 Ga0316576_10164563
1567 Ga0316576_10258615
1568 Ga0316576_10400296
1569 Ga0316576_10421965
1570 Ga0316576_10562728
1571 Ga0316576_10599487
1572 Ga0316576_10744439
1573 Ga0316576_11002327
1574 Ga0316576_11174883
1575 Ga0316578_10261755
1576 Ga0307405_10000005
1577 Ga0307405_10000006
1578 Ga0307405_10041034
1579 Ga0307405_10197523
1580 Ga0307405_10285692
1581 Ga0307405_11376350
1582 Ga0316577_10008426
1583 Ga0316577_10361873
1584 Ga0316577_10543555
1585 Ga0316577_10840365
1586 Ga0307413_10001014
1587 Ga0307413_10001307
1588 Ga0307413_10040535
1589 Ga0307413_10657550
1590 Ga0307413_11181026
1591 Ga0307413_11541395
1592 Ga0307410_10000034
1593 Ga0307410_10396019
1594 Ga0307406_10000004
1595 Ga0307406_10361121
1596 Ga0307407_10000003
1597 Ga0307407_10000196
1598 Ga0307412_10000088
1599 Ga0307412_10002740
1600 Ga0307412_10053164
1601 Ga0307412_10268629
1602 Ga0307412_10312732
1603 Ga0307412_10401220
1604 Ga0307412_10643817
1605 Ga0307409_100028055
1606 Ga0307416_100000002
1607 Ga0307416_100000006
1608 Ga0307416_100010892
1609 Ga0307414_10000011
1610 Ga0307414_10000030
1611 Ga0307414_10000673
1612 Ga0307414_10000927
1613 Ga0307414_10007281
1614 Ga0307414_10009268
1615 Ga0307414_10009965
1616 Ga0307414_10011571
1617 Ga0307414_10011719
1618 Ga0307414_10014563
1619 Ga0307414_10024140
1620 Ga0307414_10042491
1621 Ga0307414_10080701
1622 Ga0307414_10123751
1623 Ga0307414_10212613
1624 Ga0307414_10286969
1625 Ga0307414_10471367
1626 Ga0307414_10490184
1627 Ga0307414_10547897
1628 Ga0307414_10732583
1629 Ga0307414_10735928
1630 Ga0307414_10960370
1631 Ga0307414_11661410
1632 Ga0307411_10000004
1633 Ga0307411_10119322
1634 Ga0307411_10153223
1635 Ga0307411_10166804
1636 Ga0307411_10976680
1637 Ga0316585_10002058
1638 Ga0316580_10109645
1639 Ga0316580_10187250
1640 Ga0316593_10000201
1641 Ga0316593_10000279
1642 Ga0316593_10001741
1643 Ga0316593_10008603
1644 Ga0316593_10025704
1645 Ga0316593_10044098
1646 Ga0316593_10077390
1647 Ga0316593_10106176
1648 Ga0316593_10118432
1649 Ga0316593_10140339
1650 Ga0316593_10164998
1651 Ga0316593_10200655
1652 Ga0316593_10321660
1653 Ga0316593_10342474
1654 Ga0316593_10400875
1655 Ga0316593_10404845
1656 Ga0307507_10000034
1657 Ga0307510_10003892
1658 Ga0307510_10035700
1659 Ga0316592_1000131
1660 Ga0316592_1001542
1661 Ga0316592_1002393
1662 Ga0316592_1002839
1663 Ga0316592_1022509
1664 Ga0316592_1026061
1665 Ga0316592_1035568
1666 Ga0316592_1063561
1667 Ga0316592_1067956
1668 Ga0316586_1018347
1669 Ga0316586_1072843
1670 Ga0316586_1076105
1671 Ga0316586_1119418
1672 Ga0316588_1000479
1673 Ga0316588_1023041
1674 Ga0316588_1094304
1675 Ga0316588_1124404
1676 Ga0316587_1096422
1677 Ga0316596_1000052
1678 Ga0316596_1000106
1679 Ga0316596_1001043
1680 Ga0316596_1002456
1681 Ga0316596_1002626
1682 Ga0316596_1003921
1683 Ga0316596_1009524
1684 Ga0316596_1016458
1685 Ga0316596_1022355
1686 Ga0316596_1025349
1687 Ga0316596_1028216
1688 Ga0316596_1029155
1689 Ga0316596_1029434
1690 Ga0316596_1044495
1691 Ga0316596_1046954
1692 Ga0316596_1061147
1693 Ga0316596_1071909
1694 Ga0316596_1102484
1695 Ga0316596_1116222
1696 Ga0316596_1127939
1697 Ga0316596_1179504
1698 Ga0316596_1217684
1699 Ga0316596_1239773
1700 Ga0373941_0018629
1701 Ga0316574_0007562
1702 Ga0316574_0034560
1703 Ga0316574_0065061
1704 Ga0316574_0097562
1705 Ga0316574_0104645
1706 Ga0316574_0191354
1707 Ga0316574_0488456
1708 Ga0316574_0631092
1709 Ga0373937_0174104
1710 Ga0316582_0108981
1711 Ga0316584_0015050
1712 Ga0316584_0020615
1713 Ga0316584_0037517
1714 Ga0316584_0065628
1715 Ga0316584_0078998
1716 Ga0316584_0132919
1717 Ga0316584_0439094
1718 Ga0316584_0484118
1719 Ga0316584_0572670
1720 Ga0316584_1078963
1721 Ga0395899_0000034
1722 Ga0395899_0100582
1723 Ga0395899_0126981
1724 Ga0395900_0000346
1725 Ga0395900_0001482
1726 Ga0395900_0006693
1727 Ga0395898_0706147
1728 Ga0395905_0000528
1729 Ga0395905_0002993
1730 Ga0316581_0099290
1731 Ga0395901_0000351
1732 Ga0395901_0007776
1733 Ga0395901_1203652
1734 Ga0400490_55178
1735 Ga0400483_035362
1736 Ga0400483_129488
1737 Ga0400489_16856
1738 Ga0400489_59783
1739 Ga0436361_0433548
1740 Ga0439447_000447
1741 Ga0439466_0004165
1742 Ga0439466_0031119
1743 Ga0439465_0000032
1744 Ga0451788_05134
1745 Ga0451788_07398
1746 Ga0451788_19850
1747 Ga0451790_06615
1748 Ga0451790_18342
1749 Ga0451790_24640
1750 Ga0451790_32630
1751 Ga0451790_34212
1752 Ga0451790_46109
1753 Ga0451790_49048
1754 Ga0451794_08054
1755 Ga0451794_09376
1756 Ga0451794_51626
1757 Ga0451791_0955004
1758 Ga0451791_1675939
1759 Ga0451797_0517437
1760 Ga0451797_0548848
1761 Ga0451797_1089683
1762 Ga0451795_0372407
1763 Ga0451795_0626751
1764 Ga0451798_0408742
1765 Ga0451800_0124714
1766 Ga0451802_0657423
1767 Ga0451802_1561053
1768 Ga0451805_041937
1769 Ga0451805_049097
1770 Ga0451806_282812
1771 Ga0451808_27891
1772 Ga0451807_1712141
1773 Ga0451833_0789018
1774 Ga0451837_1056715
1775 Ga0451837_1663720
1776 Ga0451839_1324400
1777 Ga0451841_0723652
1778 Ga0451841_1044112
1779 Ga0451845_0433051
1780 Ga0451846_10542
1781 Ga0451847_0392278
1782 Ga0451850_42284
1783 Ga0451851_1170285
1784 Ga0451852_13332
1785 Ga0451843_0778330
1786 Ga0451843_0938722
1787 Ga0451843_0973795
1788 Ga0451843_1238084
1789 Ga0451843_1481279
1790 Ga0451855_0120142
1791 Ga0451853_2539583
1792 Ga0452271_61575
1793 Ga0439445_0001316
1794 Ga0439445_0041163
1795 Ga0439448_0031796
1796 Ga0439432_062281
1797 Ga0439432_094647
1798 Ga0450905_008908
1799 Ga0439446_0103210
1800 Ga0451577_0000092
1801 Ga0451577_0000433
1802 Ga0451577_0004463
1803 Ga0451577_0005144
1804 Ga0451577_0054888
1805 Ga0451577_0059569
1806 Ga0451577_0080589
1807 Ga0451577_0106452
1808 Ga0451577_0126458
1809 Ga0451577_0132072
1810 Ga0451577_0159725
1811 Ga0451577_0163253
1812 Ga0451577_0200564
1813 Ga0451577_0204287
1814 Ga0451577_0288217
1815 Ga0451577_0462777
1816 Ga0451577_0565645
1817 Ga0451577_0612796
1818 Ga0451577_0716104
1819 Ga0451577_0749427
1820 Ga0451577_0761496
1821 Ga0453683_0000055
1822 Ga0453683_0000522
1823 Ga0453683_0006727
1824 Ga0453683_0007526
1825 Ga0453683_0009005
1826 Ga0453683_0014569
1827 Ga0453683_0034450
1828 Ga0453683_0037310
1829 Ga0453683_0042864
1830 Ga0453683_0077545
1831 Ga0453683_0083828
1832 Ga0453683_0087298
1833 Ga0453683_0229162
1834 Ga0453683_0239477
1835 Ga0453683_0352781
1836 Ga0453683_0363438
1837 Ga0453683_0368994
1838 Ga0453683_0873184
1839 Ga0453683_0999230
1840 Ga0466961_0863405
1841 Ga0453684_0000413
1842 Ga0453684_0000440
1843 Ga0453684_0000506
1844 Ga0453684_0001193
1845 Ga0453684_0001382
1846 Ga0453684_0001549
1847 Ga0453684_0012598
1848 Ga0453684_0025154
1849 Ga0453684_0032953
1850 Ga0453684_0038585
1851 Ga0453684_0043553
1852 Ga0453684_0047532
1853 Ga0453684_0054508
1854 Ga0453684_0055899
1855 Ga0453684_0056141
1856 Ga0453684_0062135
1857 Ga0453684_0068294
1858 Ga0453684_0079180
1859 Ga0453684_0086715
1860 Ga0453684_0087955
1861 Ga0453684_0108947
1862 Ga0453684_0125131
1863 Ga0453684_0133883
1864 Ga0453684_0172588
1865 Ga0453684_0261448
1866 Ga0453684_0278356
1867 Ga0453684_0313358
1868 Ga0453684_0335008
1869 Ga0453684_0377094
1870 Ga0453684_0397650
1871 Ga0453684_0438662
1872 Ga0453684_0558870
1873 Ga0453684_0721544
1874 Ga0453684_0932542
1875 Ga0453684_1136154
1876 Ga0453684_2280040
1877 Ga0453684_2372640
1878 Ga0453684_2473736
1879 Ga0453684_2531396
1880 Ga0466959_0173896
1881 Ga0451576_0000113
1882 Ga0451576_0000204
1883 Ga0451576_0003461
1884 Ga0451576_0011813
1885 Ga0451576_0017866
1886 Ga0451576_0027225
1887 Ga0451576_0032623
1888 Ga0451576_0034310
1889 Ga0451576_0040065
1890 Ga0451576_0053102
1891 Ga0451576_0056132
1892 Ga0451576_0057514
1893 Ga0451576_0062248
1894 Ga0451576_0087954
1895 Ga0451576_0125877
1896 Ga0451576_0207257
1897 Ga0451576_0294905
1898 Ga0451576_0609488
1899 Ga0451576_1626804
1900 Ga0451576_1945411
1901 Ga0451576_1992218
1902 Ga0451576_1999458
1903 Ga0495627_000022
1904 Ga0495627_021677
1905 Ga0495592_0284949
1906 Ga0495590_0000627
1907 Ga0495629_0160521
1908 Ga0495629_1086477
1909 Ga0495638_0049204
1910 Ga0495638_0115270
1911 Ga0495638_0140267
1912 Ga0495638_0242959
1913 Ga0495641_0155360
1914 Ga0495641_0488362
1915 Ga0495651_0101584
1916 Ga0495650_0000023
1917 Ga0495650_0028243
1918 Ga0495650_0202031
1919 Ga0495662_0056763
1920 Ga0495585_0000476
1921 Ga0495585_0001907
1922 Ga0495596_0004903
1923 Ga0495596_0032305
1924 Ga0495607_0014863
1925 Ga0495607_0220096
1926 Ga0495607_0461885
1927 Ga0495583_0113021
1928 Ga0495583_0153266
1929 Ga0495606_0010457
1930 Ga0495606_0021702
1931 Ga0495606_0034482
1932 Ga0495606_0048690
1933 Ga0495606_0049499
1934 Ga0495606_0124370
1935 Ga0495606_0352579
1936 Ga0495606_0619122
1937 Ga0495610_0000005
1938 Ga0495610_0001849
1939 Ga0495610_0008200
1940 Ga0495610_0196577
1941 Ga0495610_0379923
1942 Ga0495616_0004967
1943 Ga0495616_0006047
1944 Ga0495616_0082935
1945 Ga0495618_0406134
1946 Ga0495628_1255351
1947 Ga0495631_0004390
1948 Ga0495631_0462435
1949 Ga0495632_0007484
1950 Ga0495632_0191975
1951 Ga0495637_0027540
1952 Ga0495637_0043937
1953 Ga0495643_0000294
1954 Ga0495643_0017021
1955 Ga0495643_0089150
1956 Ga0495643_0346172
1957 Ga0495644_0001340
1958 Ga0495648_0063660
1959 Ga0495663_0001345
1960 Ga0495663_0012337
1961 Ga0495663_0362949
1962 Ga0495642_0199691
1963 Ga0495652_0185319
1964 Ga0495652_0712477
1965 Ga0495652_0839351
1966 Ga0495654_0000003
1967 Ga0495654_0010358
1968 Ga0495654_0031697
1969 Ga0495640_0072274
1970 Ga0495586_0241388
1971 Ga0495598_0366777
1972 Ga0495609_0000003
1973 Ga0495609_0007815
1974 Ga0495609_0027693
1975 Ga0495609_0037227
1976 Ga0495621_0153670
1977 Ga0495645_0972863
1978 Ga0495622_0145610
1979 Ga0495633_0000072
1980 Ga0495633_0003150
1981 Ga0495633_0013345
1982 Ga0495633_0015633
1983 Ga0495633_0210516
1984 Ga0495633_0376909
1985 Ga0495633_0517884
1986 Ga0495668_0000165
1987 Ga0495668_0194258
1988 Ga0495634_0400484
1989 Ga0495611_0181608
1990 Ga0495625_0000096
1991 Ga0495625_0000308
1992 Ga0495625_0001933
1993 Ga0495625_0052360
1994 Ga0495625_0052735
1995 Ga0495625_0595165
1996 Ga0495625_0678839
1997 Ga0495661_0029023
1998 Ga0495661_0085204
1999 Ga0495661_0557674
2000 Ga0495599_0166783
2001 Ga0495669_0338445
2002 Ga0495669_0439608
2003 Ga0495670_0188908
2004 Ga0495670_0494052
2005 Ga0495671_0061380
2006 Ga0495671_0536382
2007 Ga0495649_0000105
2008 Ga0495649_0104095
2009 Ga0495589_0072429
2010 Ga0495660_0024916
2011 Ga0495660_0035007
2012 Ga0495604_0218419
2013 Ga0495674_0697615
2014 Ga0495680_0187885
2015 Ga0495683_0017548
2016 Ga0495683_0153279
2017 Ga0495687_000233
2018 Ga0495687_007622
2019 Ga0495677_0294842
2020 Ga0495679_020659
2021 Ga0495685_056387
2022 Ga0495673_0026477
2023 Ga0495673_0176259
2024 Ga0495684_0115271
2025 Ga0495686_0004601
2026 Ga0495686_0034321
2027 Ga0495686_0063660
2028 Ga0495686_0087827
2029 Ga0495686_0219736
2030 Ga0495686_0337332
2031 Ga0495686_0395132
2032 Ga0495593_0118263
2033 Ga0495602_0572585
2034 Ga0495614_0016505
2035 Ga0496103_0247774
2036 Ga0496105_0297810
2037 Ga0496105_0632892
2038 Ga0496113_0026121
2039 Ga0496114_0299048
2040 Ga0496115_0024014
2041 Ga0496115_0192438
2042 Ga0496115_0562502
2043 Ga0496115_0564860
2044 Ga0496115_0624065
2045 Ga0496116_0000024
2046 Ga0496116_0000029
2047 Ga0496116_0030225
2048 Ga0496117_0000007
2049 Ga0496117_0001863
2050 Ga0496117_0099930
2051 Ga0496118_0000252
2052 Ga0496118_0033058
2053 Ga0496119_0000007
2054 Ga0496120_0007422
2055 Ga0496121_0014632
2056 Ga0496121_0640182
2057 Ga0496122_0008592
2058 Ga0496122_0063397
2059 Ga0496122_0199187
2060 Ga0496123_0029360
2061 Ga0496123_0041623
2062 Ga0496124_0013719
2063 Ga0496124_0035036
2064 Ga0496124_0075016
2065 Ga0496124_0382692
2066 Ga0496125_0000018
2067 Ga0496125_0000031
2068 Ga0496126_0024337
2069 Ga0496126_0115769
2070 Ga0496126_0234619
2071 Ga0501309_013116
2072 Ga0501310_000150
2073 Ga0501310_052159
2074 Ga0501310_058494
2075 Ga0501341_00148
2076 Ga0501343_000882
2077 Ga0501343_001312
2078 Ga0501344_02798
2079 Ga0501305_004819
2080 Ga0501307_005377
2081 Ga0501307_015314
2082 Ga0501342_00756
2083 Ga0495678_011400
2084 Ga0495682_0007252
2085 Ga0495682_0034802
2086 Ga0501291_160291
2087 Ga0501311_002317
2088 Ga0501311_046567
2089 Ga0501311_087684
2090 Ga0501314_000001
2091 Ga0501315_001224
2092 Ga0501315_049531
2093 Ga0501316_012746
2094 Ga0501316_057983
2095 Ga0501317_000248
2096 Ga0501317_004963
2097 Ga0501317_013448
2098 Ga0501317_054344
2099 Ga0501319_000002
2100 Ga0501319_000013
2101 Ga0501320_000101
2102 Ga0501320_001086
2103 Ga0501320_002561
2104 Ga0501320_002568
2105 Ga0501320_003510
2106 Ga0501320_014417
2107 Ga0501320_030445
2108 Ga0501321_000885
2109 Ga0501321_005576
2110 Ga0501321_007433
2111 Ga0501321_023337
2112 Ga0501323_000002
2113 Ga0501323_001127
2114 Ga0501323_028392
2115 Ga0501324_000002
2116 Ga0501325_000286
2117 Ga0501326_00056
2118 Ga0501327_00944
2119 Ga0501327_01047
2120 Ga0501327_05091
2121 Ga0501328_06523
2122 Ga0501328_08669
2123 Ga0501329_00788
2124 Ga0501329_01481
2125 Ga0501329_03606
2126 Ga0501329_14337
2127 Ga0501330_000098
2128 Ga0501330_003276
2129 Ga0501330_005826
2130 Ga0501330_008060
2131 Ga0501331_00043
2132 Ga0501332_07091
2133 Ga0501333_001376
2134 Ga0501333_015054
2135 Ga0501334_00034
2136 Ga0501334_00766
2137 Ga0501334_04718
2138 Ga0501334_04908
2139 Ga0501334_13708
2140 Ga0501335_000048
2141 Ga0501335_000133
2142 Ga0501335_038046
2143 Ga0501336_002550
2144 Ga0501336_008383
2145 Ga0501336_011449
2146 Ga0501336_035032
2147 Ga0501337_000033
2148 Ga0501337_000486
2149 Ga0501337_004812
2150 Ga0501338_05037
2151 Ga0501338_09963
2152 Ga0501340_001237
2153 Ga0501340_002116
2154 Ga0501340_006596
2155 Ga0501033_0095233
2156 Ga0501034_0125981
2157 Ga0501034_0636321
2158 Ga0501036_0362242
2159 Ga0501039_0719974
2160 Ga0501043_0748300
2161 Ga0501047_0037417
2162 Ga0501223_000581
2163 Ga0501238_000015
2164 Ga0501238_071420
2165 Ga0501249_019696
2166 Ga0501249_034752
2167 Ga0501251_001173
2168 Ga0501241_000002
2169 Ga0501241_002715
2170 Ga0501266_000002
2171 Ga0501269_000004
2172 Ga0501269_001937
2173 Ga0501271_071016
2174 Ga0501280_000239
2175 Ga0501280_059225
2176 Ga0501035_0018430
2177 nmdc:mga03683_18140_c1
2178 nmdc:mga00v17_939552_c1
2179 nmdc:mga0k408_24179_c1
2180 nmdc:mga0k408_349_c1
2181 nmdc:mga0k408_378984_c1
2182 nmdc:mga07m45_270409_c1
2183 nmdc:mga07m45_38113_c1
2184 Ga0500635_0005612
2185 Ga0500646_0007145
2186 Ga0500646_0021012
2187 Ga0500647_0264730
2188 Ga0500647_0339823
2189 Ga0500651_0569790
2190 Ga0500641_0000168
2191 Ga0500641_0006404
2192 Ga0500594_0037129
2193 Ga0500608_016071
2194 Ga0500608_075213
2195 Ga0500618_000005
2196 Ga0500618_012806
2197 Ga0500642_0495421
2198 Ga0500652_333618
2199 Ga0500658_0000002
2200 Ga0500559_0010320
2201 Ga0500559_0042408
2202 Ga0500559_0567032
2203 Ga0500573_0412418
2204 Ga0500579_161976
2205 Ga0500588_0154830
2206 Ga0500619_103271
2207 Ga0500622_0000385
2208 Ga0500622_0163807
2209 Ga0500627_0221552
2210 Ga0500627_0308908
2211 Ga0500584_021185
2212 Ga0587070_001656
2213 Ga0587073_0014997
2214 Ga0587073_0063709
2215 Ga0587077_039243
2216 Ga0587080_002246
2217 Ga0587083_0013249
2218 Ga0587083_0065881
2219 Ga0587091_101864
2220 Ga0587094_028037
2221 Ga0587098_001742
2222 Ga0587106_104451
2223 Ga0587068_028699
2224 Ga0587076_000823
2225 Ga0587076_012245
2226 Ga0587076_162302
2227 Ga0587079_016619
2228 Ga0587079_097608

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00253

Ribosomal_S14

Ribosomal protein S14p/S29e

57

110

0.98

Map