F490270

General Info

Members Datasets Scaffolds Average Seq Length
1113 489 1061 373

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2831265667|2831269637
Length 435
Sequence SGLFFYLLKVTPMSTPNADTYHAEASDIRELPPPESVMRFYPVAGTPVEALVLTTRKTIHQILDGDDDRLLVVMGPCSIHDPKAAFEYALKLAKQRERFADSLEIVMRVYFEKPRTTVGWKGLINDPYLDESFKINEGLRIARQVLIDINNLGLPAGSEFLDVISPQYIGDLISWGAIGARTTESQVHRELASGLSAPIGFKNGTDGNIRIAVDAIQAAARGHHFLSVHKNGHVAIVETTGNPDCHVILRGGKSPNYDAESVELACLGLQEAGLRPSLMVDCSHANSSKMHEKQIAVAGDVAAQIAGGSSRVFGVMVESHLREGAQRFAPGRDRAADLVYGQSITDACLGWDDSVQVLEALSEAVRGRRRARLEKEGVYVRKRRGSVVYSVDSTSPDAAFVDLVDAPLAQPAGAAEGVDLNATGWQHHADFAPLA

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2643221585 Pelomonas sp. Root662 Isolate Unclassified
7 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
8 2643221596 Acidovorax sp. Root70 Isolate Unclassified
9 2643221609 Acidovorax sp. Root217 Isolate Unclassified
10 2643221611 Acidovorax sp. Root219 Isolate Unclassified
11 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
12 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
13 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
14 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
15 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
16 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
17 2643221652 Acidovorax sp. Root402 Isolate Unclassified
18 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
19 2643221656 Pelomonas sp. Root405 Isolate Unclassified
20 2643221658 Variovorax sp. Root411 Isolate Unclassified
21 2643221672 Variovorax sp. Root434 Isolate Unclassified
22 2643221683 Variovorax sp. Root473 Isolate Unclassified
23 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
24 2738541277 Variovorax sp. GV051 Isolate Unclassified
25 2738541307 Variovorax sp. GV008 Isolate Unclassified
26 2738541337 Pelomonas sp. BT06 Isolate Unclassified
27 2738543013 Variovorax sp. BT01 Isolate Unclassified
28 2738543019 Variovorax sp. GV040 Isolate Unclassified
29 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
30 2831864461 Roseateles noduli HZ7 Isolate Nodule
31 2842677519 Variovorax sp. R-72495 Isolate Unclassified
32 2842747753 Variovorax sp. R-72060 Isolate Unclassified
33 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
34 2885198086 Variovorax sp. 679 Isolate Unclassified
35 2885211737 Variovorax sp. 553 Isolate Unclassified
36 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
37 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
38 2904456579 Variovorax sp. 2002 Isolate Unclassified
39 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
40 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
41 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
42 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
43 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
44 2929520902 Variovorax beijingensis 502 Isolate Unclassified
45 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
46 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
47 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
48 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
49 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
50 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
51 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
52 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
53 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
54 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
55 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
56 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
57 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
58 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
60 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
61 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
62 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
63 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
64 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
65 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
66 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
67 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
68 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
69 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
70 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
71 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
72 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
73 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
74 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
75 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
76 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
78 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
79 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
80 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
81 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
82 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
83 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
84 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
85 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
86 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
87 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
88 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
89 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
90 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
91 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
92 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
93 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
94 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
95 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
96 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
97 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
98 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
99 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
100 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
101 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
102 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
103 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
104 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
105 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
106 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
107 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
108 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
109 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
110 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
111 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
112 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
113 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
114 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
115 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
116 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
117 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
118 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
119 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
120 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
121 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
122 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
123 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
124 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
125 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
126 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
127 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
128 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
129 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
130 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
131 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
132 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
133 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
134 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
135 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
136 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
137 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
138 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
139 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
140 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
141 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
142 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
143 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
144 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
145 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
146 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
147 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
148 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
149 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
150 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
151 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
152 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
153 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
154 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
155 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
156 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
157 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
158 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
159 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
160 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
161 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
162 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
163 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
164 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
165 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
166 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
167 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
168 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
169 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
170 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
171 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
172 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
173 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
174 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
175 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
176 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
177 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
178 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
179 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
180 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
181 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
182 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
183 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
184 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
185 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
186 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
187 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
188 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
189 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
190 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
191 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
192 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
193 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
194 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
195 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
196 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
197 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
200 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
202 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
203 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
204 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
207 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
208 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
209 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
212 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
213 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
214 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
216 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
217 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
218 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
220 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
221 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
284 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
285 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
286 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
287 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
288 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
289 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
290 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
292 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
295 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
296 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
300 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
301 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
302 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
303 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
304 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
305 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
306 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
307 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
308 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
309 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
310 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
311 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
312 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
313 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
314 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
315 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
316 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
317 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
318 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
319 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
320 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
321 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
322 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
323 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
324 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
325 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
326 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
327 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
328 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
329 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
330 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
331 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
332 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
333 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
334 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
335 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
336 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
337 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
338 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
339 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
340 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
341 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
342 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
343 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
344 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
345 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
346 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
347 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
348 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
349 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
350 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
351 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
352 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
353 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
354 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
355 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
356 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
357 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
358 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
359 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
360 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
361 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
362 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
363 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
364 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
365 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
366 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
367 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
368 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
369 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
370 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
371 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
372 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
373 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
374 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
375 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
376 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
377 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
378 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
379 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
380 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
381 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
382 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
383 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
384 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
385 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
386 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
387 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
388 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
389 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
390 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
391 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
392 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
393 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
394 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
395 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
396 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
397 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
398 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
399 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
400 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
401 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
402 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
403 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
404 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
405 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
406 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
407 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
408 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
409 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
410 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
411 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
412 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
413 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
414 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
415 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
416 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
417 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
418 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
419 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
420 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
421 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
422 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
423 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
424 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
440 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
441 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
442 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
443 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
444 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
445 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
446 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
447 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
448 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
449 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
450 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
451 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
452 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
453 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
454 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
455 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
456 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
457 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
458 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
459 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
462 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
463 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
464 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
465 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
466 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
467 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
468 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
469 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
470 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
471 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
472 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
473 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
474 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
475 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
476 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
477 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
478 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
479 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
480 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
481 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
482 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
483 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
484 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
485 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
486 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
487 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
488 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
489 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.24
Metatranscriptomes 0.09
Isolates 4.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.73
Nodule 0.63
Rhizoplane 1.08
Rhizosphere 76.37
Stem 0
Stem Tuber 0
Unclassified 7.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10052861 3300001979 Bacteria 1155
2 JGI25154J39366_1002640 3300002738 Bacteria 4423
3 JGI25157J39369_1000038 3300002741 Bacteria 130270
4 JGI25152J39213_1000972 3300002773 Bacteria 13971
5 JGI25150J39212_1006600 3300002774 Bacteria 2383
6 JGI25151J46595_10000362 3300003187 Bacteria 47753
7 JGI25151J46595_10000972 3300003187 Bacteria 21720
8 JGI25151J46595_10001552 3300003187 Bacteria 15327
9 JGI25151J46595_10026424 3300003187 Bacteria 2342
10 JGI25406J46586_10019026 3300003203 Bacteria 2808
11 JGI25165J46597_1008243 3300003214 Bacteria 1650
12 JGI25153J46596_10001411 3300003215 Bacteria 14402
13 JGI25153J46596_10002253 3300003215 Bacteria 11236
14 Ga0006777J48905_1070856 3300003308 Bacteria 1351
15 JGI25161J50226_1003108 3300003374 Bacteria 3954
16 Ga0055539_1000775 3300003752 Bacteria 7681
17 Ga0055539_1002200 3300003752 Bacteria 3103
18 Ga0055533_1000026 3300003756 Bacteria 323407
19 Ga0055525_1000004 3300003759 Bacteria 888039
20 Ga0055535_1000056 3300003761 Bacteria 128204
21 Ga0055529_1000103 3300003763 Bacteria 127175
22 Ga0055526_1000374 3300003771 Bacteria 36279
23 Ga0055526_1002321 3300003771 Bacteria 12957
24 Ga0055526_1002595 3300003771 Bacteria 12082
25 Ga0055537_1001076 3300003773 Bacteria 12083
26 Ga0055524_1001870 3300003775 Bacteria 11488
27 Ga0055524_1010050 3300003775 Bacteria 3795
28 Ga0055536_1000112 3300003781 Bacteria 70656
29 Ga0055536_1005250 3300003781 Bacteria 6387
30 Ga0055534_1000233 3300003784 Bacteria 40184
31 Ga0055534_1000536 3300003784 Bacteria 20333
32 Ga0055534_1002239 3300003784 Bacteria 6843
33 Ga0055534_1002715 3300003784 Bacteria 5965
34 Ga0055530_10008382 3300003791 Bacteria 4151
35 Ga0055540_1000007 3300003792 Bacteria 318178
36 Ga0055540_1004117 3300003792 Bacteria 6726
37 Ga0055531_10003405 3300003794 Bacteria 10160
38 JGI25405J52794_10005070 3300003911 Bacteria 2364
39 Ga0065165_1000116 3300005262 Bacteria 134997
40 Ga0065165_1001186 3300005262 Bacteria 30210
41 Ga0065704_10156447 3300005289 Bacteria 1383
42 Ga0065712_10000147 3300005290 Bacteria 47854
43 Ga0065715_10000258 3300005293 Bacteria 18448
44 Ga0065715_10119204 3300005293 Bacteria 2293
45 Ga0065707_10082206 3300005295 Bacteria 19149
46 Ga0065707_10217691 3300005295 Bacteria 1238
47 Ga0070658_10014105 3300005327 Bacteria 6416
48 Ga0070658_10210702 3300005327 Bacteria 1641
49 Ga0070676_10005340 3300005328 Bacteria 6841
50 Ga0070676_10009149 3300005328 Bacteria 5359
51 Ga0070676_10047522 3300005328 Bacteria 2506
52 Ga0070683_100109663 3300005329 Bacteria 2603
53 Ga0070690_100118899 3300005330 Bacteria 1772
54 Ga0070670_100003594 3300005331 Bacteria 12901
55 Ga0070670_100018524 3300005331 Bacteria 5974
56 Ga0070670_100022809 3300005331 Bacteria 5386
57 Ga0070670_100083123 3300005331 Bacteria 2752
58 Ga0070670_100107217 3300005331 Bacteria 2408
59 Ga0070670_100254397 3300005331 Bacteria 1530
60 Ga0070677_10004354 3300005333 Bacteria 4614
61 Ga0070677_10011030 3300005333 Bacteria 3106
62 Ga0068869_100006597 3300005334 Bacteria 7364
63 Ga0068869_100008593 3300005334 Bacteria 6594
64 Ga0068869_100033962 3300005334 Bacteria 3605
65 Ga0068869_100048618 3300005334 Bacteria 3067
66 Ga0068869_100055320 3300005334 Bacteria 2892
67 Ga0070666_10029713 3300005335 Bacteria 3595
68 Ga0070680_100010602 3300005336 Bacteria 7110
69 Ga0070682_100016479 3300005337 Bacteria 4297
70 Ga0068868_100003190 3300005338 Bacteria 11407
71 Ga0068868_100005381 3300005338 Bacteria 8994
72 Ga0068868_100034195 3300005338 Bacteria 3923
73 Ga0068868_100060430 3300005338 Bacteria 3000
74 Ga0068868_100140897 3300005338 Bacteria 1979
75 Ga0070660_100007413 3300005339 Bacteria 7641
76 Ga0070660_100020125 3300005339 Bacteria 4900
77 Ga0070660_100039265 3300005339 Bacteria 3597
78 Ga0070660_100151384 3300005339 Bacteria 1865
79 Ga0070689_100307745 3300005340 Bacteria 1320
80 Ga0070691_10012002 3300005341 Bacteria 3966
81 Ga0070687_100044584 3300005343 Bacteria 2260
82 Ga0070661_100000108 3300005344 Bacteria 68597
83 Ga0070668_100019536 3300005347 Bacteria 5100
84 Ga0070668_100118463 3300005347 Bacteria 2114
85 Ga0070669_100006476 3300005353 Bacteria 8430
86 Ga0070669_100009475 3300005353 Bacteria 6935
87 Ga0070675_100000556 3300005354 Bacteria 25668
88 Ga0070675_100005294 3300005354 Bacteria 9857
89 Ga0070675_100009078 3300005354 Bacteria 7723
90 Ga0070675_100071018 3300005354 Bacteria 2887
91 Ga0070671_100006922 3300005355 Bacteria 9082
92 Ga0070671_100034758 3300005355 Bacteria 4173
93 Ga0070671_100066536 3300005355 Bacteria 3004
94 Ga0070674_100033911 3300005356 Bacteria 3403
95 Ga0070673_100001332 3300005364 Bacteria 14386
96 Ga0070673_100032276 3300005364 Bacteria 3941
97 Ga0070673_100141459 3300005364 Bacteria 2030
98 Ga0070673_100167424 3300005364 Bacteria 1874
99 Ga0070673_100258487 3300005364 Bacteria 1520
100 Ga0070659_100001701 3300005366 Bacteria 15803
101 Ga0070667_100009343 3300005367 Bacteria 8131
102 Ga0070667_100014368 3300005367 Bacteria 6542
103 Ga0070667_100061042 3300005367 Bacteria 3191
104 Ga0070667_100084380 3300005367 Bacteria 2722
105 Ga0070701_10099426 3300005438 Bacteria 1609
106 Ga0070711_100000783 3300005439 Bacteria 16606
107 Ga0070705_100002282 3300005440 Bacteria 9693
108 Ga0070705_100162997 3300005440 Bacteria 1492
109 Ga0070694_100003005 3300005444 Bacteria 10033
110 Ga0070694_100108565 3300005444 Bacteria 1974
111 Ga0070708_100018219 3300005445 Bacteria 5876
112 Ga0070663_100029920 3300005455 Bacteria 3726
113 Ga0070663_100087356 3300005455 Bacteria 2304
114 Ga0070678_100005119 3300005456 Bacteria 7527
115 Ga0070678_100062095 3300005456 Bacteria 2757
116 Ga0070678_100347224 3300005456 Bacteria 1275
117 Ga0070662_100049993 3300005457 Bacteria 3015
118 Ga0070681_10018558 3300005458 Bacteria 6953
119 Ga0070681_10110596 3300005458 Bacteria 2687
120 Ga0070681_10442238 3300005458 Bacteria 1212
121 Ga0068867_100000004 3300005459 Bacteria 180739
122 Ga0068867_100005767 3300005459 Bacteria 8785
123 Ga0068867_100011508 3300005459 Bacteria 6246
124 Ga0068867_100026143 3300005459 Bacteria 4190
125 Ga0068867_100176513 3300005459 Bacteria 1696
126 Ga0068867_100203839 3300005459 Bacteria 1585
127 Ga0070706_100089850 3300005467 Bacteria 2848
128 Ga0070707_100011124 3300005468 Bacteria 8383
129 Ga0070699_100009099 3300005518 Bacteria 8612
130 Ga0070699_100057090 3300005518 Bacteria 3381
131 Ga0070699_100082511 3300005518 Bacteria 2803
132 Ga0070679_100004838 3300005530 Bacteria 12424
133 Ga0070684_100226424 3300005535 Bacteria 1707
134 Ga0070697_100001057 3300005536 Bacteria 20812
135 Ga0070697_100003400 3300005536 Bacteria 12230
136 Ga0070697_100056148 3300005536 Bacteria 3203
137 Ga0068853_100057828 3300005539 Bacteria 3347
138 Ga0068853_100086109 3300005539 Bacteria 2755
139 Ga0068853_100105037 3300005539 Bacteria 2501
140 Ga0068853_100235700 3300005539 Bacteria 1675
141 Ga0070672_100005974 3300005543 Bacteria 8125
142 Ga0070672_100006624 3300005543 Bacteria 7801
143 Ga0070672_100039105 3300005543 Bacteria 3631
144 Ga0070672_100052702 3300005543 Bacteria 3177
145 Ga0070672_100193817 3300005543 Bacteria 1697
146 Ga0070686_100021988 3300005544 Bacteria 3796
147 Ga0070695_100004094 3300005545 Bacteria 8522
148 Ga0070695_100021796 3300005545 Bacteria 3925
149 Ga0070695_100023046 3300005545 Bacteria 3822
150 Ga0070696_100004324 3300005546 Bacteria 9469
151 Ga0070693_100062021 3300005547 Bacteria 2175
152 Ga0070665_100055139 3300005548 Bacteria 3986
153 Ga0070665_100210804 3300005548 Bacteria 1943
154 Ga0070665_100385225 3300005548 Bacteria 1410
155 Ga0068855_100001374 3300005563 Bacteria 30099
156 Ga0068855_100006754 3300005563 Bacteria 13917
157 Ga0068855_100017132 3300005563 Bacteria 8716
158 Ga0068855_100039778 3300005563 Bacteria 5581
159 Ga0068855_100158335 3300005563 Bacteria 2572
160 Ga0068855_100162039 3300005563 Bacteria 2537
161 Ga0068855_100200638 3300005563 Bacteria 2245
162 Ga0068855_100344535 3300005563 Bacteria 1642
163 Ga0070664_100004792 3300005564 Bacteria 10841
164 Ga0070664_100019559 3300005564 Bacteria 5571
165 Ga0070664_100023637 3300005564 Bacteria 5078
166 Ga0068857_100188190 3300005577 Bacteria 1880
167 Ga0068854_100029405 3300005578 Bacteria 3804
168 Ga0068854_100082900 3300005578 Bacteria 2370
169 Ga0068856_100002420 3300005614 Bacteria 19200
170 Ga0068856_100278118 3300005614 Bacteria 1690
171 Ga0070702_100052322 3300005615 Bacteria 2341
172 Ga0068852_100033112 3300005616 Bacteria 4287
173 Ga0068852_100070988 3300005616 Bacteria 3057
174 Ga0068852_100104725 3300005616 Bacteria 2561
175 Ga0068852_100105281 3300005616 Bacteria 2556
176 Ga0068852_100118376 3300005616 Bacteria 2420
177 Ga0068852_100127122 3300005616 Bacteria 2342
178 Ga0068859_100003043 3300005617 Bacteria 17010
179 Ga0068859_100009651 3300005617 Bacteria 9744
180 Ga0068859_100053138 3300005617 Bacteria 4073
181 Ga0068864_100003888 3300005618 Bacteria 12299
182 Ga0068864_100021530 3300005618 Bacteria 5400
183 Ga0068864_100027072 3300005618 Bacteria 4838
184 Ga0068866_10003133 3300005718 Bacteria 6809
185 Ga0068866_10015069 3300005718 Bacteria 3428
186 Ga0068861_100004049 3300005719 Bacteria 9815
187 Ga0068861_100011512 3300005719 Bacteria 6154
188 Ga0068870_10010073 3300005840 Bacteria 4325
189 Ga0068870_10010553 3300005840 Bacteria 4250
190 Ga0068870_10016725 3300005840 Bacteria 3512
191 Ga0068863_100004228 3300005841 Bacteria 14178
192 Ga0068863_100009638 3300005841 Bacteria 9421
193 Ga0068863_100016559 3300005841 Bacteria 7074
194 Ga0068863_100223710 3300005841 Bacteria 1814
195 Ga0068863_100357676 3300005841 Bacteria 1423
196 Ga0068858_100000225 3300005842 Bacteria 61439
197 Ga0068858_100004355 3300005842 Bacteria 13888
198 Ga0068858_100025199 3300005842 Bacteria 5535
199 Ga0068858_100027701 3300005842 Bacteria 5265
200 Ga0068858_100029372 3300005842 Bacteria 5104
201 Ga0068858_100328027 3300005842 Bacteria 1464
202 Ga0068860_100006985 3300005843 Bacteria 11311
203 Ga0068860_100035553 3300005843 Bacteria 4778
204 Ga0068860_100047687 3300005843 Bacteria 4082
205 Ga0068860_100124880 3300005843 Bacteria 2467
206 Ga0068860_100494227 3300005843 Bacteria 1221
207 Ga0068862_100002168 3300005844 Bacteria 17645
208 Ga0068862_100007612 3300005844 Bacteria 8973
209 Ga0068862_100193874 3300005844 Bacteria 1829
210 Ga0081539_10001364 3300005985 Bacteria 42295
211 Ga0075365_10117637 3300006038 Bacteria 1831
212 Ga0075364_10070186 3300006051 Bacteria 2306
213 Ga0070715_10051994 3300006163 Bacteria 1766
214 Ga0075367_10003802 3300006178 Bacteria 7274
215 Ga0075367_10057940 3300006178 Bacteria 2304
216 Ga0075367_10085948 3300006178 Bacteria 1908
217 Ga0075367_10089237 3300006178 Bacteria 1874
218 Ga0075366_10005214 3300006195 Bacteria 7032
219 Ga0075366_10008033 3300006195 Bacteria 5847
220 Ga0075366_10012244 3300006195 Bacteria 4863
221 Ga0075366_10043163 3300006195 Bacteria 2671
222 Ga0075366_10045445 3300006195 Bacteria 2603
223 Ga0075366_10065786 3300006195 Bacteria 2156
224 Ga0075366_10113846 3300006195 Bacteria 1628
225 Ga0097621_100001554 3300006237 Bacteria 15677
226 Ga0097621_100019015 3300006237 Bacteria 5264
227 Ga0097621_100026728 3300006237 Bacteria 4531
228 Ga0075370_10001068 3300006353 Bacteria 11409
229 Ga0075370_10001217 3300006353 Bacteria 10880
230 Ga0075370_10002202 3300006353 Bacteria 8952
231 Ga0075370_10002762 3300006353 Bacteria 8220
232 Ga0075370_10004362 3300006353 Bacteria 6858
233 Ga0075370_10005946 3300006353 Bacteria 6107
234 Ga0075370_10011497 3300006353 Bacteria 4654
235 Ga0075370_10017865 3300006353 Bacteria 3837
236 Ga0075370_10040010 3300006353 Bacteria 2643
237 Ga0075370_10050205 3300006353 Bacteria 2366
238 Ga0075370_10060228 3300006353 Bacteria 2162
239 Ga0075370_10074305 3300006353 Bacteria 1948
240 Ga0068871_100006024 3300006358 Bacteria 8533
241 Ga0068871_100043531 3300006358 Bacteria 3606
242 Ga0068871_100142943 3300006358 Bacteria 2036
243 Ga0068871_100161849 3300006358 Bacteria 1915
244 Ga0075428_100189717 3300006844 Bacteria 2223
245 Ga0075430_100082419 3300006846 Bacteria 2696
246 Ga0075431_100031935 3300006847 Bacteria 5425
247 Ga0075433_10004322 3300006852 Bacteria 11036
248 Ga0075434_100000696 3300006871 Bacteria 26264
249 Ga0075434_100002860 3300006871 Bacteria 15312
250 Ga0075434_100018694 3300006871 Bacteria 6696
251 Ga0075434_100039756 3300006871 Bacteria 4659
252 Ga0075434_100411784 3300006871 Bacteria 1373
253 Ga0075429_100000871 3300006880 Bacteria 23800
254 Ga0075429_100028408 3300006880 Bacteria 4857
255 Ga0068865_100001798 3300006881 Bacteria 12586
256 Ga0068865_100055026 3300006881 Bacteria 2767
257 Ga0075436_100007333 3300006914 Bacteria 7537
258 Ga0075436_100276564 3300006914 Bacteria 1200
259 Ga0097620_100003043 3300006931 Bacteria 17010
260 Ga0097620_100009651 3300006931 Bacteria 9744
261 Ga0097620_100053135 3300006931 Bacteria 4073
262 Ga0097620_100252801 3300006931 Bacteria 1853
263 Ga0099823_1000232 3300006944 Bacteria 31969
264 Ga0079104_1000009 3300006946 Bacteria 367015
265 Ga0099826_10002824 3300006948 Bacteria 11449
266 Ga0075435_100006841 3300007076 Bacteria 8091
267 Ga0105240_10005995 3300009093 Bacteria 17972
268 Ga0105240_10016496 3300009093 Bacteria 9998
269 Ga0105240_10064424 3300009093 Bacteria 4554
270 Ga0111539_10410510 3300009094 Bacteria 1577
271 Ga0111539_10523992 3300009094 Bacteria 1381
272 Ga0105245_10159428 3300009098 Bacteria 2140
273 Ga0105245_10438964 3300009098 Bacteria 1312
274 Ga0114129_10015710 3300009147 Bacteria 10764
275 Ga0114129_10029909 3300009147 Bacteria 7713
276 Ga0114129_10098052 3300009147 Bacteria 4057
277 Ga0114129_10225945 3300009147 Bacteria 2523
278 Ga0105243_10003290 3300009148 Bacteria 13127
279 Ga0105243_10004194 3300009148 Bacteria 11428
280 Ga0105243_10022803 3300009148 Bacteria 4759
281 Ga0105243_10037020 3300009148 Bacteria 3789
282 Ga0105243_10073728 3300009148 Bacteria 2766
283 Ga0105243_10203124 3300009148 Bacteria 1739
284 Ga0105242_10001421 3300009176 Bacteria 18880
285 Ga0105242_10003452 3300009176 Bacteria 12287
286 Ga0105242_10009565 3300009176 Bacteria 7428
287 Ga0105242_10041885 3300009176 Bacteria 3695
288 Ga0105242_10117104 3300009176 Bacteria 2280
289 Ga0105248_10032848 3300009177 Bacteria 5798
290 Ga0105237_10000080 3300009545 Bacteria 127788
291 Ga0105237_10015429 3300009545 Bacteria 7951
292 Ga0105237_10021585 3300009545 Bacteria 6619
293 Ga0105237_10058446 3300009545 Bacteria 3859
294 Ga0105238_10006890 3300009551 Bacteria 11350
295 Ga0105238_10022002 3300009551 Bacteria 6497
296 Ga0105238_10056231 3300009551 Bacteria 3948
297 Ga0105238_10317745 3300009551 Bacteria 1543
298 Ga0105249_10007455 3300009553 Bacteria 9546
299 Ga0105249_10120150 3300009553 Bacteria 2496
300 Ga0105239_10000116 3300010375 Bacteria 112811
301 Ga0105239_10042014 3300010375 Bacteria 5009
302 Ga0105239_10387452 3300010375 Bacteria 1581
303 Ga0105246_10089094 3300011119 Bacteria 2219
304 Ga0157319_1000004 3300012497 Bacteria 394735
305 Ga0157370_10008219 3300013104 Bacteria 11271
306 Ga0157369_10005838 3300013105 Bacteria 14311
307 Ga0157369_10092342 3300013105 Bacteria 3230
308 Ga0157374_10178621 3300013296 Bacteria 2073
309 Ga0157378_10043514 3300013297 Bacteria 3988
310 Ga0163162_10015143 3300013306 Bacteria 7531
311 Ga0163162_10015161 3300013306 Bacteria 7527
312 Ga0163162_10060815 3300013306 Bacteria 3814
313 Ga0163162_10121871 3300013306 Bacteria 2712
314 Ga0163162_10235678 3300013306 Bacteria 1961
315 Ga0157375_10005490 3300013308 Bacteria 11026
316 Ga0157375_10014943 3300013308 Bacteria 6941
317 Ga0157375_10020633 3300013308 Bacteria 6024
318 Ga0157375_10025537 3300013308 Bacteria 5491
319 Ga0163163_10016806 3300014325 Bacteria 6811
320 Ga0157380_10009516 3300014326 Bacteria 6969
321 Ga0182008_10001216 3300014497 Bacteria 17752
322 Ga0182008_10003469 3300014497 Bacteria 9510
323 Ga0157377_10000010 3300014745 Bacteria 380929
324 Ga0157379_10010838 3300014968 Bacteria 7950
325 Ga0157379_10026514 3300014968 Bacteria 5159
326 Ga0157379_10068550 3300014968 Bacteria 3171
327 Ga0157376_10003392 3300014969 Bacteria 10967
328 Ga0157376_10103260 3300014969 Bacteria 2495
329 Ga0182006_1000937 3300015261 Bacteria 19449
330 Ga0182007_10000419 3300015262 Bacteria 25979
331 Ga0182007_10000746 3300015262 Bacteria 18360
332 Ga0183362_10003 3300015683 Bacteria 977584
333 Ga0163161_10003954 3300017792 Bacteria 10398
334 Ga0163161_10011407 3300017792 Bacteria 6162
335 Ga0163161_10032549 3300017792 Bacteria 3723
336 Ga0163161_10041709 3300017792 Bacteria 3298
337 Ga0163161_10060862 3300017792 Bacteria 2749
338 Ga0163161_10066164 3300017792 Bacteria 2638
339 Ga0163161_10073247 3300017792 Bacteria 2510
340 Ga0163161_10219409 3300017792 Bacteria 1472
341 Ga0213872_10000233 3300021361 Bacteria 48866
342 Ga0213872_10001634 3300021361 Bacteria 14191
343 Ga0209674_100024 3300025226 Bacteria 535481
344 Ga0209563_100013 3300025230 Bacteria 941463
345 Ga0209563_100069 3300025230 Bacteria 253154
346 Ga0207427_102200 3300025231 Bacteria 5523
347 Ga0209258_100071 3300025242 Bacteria 278319
348 Ga0209258_100783 3300025242 Bacteria 19264
349 Ga0207425_1000196 3300025245 Bacteria 48364
350 Ga0207425_1000663 3300025245 Bacteria 18873
351 Ga0209646_1000012 3300025246 Bacteria 573300
352 Ga0209026_1000004 3300025250 Bacteria 949012
353 Ga0209677_100092 3300025253 Bacteria 102482
354 Ga0209677_101513 3300025253 Bacteria 9963
355 Ga0209148_1010852 3300025254 Bacteria 1713
356 Ga0209759_1000003 3300025256 Bacteria 792130
357 Ga0209759_1001236 3300025256 Bacteria 15604
358 Ga0209759_1009207 3300025256 Bacteria 3003
359 Ga0209129_1000035 3300025258 Bacteria 329303
360 Ga0209129_1000084 3300025258 Bacteria 182554
361 Ga0209129_1001344 3300025258 Bacteria 13895
362 Ga0209233_1000911 3300025261 Bacteria 12899
363 Ga0209565_1000053 3300025263 Bacteria 210249
364 Ga0209565_1000169 3300025263 Bacteria 84839
365 Ga0209455_1000030 3300025272 Bacteria 533479
366 Ga0209673_1000114 3300025273 Bacteria 178557
367 Ga0209673_1002863 3300025273 Bacteria 10992
368 Ga0209673_1016035 3300025273 Bacteria 2818
369 Ga0209673_1042876 3300025273 Bacteria 1269
370 Ga0209130_1000621 3300025284 Bacteria 33935
371 Ga0209130_1001206 3300025284 Bacteria 18381
372 Ga0209675_1000043 3300025291 Bacteria 235320
373 Ga0209675_1000062 3300025291 Bacteria 178557
374 Ga0209675_1000091 3300025291 Bacteria 146390
375 Ga0209675_1001454 3300025291 Bacteria 13668
376 Ga0209675_1002744 3300025291 Bacteria 8807
377 Ga0209675_1005160 3300025291 Bacteria 5555
378 Ga0209676_1000083 3300025292 Bacteria 279816
379 Ga0209676_1000999 3300025292 Bacteria 33230
380 Ga0209676_1001040 3300025292 Bacteria 32079
381 Ga0209025_1000085 3300025294 Bacteria 263782
382 Ga0209025_1000106 3300025294 Bacteria 222421
383 Ga0209025_1000123 3300025294 Bacteria 204125
384 Ga0209025_1000678 3300025294 Bacteria 58460
385 Ga0209025_1000719 3300025294 Bacteria 56292
386 Ga0209025_1000838 3300025294 Bacteria 48812
387 Ga0209025_1000861 3300025294 Bacteria 47942
388 Ga0209025_1005452 3300025294 Bacteria 10371
389 Ga0209025_1016647 3300025294 Bacteria 4314
390 Ga0209564_1000021 3300025295 Bacteria 571316
391 Ga0209564_1000024 3300025295 Bacteria 535041
392 Ga0209564_1000170 3300025295 Bacteria 156293
393 Ga0209564_1001047 3300025295 Bacteria 33829
394 Ga0209564_1001096 3300025295 Bacteria 32208
395 Ga0209564_1002189 3300025295 Bacteria 16364
396 Ga0209758_1000558 3300025297 Bacteria 58712
397 Ga0209758_1000754 3300025297 Bacteria 46944
398 Ga0209758_1001090 3300025297 Bacteria 35155
399 Ga0209050_1000246 3300025298 Bacteria 116721
400 Ga0209050_1000266 3300025298 Bacteria 111792
401 Ga0209050_1002399 3300025298 Bacteria 16215
402 Ga0209050_1002554 3300025298 Bacteria 15213
403 Ga0209050_1006483 3300025298 Bacteria 6909
404 Ga0209256_1000019 3300025299 Bacteria 558627
405 Ga0209256_1000206 3300025299 Bacteria 111425
406 Ga0209256_1000407 3300025299 Bacteria 68090
407 Ga0209256_1000840 3300025299 Bacteria 38531
408 Ga0209256_1001471 3300025299 Bacteria 24106
409 Ga0209256_1005599 3300025299 Bacteria 7136
410 Ga0207426_1000049 3300025302 Bacteria 401954
411 Ga0209051_1000004 3300025303 Bacteria 1155596
412 Ga0209051_1000025 3300025303 Bacteria 415397
413 Ga0209051_1000824 3300025303 Bacteria 32075
414 Ga0209051_1001151 3300025303 Bacteria 24034
415 Ga0209051_1002164 3300025303 Bacteria 14577
416 Ga0209051_1002289 3300025303 Bacteria 13991
417 Ga0209051_1010874 3300025303 Bacteria 4549
418 Ga0209051_1016391 3300025303 Bacteria 3356
419 Ga0209051_1024903 3300025303 Bacteria 2449
420 Ga0209051_1027578 3300025303 Bacteria 2260
421 Ga0209051_1031720 3300025303 Bacteria 2027
422 Ga0209257_1000038 3300025304 Bacteria 609032
423 Ga0209257_1000039 3300025304 Bacteria 591694
424 Ga0209257_1000044 3300025304 Bacteria 486709
425 Ga0209257_1000047 3300025304 Bacteria 460507
426 Ga0209257_1000977 3300025304 Bacteria 38863
427 Ga0209257_1002054 3300025304 Bacteria 21333
428 Ga0209257_1004064 3300025304 Bacteria 11744
429 Ga0209257_1006483 3300025304 Bacteria 7504
430 Ga0209257_1025419 3300025304 Bacteria 2024
431 Ga0207697_10009126 3300025315 Bacteria 4298
432 Ga0207697_10020450 3300025315 Bacteria 2710
433 Ga0207656_10025409 3300025321 Bacteria 2404
434 Ga0207655_1001268 3300025728 Bacteria 24088
435 Ga0207682_10014751 3300025893 Bacteria 3044
436 Ga0207642_10073256 3300025899 Bacteria 1637
437 Ga0207688_10019501 3300025901 Bacteria 3697
438 Ga0207688_10189794 3300025901 Bacteria 1228
439 Ga0207680_10006999 3300025903 Bacteria 5474
440 Ga0207680_10056253 3300025903 Bacteria 2375
441 Ga0207645_10014439 3300025907 Bacteria 5284
442 Ga0207645_10021447 3300025907 Bacteria 4212
443 Ga0207645_10024587 3300025907 Bacteria 3903
444 Ga0207645_10028782 3300025907 Bacteria 3584
445 Ga0207643_10021976 3300025908 Bacteria 3510
446 Ga0207643_10082181 3300025908 Bacteria 1867
447 Ga0207705_10213004 3300025909 Bacteria 1466
448 Ga0207684_10086816 3300025910 Bacteria 2665
449 Ga0207684_10196895 3300025910 Bacteria 1738
450 Ga0207707_10009980 3300025912 Bacteria 8236
451 Ga0207707_10014795 3300025912 Bacteria 6797
452 Ga0207695_10005726 3300025913 Bacteria 16375
453 Ga0207695_10006409 3300025913 Bacteria 15283
454 Ga0207695_10144042 3300025913 Bacteria 2329
455 Ga0207695_10195014 3300025913 Bacteria 1941
456 Ga0207695_10323552 3300025913 Bacteria 1431
457 Ga0207671_10002929 3300025914 Bacteria 17590
458 Ga0207671_10101565 3300025914 Bacteria 2179
459 Ga0207663_10000232 3300025916 Bacteria 24669
460 Ga0207660_10047655 3300025917 Bacteria 3031
461 Ga0207662_10055077 3300025918 Bacteria 2373
462 Ga0207657_10006920 3300025919 Bacteria 11694
463 Ga0207657_10011865 3300025919 Bacteria 8625
464 Ga0207657_10034399 3300025919 Bacteria 4557
465 Ga0207657_10088986 3300025919 Bacteria 2580
466 Ga0207649_10000762 3300025920 Bacteria 20967
467 Ga0207652_10048231 3300025921 Bacteria 3640
468 Ga0207652_10308097 3300025921 Bacteria 1429
469 Ga0207646_10004382 3300025922 Bacteria 15365
470 Ga0207681_10000326 3300025923 Bacteria 34311
471 Ga0207681_10005493 3300025923 Bacteria 7785
472 Ga0207681_10031598 3300025923 Bacteria 3459
473 Ga0207694_10198339 3300025924 Bacteria 1632
474 Ga0207650_10000951 3300025925 Bacteria 21783
475 Ga0207650_10004536 3300025925 Bacteria 9496
476 Ga0207650_10009583 3300025925 Bacteria 6623
477 Ga0207659_10001095 3300025926 Bacteria 16049
478 Ga0207659_10011221 3300025926 Bacteria 5655
479 Ga0207659_10023552 3300025926 Bacteria 4111
480 Ga0207659_10039343 3300025926 Bacteria 3298
481 Ga0207659_10310467 3300025926 Bacteria 1298
482 Ga0207687_10005793 3300025927 Bacteria 8177
483 Ga0207687_10007222 3300025927 Bacteria 7327
484 Ga0207664_10090705 3300025929 Bacteria 2505
485 Ga0207644_10004898 3300025931 Bacteria 8726
486 Ga0207644_10142764 3300025931 Bacteria 1845
487 Ga0207690_10002897 3300025932 Bacteria 10338
488 Ga0207706_10008488 3300025933 Bacteria 9477
489 Ga0207706_10172398 3300025933 Bacteria 1901
490 Ga0207686_10011506 3300025934 Bacteria 4848
491 Ga0207686_10047576 3300025934 Bacteria 2652
492 Ga0207709_10000572 3300025935 Bacteria 31041
493 Ga0207709_10000990 3300025935 Bacteria 21162
494 Ga0207709_10001477 3300025935 Bacteria 16306
495 Ga0207709_10017384 3300025935 Bacteria 4014
496 Ga0207670_10087409 3300025936 Bacteria 2196
497 Ga0207669_10030025 3300025937 Bacteria 3015
498 Ga0207669_10144802 3300025937 Bacteria 1655
499 Ga0207704_10017787 3300025938 Bacteria 3695
500 Ga0207704_10027677 3300025938 Bacteria 3132
501 Ga0207704_10056114 3300025938 Bacteria 2411
502 Ga0207665_10118568 3300025939 Bacteria 1867
503 Ga0207665_10218601 3300025939 Bacteria 1395
504 Ga0207691_10008199 3300025940 Bacteria 10034
505 Ga0207691_10012361 3300025940 Bacteria 8181
506 Ga0207691_10048304 3300025940 Bacteria 3902
507 Ga0207691_10066154 3300025940 Bacteria 3271
508 Ga0207691_10075662 3300025940 Bacteria 3035
509 Ga0207691_10101754 3300025940 Bacteria 2563
510 Ga0207691_10172186 3300025940 Bacteria 1895
511 Ga0207711_10001731 3300025941 Bacteria 20035
512 Ga0207711_10014562 3300025941 Bacteria 6538
513 Ga0207689_10001900 3300025942 Bacteria 19736
514 Ga0207689_10004982 3300025942 Bacteria 11962
515 Ga0207689_10030568 3300025942 Bacteria 4489
516 Ga0207689_10039915 3300025942 Bacteria 3885
517 Ga0207689_10065318 3300025942 Bacteria 2993
518 Ga0207689_10097291 3300025942 Bacteria 2417
519 Ga0207689_10128154 3300025942 Bacteria 2087
520 Ga0207661_10032337 3300025944 Bacteria 4051
521 Ga0207661_10134466 3300025944 Bacteria 2122
522 Ga0207679_10000202 3300025945 Bacteria 47795
523 Ga0207679_10002133 3300025945 Bacteria 12247
524 Ga0207679_10020265 3300025945 Bacteria 4485
525 Ga0207679_10044244 3300025945 Bacteria 3212
526 Ga0207667_10020318 3300025949 Bacteria 7391
527 Ga0207667_10028778 3300025949 Bacteria 6032
528 Ga0207667_10055940 3300025949 Bacteria 4146
529 Ga0207667_10153265 3300025949 Bacteria 2371
530 Ga0207667_10304230 3300025949 Bacteria 1629
531 Ga0207651_10002842 3300025960 Bacteria 8337
532 Ga0207651_10024120 3300025960 Bacteria 3756
533 Ga0207651_10080595 3300025960 Bacteria 2343
534 Ga0207651_10087435 3300025960 Bacteria 2269
535 Ga0207712_10014116 3300025961 Bacteria 5127
536 Ga0207712_10040571 3300025961 Bacteria 3196
537 Ga0207668_10011209 3300025972 Bacteria 5441
538 Ga0207640_10033626 3300025981 Bacteria 3192
539 Ga0207640_10176446 3300025981 Bacteria 1598
540 Ga0207658_10001421 3300025986 Bacteria 18669
541 Ga0207658_10002120 3300025986 Bacteria 14748
542 Ga0207658_10004188 3300025986 Bacteria 10050
543 Ga0207658_10034602 3300025986 Bacteria 3612
544 Ga0207658_10096094 3300025986 Bacteria 2310
545 Ga0207658_10193858 3300025986 Bacteria 1691
546 Ga0207658_10266527 3300025986 Bacteria 1462
547 Ga0207677_10002797 3300026023 Bacteria 9209
548 Ga0207677_10009333 3300026023 Bacteria 5519
549 Ga0207677_10010579 3300026023 Bacteria 5226
550 Ga0207677_10025366 3300026023 Bacteria 3698
551 Ga0207677_10025732 3300026023 Bacteria 3676
552 Ga0207677_10048246 3300026023 Bacteria 2866
553 Ga0207703_10001042 3300026035 Bacteria 26535
554 Ga0207703_10003821 3300026035 Bacteria 12516
555 Ga0207703_10013562 3300026035 Bacteria 6349
556 Ga0207703_10049514 3300026035 Bacteria 3397
557 Ga0207703_10195540 3300026035 Bacteria 1794
558 Ga0207639_10012399 3300026041 Bacteria 5936
559 Ga0207639_10019359 3300026041 Bacteria 4854
560 Ga0207639_10180012 3300026041 Bacteria 1797
561 Ga0207678_10093239 3300026067 Bacteria 2573
562 Ga0207708_10005765 3300026075 Bacteria 9153
563 Ga0207702_10000253 3300026078 Bacteria 62073
564 Ga0207702_10273752 3300026078 Bacteria 1593
565 Ga0207641_10002703 3300026088 Bacteria 16185
566 Ga0207641_10005975 3300026088 Bacteria 10314
567 Ga0207641_10041164 3300026088 Bacteria 3871
568 Ga0207641_10110586 3300026088 Bacteria 2435
569 Ga0207641_10427420 3300026088 Bacteria 1276
570 Ga0207648_10000002 3300026089 Bacteria 307909
571 Ga0207648_10000425 3300026089 Bacteria 46432
572 Ga0207648_10008268 3300026089 Bacteria 10104
573 Ga0207648_10011180 3300026089 Bacteria 8464
574 Ga0207648_10016034 3300026089 Bacteria 6865
575 Ga0207648_10016341 3300026089 Bacteria 6784
576 Ga0207648_10055148 3300026089 Bacteria 3470
577 Ga0207648_10213997 3300026089 Bacteria 1711
578 Ga0207676_10005558 3300026095 Bacteria 8919
579 Ga0207676_10008075 3300026095 Bacteria 7481
580 Ga0207676_10028014 3300026095 Bacteria 4203
581 Ga0207676_10258309 3300026095 Bacteria 1571
582 Ga0207676_10396978 3300026095 Bacteria 1288
583 Ga0207674_10019326 3300026116 Bacteria 7381
584 Ga0207674_10019462 3300026116 Bacteria 7351
585 Ga0207674_10298072 3300026116 Bacteria 1561
586 Ga0207675_100002569 3300026118 Bacteria 17980
587 Ga0207675_100005687 3300026118 Bacteria 11928
588 Ga0207675_100014494 3300026118 Bacteria 7348
589 Ga0207675_100057826 3300026118 Bacteria 3618
590 Ga0207675_100403279 3300026118 Bacteria 1348
591 Ga0207683_10003665 3300026121 Bacteria 13353
592 Ga0207683_10006649 3300026121 Bacteria 9889
593 Ga0207683_10029871 3300026121 Bacteria 4720
594 Ga0207683_10044133 3300026121 Bacteria 3897
595 Ga0207683_10063910 3300026121 Bacteria 3243
596 Ga0207683_10361117 3300026121 Bacteria 1334
597 Ga0207698_10032405 3300026142 Bacteria 3786
598 Ga0207698_10044206 3300026142 Bacteria 3345
599 Ga0207698_10149145 3300026142 Bacteria 2027
600 Ga0207698_10152220 3300026142 Bacteria 2009
601 Ga0207698_10187329 3300026142 Bacteria 1839
602 Ga0209281_1000023 3300027111 Bacteria 519955
603 Ga0209389_1002721 3300027296 Bacteria 13755
604 Ga0209371_1008958 3300027312 Bacteria 3244
605 Ga0209967_1000664 3300027364 Bacteria 4437
606 Ga0209981_1000848 3300027378 Bacteria 3865
607 Ga0210000_1006962 3300027462 Bacteria 1651
608 Ga0209995_1005716 3300027471 Bacteria 1998
609 Ga0209999_1002399 3300027543 Bacteria 3306
610 Ga0209999_1004662 3300027543 Bacteria 2459
611 Ga0209282_1001278 3300027666 Bacteria 13653
612 Ga0209971_1005275 3300027682 Bacteria 3073
613 Ga0209971_1008605 3300027682 Bacteria 2422
614 Ga0209971_1019777 3300027682 Bacteria 1599
615 Ga0209998_10024070 3300027717 Bacteria 1320
616 Ga0209974_10002823 3300027876 Bacteria 6307
617 Ga0207428_10055920 3300027907 Bacteria 3136
618 Ga0207428_10200700 3300027907 Bacteria 1501
619 Ga0207428_10223004 3300027907 Bacteria 1412
620 Ga0268266_10032642 3300028379 Bacteria 4423
621 Ga0268265_10002921 3300028380 Bacteria 12529
622 Ga0268265_10004392 3300028380 Bacteria 9799
623 Ga0268265_10039100 3300028380 Bacteria 3494
624 Ga0268265_10057721 3300028380 Bacteria 2960
625 Ga0268264_10001548 3300028381 Bacteria 21322
626 Ga0268264_10014496 3300028381 Bacteria 6477
627 Ga0268264_10442788 3300028381 Bacteria 1257
628 Ga0268264_10468119 3300028381 Bacteria 1224
629 Ga0265336_10000156 3300028666 Bacteria 48623
630 Ga0307517_10001027 3300028786 Bacteria 47444
631 Ga0307515_10000013 3300028794 Bacteria 568456
632 Ga0307515_10000278 3300028794 Bacteria 125493
633 Ga0307515_10000291 3300028794 Bacteria 123206
634 Ga0307515_10002735 3300028794 Bacteria 37724
635 Ga0307515_10004327 3300028794 Bacteria 29456
636 Ga0307515_10009775 3300028794 Bacteria 18483
637 Ga0307515_10029645 3300028794 Bacteria 9236
638 Ga0307515_10033526 3300028794 Bacteria 8446
639 Ga0307515_10035888 3300028794 Bacteria 8046
640 Ga0307515_10042814 3300028794 Bacteria 7067
641 Ga0307515_10062847 3300028794 Bacteria 5233
642 Ga0265324_10000528 3300029957 Bacteria 26184
643 Ga0268256_1010289 3300030500 Bacteria 3042
644 Ga0307512_10025372 3300030522 Bacteria 5253
645 Ga0307512_10036833 3300030522 Bacteria 4142
646 Ga0316179_1065978 3300030734 Bacteria 1745
647 Ga0316180_1114655 3300030736 Bacteria 3009
648 Ga0316182_1157939 3300030745 Bacteria 3205
649 Ga0316182_1185814 3300030745 Bacteria 2085
650 Ga0265332_10000023 3300031238 Bacteria 211994
651 Ga0265332_10000046 3300031238 Bacteria 113777
652 Ga0265340_10005958 3300031247 Bacteria 6735
653 Ga0265339_10089759 3300031249 Bacteria 1613
654 Ga0265331_10007166 3300031250 Bacteria 6484
655 Ga0265327_10000035 3300031251 Bacteria 314419
656 Ga0265327_10000804 3300031251 Bacteria 47927
657 Ga0265327_10001807 3300031251 Bacteria 25067
658 Ga0265327_10078750 3300031251 Bacteria 1632
659 Ga0307513_10292868 3300031456 Bacteria 1398
660 Ga0307509_10000993 3300031507 Bacteria 48743
661 Ga0307509_10012095 3300031507 Bacteria 10355
662 Ga0307509_10052048 3300031507 Bacteria 4373
663 Ga0307509_10113528 3300031507 Bacteria 2706
664 Ga0307408_100000029 3300031548 Bacteria 227806
665 Ga0307408_100013966 3300031548 Bacteria 5334
666 Ga0307408_100150299 3300031548 Bacteria 1838
667 Ga0307508_10000050 3300031616 Bacteria 135222
668 Ga0307508_10016037 3300031616 Bacteria 6824
669 Ga0307508_10041729 3300031616 Bacteria 4116
670 Ga0307514_10011020 3300031649 Bacteria 7542
671 Ga0307514_10124033 3300031649 Bacteria 1794
672 Ga0265314_10000130 3300031711 Bacteria 113776
673 Ga0265314_10002601 3300031711 Bacteria 18259
674 Ga0316576_10158950 3300031727 Bacteria 1704
675 Ga0316578_10049280 3300031728 Bacteria 2461
676 Ga0307516_10000610 3300031730 Bacteria 48458
677 Ga0307516_10000879 3300031730 Bacteria 41327
678 Ga0307516_10009704 3300031730 Bacteria 10688
679 Ga0307516_10018396 3300031730 Bacteria 7260
680 Ga0307516_10044798 3300031730 Bacteria 4374
681 Ga0307516_10087710 3300031730 Bacteria 2945
682 Ga0307516_10094213 3300031730 Bacteria 2819
683 Ga0307516_10200092 3300031730 Bacteria 1718
684 Ga0307405_10000330 3300031731 Bacteria 17558
685 Ga0316577_10000781 3300031733 Bacteria 13711
686 Ga0307413_10078925 3300031824 Bacteria 2102
687 Ga0307410_10118254 3300031852 Bacteria 1928
688 Ga0307410_10148171 3300031852 Bacteria 1744
689 Ga0307406_10010474 3300031901 Bacteria 5231
690 Ga0307406_10036537 3300031901 Bacteria 3027
691 Ga0307412_10002581 3300031911 Bacteria 10065
692 Ga0307412_10347045 3300031911 Bacteria 1190
693 Ga0307416_100048307 3300032002 Bacteria 3375
694 Ga0307416_100182830 3300032002 Bacteria 1967
695 Ga0307416_100303875 3300032002 Bacteria 1587
696 Ga0307414_10081814 3300032004 Bacteria 2366
697 Ga0307411_10012343 3300032005 Bacteria 4658
698 Ga0307411_10053269 3300032005 Bacteria 2650
699 Ga0307411_10060001 3300032005 Bacteria 2524
700 Ga0307411_10116582 3300032005 Bacteria 1923
701 Ga0307411_10122687 3300032005 Bacteria 1883
702 Ga0316585_10001297 3300032137 Bacteria 6554
703 Ga0307507_10211099 3300033179 Bacteria 1323
704 Ga0307510_10000129 3300033180 Bacteria 60839
705 Ga0307510_10088323 3300033180 Bacteria 2959
706 Ga0373938_0009067 3300034957 Bacteria 1792
707 Ga0373944_0025403 3300035089 Bacteria 1743
708 Ga0373939_0000114 3300035114 Bacteria 24291
709 Ga0373954_0000065 3300035118 Bacteria 37154
710 Ga0316574_0021473 3300035398 Bacteria 3834
711 Ga0373931_0001114 3300035691 Bacteria 11409
712 Ga0373931_0004773 3300035691 Bacteria 6217
713 Ga0373931_0008979 3300035691 Bacteria 4766
714 Ga0373931_0033420 3300035691 Bacteria 2665
715 Ga0373931_0050825 3300035691 Bacteria 2206
716 Ga0373935_0003962 3300035692 Bacteria 8645
717 Ga0373927_0011088 3300035695 Bacteria 6003
718 Ga0373927_0028309 3300035695 Bacteria 3655
719 Ga0373937_0000149 3300036401 Bacteria 67267
720 Ga0373937_0013228 3300036401 Bacteria 7268
721 Ga0373937_0013501 3300036401 Bacteria 7195
722 Ga0373937_0060748 3300036401 Bacteria 3473
723 Ga0373937_0435103 3300036401 Bacteria 1245
724 Ga0316582_0009408 3300036647 Bacteria 5306
725 Ga0316584_0041943 3300036712 Bacteria 3412
726 Ga0316584_0042026 3300036712 Bacteria 3408
727 Ga0373925_0004762 3300037068 Bacteria 10221
728 Ga0373925_0006143 3300037068 Bacteria 8871
729 Ga0373925_0018650 3300037068 Bacteria 5044
730 Ga0373925_0054679 3300037068 Bacteria 2986
731 Ga0395905_0001109 3300037471 Bacteria 33882
732 Ga0395905_0005213 3300037471 Bacteria 13305
733 Ga0395905_0005228 3300037471 Bacteria 13283
734 Ga0395905_0012217 3300037471 Bacteria 8270
735 Ga0395905_0113555 3300037471 Bacteria 2545
736 Ga0395901_0205970 3300038443 Bacteria 2061
737 Ga0400483_026673 3300039062 Bacteria 10412
738 Ga0436361_0273200 3300039447 Bacteria 12118
739 Ga0436361_0391372 3300039447 Bacteria 7663
740 Ga0436361_0504982 3300039447 Bacteria 102576
741 Ga0436361_0941839 3300039447 Bacteria 174965
742 Ga0436361_0958334 3300039447 Bacteria 4009
743 Ga0436361_1013275 3300039447 Bacteria 10012
744 Ga0436361_1167303 3300039447 Bacteria 20106
745 Ga0436361_1187903 3300039447 Bacteria 10313
746 Ga0436363_0328320 3300039450 Bacteria 1340
747 Ga0439436_0016872 3300041404 Bacteria 2188
748 Ga0451800_1314933 3300041459 Bacteria 2910
749 Ga0439443_000181 3300042003 Bacteria 4606
750 Ga0439445_0007246 3300042004 Bacteria 2570
751 Ga0439432_003503 3300042006 Bacteria 5813
752 Ga0439449_0000582 3300042007 Bacteria 13681
753 Ga0439449_0003507 3300042007 Bacteria 6095
754 Ga0450888_001580 3300042126 Bacteria 2191
755 Ga0450898_000630 3300042134 Bacteria 4231
756 Ga0450889_001137 3300042144 Bacteria 2778
757 Ga0439434_0001050 3300042435 Bacteria 8007
758 Ga0439435_0000063 3300042436 Bacteria 12691
759 Ga0439435_0009565 3300042436 Bacteria 2277
760 Ga0439460_0000592 3300042461 Bacteria 7966
761 Ga0439460_0014862 3300042461 Bacteria 2052
762 Ga0450918_000470 3300042531 Bacteria 8582
763 Ga0450918_001277 3300042531 Bacteria 5105
764 Ga0450893_0003122 3300042532 Bacteria 2600
765 Ga0451577_0018358 3300042876 Bacteria 6445
766 Ga0451577_0026109 3300042876 Bacteria 5291
767 Ga0451577_0158978 3300042876 Bacteria 2034
768 Ga0451577_0258952 3300042876 Bacteria 1575
769 Ga0466969_0013133 3300044656 Bacteria 4363
770 Ga0453683_0000171 3300044673 Bacteria 89761
771 Ga0453683_0004241 3300044673 Bacteria 10235
772 Ga0453683_0047194 3300044673 Bacteria 2700
773 Ga0466966_0002762 3300044684 Bacteria 11531
774 Ga0466966_0038911 3300044684 Bacteria 3063
775 Ga0466961_0033795 3300044693 Bacteria 3285
776 Ga0466964_0109901 3300044706 Bacteria 1228
777 Ga0453684_0020279 3300044712 Bacteria 10042
778 Ga0453684_0026597 3300044712 Bacteria 8344
779 Ga0453684_0075128 3300044712 Bacteria 4249
780 Ga0453684_0156564 3300044712 Bacteria 2700
781 Ga0466971_0033203 3300044719 Bacteria 2312
782 Ga0466957_0004692 3300044842 Bacteria 7645
783 Ga0466959_0000147 3300045049 Bacteria 46013
784 Ga0451576_0000435 3300045051 Bacteria 96004
785 Ga0451576_0013663 3300045051 Bacteria 9071
786 Ga0451576_0177309 3300045051 Bacteria 2225
787 Ga0451576_0185792 3300045051 Bacteria 2170
788 Ga0451576_0200269 3300045051 Bacteria 2086
789 Ga0466967_0140966 3300045976 Bacteria 2245
790 Ga0495592_0000421 3300046454 Bacteria 32129
791 Ga0495592_0004067 3300046454 Bacteria 10636
792 Ga0495590_0011692 3300046457 Bacteria 3278
793 Ga0495650_0006869 3300046471 Bacteria 6998
794 Ga0495580_0004160 3300046472 Bacteria 12166
795 Ga0495580_0005957 3300046472 Bacteria 9998
796 Ga0495662_0002439 3300046476 Bacteria 9352
797 Ga0495583_0000018 3300046506 Bacteria 306541
798 Ga0495606_0000870 3300046507 Bacteria 45205
799 Ga0495608_0002951 3300046511 Bacteria 12159
800 Ga0495608_0159986 3300046511 Bacteria 1432
801 Ga0495618_0005161 3300046514 Bacteria 7983
802 Ga0495628_0001501 3300046516 Bacteria 21386
803 Ga0495630_0013699 3300046517 Bacteria 5895
804 Ga0495630_0067400 3300046517 Bacteria 2691
805 Ga0495631_0000253 3300046518 Bacteria 37177
806 Ga0495666_0001113 3300046526 Bacteria 12871
807 Ga0495642_0019344 3300046528 Bacteria 2669
808 Ga0495642_0027259 3300046528 Bacteria 2273
809 Ga0495640_0001888 3300046533 Bacteria 16684
810 Ga0495586_0000899 3300046535 Bacteria 16977
811 Ga0495587_0028894 3300046536 Bacteria 3369
812 Ga0495645_0133091 3300046543 Bacteria 1741
813 Ga0495656_0000093 3300046615 Bacteria 38558
814 Ga0495668_0010217 3300046616 Bacteria 5700
815 Ga0495634_0009473 3300046642 Bacteria 7182
816 Ga0495625_0013462 3300046660 Bacteria 6574
817 Ga0495625_0048746 3300046660 Bacteria 3048
818 Ga0495657_0027599 3300046675 Bacteria 4004
819 Ga0495599_0008055 3300046678 Bacteria 6396
820 Ga0495658_0066636 3300046683 Bacteria 2080
821 Ga0495658_0115437 3300046683 Bacteria 1618
822 Ga0495669_0044076 3300046684 Bacteria 1986
823 Ga0495613_0092977 3300046689 Bacteria 2183
824 Ga0495624_0012670 3300046690 Bacteria 5759
825 Ga0495649_0001395 3300046694 Bacteria 18238
826 Ga0495649_0003876 3300046694 Bacteria 9896
827 Ga0495589_0001942 3300046794 Bacteria 11710
828 Ga0495600_0005182 3300046809 Bacteria 7835
829 Ga0495604_0001777 3300047317 Bacteria 17568
830 Ga0495604_0096671 3300047317 Bacteria 2179
831 Ga0495636_0014121 3300047318 Bacteria 3175
832 Ga0495676_0008226 3300047321 Bacteria 9567
833 Ga0495680_0003539 3300047322 Bacteria 15309
834 Ga0495686_0008016 3300047472 Bacteria 7830
835 Ga0496101_0053427 3300048904 Bacteria 2915
836 Ga0496101_0088063 3300048904 Bacteria 2305
837 Ga0496101_0284153 3300048904 Bacteria 1294
838 Ga0496104_0087476 3300048907 Bacteria 2976
839 Ga0496105_0069379 3300048908 Bacteria 2913
840 Ga0496106_0014315 3300048909 Bacteria 5861
841 Ga0496108_0099831 3300048911 Bacteria 2475
842 Ga0496109_0038844 3300048912 Bacteria 4306
843 Ga0496109_0263446 3300048912 Bacteria 1624
844 Ga0496112_0000331 3300048915 Bacteria 30608
845 Ga0496115_0047347 3300048918 Bacteria 3438
846 Ga0496116_0044569 3300048919 Bacteria 3012
847 Ga0496117_0012516 3300048920 Bacteria 7468
848 Ga0496124_0169162 3300048927 Bacteria 1695
849 Ga0501031_0023508 3300049568 Bacteria 4017
850 Ga0501031_0125388 3300049568 Bacteria 1677
851 Ga0501031_0174242 3300049568 Bacteria 1405
852 Ga0501032_0007889 3300049569 Bacteria 7753
853 Ga0501032_0014778 3300049569 Bacteria 5525
854 Ga0501032_0144102 3300049569 Bacteria 1568
855 Ga0501033_0005063 3300049570 Bacteria 10494
856 Ga0501033_0019086 3300049570 Bacteria 5184
857 Ga0501033_0020417 3300049570 Bacteria 5003
858 Ga0501033_0107758 3300049570 Bacteria 2029
859 Ga0501033_0207659 3300049570 Bacteria 1397
860 Ga0501034_0000056 3300049571 Bacteria 202540
861 Ga0501034_0069615 3300049571 Bacteria 3529
862 Ga0501034_0207246 3300049571 Bacteria 1916
863 Ga0501034_0350933 3300049571 Bacteria 1403
864 Ga0501036_0054326 3300049572 Bacteria 3392
865 Ga0501036_0093216 3300049572 Bacteria 2544
866 Ga0501036_0116897 3300049572 Bacteria 2252
867 Ga0501036_0130092 3300049572 Bacteria 2125
868 Ga0501036_0189737 3300049572 Bacteria 1729
869 Ga0501037_0032922 3300049573 Bacteria 3830
870 Ga0501037_0073157 3300049573 Bacteria 2492
871 Ga0501037_0080116 3300049573 Bacteria 2370
872 Ga0501037_0110091 3300049573 Bacteria 1984
873 Ga0501037_0138111 3300049573 Bacteria 1745
874 Ga0501037_0162159 3300049573 Bacteria 1593
875 Ga0501038_0002910 3300049574 Bacteria 15960
876 Ga0501038_0008449 3300049574 Bacteria 9471
877 Ga0501038_0055820 3300049574 Bacteria 3392
878 Ga0501038_0096755 3300049574 Bacteria 2463
879 Ga0501038_0170626 3300049574 Bacteria 1761
880 Ga0501039_0003889 3300049575 Bacteria 11211
881 Ga0501039_0038682 3300049575 Bacteria 3683
882 Ga0501039_0046331 3300049575 Bacteria 3359
883 Ga0501039_0268752 3300049575 Bacteria 1340
884 Ga0501040_0001180 3300049576 Bacteria 16629
885 Ga0501040_0004683 3300049576 Bacteria 8875
886 Ga0501040_0022079 3300049576 Bacteria 4257
887 Ga0501040_0240116 3300049576 Bacteria 1291
888 Ga0501041_0000037 3300049577 Bacteria 44326
889 Ga0501041_0011861 3300049577 Bacteria 5159
890 Ga0501041_0119966 3300049577 Bacteria 1634
891 Ga0501042_0003967 3300049578 Bacteria 9367
892 Ga0501042_0004460 3300049578 Bacteria 8925
893 Ga0501043_0000071 3300049579 Bacteria 89105
894 Ga0501043_0090945 3300049579 Bacteria 2399
895 Ga0501046_0000034 3300049580 Bacteria 173742
896 Ga0501046_0003675 3300049580 Bacteria 14058
897 Ga0501046_0004629 3300049580 Bacteria 12429
898 Ga0501046_0009080 3300049580 Bacteria 8619
899 Ga0501046_0069261 3300049580 Bacteria 2745
900 Ga0501046_0082278 3300049580 Bacteria 2486
901 Ga0501046_0182490 3300049580 Bacteria 1568
902 Ga0501046_0184314 3300049580 Bacteria 1559
903 Ga0501047_0000042 3300049581 Bacteria 176603
904 Ga0501047_0000087 3300049581 Bacteria 117516
905 Ga0501047_0001227 3300049581 Bacteria 25448
906 Ga0501047_0024956 3300049581 Bacteria 5741
907 Ga0501047_0073348 3300049581 Bacteria 3295
908 Ga0501047_0109307 3300049581 Bacteria 2648
909 Ga0501047_0202667 3300049581 Bacteria 1844
910 Ga0501047_0210179 3300049581 Bacteria 1804
911 Ga0501047_0264629 3300049581 Bacteria 1566
912 Ga0501048_0000019 3300049582 Bacteria 71064
913 Ga0501048_0012896 3300049582 Bacteria 6208
914 Ga0501048_0031097 3300049582 Bacteria 3862
915 Ga0501048_0070841 3300049582 Bacteria 2461
916 Ga0501048_0074530 3300049582 Bacteria 2394
917 Ga0501067_0005627 3300049583 Bacteria 6958
918 Ga0501067_0028447 3300049583 Bacteria 3097
919 Ga0501068_0006477 3300049584 Bacteria 6456
920 Ga0501068_0062549 3300049584 Bacteria 2263
921 Ga0501068_0112392 3300049584 Bacteria 1694
922 Ga0501068_0248448 3300049584 Bacteria 1133
923 Ga0501069_0011227 3300049585 Bacteria 4751
924 Ga0501069_0046669 3300049585 Bacteria 2403
925 Ga0501070_0022567 3300049586 Bacteria 5271
926 Ga0501070_0022604 3300049586 Bacteria 5265
927 Ga0501070_0164994 3300049586 Bacteria 1825
928 Ga0501071_0000765 3300049587 Bacteria 17066
929 Ga0501071_0003144 3300049587 Bacteria 10261
930 Ga0501071_0061475 3300049587 Bacteria 2720
931 Ga0501071_0150287 3300049587 Bacteria 1737
932 Ga0501071_0187260 3300049587 Bacteria 1552
933 Ga0501072_0000314 3300049588 Bacteria 34441
934 Ga0501072_0000757 3300049588 Bacteria 23565
935 Ga0501072_0018429 3300049588 Bacteria 5375
936 Ga0501072_0032308 3300049588 Bacteria 4099
937 Ga0501072_0064143 3300049588 Bacteria 2897
938 Ga0501072_0140006 3300049588 Bacteria 1929
939 Ga0501072_0185094 3300049588 Bacteria 1661
940 Ga0501073_0017602 3300049589 Bacteria 5175
941 Ga0501073_0084575 3300049589 Bacteria 2207
942 Ga0501073_0129165 3300049589 Bacteria 1751
943 Ga0501073_0143711 3300049589 Bacteria 1653
944 Ga0501073_0236669 3300049589 Bacteria 1261
945 Ga0501074_0050270 3300049590 Bacteria 3009
946 Ga0501074_0099929 3300049590 Bacteria 2076
947 Ga0501074_0107740 3300049590 Bacteria 1995
948 Ga0501075_0001817 3300049591 Bacteria 14067
949 Ga0501075_0002514 3300049591 Bacteria 12227
950 Ga0501075_0005925 3300049591 Bacteria 8360
951 Ga0501075_0064610 3300049591 Bacteria 2760
952 Ga0501075_0189266 3300049591 Bacteria 1570
953 Ga0501076_0000285 3300049592 Bacteria 31507
954 Ga0501076_0002261 3300049592 Bacteria 13176
955 Ga0501076_0004951 3300049592 Bacteria 9538
956 Ga0501076_0089029 3300049592 Bacteria 2481
957 Ga0501076_0196643 3300049592 Bacteria 1646
958 Ga0501077_0000210 3300049593 Bacteria 34104
959 Ga0501077_0030845 3300049593 Bacteria 3412
960 Ga0501077_0098789 3300049593 Bacteria 1850
961 Ga0501077_0107972 3300049593 Bacteria 1763
962 Ga0501077_0189880 3300049593 Bacteria 1305
963 Ga0501198_000009 3300049649 Bacteria 122302
964 Ga0501222_000001 3300049662 Bacteria 307689
965 Ga0501223_010748 3300049663 Bacteria 1840
966 Ga0501252_003776 3300049682 Bacteria 1583
967 Ga0501229_000045 3300049706 Bacteria 12123
968 Ga0501079_0000228 3300049741 Bacteria 33621
969 Ga0501079_0005448 3300049741 Bacteria 9483
970 Ga0501079_0005775 3300049741 Bacteria 9249
971 Ga0501079_0013504 3300049741 Bacteria 6227
972 Ga0501079_0039028 3300049741 Bacteria 3662
973 Ga0501079_0042908 3300049741 Bacteria 3491
974 Ga0501080_0001366 3300049742 Bacteria 20410
975 Ga0501080_0016812 3300049742 Bacteria 6755
976 Ga0501080_0020435 3300049742 Bacteria 6129
977 Ga0501080_0055491 3300049742 Bacteria 3690
978 Ga0501080_0086091 3300049742 Bacteria 2919
979 Ga0501080_0135011 3300049742 Bacteria 2283
980 Ga0501080_0147695 3300049742 Bacteria 2173
981 Ga0501080_0394034 3300049742 Bacteria 1246
982 Ga0501081_0000513 3300049743 Bacteria 21769
983 Ga0501081_0000759 3300049743 Bacteria 18898
984 Ga0501083_0010144 3300049744 Bacteria 6637
985 Ga0501083_0026026 3300049744 Bacteria 4046
986 Ga0501083_0034046 3300049744 Bacteria 3484
987 Ga0501083_0091358 3300049744 Bacteria 2010
988 Ga0501035_0026558 3300049822 Bacteria 5296
989 Ga0501035_0089285 3300049822 Bacteria 2715
990 Ga0501035_0089468 3300049822 Bacteria 2711
991 Ga0501035_0224078 3300049822 Bacteria 1604
992 Ga0501044_0018370 3300049823 Bacteria 7492
993 Ga0501044_0109836 3300049823 Bacteria 2766
994 Ga0501045_0000680 3300049824 Bacteria 21550
995 Ga0501045_0001421 3300049824 Bacteria 15960
996 Ga0501045_0003900 3300049824 Bacteria 10269
997 Ga0501045_0015438 3300049824 Bacteria 5418
998 nmdc:mga03683_17689_c1 3300050489 Bacteria 2702
999 nmdc:mga0k408_17882_c1 3300050493 Bacteria 3952
1000 nmdc:mga0k408_19674_c1 3300050493 Bacteria 3776
1001 nmdc:mga0k408_223_c2 3300050493 Bacteria 25073
1002 nmdc:mga0k408_412_c1 3300050493 Bacteria 23440
1003 nmdc:mga0k408_6089_c1 3300050493 Bacteria 6426
1004 nmdc:mga07m45_1175_c1 3300050496 Bacteria 11788
1005 nmdc:mga07m45_183_c1 3300050496 Bacteria 24910
1006 nmdc:mga07m45_38640_c1 3300050496 Bacteria 2664
1007 nmdc:mga07m45_4586_c1 3300050496 Bacteria 6401
1008 nmdc:mga07m45_4942_c1 3300050496 Bacteria 6572
1009 nmdc:mga07m45_5166_c1 3300050496 Bacteria 6470
1010 nmdc:mga07m45_92666_c1 3300050496 Bacteria 1732
1011 nmdc:mga05p37_2494_c1 3300050507 Bacteria 21411
1012 nmdc:mga05p37_387488_c1 3300050507 Bacteria 1635
1013 nmdc:mga09592_132724_c1 3300050508 Bacteria 2144
1014 nmdc:mga09592_16423_c1 3300050508 Bacteria 6055
1015 nmdc:mga09592_26781_c1 3300050508 Bacteria 4780
1016 nmdc:mga09592_540_c1 3300050508 Bacteria 28649
1017 nmdc:mga0qj67_59582_c1 3300050509 Bacteria 3028
1018 nmdc:mga06r32_518483_c1 3300050510 Bacteria 1168
1019 nmdc:mga08y16_437273_c1 3300050511 Bacteria 1336
1020 nmdc:mga08y16_60479_c1 3300050511 Bacteria 3956
1021 nmdc:mga0n895_10157_c1 3300050512 Bacteria 8290
1022 nmdc:mga0n895_1049_c1 3300050512 Bacteria 20112
1023 nmdc:mga0n895_242302_c1 3300050512 Bacteria 1830
1024 nmdc:mga0n895_342592_c1 3300050512 Bacteria 1514
1025 nmdc:mga0n895_49431_c1 3300050512 Bacteria 4120
1026 nmdc:mga0rr50_16126_c1 3300050513 Bacteria 4952
1027 nmdc:mga08x19_16713_c1 3300050514 Bacteria 4479
1028 nmdc:mga08x19_4865_c1 3300050514 Bacteria 7941
1029 nmdc:mga0a205_10465_c1 3300050515 Bacteria 8521
1030 nmdc:mga0a205_42325_c1 3300050515 Bacteria 4388
1031 Ga0495601_0048211 3300053077 Bacteria 2683
1032 Ga0495601_0144958 3300053077 Bacteria 1550
1033 Ga0495612_0132672 3300053078 Bacteria 1077
1034 Ga0500635_0000112 3300053080 Bacteria 49317
1035 Ga0500578_0000057 3300053086 Bacteria 120178
1036 Ga0500651_0001184 3300053093 Bacteria 12929
1037 Ga0500571_000088 3300053110 Bacteria 29136
1038 Ga0500652_003063 3300053131 Bacteria 5042
1039 Ga0500658_0002407 3300053134 Bacteria 7249
1040 Ga0500568_0023742 3300053139 Bacteria 2605
1041 Ga0500636_0000512 3300053177 Bacteria 21104
1042 Ga0500637_0121518 3300053178 Bacteria 1515
1043 Ga0501084_0000162 3300054114 Bacteria 51385
1044 Ga0501084_0020266 3300054114 Bacteria 5544
1045 Ga0501084_0036899 3300054114 Bacteria 4083
1046 Ga0501084_0104417 3300054114 Bacteria 2380
1047 Ga0590071_001911 3300059421 Bacteria 5337
1048 Ga0501082_0001350 3300060353 Bacteria 21559
1049 Ga0501082_0006062 3300060353 Bacteria 10494
1050 Ga0501082_0006637 3300060353 Bacteria 10013
1051 Ga0501082_0016997 3300060353 Bacteria 6264
1052 Ga0501082_0027237 3300060353 Bacteria 4921
1053 Ga0501082_0034080 3300060353 Bacteria 4392
1054 Ga0501082_0035171 3300060353 Bacteria 4318
1055 Ga0501082_0070573 3300060353 Bacteria 3008
1056 Ga0466962_0033972 3300061719 Bacteria 2440
1057 Ga0466962_0051545 3300061719 Bacteria 1968
1058 Ga0530510_0000091 3300061734 Bacteria 48589
1059 Ga0530510_0001285 3300061734 Bacteria 16766
1060 Ga0530510_0008179 3300061734 Bacteria 7296
1061 Ga0530510_0021161 3300061734 Bacteria 4626

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0268752 Ga0501039_0268752_26_937 294
2 3300050512 nmdc:mga0n895_342592_c1 nmdc:mga0n895_342592_c1_584_1504 297
3 3300044706 Ga0466964_0109901 Ga0466964_0109901_231_1217 315
4 3300053078 Ga0495612_0132672 Ga0495612_0132672_17_1045 315
5 3300025916 Ga0207663_10000232 Ga0207663_1000023218 328
6 3300025944 Ga0207661_10032337 Ga0207661_100323372 328
7 3300049578 Ga0501042_0003967 Ga0501042_0003967_17_1033 329
8 3300049584 Ga0501068_0248448 Ga0501068_0248448_97_1113 329
9 3300046476 Ga0495662_0002439 Ga0495662_0002439_3653_4732 344
10 3300046517 Ga0495630_0067400 Ga0495630_0067400_171_1250 344
11 3300028666 Ga0265336_10000156 Ga0265336_1000015610 346
12 3300029957 Ga0265324_10000528 Ga0265324_1000052819 346
13 3300005467 Ga0070706_100089850 Ga0070706_1000898502 347
14 3300005468 Ga0070707_100011124 Ga0070707_1000111246 347
15 3300005518 Ga0070699_100057090 Ga0070699_1000570903 347
16 3300025910 Ga0207684_10086816 Ga0207684_100868162 347
17 3300025922 Ga0207646_10004382 Ga0207646_1000438213 347
18 3300044673 Ga0453683_0047194 Ga0453683_0047194_374_1432 347
19 3300006847 Ga0075431_100031935 Ga0075431_1000319351 348
20 3300050510 nmdc:mga06r32_518483_c1 nmdc:mga06r32_518483_c1_64_1125 348
21 3300003214 JGI25165J46597_1008243 JGI25165J46597_10082432 349
22 3300003911 JGI25405J52794_10005070 JGI25405J52794_100050701 349
23 3300005290 Ga0065712_10000147 Ga0065712_100001471 349
24 3300005293 Ga0065715_10000258 Ga0065715_1000025814 349
25 3300005338 Ga0068868_100140897 Ga0068868_1001408972 349
26 3300005439 Ga0070711_100000783 Ga0070711_1000007834 349
27 3300005445 Ga0070708_100018219 Ga0070708_1000182192 349
28 3300005518 Ga0070699_100009099 Ga0070699_1000090993 349
29 3300005518 Ga0070699_100082511 Ga0070699_1000825113 349
30 3300005536 Ga0070697_100056148 Ga0070697_1000561483 349
31 3300005539 Ga0068853_100057828 Ga0068853_1000578282 349
32 3300005564 Ga0070664_100004792 Ga0070664_1000047922 349
33 3300006163 Ga0070715_10051994 Ga0070715_100519943 349
34 3300006852 Ga0075433_10004322 Ga0075433_100043227 349
35 3300006871 Ga0075434_100000696 Ga0075434_10000069622 349
36 3300006871 Ga0075434_100018694 Ga0075434_1000186944 349
37 3300006871 Ga0075434_100411784 Ga0075434_1004117841 349
38 3300007076 Ga0075435_100006841 Ga0075435_1000068413 349
39 3300009094 Ga0111539_10523992 Ga0111539_105239922 349
40 3300009147 Ga0114129_10225945 Ga0114129_102259452 349
41 3300009176 Ga0105242_10009565 Ga0105242_100095653 349
42 3300009545 Ga0105237_10058446 Ga0105237_100584463 349
43 3300010375 Ga0105239_10387452 Ga0105239_103874521 349
44 3300025231 Ga0207427_102200 Ga0207427_1022005 349
45 3300025261 Ga0209233_1000911 Ga0209233_10009112 349
46 3300025910 Ga0207684_10196895 Ga0207684_101968952 349
47 3300025939 Ga0207665_10118568 Ga0207665_101185682 349
48 3300025939 Ga0207665_10218601 Ga0207665_102186012 349
49 3300027907 Ga0207428_10200700 Ga0207428_102007002 349
50 3300031728 Ga0316578_10049280 Ga0316578_100492802 349
51 3300031733 Ga0316577_10000781 Ga0316577_1000078114 349
52 3300032137 Ga0316585_10001297 Ga0316585_100012975 349
53 3300035691 Ga0373931_0008979 Ga0373931_0008979_3226_4305 349
54 3300036401 Ga0373937_0435103 Ga0373937_0435103_11_1141 349
55 3300036647 Ga0316582_0009408 Ga0316582_0009408_1695_2765 349
56 3300036712 Ga0316584_0042026 Ga0316584_0042026_1123_2193 349
57 3300039062 Ga0400483_026673 Ga0400483_026673_2855_3907 349
58 3300039447 Ga0436361_0273200 Ga0436361_0273200_2063_3121 349
59 3300039447 Ga0436361_0391372 Ga0436361_0391372_578_1636 349
60 3300041404 Ga0439436_0016872 Ga0439436_0016872_39_1112 349
61 3300042876 Ga0451577_0158978 Ga0451577_0158978_854_1921 349
62 3300042876 Ga0451577_0258952 Ga0451577_0258952_45_1124 349
63 3300044712 Ga0453684_0020279 Ga0453684_0020279_6151_7218 349
64 3300044712 Ga0453684_0026597 Ga0453684_0026597_3627_4694 349
65 3300044712 Ga0453684_0075128 Ga0453684_0075128_2036_3103 349
66 3300045051 Ga0451576_0000435 Ga0451576_0000435_88650_89717 349
67 3300045051 Ga0451576_0177309 Ga0451576_0177309_936_2003 349
68 3300046472 Ga0495580_0005957 Ga0495580_0005957_5210_6286 349
69 3300048904 Ga0496101_0284153 Ga0496101_0284153_186_1265 349
70 3300048915 Ga0496112_0000331 Ga0496112_0000331_14931_16010 349
71 3300049568 Ga0501031_0125388 Ga0501031_0125388_58_1137 349
72 3300049568 Ga0501031_0174242 Ga0501031_0174242_28_1098 349
73 3300049569 Ga0501032_0014778 Ga0501032_0014778_230_1300 349
74 3300049569 Ga0501032_0144102 Ga0501032_0144102_232_1305 349
75 3300049570 Ga0501033_0005063 Ga0501033_0005063_335_1408 349
76 3300049570 Ga0501033_0020417 Ga0501033_0020417_356_1426 349
77 3300049570 Ga0501033_0107758 Ga0501033_0107758_296_1369 349
78 3300049570 Ga0501033_0207659 Ga0501033_0207659_73_1152 349
79 3300049571 Ga0501034_0207246 Ga0501034_0207246_285_1358 349
80 3300049571 Ga0501034_0350933 Ga0501034_0350933_241_1311 349
81 3300049572 Ga0501036_0093216 Ga0501036_0093216_180_1253 349
82 3300049572 Ga0501036_0116897 Ga0501036_0116897_338_1411 349
83 3300049573 Ga0501037_0032922 Ga0501037_0032922_2597_3670 349
84 3300049573 Ga0501037_0080116 Ga0501037_0080116_144_1223 349
85 3300049573 Ga0501037_0162159 Ga0501037_0162159_207_1280 349
86 3300049574 Ga0501038_0002910 Ga0501038_0002910_2542_3621 349
87 3300049574 Ga0501038_0055820 Ga0501038_0055820_2090_3163 349
88 3300049575 Ga0501039_0003889 Ga0501039_0003889_3886_4965 349
89 3300049576 Ga0501040_0001180 Ga0501040_0001180_6795_7859 349
90 3300049576 Ga0501040_0004683 Ga0501040_0004683_3052_4131 349
91 3300049577 Ga0501041_0000037 Ga0501041_0000037_9613_10692 349
92 3300049580 Ga0501046_0004629 Ga0501046_0004629_5633_6712 349
93 3300049580 Ga0501046_0182490 Ga0501046_0182490_436_1506 349
94 3300049581 Ga0501047_0210179 Ga0501047_0210179_293_1366 349
95 3300049581 Ga0501047_0264629 Ga0501047_0264629_354_1424 349
96 3300049582 Ga0501048_0031097 Ga0501048_0031097_351_1424 349
97 3300049582 Ga0501048_0074530 Ga0501048_0074530_1083_2153 349
98 3300049584 Ga0501068_0006477 Ga0501068_0006477_185_1255 349
99 3300049584 Ga0501068_0112392 Ga0501068_0112392_344_1417 349
100 3300049585 Ga0501069_0011227 Ga0501069_0011227_3562_4632 349
101 3300049586 Ga0501070_0022567 Ga0501070_0022567_354_1427 349
102 3300049586 Ga0501070_0022604 Ga0501070_0022604_273_1346 349
103 3300049586 Ga0501070_0164994 Ga0501070_0164994_486_1556 349
104 3300049587 Ga0501071_0000765 Ga0501071_0000765_10320_11399 349
105 3300049587 Ga0501071_0003144 Ga0501071_0003144_261_1331 349
106 3300049587 Ga0501071_0187260 Ga0501071_0187260_274_1335 349
107 3300049588 Ga0501072_0000314 Ga0501072_0000314_20982_22061 349
108 3300049589 Ga0501073_0129165 Ga0501073_0129165_246_1316 349
109 3300049589 Ga0501073_0236669 Ga0501073_0236669_75_1154 349
110 3300049590 Ga0501074_0050270 Ga0501074_0050270_183_1256 349
111 3300049590 Ga0501074_0099929 Ga0501074_0099929_405_1475 349
112 3300049591 Ga0501075_0002514 Ga0501075_0002514_10180_11259 349
113 3300049591 Ga0501075_0189266 Ga0501075_0189266_143_1222 349
114 3300049592 Ga0501076_0004951 Ga0501076_0004951_282_1361 349
115 3300049593 Ga0501077_0000210 Ga0501077_0000210_24727_25806 349
116 3300049741 Ga0501079_0000228 Ga0501079_0000228_12343_13422 349
117 3300049741 Ga0501079_0005448 Ga0501079_0005448_8223_9293 349
118 3300049741 Ga0501079_0013504 Ga0501079_0013504_290_1363 349
119 3300049741 Ga0501079_0042908 Ga0501079_0042908_2272_3345 349
120 3300049742 Ga0501080_0086091 Ga0501080_0086091_93_1163 349
121 3300049742 Ga0501080_0394034 Ga0501080_0394034_125_1204 349
122 3300049743 Ga0501081_0000513 Ga0501081_0000513_20528_21607 349
123 3300049744 Ga0501083_0010144 Ga0501083_0010144_5283_6362 349
124 3300049822 Ga0501035_0026558 Ga0501035_0026558_304_1377 349
125 3300049822 Ga0501035_0089468 Ga0501035_0089468_246_1316 349
126 3300049823 Ga0501044_0109836 Ga0501044_0109836_1623_2693 349
127 3300049824 Ga0501045_0000680 Ga0501045_0000680_10018_11097 349
128 3300050507 nmdc:mga05p37_387488_c1 nmdc:mga05p37_387488_c1_525_1604 349
129 3300050512 nmdc:mga0n895_10157_c1 nmdc:mga0n895_10157_c1_3354_4433 349
130 3300050512 nmdc:mga0n895_242302_c1 nmdc:mga0n895_242302_c1_363_1430 349
131 3300050513 nmdc:mga0rr50_16126_c1 nmdc:mga0rr50_16126_c1_3312_4379 349
132 3300050515 nmdc:mga0a205_10465_c1 nmdc:mga0a205_10465_c1_4327_5403 349
133 3300053177 Ga0500636_0000512 Ga0500636_0000512_9613_10680 349
134 3300054114 Ga0501084_0000162 Ga0501084_0000162_38050_39129 349
135 3300054114 Ga0501084_0036899 Ga0501084_0036899_2793_3863 349
136 3300060353 Ga0501082_0001350 Ga0501082_0001350_12381_13460 349
137 3300060353 Ga0501082_0016997 Ga0501082_0016997_4870_5943 349
138 3300060353 Ga0501082_0027237 Ga0501082_0027237_3605_4675 349
139 3300061734 Ga0530510_0021161 Ga0530510_0021161_2579_3658 349
140 3300035398 Ga0316574_0021473 Ga0316574_0021473_264_1331 350
141 3300049593 Ga0501077_0189880 Ga0501077_0189880_113_1216 350
142 3300050511 nmdc:mga08y16_437273_c1 nmdc:mga08y16_437273_c1_217_1326 350
143 3300027682 Ga0209971_1019777 Ga0209971_10197772 351
144 3300027717 Ga0209998_10024070 Ga0209998_100240702 351
145 3300042004 Ga0439445_0007246 Ga0439445_0007246_1307_2392 351
146 3300042007 Ga0439449_0000582 Ga0439449_0000582_10595_11680 351
147 3300031249 Ga0265339_10089759 Ga0265339_100897592 352
148 3300031727 Ga0316576_10158950 Ga0316576_101589502 352
149 3300036712 Ga0316584_0041943 Ga0316584_0041943_2054_3130 352
150 3300045051 Ga0451576_0200269 Ga0451576_0200269_40_1122 352
151 3300005444 Ga0070694_100108565 Ga0070694_1001085651 353
152 3300044673 Ga0453683_0000171 Ga0453683_0000171_13394_14485 353
153 3300046683 Ga0495658_0115437 Ga0495658_0115437_72_1166 353
154 3300050509 nmdc:mga0qj67_59582_c1 nmdc:mga0qj67_59582_c1_745_1854 353
155 iso_pu_bacteria 2929160207 2929168577 353
156 3300037471 Ga0395905_0113555 Ga0395905_0113555_1152_2270 355
157 3300053077 Ga0495601_0144958 Ga0495601_0144958_376_1452 355
158 iso_pu_bacteria 2671180531 2673165926 355
159 3300005293 Ga0065715_10119204 Ga0065715_101192042 356
160 3300005333 Ga0070677_10011030 Ga0070677_100110302 356
161 3300005334 Ga0068869_100048618 Ga0068869_1000486183 356
162 3300005337 Ga0070682_100016479 Ga0070682_1000164793 356
163 3300005339 Ga0070660_100007413 Ga0070660_1000074137 356
164 3300005341 Ga0070691_10012002 Ga0070691_100120022 356
165 3300005367 Ga0070667_100084380 Ga0070667_1000843803 356
166 3300005440 Ga0070705_100162997 Ga0070705_1001629971 356
167 3300005456 Ga0070678_100062095 Ga0070678_1000620952 356
168 3300005458 Ga0070681_10018558 Ga0070681_100185582 356
169 3300005459 Ga0068867_100203839 Ga0068867_1002038391 356
170 3300005539 Ga0068853_100105037 Ga0068853_1001050372 356
171 3300005543 Ga0070672_100193817 Ga0070672_1001938172 356
172 3300005545 Ga0070695_100023046 Ga0070695_1000230462 356
173 3300005547 Ga0070693_100062021 Ga0070693_1000620212 356
174 3300005548 Ga0070665_100210804 Ga0070665_1002108042 356
175 3300005563 Ga0068855_100344535 Ga0068855_1003445352 356
176 3300005842 Ga0068858_100328027 Ga0068858_1003280271 356
177 3300006871 Ga0075434_100039756 Ga0075434_1000397564 356
178 3300009176 Ga0105242_10041885 Ga0105242_100418851 356
179 3300009553 Ga0105249_10120150 Ga0105249_101201502 356
180 3300010375 Ga0105239_10042014 Ga0105239_100420145 356
181 3300013306 Ga0163162_10015143 Ga0163162_100151438 356
182 3300025315 Ga0207697_10009126 Ga0207697_100091263 356
183 3300025893 Ga0207682_10014751 Ga0207682_100147513 356
184 3300025901 Ga0207688_10019501 Ga0207688_100195013 356
185 3300025907 Ga0207645_10024587 Ga0207645_100245872 356
186 3300025912 Ga0207707_10014795 Ga0207707_100147959 356
187 3300025919 Ga0207657_10011865 Ga0207657_100118658 356
188 3300025923 Ga0207681_10031598 Ga0207681_100315985 356
189 3300025925 Ga0207650_10000951 Ga0207650_100009519 356
190 3300025933 Ga0207706_10008488 Ga0207706_100084885 356
191 3300025940 Ga0207691_10075662 Ga0207691_100756622 356
192 3300025942 Ga0207689_10030568 Ga0207689_100305682 356
193 3300025945 Ga0207679_10002133 Ga0207679_100021336 356
194 3300025949 Ga0207667_10153265 Ga0207667_101532652 356
195 3300026041 Ga0207639_10019359 Ga0207639_100193594 356
196 3300026121 Ga0207683_10003665 Ga0207683_100036652 356
197 3300031730 Ga0307516_10009704 Ga0307516_100097047 356
198 3300048912 Ga0496109_0263446 Ga0496109_0263446_138_1253 356
199 3300049580 Ga0501046_0184314 Ga0501046_0184314_350_1474 356
200 3300049588 Ga0501072_0140006 Ga0501072_0140006_497_1621 356
201 3300049591 Ga0501075_0064610 Ga0501075_0064610_809_1933 356
202 3300049592 Ga0501076_0089029 Ga0501076_0089029_80_1204 356
203 3300049593 Ga0501077_0030845 Ga0501077_0030845_1499_2623 356
204 3300049741 Ga0501079_0039028 Ga0501079_0039028_1042_2166 356
205 3300049744 Ga0501083_0091358 Ga0501083_0091358_438_1562 356
206 3300050515 nmdc:mga0a205_42325_c1 nmdc:mga0a205_42325_c1_1245_2360 356
207 3300061734 Ga0530510_0008179 Ga0530510_0008179_1426_2550 356
208 3300005340 Ga0070689_100307745 Ga0070689_1003077451 357
209 3300005343 Ga0070687_100044584 Ga0070687_1000445843 357
210 3300005347 Ga0070668_100019536 Ga0070668_1000195364 357
211 3300005353 Ga0070669_100009475 Ga0070669_1000094756 357
212 3300005364 Ga0070673_100258487 Ga0070673_1002584871 357
213 3300005459 Ga0068867_100011508 Ga0068867_1000115086 357
214 3300005544 Ga0070686_100021988 Ga0070686_1000219883 357
215 3300005615 Ga0070702_100052322 Ga0070702_1000523223 357
216 3300005719 Ga0068861_100011512 Ga0068861_1000115122 357
217 3300005840 Ga0068870_10010553 Ga0068870_100105532 357
218 3300005844 Ga0068862_100007612 Ga0068862_10000761210 357
219 3300006237 Ga0097621_100001554 Ga0097621_10000155416 357
220 3300006358 Ga0068871_100006024 Ga0068871_1000060243 357
221 3300006844 Ga0075428_100189717 Ga0075428_1001897172 357
222 3300006880 Ga0075429_100028408 Ga0075429_1000284084 357
223 3300009094 Ga0111539_10410510 Ga0111539_104105102 357
224 3300009147 Ga0114129_10029909 Ga0114129_100299097 357
225 3300009147 Ga0114129_10098052 Ga0114129_100980523 357
226 3300009148 Ga0105243_10022803 Ga0105243_100228034 357
227 3300009553 Ga0105249_10007455 Ga0105249_100074556 357
228 3300013306 Ga0163162_10235678 Ga0163162_102356782 357
229 3300025918 Ga0207662_10055077 Ga0207662_100550773 357
230 3300025923 Ga0207681_10005493 Ga0207681_100054934 357
231 3300025935 Ga0207709_10017384 Ga0207709_100173843 357
232 3300025938 Ga0207704_10027677 Ga0207704_100276772 357
233 3300025942 Ga0207689_10039915 Ga0207689_100399153 357
234 3300025961 Ga0207712_10014116 Ga0207712_100141164 357
235 3300025972 Ga0207668_10011209 Ga0207668_100112092 357
236 3300026075 Ga0207708_10005765 Ga0207708_100057656 357
237 3300026089 Ga0207648_10008268 Ga0207648_100082684 357
238 3300026118 Ga0207675_100403279 Ga0207675_1004032791 357
239 3300027364 Ga0209967_1000664 Ga0209967_10006644 357
240 3300027378 Ga0209981_1000848 Ga0209981_10008482 357
241 3300027462 Ga0210000_1006962 Ga0210000_10069621 357
242 3300027471 Ga0209995_1005716 Ga0209995_10057161 357
243 3300027543 Ga0209999_1002399 Ga0209999_10023993 357
244 3300027543 Ga0209999_1004662 Ga0209999_10046622 357
245 3300027682 Ga0209971_1005275 Ga0209971_10052754 357
246 3300027907 Ga0207428_10055920 Ga0207428_100559203 357
247 3300027907 Ga0207428_10223004 Ga0207428_102230042 357
248 3300028380 Ga0268265_10004392 Ga0268265_100043923 357
249 3300034957 Ga0373938_0009067 Ga0373938_0009067_704_1780 357
250 3300042003 Ga0439443_000181 Ga0439443_000181_3082_4167 357
251 3300042435 Ga0439434_0001050 Ga0439434_0001050_738_1823 357
252 3300042436 Ga0439435_0000063 Ga0439435_0000063_6785_7870 357
253 3300042436 Ga0439435_0009565 Ga0439435_0009565_608_1696 357
254 3300042461 Ga0439460_0000592 Ga0439460_0000592_6072_7157 357
255 3300042461 Ga0439460_0014862 Ga0439460_0014862_825_1913 357
256 3300049576 Ga0501040_0022079 Ga0501040_0022079_731_1816 357
257 3300049576 Ga0501040_0240116 Ga0501040_0240116_52_1137 357
258 3300049577 Ga0501041_0011861 Ga0501041_0011861_2793_3878 357
259 3300049580 Ga0501046_0069261 Ga0501046_0069261_1082_2167 357
260 3300049582 Ga0501048_0012896 Ga0501048_0012896_4954_6039 357
261 3300049587 Ga0501071_0061475 Ga0501071_0061475_552_1637 357
262 3300049587 Ga0501071_0150287 Ga0501071_0150287_94_1170 357
263 3300049588 Ga0501072_0000757 Ga0501072_0000757_10629_11714 357
264 3300049592 Ga0501076_0000285 Ga0501076_0000285_16538_17623 357
265 3300049592 Ga0501076_0196643 Ga0501076_0196643_512_1618 357
266 3300049741 Ga0501079_0005775 Ga0501079_0005775_7818_8903 357
267 3300049742 Ga0501080_0055491 Ga0501080_0055491_994_2079 357
268 3300049743 Ga0501081_0000759 Ga0501081_0000759_7416_8501 357
269 3300049822 Ga0501035_0089285 Ga0501035_0089285_1358_2443 357
270 3300049824 Ga0501045_0003900 Ga0501045_0003900_5708_6793 357
271 3300050508 nmdc:mga09592_132724_c1 nmdc:mga09592_132724_c1_584_1663 357
272 3300050508 nmdc:mga09592_26781_c1 nmdc:mga09592_26781_c1_1429_2517 357
273 3300050511 nmdc:mga08y16_60479_c1 nmdc:mga08y16_60479_c1_747_1829 357
274 3300054114 Ga0501084_0020266 Ga0501084_0020266_1562_2647 357
275 3300054114 Ga0501084_0104417 Ga0501084_0104417_1217_2323 357
276 3300060353 Ga0501082_0070573 Ga0501082_0070573_1112_2197 357
277 3300061719 Ga0466962_0051545 Ga0466962_0051545_572_1720 357
278 3300061734 Ga0530510_0000091 Ga0530510_0000091_21922_23007 357
279 3300046675 Ga0495657_0027599 Ga0495657_0027599_2089_3180 358
280 3300047317 Ga0495604_0096671 Ga0495604_0096671_790_1881 358
281 3300005327 Ga0070658_10210702 Ga0070658_102107021 359
282 3300025914 Ga0207671_10002929 Ga0207671_1000292915 359
283 3300032002 Ga0307416_100182830 Ga0307416_1001828302 359
284 3300005444 Ga0070694_100003005 Ga0070694_10000300512 360
285 3300005617 Ga0068859_100003043 Ga0068859_1000030432 360
286 3300006931 Ga0097620_100003043 Ga0097620_1000030432 360
287 3300009176 Ga0105242_10003452 Ga0105242_100034521 360
288 3300025942 Ga0207689_10097291 Ga0207689_100972913 360
289 3300025986 Ga0207658_10096094 Ga0207658_100960942 360
290 3300042876 Ga0451577_0018358 Ga0451577_0018358_1193_2320 360
291 3300049568 Ga0501031_0023508 Ga0501031_0023508_1574_2719 360
292 3300049569 Ga0501032_0007889 Ga0501032_0007889_6586_7731 360
293 3300049570 Ga0501033_0019086 Ga0501033_0019086_1660_2805 360
294 3300049571 Ga0501034_0069615 Ga0501034_0069615_2339_3484 360
295 3300049572 Ga0501036_0054326 Ga0501036_0054326_100_1245 360
296 3300049572 Ga0501036_0130092 Ga0501036_0130092_447_1592 360
297 3300049572 Ga0501036_0189737 Ga0501036_0189737_546_1691 360
298 3300049573 Ga0501037_0073157 Ga0501037_0073157_299_1444 360
299 3300049573 Ga0501037_0110091 Ga0501037_0110091_209_1354 360
300 3300049573 Ga0501037_0138111 Ga0501037_0138111_284_1429 360
301 3300049574 Ga0501038_0008449 Ga0501038_0008449_5532_6677 360
302 3300049574 Ga0501038_0170626 Ga0501038_0170626_177_1322 360
303 3300049575 Ga0501039_0038682 Ga0501039_0038682_46_1191 360
304 3300049579 Ga0501043_0090945 Ga0501043_0090945_1209_2354 360
305 3300049580 Ga0501046_0009080 Ga0501046_0009080_5526_6671 360
306 3300049580 Ga0501046_0082278 Ga0501046_0082278_1208_2353 360
307 3300049581 Ga0501047_0001227 Ga0501047_0001227_1663_2808 360
308 3300049581 Ga0501047_0024956 Ga0501047_0024956_4242_5387 360
309 3300049581 Ga0501047_0202667 Ga0501047_0202667_667_1812 360
310 3300049582 Ga0501048_0070841 Ga0501048_0070841_1284_2429 360
311 3300049583 Ga0501067_0005627 Ga0501067_0005627_4404_5549 360
312 3300049584 Ga0501068_0062549 Ga0501068_0062549_990_2135 360
313 3300049585 Ga0501069_0046669 Ga0501069_0046669_947_2092 360
314 3300049588 Ga0501072_0064143 Ga0501072_0064143_1724_2869 360
315 3300049588 Ga0501072_0185094 Ga0501072_0185094_380_1525 360
316 3300049589 Ga0501073_0017602 Ga0501073_0017602_3454_4599 360
317 3300049589 Ga0501073_0084575 Ga0501073_0084575_46_1191 360
318 3300049589 Ga0501073_0143711 Ga0501073_0143711_493_1638 360
319 3300049593 Ga0501077_0098789 Ga0501077_0098789_695_1837 360
320 3300049593 Ga0501077_0107972 Ga0501077_0107972_67_1212 360
321 3300049742 Ga0501080_0016812 Ga0501080_0016812_5565_6710 360
322 3300049742 Ga0501080_0135011 Ga0501080_0135011_1093_2238 360
323 3300049742 Ga0501080_0147695 Ga0501080_0147695_51_1196 360
324 3300049744 Ga0501083_0026026 Ga0501083_0026026_747_1892 360
325 3300049744 Ga0501083_0034046 Ga0501083_0034046_2307_3452 360
326 3300049822 Ga0501035_0224078 Ga0501035_0224078_361_1506 360
327 3300049823 Ga0501044_0018370 Ga0501044_0018370_2106_3251 360
328 3300060353 Ga0501082_0006062 Ga0501082_0006062_8674_9819 360
329 3300060353 Ga0501082_0034080 Ga0501082_0034080_2814_3959 360
330 3300060353 Ga0501082_0035171 Ga0501082_0035171_434_1579 360
331 3300005295 Ga0065707_10217691 Ga0065707_102176911 361
332 3300005339 Ga0070660_100020125 Ga0070660_1000201252 361
333 3300005440 Ga0070705_100002282 Ga0070705_1000022826 361
334 3300005458 Ga0070681_10110596 Ga0070681_101105961 361
335 3300005458 Ga0070681_10442238 Ga0070681_104422381 361
336 3300005530 Ga0070679_100004838 Ga0070679_1000048384 361
337 3300005536 Ga0070697_100001057 Ga0070697_10000105720 361
338 3300005545 Ga0070695_100021796 Ga0070695_1000217963 361
339 3300005546 Ga0070696_100004324 Ga0070696_1000043245 361
340 3300005563 Ga0068855_100006754 Ga0068855_1000067544 361
341 3300006871 Ga0075434_100002860 Ga0075434_1000028603 361
342 3300006914 Ga0075436_100007333 Ga0075436_1000073332 361
343 3300009093 Ga0105240_10005995 Ga0105240_100059958 361
344 3300025909 Ga0207705_10213004 Ga0207705_102130042 361
345 3300025912 Ga0207707_10009980 Ga0207707_100099801 361
346 3300025919 Ga0207657_10006920 Ga0207657_100069205 361
347 3300025921 Ga0207652_10048231 Ga0207652_100482313 361
348 3300025949 Ga0207667_10028778 Ga0207667_100287783 361
349 3300035118 Ga0373954_0000065 Ga0373954_0000065_34535_35644 361
350 3300036401 Ga0373937_0000149 Ga0373937_0000149_54974_56083 361
351 3300036401 Ga0373937_0013228 Ga0373937_0013228_995_2101 361
352 3300037068 Ga0373925_0006143 Ga0373925_0006143_2874_3971 361
353 3300046454 Ga0495592_0004067 Ga0495592_0004067_2731_3837 361
354 3300046511 Ga0495608_0002951 Ga0495608_0002951_4309_5415 361
355 3300046514 Ga0495618_0005161 Ga0495618_0005161_4947_6053 361
356 3300046516 Ga0495628_0001501 Ga0495628_0001501_14914_16020 361
357 3300046517 Ga0495630_0013699 Ga0495630_0013699_52_1158 361
358 3300046533 Ga0495640_0001888 Ga0495640_0001888_10461_11567 361
359 3300046535 Ga0495586_0000899 Ga0495586_0000899_9703_10809 361
360 3300046536 Ga0495587_0028894 Ga0495587_0028894_1382_2488 361
361 3300046543 Ga0495645_0133091 Ga0495645_0133091_339_1445 361
362 3300046642 Ga0495634_0009473 Ga0495634_0009473_5151_6257 361
363 3300046678 Ga0495599_0008055 Ga0495599_0008055_149_1255 361
364 3300046683 Ga0495658_0066636 Ga0495658_0066636_567_1673 361
365 3300046689 Ga0495613_0092977 Ga0495613_0092977_1037_2143 361
366 3300046809 Ga0495600_0005182 Ga0495600_0005182_557_1663 361
367 3300047317 Ga0495604_0001777 Ga0495604_0001777_2923_4029 361
368 3300047318 Ga0495636_0014121 Ga0495636_0014121_832_1938 361
369 3300047322 Ga0495680_0003539 Ga0495680_0003539_6316_7422 361
370 3300049583 Ga0501067_0028447 Ga0501067_0028447_1710_2807 361
371 3300050512 nmdc:mga0n895_49431_c1 nmdc:mga0n895_49431_c1_2117_3220 361
372 3300050514 nmdc:mga08x19_4865_c1 nmdc:mga08x19_4865_c1_435_1547 361
373 3300053077 Ga0495601_0048211 Ga0495601_0048211_610_1716 361
374 3300003203 JGI25406J46586_10019026 JGI25406J46586_100190263 362
375 3300005536 Ga0070697_100003400 Ga0070697_1000034005 362
376 3300005545 Ga0070695_100004094 Ga0070695_1000040948 362
377 3300005841 Ga0068863_100223710 Ga0068863_1002237101 362
378 3300005985 Ga0081539_10001364 Ga0081539_1000136424 362
379 3300006880 Ga0075429_100000871 Ga0075429_10000087114 362
380 3300006914 Ga0075436_100276564 Ga0075436_1002765641 362
381 3300009147 Ga0114129_10015710 Ga0114129_100157103 362
382 3300025303 Ga0209051_1027578 Ga0209051_10275782 362
383 3300025908 Ga0207643_10082181 Ga0207643_100821811 362
384 3300025929 Ga0207664_10090705 Ga0207664_100907053 362
385 3300026088 Ga0207641_10427420 Ga0207641_104274201 362
386 3300031730 Ga0307516_10000610 Ga0307516_1000061038 362
387 3300035692 Ga0373935_0003962 Ga0373935_0003962_6589_7698 362
388 3300035695 Ga0373927_0011088 Ga0373927_0011088_1275_2384 362
389 3300036401 Ga0373937_0013501 Ga0373937_0013501_2438_3583 362
390 3300037068 Ga0373925_0054679 Ga0373925_0054679_350_1459 362
391 3300045051 Ga0451576_0185792 Ga0451576_0185792_168_1274 362
392 3300046528 Ga0495642_0019344 Ga0495642_0019344_1399_2505 362
393 3300046684 Ga0495669_0044076 Ga0495669_0044076_255_1361 362
394 3300049574 Ga0501038_0096755 Ga0501038_0096755_205_1350 362
395 3300049575 Ga0501039_0046331 Ga0501039_0046331_353_1498 362
396 3300049577 Ga0501041_0119966 Ga0501041_0119966_280_1425 362
397 3300049578 Ga0501042_0004460 Ga0501042_0004460_1393_2538 362
398 3300049588 Ga0501072_0018429 Ga0501072_0018429_1083_2234 362
399 3300049588 Ga0501072_0032308 Ga0501072_0032308_990_2135 362
400 3300049590 Ga0501074_0107740 Ga0501074_0107740_633_1778 362
401 3300049591 Ga0501075_0001817 Ga0501075_0001817_4134_5279 362
402 3300049591 Ga0501075_0005925 Ga0501075_0005925_1306_2457 362
403 3300049592 Ga0501076_0002261 Ga0501076_0002261_5268_6413 362
404 3300049742 Ga0501080_0001366 Ga0501080_0001366_4092_5243 362
405 3300049742 Ga0501080_0020435 Ga0501080_0020435_4873_6018 362
406 3300049824 Ga0501045_0001421 Ga0501045_0001421_7423_8568 362
407 3300050507 nmdc:mga05p37_2494_c1 nmdc:mga05p37_2494_c1_8453_9574 362
408 3300050508 nmdc:mga09592_540_c1 nmdc:mga09592_540_c1_21211_22332 362
409 3300050512 nmdc:mga0n895_1049_c1 nmdc:mga0n895_1049_c1_16351_17451 362
410 3300050514 nmdc:mga08x19_16713_c1 nmdc:mga08x19_16713_c1_742_1860 362
411 3300060353 Ga0501082_0006637 Ga0501082_0006637_141_1286 362
412 3300061734 Ga0530510_0001285 Ga0530510_0001285_13138_14283 362
413 iso_pu_bacteria 2831265667 2831269637 362
414 3300028794 Ga0307515_10062847 Ga0307515_100628473 363
415 3300006931 Ga0097620_100252801 Ga0097620_1002528012 364
416 3300014325 Ga0163163_10016806 Ga0163163_100168063 364
417 3300025913 Ga0207695_10144042 Ga0207695_101440422 364
418 3300025949 Ga0207667_10304230 Ga0207667_103042302 364
419 3300026035 Ga0207703_10049514 Ga0207703_100495142 364
420 3300028794 Ga0307515_10000291 Ga0307515_100002914 365
421 3300005356 Ga0070674_100033911 Ga0070674_1000339114 366
422 3300006353 Ga0075370_10040010 Ga0075370_100400102 366
423 3300009093 Ga0105240_10016496 Ga0105240_100164966 366
424 3300009545 Ga0105237_10000080 Ga0105237_10000080105 366
425 3300009551 Ga0105238_10022002 Ga0105238_100220022 366
426 3300010375 Ga0105239_10000116 Ga0105239_100001162 366
427 3300025913 Ga0207695_10006409 Ga0207695_100064097 366
428 3300028794 Ga0307515_10000013 Ga0307515_10000013308 366
429 3300046511 Ga0495608_0159986 Ga0495608_0159986_204_1367 366
430 3300025942 Ga0207689_10065318 Ga0207689_100653181 367
431 3300031251 Ga0265327_10000804 Ga0265327_1000080440 367
432 3300035691 Ga0373931_0004773 Ga0373931_0004773_1564_2691 367
433 3300037471 Ga0395905_0001109 Ga0395905_0001109_25548_26666 367
434 3300048912 Ga0496109_0038844 Ga0496109_0038844_485_1603 367
435 iso_pu_bacteria 2585428057 2587726056 367
436 iso_pu_bacteria 2585428058 2587735786 367
437 iso_pu_bacteria 2585428062 2587756501 367
438 iso_pu_bacteria 2588253510 2588290383 367
439 iso_pu_bacteria 2643221592 2643967692 367
440 iso_pu_bacteria 2643221625 2644140514 367
441 iso_pu_bacteria 2643221644 2644245130 367
442 iso_pu_bacteria 2643221648 2644273481 367
443 iso_pu_bacteria 2886848708 2886852231 367
444 iso_pu_bacteria 2928115317 2928117231 367
445 3300002738 JGI25154J39366_1002640 JGI25154J39366_10026404 368
446 3300002741 JGI25157J39369_1000038 JGI25157J39369_10000387 368
447 3300003752 Ga0055539_1000775 Ga0055539_10007752 368
448 3300003752 Ga0055539_1002200 Ga0055539_10022002 368
449 3300003756 Ga0055533_1000026 Ga0055533_1000026209 368
450 3300003761 Ga0055535_1000056 Ga0055535_1000056115 368
451 3300003763 Ga0055529_1000103 Ga0055529_100010398 368
452 3300005327 Ga0070658_10014105 Ga0070658_100141052 368
453 3300005339 Ga0070660_100151384 Ga0070660_1001513841 368
454 3300005364 Ga0070673_100032276 Ga0070673_1000322762 368
455 3300005563 Ga0068855_100017132 Ga0068855_1000171321 368
456 3300005563 Ga0068855_100200638 Ga0068855_1002006382 368
457 3300005578 Ga0068854_100029405 Ga0068854_1000294052 368
458 3300005614 Ga0068856_100002420 Ga0068856_10000242011 368
459 3300006195 Ga0075366_10113846 Ga0075366_101138461 368
460 3300006353 Ga0075370_10002202 Ga0075370_100022024 368
461 3300009148 Ga0105243_10073728 Ga0105243_100737282 368
462 3300011119 Ga0105246_10089094 Ga0105246_100890941 368
463 3300025226 Ga0209674_100024 Ga0209674_10002492 368
464 3300025230 Ga0209563_100069 Ga0209563_10006992 368
465 3300025242 Ga0209258_100071 Ga0209258_1000718 368
466 3300025242 Ga0209258_100783 Ga0209258_1007836 368
467 3300025246 Ga0209646_1000012 Ga0209646_1000012412 368
468 3300025250 Ga0209026_1000004 Ga0209026_1000004208 368
469 3300025253 Ga0209677_100092 Ga0209677_10009210 368
470 3300025253 Ga0209677_101513 Ga0209677_1015137 368
471 3300025254 Ga0209148_1010852 Ga0209148_10108522 368
472 3300025256 Ga0209759_1000003 Ga0209759_1000003520 368
473 3300025256 Ga0209759_1001236 Ga0209759_10012365 368
474 3300025256 Ga0209759_1009207 Ga0209759_10092071 368
475 3300025272 Ga0209455_1000030 Ga0209455_1000030263 368
476 3300025913 Ga0207695_10005726 Ga0207695_100057263 368
477 3300025913 Ga0207695_10323552 Ga0207695_103235521 368
478 3300025919 Ga0207657_10088986 Ga0207657_100889862 368
479 3300025949 Ga0207667_10055940 Ga0207667_100559401 368
480 3300025960 Ga0207651_10080595 Ga0207651_100805952 368
481 3300025981 Ga0207640_10033626 Ga0207640_100336261 368
482 3300026078 Ga0207702_10000253 Ga0207702_1000025326 368
483 3300026116 Ga0207674_10019326 Ga0207674_100193267 368
484 3300031730 Ga0307516_10018396 Ga0307516_100183965 368
485 3300039447 Ga0436361_0958334 Ga0436361_0958334_875_2008 368
486 3300046506 Ga0495583_0000018 Ga0495583_0000018_35721_36851 368
487 3300046507 Ga0495606_0000870 Ga0495606_0000870_35205_36335 368
488 3300046616 Ga0495668_0010217 Ga0495668_0010217_2066_3196 368
489 3300046660 Ga0495625_0048746 Ga0495625_0048746_1196_2326 368
490 3300046694 Ga0495649_0001395 Ga0495649_0001395_9223_10353 368
491 3300046794 Ga0495589_0001942 Ga0495589_0001942_10270_11400 368
492 3300047472 Ga0495686_0008016 Ga0495686_0008016_5965_7095 368
493 3300048907 Ga0496104_0087476 Ga0496104_0087476_35_1192 368
494 3300050496 nmdc:mga07m45_4586_c1 nmdc:mga07m45_4586_c1_479_1612 368
495 3300053080 Ga0500635_0000112 Ga0500635_0000112_47596_48726 368
496 iso_pu_bacteria 2513020051 2513228283 368
497 iso_pu_bacteria 2643221585 2643936542 368
498 iso_pu_bacteria 2643221596 2643990192 368
499 iso_pu_bacteria 2643221609 2644059266 368
500 iso_pu_bacteria 2643221611 2644075696 368
501 iso_pu_bacteria 2643221628 2644161359 368
502 iso_pu_bacteria 2643221652 2644295683 368
503 iso_pu_bacteria 2643221654 2644305278 368
504 iso_pu_bacteria 2643221656 2644317898 368
505 iso_pu_bacteria 2643221658 2644324076 368
506 iso_pu_bacteria 2643221672 2644400738 368
507 iso_pu_bacteria 2643221683 2644465977 368
508 iso_pu_bacteria 2738541277 2738720702 368
509 iso_pu_bacteria 2738541307 2738882302 368
510 iso_pu_bacteria 2738541337 2739058350 368
511 iso_pu_bacteria 2738543019 2739279901 368
512 iso_pu_bacteria 2831864461 2831867932 368
513 iso_pu_bacteria 2842677519 2842680891 368
514 iso_pu_bacteria 2842747753 2842749700 368
515 iso_pu_bacteria 2885198086 2885201824 368
516 iso_pu_bacteria 2885211737 2885215466 368
517 iso_pu_bacteria 2904449895 2904453977 368
518 iso_pu_bacteria 2904456579 2904459485 368
519 iso_pu_bacteria 2904541872 2904549904 368
520 iso_pu_bacteria 2919462493 2919465444 368
521 iso_pu_bacteria 2928084124 2928089718 368
522 iso_pu_bacteria 2929160207 2929161335 368
523 iso_pu_bacteria 2929520902 2929521599 368
524 iso_pu_bacteria 2932422444 2932425459 368
525 iso_pu_bacteria 2945909444 2945914198 368
526 iso_pu_bacteria 2945945610 2945949767 368
527 iso_pu_bacteria 2945972063 2945973788 368
528 iso_pu_bacteria 2945984333 2945990418 368
529 iso_pu_bacteria 2954767861 2954770622 368
530 iso_pu_bacteria 2990710928 2990711089 368
531 3300005295 Ga0065707_10082206 Ga0065707_1008220613 369
532 3300005330 Ga0070690_100118899 Ga0070690_1001188992 369
533 3300005331 Ga0070670_100107217 Ga0070670_1001072172 369
534 3300005334 Ga0068869_100033962 Ga0068869_1000339622 369
535 3300005338 Ga0068868_100003190 Ga0068868_1000031906 369
536 3300005354 Ga0070675_100000556 Ga0070675_10000055619 369
537 3300005364 Ga0070673_100001332 Ga0070673_1000013326 369
538 3300005367 Ga0070667_100009343 Ga0070667_1000093437 369
539 3300005455 Ga0070663_100087356 Ga0070663_1000873562 369
540 3300005459 Ga0068867_100005767 Ga0068867_1000057679 369
541 3300005543 Ga0070672_100052702 Ga0070672_1000527023 369
542 3300005563 Ga0068855_100001374 Ga0068855_10000137414 369
543 3300005614 Ga0068856_100278118 Ga0068856_1002781182 369
544 3300005617 Ga0068859_100009651 Ga0068859_1000096516 369
545 3300005617 Ga0068859_100053138 Ga0068859_1000531384 369
546 3300005618 Ga0068864_100003888 Ga0068864_1000038886 369
547 3300005618 Ga0068864_100027072 Ga0068864_1000270724 369
548 3300005718 Ga0068866_10003133 Ga0068866_100031333 369
549 3300005841 Ga0068863_100004228 Ga0068863_1000042284 369
550 3300005841 Ga0068863_100357676 Ga0068863_1003576761 369
551 3300005842 Ga0068858_100000225 Ga0068858_10000022552 369
552 3300005842 Ga0068858_100025199 Ga0068858_1000251994 369
553 3300005842 Ga0068858_100027701 Ga0068858_1000277012 369
554 3300005843 Ga0068860_100035553 Ga0068860_1000355535 369
555 3300005843 Ga0068860_100047687 Ga0068860_1000476872 369
556 3300005843 Ga0068860_100124880 Ga0068860_1001248803 369
557 3300005844 Ga0068862_100002168 Ga0068862_1000021682 369
558 3300005844 Ga0068862_100193874 Ga0068862_1001938742 369
559 3300006237 Ga0097621_100026728 Ga0097621_1000267284 369
560 3300006358 Ga0068871_100043531 Ga0068871_1000435311 369
561 3300006881 Ga0068865_100001798 Ga0068865_1000017987 369
562 3300006931 Ga0097620_100009651 Ga0097620_1000096516 369
563 3300006931 Ga0097620_100053135 Ga0097620_1000531353 369
564 3300009093 Ga0105240_10064424 Ga0105240_100644244 369
565 3300009551 Ga0105238_10006890 Ga0105238_100068905 369
566 3300013297 Ga0157378_10043514 Ga0157378_100435142 369
567 3300013306 Ga0163162_10060815 Ga0163162_100608153 369
568 3300013308 Ga0157375_10020633 Ga0157375_100206333 369
569 3300014968 Ga0157379_10026514 Ga0157379_100265143 369
570 3300017792 Ga0163161_10011407 Ga0163161_100114073 369
571 3300017792 Ga0163161_10060862 Ga0163161_100608622 369
572 3300025321 Ga0207656_10025409 Ga0207656_100254092 369
573 3300025899 Ga0207642_10073256 Ga0207642_100732561 369
574 3300025903 Ga0207680_10006999 Ga0207680_100069995 369
575 3300025926 Ga0207659_10001095 Ga0207659_1000109510 369
576 3300025936 Ga0207670_10087409 Ga0207670_100874092 369
577 3300025938 Ga0207704_10017787 Ga0207704_100177872 369
578 3300025940 Ga0207691_10048304 Ga0207691_100483043 369
579 3300025940 Ga0207691_10172186 Ga0207691_101721861 369
580 3300025960 Ga0207651_10002842 Ga0207651_100028424 369
581 3300025986 Ga0207658_10004188 Ga0207658_100041886 369
582 3300026023 Ga0207677_10002797 Ga0207677_100027977 369
583 3300026035 Ga0207703_10003821 Ga0207703_100038216 369
584 3300026035 Ga0207703_10195540 Ga0207703_101955402 369
585 3300026067 Ga0207678_10093239 Ga0207678_100932391 369
586 3300026088 Ga0207641_10002703 Ga0207641_100027036 369
587 3300026088 Ga0207641_10110586 Ga0207641_101105863 369
588 3300026089 Ga0207648_10000425 Ga0207648_100004257 369
589 3300026095 Ga0207676_10008075 Ga0207676_100080756 369
590 3300026118 Ga0207675_100014494 Ga0207675_1000144942 369
591 3300026121 Ga0207683_10006649 Ga0207683_100066494 369
592 3300028380 Ga0268265_10002921 Ga0268265_1000292113 369
593 3300028381 Ga0268264_10014496 Ga0268264_100144967 369
594 3300028381 Ga0268264_10442788 Ga0268264_104427881 369
595 3300031548 Ga0307408_100150299 Ga0307408_1001502991 369
596 3300031852 Ga0307410_10148171 Ga0307410_101481711 369
597 3300032005 Ga0307411_10060001 Ga0307411_100600012 369
598 3300035089 Ga0373944_0025403 Ga0373944_0025403_471_1601 369
599 3300035695 Ga0373927_0028309 Ga0373927_0028309_2456_3586 369
600 3300037068 Ga0373925_0004762 Ga0373925_0004762_3124_4254 369
601 3300049649 Ga0501198_000009 Ga0501198_000009_6567_7682 369
602 3300049662 Ga0501222_000001 Ga0501222_000001_177277_178392 369
603 3300050493 nmdc:mga0k408_19674_c1 nmdc:mga0k408_19674_c1_1819_2955 369
604 3300050508 nmdc:mga09592_16423_c1 nmdc:mga09592_16423_c1_548_1711 369
605 3300053178 Ga0500637_0121518 Ga0500637_0121518_341_1492 369
606 iso_pu_bacteria 2643221639 2644222382 369
607 iso_pu_bacteria 2643221646 2644256392 369
608 iso_pu_bacteria 2858688981 2858696046 369
609 3300002773 JGI25152J39213_1000972 JGI25152J39213_100097213 370
610 3300003215 JGI25153J46596_10001411 JGI25153J46596_100014115 370
611 3300003215 JGI25153J46596_10002253 JGI25153J46596_100022534 370
612 3300003308 Ga0006777J48905_1070856 Ga0006777J48905_10708562 370
613 3300003771 Ga0055526_1002321 Ga0055526_100232113 370
614 3300003791 Ga0055530_10008382 Ga0055530_100083822 370
615 3300003792 Ga0055540_1000007 Ga0055540_1000007179 370
616 3300005262 Ga0065165_1001186 Ga0065165_10011864 370
617 3300005328 Ga0070676_10009149 Ga0070676_100091493 370
618 3300005328 Ga0070676_10047522 Ga0070676_100475221 370
619 3300005329 Ga0070683_100109663 Ga0070683_1001096632 370
620 3300005331 Ga0070670_100003594 Ga0070670_1000035947 370
621 3300005331 Ga0070670_100018524 Ga0070670_1000185246 370
622 3300005331 Ga0070670_100022809 Ga0070670_1000228095 370
623 3300005331 Ga0070670_100254397 Ga0070670_1002543972 370
624 3300005333 Ga0070677_10004354 Ga0070677_100043543 370
625 3300005334 Ga0068869_100006597 Ga0068869_1000065979 370
626 3300005334 Ga0068869_100008593 Ga0068869_1000085931 370
627 3300005335 Ga0070666_10029713 Ga0070666_100297134 370
628 3300005336 Ga0070680_100010602 Ga0070680_1000106026 370
629 3300005338 Ga0068868_100005381 Ga0068868_1000053815 370
630 3300005339 Ga0070660_100039265 Ga0070660_1000392652 370
631 3300005344 Ga0070661_100000108 Ga0070661_1000001081 370
632 3300005347 Ga0070668_100118463 Ga0070668_1001184632 370
633 3300005353 Ga0070669_100006476 Ga0070669_1000064761 370
634 3300005354 Ga0070675_100005294 Ga0070675_1000052942 370
635 3300005354 Ga0070675_100009078 Ga0070675_1000090785 370
636 3300005354 Ga0070675_100071018 Ga0070675_1000710183 370
637 3300005355 Ga0070671_100006922 Ga0070671_1000069225 370
638 3300005355 Ga0070671_100034758 Ga0070671_1000347583 370
639 3300005364 Ga0070673_100167424 Ga0070673_1001674242 370
640 3300005366 Ga0070659_100001701 Ga0070659_10000170113 370
641 3300005367 Ga0070667_100014368 Ga0070667_1000143681 370
642 3300005367 Ga0070667_100061042 Ga0070667_1000610422 370
643 3300005438 Ga0070701_10099426 Ga0070701_100994261 370
644 3300005456 Ga0070678_100005119 Ga0070678_1000051195 370
645 3300005457 Ga0070662_100049993 Ga0070662_1000499932 370
646 3300005459 Ga0068867_100000004 Ga0068867_100000004157 370
647 3300005459 Ga0068867_100026143 Ga0068867_1000261433 370
648 3300005535 Ga0070684_100226424 Ga0070684_1002264242 370
649 3300005539 Ga0068853_100235700 Ga0068853_1002357001 370
650 3300005543 Ga0070672_100005974 Ga0070672_1000059744 370
651 3300005543 Ga0070672_100006624 Ga0070672_1000066241 370
652 3300005543 Ga0070672_100039105 Ga0070672_1000391055 370
653 3300005563 Ga0068855_100158335 Ga0068855_1001583353 370
654 3300005563 Ga0068855_100162039 Ga0068855_1001620393 370
655 3300005564 Ga0070664_100023637 Ga0070664_1000236373 370
656 3300005577 Ga0068857_100188190 Ga0068857_1001881902 370
657 3300005578 Ga0068854_100082900 Ga0068854_1000829003 370
658 3300005616 Ga0068852_100033112 Ga0068852_1000331121 370
659 3300005616 Ga0068852_100070988 Ga0068852_1000709883 370
660 3300005616 Ga0068852_100104725 Ga0068852_1001047252 370
661 3300005616 Ga0068852_100105281 Ga0068852_1001052813 370
662 3300005616 Ga0068852_100118376 Ga0068852_1001183762 370
663 3300005616 Ga0068852_100127122 Ga0068852_1001271222 370
664 3300005618 Ga0068864_100021530 Ga0068864_1000215305 370
665 3300005718 Ga0068866_10015069 Ga0068866_100150693 370
666 3300005719 Ga0068861_100004049 Ga0068861_1000040496 370
667 3300005840 Ga0068870_10010073 Ga0068870_100100732 370
668 3300005841 Ga0068863_100016559 Ga0068863_1000165594 370
669 3300005842 Ga0068858_100004355 Ga0068858_1000043557 370
670 3300005842 Ga0068858_100029372 Ga0068858_1000293722 370
671 3300005843 Ga0068860_100006985 Ga0068860_1000069859 370
672 3300006178 Ga0075367_10057940 Ga0075367_100579402 370
673 3300006195 Ga0075366_10012244 Ga0075366_100122443 370
674 3300006195 Ga0075366_10043163 Ga0075366_100431632 370
675 3300006195 Ga0075366_10045445 Ga0075366_100454453 370
676 3300006237 Ga0097621_100019015 Ga0097621_1000190155 370
677 3300006358 Ga0068871_100142943 Ga0068871_1001429433 370
678 3300006358 Ga0068871_100161849 Ga0068871_1001618491 370
679 3300006881 Ga0068865_100055026 Ga0068865_1000550263 370
680 3300006944 Ga0099823_1000232 Ga0099823_100023217 370
681 3300006946 Ga0079104_1000009 Ga0079104_1000009121 370
682 3300009098 Ga0105245_10159428 Ga0105245_101594282 370
683 3300009148 Ga0105243_10003290 Ga0105243_1000329010 370
684 3300009177 Ga0105248_10032848 Ga0105248_100328485 370
685 3300009551 Ga0105238_10056231 Ga0105238_100562313 370
686 3300012497 Ga0157319_1000004 Ga0157319_1000004128 370
687 3300013105 Ga0157369_10092342 Ga0157369_100923422 370
688 3300013296 Ga0157374_10178621 Ga0157374_101786212 370
689 3300013306 Ga0163162_10015161 Ga0163162_100151617 370
690 3300013308 Ga0157375_10005490 Ga0157375_100054906 370
691 3300013308 Ga0157375_10014943 Ga0157375_100149437 370
692 3300014326 Ga0157380_10009516 Ga0157380_100095167 370
693 3300014745 Ga0157377_10000010 Ga0157377_10000010217 370
694 3300014968 Ga0157379_10010838 Ga0157379_100108387 370
695 3300014968 Ga0157379_10068550 Ga0157379_100685504 370
696 3300014969 Ga0157376_10103260 Ga0157376_101032602 370
697 3300017792 Ga0163161_10032549 Ga0163161_100325495 370
698 3300017792 Ga0163161_10041709 Ga0163161_100417093 370
699 3300021361 Ga0213872_10000233 Ga0213872_100002332 370
700 3300025245 Ga0207425_1000196 Ga0207425_100019613 370
701 3300025258 Ga0209129_1000035 Ga0209129_100003514 370
702 3300025273 Ga0209673_1002863 Ga0209673_10028633 370
703 3300025295 Ga0209564_1000024 Ga0209564_1000024208 370
704 3300025297 Ga0209758_1000558 Ga0209758_100055820 370
705 3300025297 Ga0209758_1001090 Ga0209758_100109012 370
706 3300025298 Ga0209050_1000246 Ga0209050_1000246123 370
707 3300025298 Ga0209050_1000266 Ga0209050_100026613 370
708 3300025298 Ga0209050_1002399 Ga0209050_10023998 370
709 3300025299 Ga0209256_1000019 Ga0209256_1000019177 370
710 3300025299 Ga0209256_1000840 Ga0209256_10008401 370
711 3300025299 Ga0209256_1005599 Ga0209256_10055999 370
712 3300025303 Ga0209051_1000004 Ga0209051_1000004233 370
713 3300025303 Ga0209051_1010874 Ga0209051_10108741 370
714 3300025304 Ga0209257_1000038 Ga0209257_1000038367 370
715 3300025304 Ga0209257_1000044 Ga0209257_1000044192 370
716 3300025304 Ga0209257_1002054 Ga0209257_10020541 370
717 3300025304 Ga0209257_1006483 Ga0209257_10064839 370
718 3300025315 Ga0207697_10020450 Ga0207697_100204503 370
719 3300025901 Ga0207688_10189794 Ga0207688_101897941 370
720 3300025907 Ga0207645_10014439 Ga0207645_100144393 370
721 3300025907 Ga0207645_10028782 Ga0207645_100287825 370
722 3300025908 Ga0207643_10021976 Ga0207643_100219763 370
723 3300025917 Ga0207660_10047655 Ga0207660_100476553 370
724 3300025919 Ga0207657_10034399 Ga0207657_100343993 370
725 3300025920 Ga0207649_10000762 Ga0207649_1000076219 370
726 3300025921 Ga0207652_10308097 Ga0207652_103080971 370
727 3300025923 Ga0207681_10000326 Ga0207681_1000032613 370
728 3300025925 Ga0207650_10004536 Ga0207650_100045363 370
729 3300025925 Ga0207650_10009583 Ga0207650_100095836 370
730 3300025926 Ga0207659_10011221 Ga0207659_100112216 370
731 3300025926 Ga0207659_10023552 Ga0207659_100235522 370
732 3300025926 Ga0207659_10039343 Ga0207659_100393433 370
733 3300025926 Ga0207659_10310467 Ga0207659_103104671 370
734 3300025927 Ga0207687_10007222 Ga0207687_100072229 370
735 3300025931 Ga0207644_10004898 Ga0207644_100048985 370
736 3300025932 Ga0207690_10002897 Ga0207690_100028979 370
737 3300025934 Ga0207686_10047576 Ga0207686_100475762 370
738 3300025935 Ga0207709_10000990 Ga0207709_100009904 370
739 3300025937 Ga0207669_10030025 Ga0207669_100300254 370
740 3300025937 Ga0207669_10144802 Ga0207669_101448021 370
741 3300025940 Ga0207691_10008199 Ga0207691_100081993 370
742 3300025940 Ga0207691_10012361 Ga0207691_100123613 370
743 3300025940 Ga0207691_10066154 Ga0207691_100661544 370
744 3300025941 Ga0207711_10001731 Ga0207711_1000173116 370
745 3300025941 Ga0207711_10014562 Ga0207711_100145622 370
746 3300025942 Ga0207689_10001900 Ga0207689_100019004 370
747 3300025942 Ga0207689_10004982 Ga0207689_100049828 370
748 3300025944 Ga0207661_10134466 Ga0207661_101344661 370
749 3300025945 Ga0207679_10000202 Ga0207679_100002028 370
750 3300025945 Ga0207679_10020265 Ga0207679_100202655 370
751 3300025949 Ga0207667_10020318 Ga0207667_100203188 370
752 3300025960 Ga0207651_10024120 Ga0207651_100241203 370
753 3300025960 Ga0207651_10087435 Ga0207651_100874352 370
754 3300025961 Ga0207712_10040571 Ga0207712_100405712 370
755 3300025981 Ga0207640_10176446 Ga0207640_101764462 370
756 3300025986 Ga0207658_10001421 Ga0207658_1000142111 370
757 3300025986 Ga0207658_10002120 Ga0207658_100021208 370
758 3300025986 Ga0207658_10034602 Ga0207658_100346023 370
759 3300025986 Ga0207658_10266527 Ga0207658_102665271 370
760 3300026023 Ga0207677_10025366 Ga0207677_100253662 370
761 3300026023 Ga0207677_10025732 Ga0207677_100257322 370
762 3300026023 Ga0207677_10048246 Ga0207677_100482463 370
763 3300026035 Ga0207703_10001042 Ga0207703_1000104223 370
764 3300026035 Ga0207703_10013562 Ga0207703_100135622 370
765 3300026041 Ga0207639_10012399 Ga0207639_100123991 370
766 3300026041 Ga0207639_10180012 Ga0207639_101800122 370
767 3300026078 Ga0207702_10273752 Ga0207702_102737521 370
768 3300026088 Ga0207641_10005975 Ga0207641_100059759 370
769 3300026088 Ga0207641_10041164 Ga0207641_100411643 370
770 3300026089 Ga0207648_10000002 Ga0207648_10000002154 370
771 3300026089 Ga0207648_10011180 Ga0207648_100111806 370
772 3300026089 Ga0207648_10016034 Ga0207648_100160341 370
773 3300026089 Ga0207648_10016341 Ga0207648_100163412 370
774 3300026095 Ga0207676_10005558 Ga0207676_100055583 370
775 3300026095 Ga0207676_10028014 Ga0207676_100280144 370
776 3300026095 Ga0207676_10258309 Ga0207676_102583092 370
777 3300026116 Ga0207674_10298072 Ga0207674_102980722 370
778 3300026118 Ga0207675_100002569 Ga0207675_1000025692 370
779 3300026118 Ga0207675_100005687 Ga0207675_1000056875 370
780 3300026118 Ga0207675_100057826 Ga0207675_1000578264 370
781 3300026121 Ga0207683_10029871 Ga0207683_100298714 370
782 3300026121 Ga0207683_10044133 Ga0207683_100441334 370
783 3300026142 Ga0207698_10032405 Ga0207698_100324053 370
784 3300026142 Ga0207698_10044206 Ga0207698_100442064 370
785 3300026142 Ga0207698_10149145 Ga0207698_101491452 370
786 3300026142 Ga0207698_10152220 Ga0207698_101522202 370
787 3300027111 Ga0209281_1000023 Ga0209281_1000023266 370
788 3300027296 Ga0209389_1002721 Ga0209389_10027213 370
789 3300027312 Ga0209371_1008958 Ga0209371_10089584 370
790 3300027876 Ga0209974_10002823 Ga0209974_100028234 370
791 3300028380 Ga0268265_10057721 Ga0268265_100577213 370
792 3300028381 Ga0268264_10001548 Ga0268264_1000154814 370
793 3300028794 Ga0307515_10002735 Ga0307515_1000273528 370
794 3300028794 Ga0307515_10004327 Ga0307515_1000432712 370
795 3300028794 Ga0307515_10009775 Ga0307515_100097756 370
796 3300030500 Ga0268256_1010289 Ga0268256_10102894 370
797 3300030522 Ga0307512_10025372 Ga0307512_100253724 370
798 3300031250 Ga0265331_10007166 Ga0265331_100071663 370
799 3300031251 Ga0265327_10000035 Ga0265327_10000035142 370
800 3300031548 Ga0307408_100000029 Ga0307408_10000002910 370
801 3300031548 Ga0307408_100013966 Ga0307408_1000139662 370
802 3300031616 Ga0307508_10000050 Ga0307508_1000005074 370
803 3300031711 Ga0265314_10002601 Ga0265314_1000260119 370
804 3300031730 Ga0307516_10000879 Ga0307516_1000087924 370
805 3300031730 Ga0307516_10087710 Ga0307516_100877102 370
806 3300031731 Ga0307405_10000330 Ga0307405_1000033010 370
807 3300031824 Ga0307413_10078925 Ga0307413_100789252 370
808 3300031852 Ga0307410_10118254 Ga0307410_101182542 370
809 3300031901 Ga0307406_10010474 Ga0307406_100104741 370
810 3300031911 Ga0307412_10002581 Ga0307412_100025814 370
811 3300031911 Ga0307412_10347045 Ga0307412_103470451 370
812 3300032002 Ga0307416_100048307 Ga0307416_1000483075 370
813 3300032002 Ga0307416_100303875 Ga0307416_1003038751 370
814 3300032004 Ga0307414_10081814 Ga0307414_100818142 370
815 3300032005 Ga0307411_10012343 Ga0307411_100123432 370
816 3300032005 Ga0307411_10116582 Ga0307411_101165822 370
817 3300035114 Ga0373939_0000114 Ga0373939_0000114_7475_8599 370
818 3300035691 Ga0373931_0001114 Ga0373931_0001114_3515_4633 370
819 3300035691 Ga0373931_0033420 Ga0373931_0033420_792_1946 370
820 3300035691 Ga0373931_0050825 Ga0373931_0050825_903_2027 370
821 3300037068 Ga0373925_0018650 Ga0373925_0018650_3190_4314 370
822 3300037471 Ga0395905_0005213 Ga0395905_0005213_4823_5953 370
823 3300037471 Ga0395905_0012217 Ga0395905_0012217_4651_5775 370
824 3300039447 Ga0436361_1013275 Ga0436361_1013275_1437_2561 370
825 3300039447 Ga0436361_1167303 Ga0436361_1167303_13197_14321 370
826 3300039447 Ga0436361_1187903 Ga0436361_1187903_1442_2566 370
827 3300039450 Ga0436363_0328320 Ga0436363_0328320_61_1203 370
828 3300041459 Ga0451800_1314933 Ga0451800_1314933_468_1586 370
829 3300042126 Ga0450888_001580 Ga0450888_001580_372_1496 370
830 3300042144 Ga0450889_001137 Ga0450889_001137_334_1458 370
831 3300042531 Ga0450918_000470 Ga0450918_000470_2235_3353 370
832 3300042532 Ga0450893_0003122 Ga0450893_0003122_195_1319 370
833 3300046690 Ga0495624_0012670 Ga0495624_0012670_2777_3895 370
834 3300048908 Ga0496105_0069379 Ga0496105_0069379_1504_2652 370
835 3300048909 Ga0496106_0014315 Ga0496106_0014315_3604_4758 370
836 3300048911 Ga0496108_0099831 Ga0496108_0099831_485_1639 370
837 3300048918 Ga0496115_0047347 Ga0496115_0047347_1311_2465 370
838 3300049579 Ga0501043_0000071 Ga0501043_0000071_61087_62205 370
839 3300049580 Ga0501046_0003675 Ga0501046_0003675_12349_13467 370
840 3300049581 Ga0501047_0000087 Ga0501047_0000087_55133_56251 370
841 3300049581 Ga0501047_0073348 Ga0501047_0073348_1793_2908 370
842 3300049663 Ga0501223_010748 Ga0501223_010748_393_1517 370
843 3300049682 Ga0501252_003776 Ga0501252_003776_359_1477 370
844 3300049706 Ga0501229_000045 Ga0501229_000045_604_1728 370
845 3300049824 Ga0501045_0015438 Ga0501045_0015438_3619_4737 370
846 3300050496 nmdc:mga07m45_5166_c1 nmdc:mga07m45_5166_c1_1495_2619 370
847 3300053086 Ga0500578_0000057 Ga0500578_0000057_51918_53036 370
848 3300053131 Ga0500652_003063 Ga0500652_003063_468_1589 370
849 iso_pu_bacteria 2738543013 2739251926 370
850 3300003187 JGI25151J46595_10000362 JGI25151J46595_1000036238 371
851 3300003759 Ga0055525_1000004 Ga0055525_1000004119 371
852 3300003771 Ga0055526_1000374 Ga0055526_100037425 371
853 3300003771 Ga0055526_1002595 Ga0055526_10025958 371
854 3300003773 Ga0055537_1001076 Ga0055537_10010765 371
855 3300003775 Ga0055524_1001870 Ga0055524_10018704 371
856 3300003775 Ga0055524_1010050 Ga0055524_10100503 371
857 3300003784 Ga0055534_1000233 Ga0055534_10002331 371
858 3300005262 Ga0065165_1000116 Ga0065165_100011695 371
859 3300005328 Ga0070676_10005340 Ga0070676_100053403 371
860 3300005331 Ga0070670_100083123 Ga0070670_1000831233 371
861 3300005334 Ga0068869_100055320 Ga0068869_1000553203 371
862 3300005338 Ga0068868_100034195 Ga0068868_1000341952 371
863 3300005338 Ga0068868_100060430 Ga0068868_1000604302 371
864 3300005355 Ga0070671_100066536 Ga0070671_1000665363 371
865 3300005364 Ga0070673_100141459 Ga0070673_1001414591 371
866 3300005455 Ga0070663_100029920 Ga0070663_1000299204 371
867 3300005459 Ga0068867_100176513 Ga0068867_1001765131 371
868 3300005539 Ga0068853_100086109 Ga0068853_1000861092 371
869 3300005563 Ga0068855_100039778 Ga0068855_1000397782 371
870 3300005840 Ga0068870_10016725 Ga0068870_100167253 371
871 3300005841 Ga0068863_100009638 Ga0068863_1000096388 371
872 3300005843 Ga0068860_100494227 Ga0068860_1004942271 371
873 3300006051 Ga0075364_10070186 Ga0075364_100701861 371
874 3300006178 Ga0075367_10003802 Ga0075367_100038027 371
875 3300006178 Ga0075367_10089237 Ga0075367_100892373 371
876 3300006195 Ga0075366_10008033 Ga0075366_100080333 371
877 3300006195 Ga0075366_10065786 Ga0075366_100657863 371
878 3300006353 Ga0075370_10004362 Ga0075370_100043622 371
879 3300006353 Ga0075370_10011497 Ga0075370_100114975 371
880 3300006353 Ga0075370_10017865 Ga0075370_100178654 371
881 3300006353 Ga0075370_10050205 Ga0075370_100502051 371
882 3300006353 Ga0075370_10060228 Ga0075370_100602282 371
883 3300009148 Ga0105243_10203124 Ga0105243_102031241 371
884 3300009545 Ga0105237_10021585 Ga0105237_100215856 371
885 3300013308 Ga0157375_10025537 Ga0157375_100255373 371
886 3300014969 Ga0157376_10003392 Ga0157376_100033924 371
887 3300015683 Ga0183362_10003 Ga0183362_10003861 371
888 3300021361 Ga0213872_10001634 Ga0213872_100016347 371
889 3300025230 Ga0209563_100013 Ga0209563_100013119 371
890 3300025263 Ga0209565_1000053 Ga0209565_100005315 371
891 3300025273 Ga0209673_1016035 Ga0209673_10160352 371
892 3300025273 Ga0209673_1042876 Ga0209673_10428761 371
893 3300025291 Ga0209675_1000091 Ga0209675_100009115 371
894 3300025291 Ga0209675_1005160 Ga0209675_10051604 371
895 3300025294 Ga0209025_1000085 Ga0209025_1000085176 371
896 3300025294 Ga0209025_1000123 Ga0209025_100012338 371
897 3300025294 Ga0209025_1000838 Ga0209025_100083813 371
898 3300025295 Ga0209564_1000021 Ga0209564_1000021293 371
899 3300025295 Ga0209564_1000170 Ga0209564_100017037 371
900 3300025295 Ga0209564_1002189 Ga0209564_10021894 371
901 3300025298 Ga0209050_1006483 Ga0209050_10064833 371
902 3300025299 Ga0209256_1000407 Ga0209256_100040713 371
903 3300025299 Ga0209256_1001471 Ga0209256_100147112 371
904 3300025303 Ga0209051_1002164 Ga0209051_10021644 371
905 3300025303 Ga0209051_1016391 Ga0209051_10163913 371
906 3300025304 Ga0209257_1000047 Ga0209257_1000047107 371
907 3300025907 Ga0207645_10021447 Ga0207645_100214474 371
908 3300025914 Ga0207671_10101565 Ga0207671_101015652 371
909 3300025927 Ga0207687_10005793 Ga0207687_100057934 371
910 3300025931 Ga0207644_10142764 Ga0207644_101427642 371
911 3300025938 Ga0207704_10056114 Ga0207704_100561143 371
912 3300025942 Ga0207689_10128154 Ga0207689_101281542 371
913 3300026023 Ga0207677_10009333 Ga0207677_100093335 371
914 3300026023 Ga0207677_10010579 Ga0207677_100105793 371
915 3300026089 Ga0207648_10213997 Ga0207648_102139973 371
916 3300026095 Ga0207676_10396978 Ga0207676_103969781 371
917 3300026116 Ga0207674_10019462 Ga0207674_100194626 371
918 3300028381 Ga0268264_10468119 Ga0268264_104681191 371
919 3300028786 Ga0307517_10001027 Ga0307517_1000102730 371
920 3300028794 Ga0307515_10029645 Ga0307515_100296451 371
921 3300028794 Ga0307515_10033526 Ga0307515_100335262 371
922 3300028794 Ga0307515_10035888 Ga0307515_100358886 371
923 3300028794 Ga0307515_10042814 Ga0307515_100428142 371
924 3300030522 Ga0307512_10036833 Ga0307512_100368332 371
925 3300031456 Ga0307513_10292868 Ga0307513_102928681 371
926 3300031507 Ga0307509_10000993 Ga0307509_1000099330 371
927 3300031507 Ga0307509_10012095 Ga0307509_1001209511 371
928 3300031507 Ga0307509_10052048 Ga0307509_100520484 371
929 3300031507 Ga0307509_10113528 Ga0307509_101135282 371
930 3300031616 Ga0307508_10016037 Ga0307508_100160373 371
931 3300031616 Ga0307508_10041729 Ga0307508_100417293 371
932 3300031649 Ga0307514_10011020 Ga0307514_100110204 371
933 3300031730 Ga0307516_10094213 Ga0307516_100942134 371
934 3300031730 Ga0307516_10200092 Ga0307516_102000922 371
935 3300033179 Ga0307507_10211099 Ga0307507_102110991 371
936 3300033180 Ga0307510_10000129 Ga0307510_100001291 371
937 3300033180 Ga0307510_10088323 Ga0307510_100883232 371
938 3300036401 Ga0373937_0060748 Ga0373937_0060748_2064_3323 371
939 3300037471 Ga0395905_0005228 Ga0395905_0005228_5599_6726 371
940 3300039447 Ga0436361_0504982 Ga0436361_0504982_57458_58597 371
941 3300039447 Ga0436361_0941839 Ga0436361_0941839_168136_169266 371
942 3300042007 Ga0439449_0003507 Ga0439449_0003507_4261_5403 371
943 3300046454 Ga0495592_0000421 Ga0495592_0000421_5450_6571 371
944 3300046457 Ga0495590_0011692 Ga0495590_0011692_242_1369 371
945 3300046471 Ga0495650_0006869 Ga0495650_0006869_4423_5568 371
946 3300046472 Ga0495580_0004160 Ga0495580_0004160_10387_11529 371
947 3300046526 Ga0495666_0001113 Ga0495666_0001113_1599_2741 371
948 3300046660 Ga0495625_0013462 Ga0495625_0013462_2802_3944 371
949 3300046694 Ga0495649_0003876 Ga0495649_0003876_5960_7102 371
950 3300048919 Ga0496116_0044569 Ga0496116_0044569_103_1242 371
951 3300049571 Ga0501034_0000056 Ga0501034_0000056_163146_164288 371
952 3300050489 nmdc:mga03683_17689_c1 nmdc:mga03683_17689_c1_23_1165 371
953 3300050493 nmdc:mga0k408_223_c2 nmdc:mga0k408_223_c2_1932_3074 371
954 3300050493 nmdc:mga0k408_412_c1 nmdc:mga0k408_412_c1_18040_19173 371
955 3300050493 nmdc:mga0k408_6089_c1 nmdc:mga0k408_6089_c1_5187_6329 371
956 3300050496 nmdc:mga07m45_1175_c1 nmdc:mga07m45_1175_c1_177_1319 371
957 3300050496 nmdc:mga07m45_183_c1 nmdc:mga07m45_183_c1_2074_3216 371
958 3300050496 nmdc:mga07m45_38640_c1 nmdc:mga07m45_38640_c1_857_1978 371
959 3300059421 Ga0590071_001911 Ga0590071_001911_2386_3522 371
960 3300001979 JGI24740J21852_10052861 JGI24740J21852_100528611 372
961 3300002774 JGI25150J39212_1006600 JGI25150J39212_10066002 372
962 3300003187 JGI25151J46595_10000972 JGI25151J46595_1000097210 372
963 3300003187 JGI25151J46595_10001552 JGI25151J46595_100015526 372
964 3300003187 JGI25151J46595_10026424 JGI25151J46595_100264242 372
965 3300003374 JGI25161J50226_1003108 JGI25161J50226_10031083 372
966 3300003781 Ga0055536_1000112 Ga0055536_100011257 372
967 3300003781 Ga0055536_1005250 Ga0055536_10052502 372
968 3300003784 Ga0055534_1000536 Ga0055534_10005366 372
969 3300003784 Ga0055534_1002239 Ga0055534_10022392 372
970 3300003784 Ga0055534_1002715 Ga0055534_10027152 372
971 3300003792 Ga0055540_1004117 Ga0055540_10041172 372
972 3300003794 Ga0055531_10003405 Ga0055531_100034057 372
973 3300005289 Ga0065704_10156447 Ga0065704_101564471 372
974 3300005456 Ga0070678_100347224 Ga0070678_1003472241 372
975 3300005548 Ga0070665_100055139 Ga0070665_1000551392 372
976 3300005548 Ga0070665_100385225 Ga0070665_1003852251 372
977 3300005564 Ga0070664_100019559 Ga0070664_1000195593 372
978 3300006038 Ga0075365_10117637 Ga0075365_101176372 372
979 3300006178 Ga0075367_10085948 Ga0075367_100859483 372
980 3300006195 Ga0075366_10005214 Ga0075366_100052147 372
981 3300006353 Ga0075370_10001068 Ga0075370_100010683 372
982 3300006353 Ga0075370_10001217 Ga0075370_1000121711 372
983 3300006353 Ga0075370_10002762 Ga0075370_100027626 372
984 3300006353 Ga0075370_10005946 Ga0075370_100059463 372
985 3300006353 Ga0075370_10074305 Ga0075370_100743052 372
986 3300006846 Ga0075430_100082419 Ga0075430_1000824192 372
987 3300006948 Ga0099826_10002824 Ga0099826_100028248 372
988 3300009098 Ga0105245_10438964 Ga0105245_104389641 372
989 3300009148 Ga0105243_10004194 Ga0105243_100041943 372
990 3300009148 Ga0105243_10037020 Ga0105243_100370203 372
991 3300009176 Ga0105242_10001421 Ga0105242_100014214 372
992 3300009176 Ga0105242_10117104 Ga0105242_101171042 372
993 3300009545 Ga0105237_10015429 Ga0105237_100154294 372
994 3300009551 Ga0105238_10317745 Ga0105238_103177451 372
995 3300013104 Ga0157370_10008219 Ga0157370_100082193 372
996 3300013105 Ga0157369_10005838 Ga0157369_1000583813 372
997 3300013306 Ga0163162_10121871 Ga0163162_101218711 372
998 3300014497 Ga0182008_10001216 Ga0182008_100012169 372
999 3300014497 Ga0182008_10003469 Ga0182008_100034691 372
1000 3300015261 Ga0182006_1000937 Ga0182006_10009378 372
1001 3300015262 Ga0182007_10000419 Ga0182007_100004199 372
1002 3300015262 Ga0182007_10000746 Ga0182007_100007465 372
1003 3300017792 Ga0163161_10003954 Ga0163161_1000395410 372
1004 3300017792 Ga0163161_10066164 Ga0163161_100661642 372
1005 3300017792 Ga0163161_10073247 Ga0163161_100732473 372
1006 3300017792 Ga0163161_10219409 Ga0163161_102194092 372
1007 3300025245 Ga0207425_1000663 Ga0207425_10006638 372
1008 3300025258 Ga0209129_1000084 Ga0209129_100008411 372
1009 3300025258 Ga0209129_1001344 Ga0209129_10013443 372
1010 3300025263 Ga0209565_1000169 Ga0209565_100016912 372
1011 3300025273 Ga0209673_1000114 Ga0209673_100011412 372
1012 3300025284 Ga0209130_1000621 Ga0209130_100062111 372
1013 3300025284 Ga0209130_1001206 Ga0209130_10012063 372
1014 3300025291 Ga0209675_1000043 Ga0209675_1000043151 372
1015 3300025291 Ga0209675_1000062 Ga0209675_100006212 372
1016 3300025291 Ga0209675_1001454 Ga0209675_100145411 372
1017 3300025291 Ga0209675_1002744 Ga0209675_10027448 372
1018 3300025292 Ga0209676_1000083 Ga0209676_1000083198 372
1019 3300025292 Ga0209676_1000999 Ga0209676_100099921 372
1020 3300025292 Ga0209676_1001040 Ga0209676_100104012 372
1021 3300025294 Ga0209025_1000106 Ga0209025_1000106142 372
1022 3300025294 Ga0209025_1000678 Ga0209025_100067831 372
1023 3300025294 Ga0209025_1000719 Ga0209025_100071922 372
1024 3300025294 Ga0209025_1000861 Ga0209025_100086114 372
1025 3300025294 Ga0209025_1005452 Ga0209025_10054521 372
1026 3300025294 Ga0209025_1016647 Ga0209025_10166474 372
1027 3300025295 Ga0209564_1001047 Ga0209564_100104724 372
1028 3300025295 Ga0209564_1001096 Ga0209564_100109621 372
1029 3300025297 Ga0209758_1000754 Ga0209758_100075423 372
1030 3300025298 Ga0209050_1002554 Ga0209050_10025545 372
1031 3300025299 Ga0209256_1000206 Ga0209256_100020636 372
1032 3300025302 Ga0207426_1000049 Ga0207426_1000049172 372
1033 3300025303 Ga0209051_1000025 Ga0209051_1000025311 372
1034 3300025303 Ga0209051_1000824 Ga0209051_100082412 372
1035 3300025303 Ga0209051_1001151 Ga0209051_100115114 372
1036 3300025303 Ga0209051_1002289 Ga0209051_100228912 372
1037 3300025303 Ga0209051_1024903 Ga0209051_10249032 372
1038 3300025303 Ga0209051_1031720 Ga0209051_10317202 372
1039 3300025304 Ga0209257_1000039 Ga0209257_1000039297 372
1040 3300025304 Ga0209257_1000977 Ga0209257_100097714 372
1041 3300025304 Ga0209257_1004064 Ga0209257_100406411 372
1042 3300025304 Ga0209257_1025419 Ga0209257_10254192 372
1043 3300025728 Ga0207655_1001268 Ga0207655_100126819 372
1044 3300025903 Ga0207680_10056253 Ga0207680_100562532 372
1045 3300025913 Ga0207695_10195014 Ga0207695_101950141 372
1046 3300025924 Ga0207694_10198339 Ga0207694_101983391 372
1047 3300025933 Ga0207706_10172398 Ga0207706_101723981 372
1048 3300025934 Ga0207686_10011506 Ga0207686_100115063 372
1049 3300025935 Ga0207709_10000572 Ga0207709_1000057220 372
1050 3300025935 Ga0207709_10001477 Ga0207709_100014774 372
1051 3300025940 Ga0207691_10101754 Ga0207691_101017543 372
1052 3300025945 Ga0207679_10044244 Ga0207679_100442442 372
1053 3300025986 Ga0207658_10193858 Ga0207658_101938582 372
1054 3300026089 Ga0207648_10055148 Ga0207648_100551483 372
1055 3300026121 Ga0207683_10063910 Ga0207683_100639103 372
1056 3300026121 Ga0207683_10361117 Ga0207683_103611171 372
1057 3300026142 Ga0207698_10187329 Ga0207698_101873292 372
1058 3300027666 Ga0209282_1001278 Ga0209282_10012786 372
1059 3300027682 Ga0209971_1008605 Ga0209971_10086053 372
1060 3300028379 Ga0268266_10032642 Ga0268266_100326423 372
1061 3300028380 Ga0268265_10039100 Ga0268265_100391002 372
1062 3300028794 Ga0307515_10000278 Ga0307515_1000027846 372
1063 3300030734 Ga0316179_1065978 Ga0316179_10659782 372
1064 3300030736 Ga0316180_1114655 Ga0316180_11146553 372
1065 3300030745 Ga0316182_1157939 Ga0316182_11579392 372
1066 3300030745 Ga0316182_1185814 Ga0316182_11858141 372
1067 3300031238 Ga0265332_10000023 Ga0265332_1000002395 372
1068 3300031238 Ga0265332_10000046 Ga0265332_1000004694 372
1069 3300031247 Ga0265340_10005958 Ga0265340_100059584 372
1070 3300031251 Ga0265327_10001807 Ga0265327_1000180722 372
1071 3300031251 Ga0265327_10078750 Ga0265327_100787501 372
1072 3300031649 Ga0307514_10124033 Ga0307514_101240332 372
1073 3300031711 Ga0265314_10000130 Ga0265314_100001302 372
1074 3300031730 Ga0307516_10044798 Ga0307516_100447984 372
1075 3300031901 Ga0307406_10036537 Ga0307406_100365373 372
1076 3300032005 Ga0307411_10053269 Ga0307411_100532693 372
1077 3300032005 Ga0307411_10122687 Ga0307411_101226872 372
1078 3300038443 Ga0395901_0205970 Ga0395901_0205970_304_1440 372
1079 3300042006 Ga0439432_003503 Ga0439432_003503_128_1246 372
1080 3300042134 Ga0450898_000630 Ga0450898_000630_735_1856 372
1081 3300042531 Ga0450918_001277 Ga0450918_001277_3193_4311 372
1082 3300042876 Ga0451577_0026109 Ga0451577_0026109_2252_3394 372
1083 3300044656 Ga0466969_0013133 Ga0466969_0013133_1602_2738 372
1084 3300044673 Ga0453683_0004241 Ga0453683_0004241_1083_2207 372
1085 3300044684 Ga0466966_0002762 Ga0466966_0002762_4809_5945 372
1086 3300044684 Ga0466966_0038911 Ga0466966_0038911_1479_2603 372
1087 3300044693 Ga0466961_0033795 Ga0466961_0033795_755_1891 372
1088 3300044712 Ga0453684_0156564 Ga0453684_0156564_1130_2272 372
1089 3300044719 Ga0466971_0033203 Ga0466971_0033203_755_1891 372
1090 3300044842 Ga0466957_0004692 Ga0466957_0004692_4737_5873 372
1091 3300045049 Ga0466959_0000147 Ga0466959_0000147_35551_36687 372
1092 3300045051 Ga0451576_0013663 Ga0451576_0013663_4868_6010 372
1093 3300045976 Ga0466967_0140966 Ga0466967_0140966_579_1715 372
1094 3300046518 Ga0495631_0000253 Ga0495631_0000253_34408_35526 372
1095 3300046528 Ga0495642_0027259 Ga0495642_0027259_635_1759 372
1096 3300046615 Ga0495656_0000093 Ga0495656_0000093_10919_12037 372
1097 3300047321 Ga0495676_0008226 Ga0495676_0008226_7872_8990 372
1098 3300048904 Ga0496101_0053427 Ga0496101_0053427_130_1248 372
1099 3300048904 Ga0496101_0088063 Ga0496101_0088063_665_1783 372
1100 3300048920 Ga0496117_0012516 Ga0496117_0012516_4754_5872 372
1101 3300048927 Ga0496124_0169162 Ga0496124_0169162_361_1479 372
1102 3300049580 Ga0501046_0000034 Ga0501046_0000034_86803_88116 372
1103 3300049581 Ga0501047_0000042 Ga0501047_0000042_88484_89797 372
1104 3300049581 Ga0501047_0109307 Ga0501047_0109307_897_2021 372
1105 3300049582 Ga0501048_0000019 Ga0501048_0000019_21406_22719 372
1106 3300050493 nmdc:mga0k408_17882_c1 nmdc:mga0k408_17882_c1_808_1941 372
1107 3300050496 nmdc:mga07m45_4942_c1 nmdc:mga07m45_4942_c1_809_1951 372
1108 3300050496 nmdc:mga07m45_92666_c1 nmdc:mga07m45_92666_c1_453_1571 372
1109 3300053093 Ga0500651_0001184 Ga0500651_0001184_10499_11617 372
1110 3300053110 Ga0500571_000088 Ga0500571_000088_4446_5564 372
1111 3300053134 Ga0500658_0002407 Ga0500658_0002407_5921_7039 372
1112 3300053139 Ga0500568_0023742 Ga0500568_0023742_1352_2470 372
1113 3300061719 Ga0466962_0033972 Ga0466962_0033972_755_1891 372

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00793

DAHP_synth_1

DAHP synthetase I family

47

359

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qr7-assembly1.cif.gz_C crystal structure of phenylalanine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase from escherichia coli complexed with pb2+ and pep 0.9876 26 372
5d09-assembly1.cif.gz_D neisseria meningitidis 3 deoxy-d-arabino-heptulosonate 7-phosphate synthase phe211ala variant 0.9875 32 371
5cz0-assembly1.cif.gz_C neisseria meningitidis 3 dexy-d-arabino-heptulosonate 7-phosphate synthase glu98ala variant 0.9868 32 371
5d09-assembly1.cif.gz_C neisseria meningitidis 3 deoxy-d-arabino-heptulosonate 7-phosphate synthase phe211ala variant 0.9867 32 371
5dcd-assembly1.cif.gz_B neisseria meningitidis 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase regulated (tyrosine) 0.9865 23 370
ID Description Score Start End Superfamily
6aglB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9739 27 366 3.20.20.70
6aglB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.956 27 366 3.20.20.70
1ofpA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9548 23 371 3.20.20.70
1of6A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9546 23 371 3.20.20.70
1ofpA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9395 23 371 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3C0YAS2-F1-model_v4 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (3-deoxy-D-arabino-heptulosonate 7-phosphate synthase) (DAHP synthase) (Phospho-2-keto-3-deoxyheptonate aldolase) 0.9982 128 371 GO:0003849
GO:0005737
GO:0008652
GO:0009073
GO:0009423
AF-A0A2R7NKD4-F1-model_v4 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (3-deoxy-D-arabino-heptulosonate 7-phosphate synthase) (DAHP synthase) (Phospho-2-keto-3-deoxyheptonate aldolase) 0.9952 77 371 GO:0003849
GO:0005737
GO:0008652
GO:0009073
GO:0009423
AF-A0A519J7T6-F1-model_v4 deleted 0.9951 76 371
AF-A0A1J5PI59-F1-model_v4 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (3-deoxy-D-arabino-heptulosonate 7-phosphate synthase) (DAHP synthase) (Phospho-2-keto-3-deoxyheptonate aldolase) 0.9949 156 371 GO:0003849
GO:0005737
GO:0008652
GO:0009073
AF-A0A1E4QQW9-F1-model_v4 deleted 0.9926 16 371

Feature Viewer

pLDDT pTM Quality
91.61 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map