F490270
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1113 | 489 | 1061 | 373 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2831265667|2831269637 |
| Length | 435 |
| Sequence | SGLFFYLLKVTPMSTPNADTYHAEASDIRELPPPESVMRFYPVAGTPVEALVLTTRKTIHQILDGDDDRLLVVMGPCSIHDPKAAFEYALKLAKQRERFADSLEIVMRVYFEKPRTTVGWKGLINDPYLDESFKINEGLRIARQVLIDINNLGLPAGSEFLDVISPQYIGDLISWGAIGARTTESQVHRELASGLSAPIGFKNGTDGNIRIAVDAIQAAARGHHFLSVHKNGHVAIVETTGNPDCHVILRGGKSPNYDAESVELACLGLQEAGLRPSLMVDCSHANSSKMHEKQIAVAGDVAAQIAGGSSRVFGVMVESHLREGAQRFAPGRDRAADLVYGQSITDACLGWDDSVQVLEALSEAVRGRRRARLEKEGVYVRKRRGSVVYSVDSTSPDAAFVDLVDAPLAQPAGAAEGVDLNATGWQHHADFAPLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 3 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 4 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 5 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 6 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 7 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 8 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 9 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 10 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 11 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 12 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 13 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 14 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 15 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 16 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 17 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 18 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 19 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 20 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 21 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 22 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 23 | 2671180531 | Gemmata sp. SH-PL17 | Isolate | Unclassified |
| 24 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 25 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 26 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 27 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 28 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 29 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 30 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 31 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 32 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 33 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 34 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 35 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 36 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 37 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 38 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 39 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 40 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 41 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 42 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 43 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 44 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 45 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 46 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 47 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 48 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 49 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 50 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 51 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 52 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 53 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 54 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 55 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 56 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 57 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 58 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 60 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 61 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 62 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 63 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 64 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 65 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 66 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 67 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 68 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 69 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 70 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 71 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 72 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 73 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 74 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 75 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 76 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 78 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 79 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 80 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 81 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 82 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 86 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 89 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 93 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 95 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 115 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 116 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 117 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 118 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 120 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 121 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 122 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 123 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 125 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 126 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 130 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 132 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 133 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 134 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 136 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 137 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 138 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 139 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 140 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 141 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 142 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 143 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 144 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 145 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 146 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 147 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 148 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 149 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 150 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 151 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 153 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 154 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 155 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 156 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 157 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 158 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 159 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 160 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 161 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 162 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 164 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 165 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 166 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 167 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 180 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 189 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 193 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 194 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 195 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 197 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 202 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 203 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 204 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 207 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 208 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 210 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 212 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 214 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 217 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 220 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 284 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 285 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 292 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 296 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 300 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 301 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 302 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 303 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 304 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 305 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 306 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 307 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 308 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 309 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 310 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 311 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 312 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 313 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 314 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 315 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 316 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 317 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 318 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 319 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 320 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 321 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 322 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 323 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 324 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 325 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 326 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 327 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 328 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 329 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 330 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 331 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 332 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 333 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 334 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 335 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 336 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 337 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 338 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 339 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 340 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 341 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 342 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 343 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 344 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 345 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 346 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 347 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 348 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 349 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 350 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 351 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 352 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 353 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 354 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 355 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 356 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 357 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 358 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 359 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 360 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 361 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 362 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 363 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 364 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 365 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 366 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 367 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 368 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 369 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 370 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 371 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 372 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 373 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 374 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 375 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 376 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 377 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 415 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 416 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 417 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 418 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 419 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 420 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 421 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 422 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 423 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 424 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 451 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 452 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 453 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 454 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 455 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 463 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 464 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 465 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 477 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 478 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 479 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 480 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 481 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 482 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 483 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 484 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 485 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 487 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 488 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 489 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.24 |
| Metatranscriptomes | 0.09 |
| Isolates | 4.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.73 |
| Nodule | 0.63 |
| Rhizoplane | 1.08 |
| Rhizosphere | 76.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10052861 | 3300001979 | Bacteria | 1155 |
| 2 | JGI25154J39366_1002640 | 3300002738 | Bacteria | 4423 |
| 3 | JGI25157J39369_1000038 | 3300002741 | Bacteria | 130270 |
| 4 | JGI25152J39213_1000972 | 3300002773 | Bacteria | 13971 |
| 5 | JGI25150J39212_1006600 | 3300002774 | Bacteria | 2383 |
| 6 | JGI25151J46595_10000362 | 3300003187 | Bacteria | 47753 |
| 7 | JGI25151J46595_10000972 | 3300003187 | Bacteria | 21720 |
| 8 | JGI25151J46595_10001552 | 3300003187 | Bacteria | 15327 |
| 9 | JGI25151J46595_10026424 | 3300003187 | Bacteria | 2342 |
| 10 | JGI25406J46586_10019026 | 3300003203 | Bacteria | 2808 |
| 11 | JGI25165J46597_1008243 | 3300003214 | Bacteria | 1650 |
| 12 | JGI25153J46596_10001411 | 3300003215 | Bacteria | 14402 |
| 13 | JGI25153J46596_10002253 | 3300003215 | Bacteria | 11236 |
| 14 | Ga0006777J48905_1070856 | 3300003308 | Bacteria | 1351 |
| 15 | JGI25161J50226_1003108 | 3300003374 | Bacteria | 3954 |
| 16 | Ga0055539_1000775 | 3300003752 | Bacteria | 7681 |
| 17 | Ga0055539_1002200 | 3300003752 | Bacteria | 3103 |
| 18 | Ga0055533_1000026 | 3300003756 | Bacteria | 323407 |
| 19 | Ga0055525_1000004 | 3300003759 | Bacteria | 888039 |
| 20 | Ga0055535_1000056 | 3300003761 | Bacteria | 128204 |
| 21 | Ga0055529_1000103 | 3300003763 | Bacteria | 127175 |
| 22 | Ga0055526_1000374 | 3300003771 | Bacteria | 36279 |
| 23 | Ga0055526_1002321 | 3300003771 | Bacteria | 12957 |
| 24 | Ga0055526_1002595 | 3300003771 | Bacteria | 12082 |
| 25 | Ga0055537_1001076 | 3300003773 | Bacteria | 12083 |
| 26 | Ga0055524_1001870 | 3300003775 | Bacteria | 11488 |
| 27 | Ga0055524_1010050 | 3300003775 | Bacteria | 3795 |
| 28 | Ga0055536_1000112 | 3300003781 | Bacteria | 70656 |
| 29 | Ga0055536_1005250 | 3300003781 | Bacteria | 6387 |
| 30 | Ga0055534_1000233 | 3300003784 | Bacteria | 40184 |
| 31 | Ga0055534_1000536 | 3300003784 | Bacteria | 20333 |
| 32 | Ga0055534_1002239 | 3300003784 | Bacteria | 6843 |
| 33 | Ga0055534_1002715 | 3300003784 | Bacteria | 5965 |
| 34 | Ga0055530_10008382 | 3300003791 | Bacteria | 4151 |
| 35 | Ga0055540_1000007 | 3300003792 | Bacteria | 318178 |
| 36 | Ga0055540_1004117 | 3300003792 | Bacteria | 6726 |
| 37 | Ga0055531_10003405 | 3300003794 | Bacteria | 10160 |
| 38 | JGI25405J52794_10005070 | 3300003911 | Bacteria | 2364 |
| 39 | Ga0065165_1000116 | 3300005262 | Bacteria | 134997 |
| 40 | Ga0065165_1001186 | 3300005262 | Bacteria | 30210 |
| 41 | Ga0065704_10156447 | 3300005289 | Bacteria | 1383 |
| 42 | Ga0065712_10000147 | 3300005290 | Bacteria | 47854 |
| 43 | Ga0065715_10000258 | 3300005293 | Bacteria | 18448 |
| 44 | Ga0065715_10119204 | 3300005293 | Bacteria | 2293 |
| 45 | Ga0065707_10082206 | 3300005295 | Bacteria | 19149 |
| 46 | Ga0065707_10217691 | 3300005295 | Bacteria | 1238 |
| 47 | Ga0070658_10014105 | 3300005327 | Bacteria | 6416 |
| 48 | Ga0070658_10210702 | 3300005327 | Bacteria | 1641 |
| 49 | Ga0070676_10005340 | 3300005328 | Bacteria | 6841 |
| 50 | Ga0070676_10009149 | 3300005328 | Bacteria | 5359 |
| 51 | Ga0070676_10047522 | 3300005328 | Bacteria | 2506 |
| 52 | Ga0070683_100109663 | 3300005329 | Bacteria | 2603 |
| 53 | Ga0070690_100118899 | 3300005330 | Bacteria | 1772 |
| 54 | Ga0070670_100003594 | 3300005331 | Bacteria | 12901 |
| 55 | Ga0070670_100018524 | 3300005331 | Bacteria | 5974 |
| 56 | Ga0070670_100022809 | 3300005331 | Bacteria | 5386 |
| 57 | Ga0070670_100083123 | 3300005331 | Bacteria | 2752 |
| 58 | Ga0070670_100107217 | 3300005331 | Bacteria | 2408 |
| 59 | Ga0070670_100254397 | 3300005331 | Bacteria | 1530 |
| 60 | Ga0070677_10004354 | 3300005333 | Bacteria | 4614 |
| 61 | Ga0070677_10011030 | 3300005333 | Bacteria | 3106 |
| 62 | Ga0068869_100006597 | 3300005334 | Bacteria | 7364 |
| 63 | Ga0068869_100008593 | 3300005334 | Bacteria | 6594 |
| 64 | Ga0068869_100033962 | 3300005334 | Bacteria | 3605 |
| 65 | Ga0068869_100048618 | 3300005334 | Bacteria | 3067 |
| 66 | Ga0068869_100055320 | 3300005334 | Bacteria | 2892 |
| 67 | Ga0070666_10029713 | 3300005335 | Bacteria | 3595 |
| 68 | Ga0070680_100010602 | 3300005336 | Bacteria | 7110 |
| 69 | Ga0070682_100016479 | 3300005337 | Bacteria | 4297 |
| 70 | Ga0068868_100003190 | 3300005338 | Bacteria | 11407 |
| 71 | Ga0068868_100005381 | 3300005338 | Bacteria | 8994 |
| 72 | Ga0068868_100034195 | 3300005338 | Bacteria | 3923 |
| 73 | Ga0068868_100060430 | 3300005338 | Bacteria | 3000 |
| 74 | Ga0068868_100140897 | 3300005338 | Bacteria | 1979 |
| 75 | Ga0070660_100007413 | 3300005339 | Bacteria | 7641 |
| 76 | Ga0070660_100020125 | 3300005339 | Bacteria | 4900 |
| 77 | Ga0070660_100039265 | 3300005339 | Bacteria | 3597 |
| 78 | Ga0070660_100151384 | 3300005339 | Bacteria | 1865 |
| 79 | Ga0070689_100307745 | 3300005340 | Bacteria | 1320 |
| 80 | Ga0070691_10012002 | 3300005341 | Bacteria | 3966 |
| 81 | Ga0070687_100044584 | 3300005343 | Bacteria | 2260 |
| 82 | Ga0070661_100000108 | 3300005344 | Bacteria | 68597 |
| 83 | Ga0070668_100019536 | 3300005347 | Bacteria | 5100 |
| 84 | Ga0070668_100118463 | 3300005347 | Bacteria | 2114 |
| 85 | Ga0070669_100006476 | 3300005353 | Bacteria | 8430 |
| 86 | Ga0070669_100009475 | 3300005353 | Bacteria | 6935 |
| 87 | Ga0070675_100000556 | 3300005354 | Bacteria | 25668 |
| 88 | Ga0070675_100005294 | 3300005354 | Bacteria | 9857 |
| 89 | Ga0070675_100009078 | 3300005354 | Bacteria | 7723 |
| 90 | Ga0070675_100071018 | 3300005354 | Bacteria | 2887 |
| 91 | Ga0070671_100006922 | 3300005355 | Bacteria | 9082 |
| 92 | Ga0070671_100034758 | 3300005355 | Bacteria | 4173 |
| 93 | Ga0070671_100066536 | 3300005355 | Bacteria | 3004 |
| 94 | Ga0070674_100033911 | 3300005356 | Bacteria | 3403 |
| 95 | Ga0070673_100001332 | 3300005364 | Bacteria | 14386 |
| 96 | Ga0070673_100032276 | 3300005364 | Bacteria | 3941 |
| 97 | Ga0070673_100141459 | 3300005364 | Bacteria | 2030 |
| 98 | Ga0070673_100167424 | 3300005364 | Bacteria | 1874 |
| 99 | Ga0070673_100258487 | 3300005364 | Bacteria | 1520 |
| 100 | Ga0070659_100001701 | 3300005366 | Bacteria | 15803 |
| 101 | Ga0070667_100009343 | 3300005367 | Bacteria | 8131 |
| 102 | Ga0070667_100014368 | 3300005367 | Bacteria | 6542 |
| 103 | Ga0070667_100061042 | 3300005367 | Bacteria | 3191 |
| 104 | Ga0070667_100084380 | 3300005367 | Bacteria | 2722 |
| 105 | Ga0070701_10099426 | 3300005438 | Bacteria | 1609 |
| 106 | Ga0070711_100000783 | 3300005439 | Bacteria | 16606 |
| 107 | Ga0070705_100002282 | 3300005440 | Bacteria | 9693 |
| 108 | Ga0070705_100162997 | 3300005440 | Bacteria | 1492 |
| 109 | Ga0070694_100003005 | 3300005444 | Bacteria | 10033 |
| 110 | Ga0070694_100108565 | 3300005444 | Bacteria | 1974 |
| 111 | Ga0070708_100018219 | 3300005445 | Bacteria | 5876 |
| 112 | Ga0070663_100029920 | 3300005455 | Bacteria | 3726 |
| 113 | Ga0070663_100087356 | 3300005455 | Bacteria | 2304 |
| 114 | Ga0070678_100005119 | 3300005456 | Bacteria | 7527 |
| 115 | Ga0070678_100062095 | 3300005456 | Bacteria | 2757 |
| 116 | Ga0070678_100347224 | 3300005456 | Bacteria | 1275 |
| 117 | Ga0070662_100049993 | 3300005457 | Bacteria | 3015 |
| 118 | Ga0070681_10018558 | 3300005458 | Bacteria | 6953 |
| 119 | Ga0070681_10110596 | 3300005458 | Bacteria | 2687 |
| 120 | Ga0070681_10442238 | 3300005458 | Bacteria | 1212 |
| 121 | Ga0068867_100000004 | 3300005459 | Bacteria | 180739 |
| 122 | Ga0068867_100005767 | 3300005459 | Bacteria | 8785 |
| 123 | Ga0068867_100011508 | 3300005459 | Bacteria | 6246 |
| 124 | Ga0068867_100026143 | 3300005459 | Bacteria | 4190 |
| 125 | Ga0068867_100176513 | 3300005459 | Bacteria | 1696 |
| 126 | Ga0068867_100203839 | 3300005459 | Bacteria | 1585 |
| 127 | Ga0070706_100089850 | 3300005467 | Bacteria | 2848 |
| 128 | Ga0070707_100011124 | 3300005468 | Bacteria | 8383 |
| 129 | Ga0070699_100009099 | 3300005518 | Bacteria | 8612 |
| 130 | Ga0070699_100057090 | 3300005518 | Bacteria | 3381 |
| 131 | Ga0070699_100082511 | 3300005518 | Bacteria | 2803 |
| 132 | Ga0070679_100004838 | 3300005530 | Bacteria | 12424 |
| 133 | Ga0070684_100226424 | 3300005535 | Bacteria | 1707 |
| 134 | Ga0070697_100001057 | 3300005536 | Bacteria | 20812 |
| 135 | Ga0070697_100003400 | 3300005536 | Bacteria | 12230 |
| 136 | Ga0070697_100056148 | 3300005536 | Bacteria | 3203 |
| 137 | Ga0068853_100057828 | 3300005539 | Bacteria | 3347 |
| 138 | Ga0068853_100086109 | 3300005539 | Bacteria | 2755 |
| 139 | Ga0068853_100105037 | 3300005539 | Bacteria | 2501 |
| 140 | Ga0068853_100235700 | 3300005539 | Bacteria | 1675 |
| 141 | Ga0070672_100005974 | 3300005543 | Bacteria | 8125 |
| 142 | Ga0070672_100006624 | 3300005543 | Bacteria | 7801 |
| 143 | Ga0070672_100039105 | 3300005543 | Bacteria | 3631 |
| 144 | Ga0070672_100052702 | 3300005543 | Bacteria | 3177 |
| 145 | Ga0070672_100193817 | 3300005543 | Bacteria | 1697 |
| 146 | Ga0070686_100021988 | 3300005544 | Bacteria | 3796 |
| 147 | Ga0070695_100004094 | 3300005545 | Bacteria | 8522 |
| 148 | Ga0070695_100021796 | 3300005545 | Bacteria | 3925 |
| 149 | Ga0070695_100023046 | 3300005545 | Bacteria | 3822 |
| 150 | Ga0070696_100004324 | 3300005546 | Bacteria | 9469 |
| 151 | Ga0070693_100062021 | 3300005547 | Bacteria | 2175 |
| 152 | Ga0070665_100055139 | 3300005548 | Bacteria | 3986 |
| 153 | Ga0070665_100210804 | 3300005548 | Bacteria | 1943 |
| 154 | Ga0070665_100385225 | 3300005548 | Bacteria | 1410 |
| 155 | Ga0068855_100001374 | 3300005563 | Bacteria | 30099 |
| 156 | Ga0068855_100006754 | 3300005563 | Bacteria | 13917 |
| 157 | Ga0068855_100017132 | 3300005563 | Bacteria | 8716 |
| 158 | Ga0068855_100039778 | 3300005563 | Bacteria | 5581 |
| 159 | Ga0068855_100158335 | 3300005563 | Bacteria | 2572 |
| 160 | Ga0068855_100162039 | 3300005563 | Bacteria | 2537 |
| 161 | Ga0068855_100200638 | 3300005563 | Bacteria | 2245 |
| 162 | Ga0068855_100344535 | 3300005563 | Bacteria | 1642 |
| 163 | Ga0070664_100004792 | 3300005564 | Bacteria | 10841 |
| 164 | Ga0070664_100019559 | 3300005564 | Bacteria | 5571 |
| 165 | Ga0070664_100023637 | 3300005564 | Bacteria | 5078 |
| 166 | Ga0068857_100188190 | 3300005577 | Bacteria | 1880 |
| 167 | Ga0068854_100029405 | 3300005578 | Bacteria | 3804 |
| 168 | Ga0068854_100082900 | 3300005578 | Bacteria | 2370 |
| 169 | Ga0068856_100002420 | 3300005614 | Bacteria | 19200 |
| 170 | Ga0068856_100278118 | 3300005614 | Bacteria | 1690 |
| 171 | Ga0070702_100052322 | 3300005615 | Bacteria | 2341 |
| 172 | Ga0068852_100033112 | 3300005616 | Bacteria | 4287 |
| 173 | Ga0068852_100070988 | 3300005616 | Bacteria | 3057 |
| 174 | Ga0068852_100104725 | 3300005616 | Bacteria | 2561 |
| 175 | Ga0068852_100105281 | 3300005616 | Bacteria | 2556 |
| 176 | Ga0068852_100118376 | 3300005616 | Bacteria | 2420 |
| 177 | Ga0068852_100127122 | 3300005616 | Bacteria | 2342 |
| 178 | Ga0068859_100003043 | 3300005617 | Bacteria | 17010 |
| 179 | Ga0068859_100009651 | 3300005617 | Bacteria | 9744 |
| 180 | Ga0068859_100053138 | 3300005617 | Bacteria | 4073 |
| 181 | Ga0068864_100003888 | 3300005618 | Bacteria | 12299 |
| 182 | Ga0068864_100021530 | 3300005618 | Bacteria | 5400 |
| 183 | Ga0068864_100027072 | 3300005618 | Bacteria | 4838 |
| 184 | Ga0068866_10003133 | 3300005718 | Bacteria | 6809 |
| 185 | Ga0068866_10015069 | 3300005718 | Bacteria | 3428 |
| 186 | Ga0068861_100004049 | 3300005719 | Bacteria | 9815 |
| 187 | Ga0068861_100011512 | 3300005719 | Bacteria | 6154 |
| 188 | Ga0068870_10010073 | 3300005840 | Bacteria | 4325 |
| 189 | Ga0068870_10010553 | 3300005840 | Bacteria | 4250 |
| 190 | Ga0068870_10016725 | 3300005840 | Bacteria | 3512 |
| 191 | Ga0068863_100004228 | 3300005841 | Bacteria | 14178 |
| 192 | Ga0068863_100009638 | 3300005841 | Bacteria | 9421 |
| 193 | Ga0068863_100016559 | 3300005841 | Bacteria | 7074 |
| 194 | Ga0068863_100223710 | 3300005841 | Bacteria | 1814 |
| 195 | Ga0068863_100357676 | 3300005841 | Bacteria | 1423 |
| 196 | Ga0068858_100000225 | 3300005842 | Bacteria | 61439 |
| 197 | Ga0068858_100004355 | 3300005842 | Bacteria | 13888 |
| 198 | Ga0068858_100025199 | 3300005842 | Bacteria | 5535 |
| 199 | Ga0068858_100027701 | 3300005842 | Bacteria | 5265 |
| 200 | Ga0068858_100029372 | 3300005842 | Bacteria | 5104 |
| 201 | Ga0068858_100328027 | 3300005842 | Bacteria | 1464 |
| 202 | Ga0068860_100006985 | 3300005843 | Bacteria | 11311 |
| 203 | Ga0068860_100035553 | 3300005843 | Bacteria | 4778 |
| 204 | Ga0068860_100047687 | 3300005843 | Bacteria | 4082 |
| 205 | Ga0068860_100124880 | 3300005843 | Bacteria | 2467 |
| 206 | Ga0068860_100494227 | 3300005843 | Bacteria | 1221 |
| 207 | Ga0068862_100002168 | 3300005844 | Bacteria | 17645 |
| 208 | Ga0068862_100007612 | 3300005844 | Bacteria | 8973 |
| 209 | Ga0068862_100193874 | 3300005844 | Bacteria | 1829 |
| 210 | Ga0081539_10001364 | 3300005985 | Bacteria | 42295 |
| 211 | Ga0075365_10117637 | 3300006038 | Bacteria | 1831 |
| 212 | Ga0075364_10070186 | 3300006051 | Bacteria | 2306 |
| 213 | Ga0070715_10051994 | 3300006163 | Bacteria | 1766 |
| 214 | Ga0075367_10003802 | 3300006178 | Bacteria | 7274 |
| 215 | Ga0075367_10057940 | 3300006178 | Bacteria | 2304 |
| 216 | Ga0075367_10085948 | 3300006178 | Bacteria | 1908 |
| 217 | Ga0075367_10089237 | 3300006178 | Bacteria | 1874 |
| 218 | Ga0075366_10005214 | 3300006195 | Bacteria | 7032 |
| 219 | Ga0075366_10008033 | 3300006195 | Bacteria | 5847 |
| 220 | Ga0075366_10012244 | 3300006195 | Bacteria | 4863 |
| 221 | Ga0075366_10043163 | 3300006195 | Bacteria | 2671 |
| 222 | Ga0075366_10045445 | 3300006195 | Bacteria | 2603 |
| 223 | Ga0075366_10065786 | 3300006195 | Bacteria | 2156 |
| 224 | Ga0075366_10113846 | 3300006195 | Bacteria | 1628 |
| 225 | Ga0097621_100001554 | 3300006237 | Bacteria | 15677 |
| 226 | Ga0097621_100019015 | 3300006237 | Bacteria | 5264 |
| 227 | Ga0097621_100026728 | 3300006237 | Bacteria | 4531 |
| 228 | Ga0075370_10001068 | 3300006353 | Bacteria | 11409 |
| 229 | Ga0075370_10001217 | 3300006353 | Bacteria | 10880 |
| 230 | Ga0075370_10002202 | 3300006353 | Bacteria | 8952 |
| 231 | Ga0075370_10002762 | 3300006353 | Bacteria | 8220 |
| 232 | Ga0075370_10004362 | 3300006353 | Bacteria | 6858 |
| 233 | Ga0075370_10005946 | 3300006353 | Bacteria | 6107 |
| 234 | Ga0075370_10011497 | 3300006353 | Bacteria | 4654 |
| 235 | Ga0075370_10017865 | 3300006353 | Bacteria | 3837 |
| 236 | Ga0075370_10040010 | 3300006353 | Bacteria | 2643 |
| 237 | Ga0075370_10050205 | 3300006353 | Bacteria | 2366 |
| 238 | Ga0075370_10060228 | 3300006353 | Bacteria | 2162 |
| 239 | Ga0075370_10074305 | 3300006353 | Bacteria | 1948 |
| 240 | Ga0068871_100006024 | 3300006358 | Bacteria | 8533 |
| 241 | Ga0068871_100043531 | 3300006358 | Bacteria | 3606 |
| 242 | Ga0068871_100142943 | 3300006358 | Bacteria | 2036 |
| 243 | Ga0068871_100161849 | 3300006358 | Bacteria | 1915 |
| 244 | Ga0075428_100189717 | 3300006844 | Bacteria | 2223 |
| 245 | Ga0075430_100082419 | 3300006846 | Bacteria | 2696 |
| 246 | Ga0075431_100031935 | 3300006847 | Bacteria | 5425 |
| 247 | Ga0075433_10004322 | 3300006852 | Bacteria | 11036 |
| 248 | Ga0075434_100000696 | 3300006871 | Bacteria | 26264 |
| 249 | Ga0075434_100002860 | 3300006871 | Bacteria | 15312 |
| 250 | Ga0075434_100018694 | 3300006871 | Bacteria | 6696 |
| 251 | Ga0075434_100039756 | 3300006871 | Bacteria | 4659 |
| 252 | Ga0075434_100411784 | 3300006871 | Bacteria | 1373 |
| 253 | Ga0075429_100000871 | 3300006880 | Bacteria | 23800 |
| 254 | Ga0075429_100028408 | 3300006880 | Bacteria | 4857 |
| 255 | Ga0068865_100001798 | 3300006881 | Bacteria | 12586 |
| 256 | Ga0068865_100055026 | 3300006881 | Bacteria | 2767 |
| 257 | Ga0075436_100007333 | 3300006914 | Bacteria | 7537 |
| 258 | Ga0075436_100276564 | 3300006914 | Bacteria | 1200 |
| 259 | Ga0097620_100003043 | 3300006931 | Bacteria | 17010 |
| 260 | Ga0097620_100009651 | 3300006931 | Bacteria | 9744 |
| 261 | Ga0097620_100053135 | 3300006931 | Bacteria | 4073 |
| 262 | Ga0097620_100252801 | 3300006931 | Bacteria | 1853 |
| 263 | Ga0099823_1000232 | 3300006944 | Bacteria | 31969 |
| 264 | Ga0079104_1000009 | 3300006946 | Bacteria | 367015 |
| 265 | Ga0099826_10002824 | 3300006948 | Bacteria | 11449 |
| 266 | Ga0075435_100006841 | 3300007076 | Bacteria | 8091 |
| 267 | Ga0105240_10005995 | 3300009093 | Bacteria | 17972 |
| 268 | Ga0105240_10016496 | 3300009093 | Bacteria | 9998 |
| 269 | Ga0105240_10064424 | 3300009093 | Bacteria | 4554 |
| 270 | Ga0111539_10410510 | 3300009094 | Bacteria | 1577 |
| 271 | Ga0111539_10523992 | 3300009094 | Bacteria | 1381 |
| 272 | Ga0105245_10159428 | 3300009098 | Bacteria | 2140 |
| 273 | Ga0105245_10438964 | 3300009098 | Bacteria | 1312 |
| 274 | Ga0114129_10015710 | 3300009147 | Bacteria | 10764 |
| 275 | Ga0114129_10029909 | 3300009147 | Bacteria | 7713 |
| 276 | Ga0114129_10098052 | 3300009147 | Bacteria | 4057 |
| 277 | Ga0114129_10225945 | 3300009147 | Bacteria | 2523 |
| 278 | Ga0105243_10003290 | 3300009148 | Bacteria | 13127 |
| 279 | Ga0105243_10004194 | 3300009148 | Bacteria | 11428 |
| 280 | Ga0105243_10022803 | 3300009148 | Bacteria | 4759 |
| 281 | Ga0105243_10037020 | 3300009148 | Bacteria | 3789 |
| 282 | Ga0105243_10073728 | 3300009148 | Bacteria | 2766 |
| 283 | Ga0105243_10203124 | 3300009148 | Bacteria | 1739 |
| 284 | Ga0105242_10001421 | 3300009176 | Bacteria | 18880 |
| 285 | Ga0105242_10003452 | 3300009176 | Bacteria | 12287 |
| 286 | Ga0105242_10009565 | 3300009176 | Bacteria | 7428 |
| 287 | Ga0105242_10041885 | 3300009176 | Bacteria | 3695 |
| 288 | Ga0105242_10117104 | 3300009176 | Bacteria | 2280 |
| 289 | Ga0105248_10032848 | 3300009177 | Bacteria | 5798 |
| 290 | Ga0105237_10000080 | 3300009545 | Bacteria | 127788 |
| 291 | Ga0105237_10015429 | 3300009545 | Bacteria | 7951 |
| 292 | Ga0105237_10021585 | 3300009545 | Bacteria | 6619 |
| 293 | Ga0105237_10058446 | 3300009545 | Bacteria | 3859 |
| 294 | Ga0105238_10006890 | 3300009551 | Bacteria | 11350 |
| 295 | Ga0105238_10022002 | 3300009551 | Bacteria | 6497 |
| 296 | Ga0105238_10056231 | 3300009551 | Bacteria | 3948 |
| 297 | Ga0105238_10317745 | 3300009551 | Bacteria | 1543 |
| 298 | Ga0105249_10007455 | 3300009553 | Bacteria | 9546 |
| 299 | Ga0105249_10120150 | 3300009553 | Bacteria | 2496 |
| 300 | Ga0105239_10000116 | 3300010375 | Bacteria | 112811 |
| 301 | Ga0105239_10042014 | 3300010375 | Bacteria | 5009 |
| 302 | Ga0105239_10387452 | 3300010375 | Bacteria | 1581 |
| 303 | Ga0105246_10089094 | 3300011119 | Bacteria | 2219 |
| 304 | Ga0157319_1000004 | 3300012497 | Bacteria | 394735 |
| 305 | Ga0157370_10008219 | 3300013104 | Bacteria | 11271 |
| 306 | Ga0157369_10005838 | 3300013105 | Bacteria | 14311 |
| 307 | Ga0157369_10092342 | 3300013105 | Bacteria | 3230 |
| 308 | Ga0157374_10178621 | 3300013296 | Bacteria | 2073 |
| 309 | Ga0157378_10043514 | 3300013297 | Bacteria | 3988 |
| 310 | Ga0163162_10015143 | 3300013306 | Bacteria | 7531 |
| 311 | Ga0163162_10015161 | 3300013306 | Bacteria | 7527 |
| 312 | Ga0163162_10060815 | 3300013306 | Bacteria | 3814 |
| 313 | Ga0163162_10121871 | 3300013306 | Bacteria | 2712 |
| 314 | Ga0163162_10235678 | 3300013306 | Bacteria | 1961 |
| 315 | Ga0157375_10005490 | 3300013308 | Bacteria | 11026 |
| 316 | Ga0157375_10014943 | 3300013308 | Bacteria | 6941 |
| 317 | Ga0157375_10020633 | 3300013308 | Bacteria | 6024 |
| 318 | Ga0157375_10025537 | 3300013308 | Bacteria | 5491 |
| 319 | Ga0163163_10016806 | 3300014325 | Bacteria | 6811 |
| 320 | Ga0157380_10009516 | 3300014326 | Bacteria | 6969 |
| 321 | Ga0182008_10001216 | 3300014497 | Bacteria | 17752 |
| 322 | Ga0182008_10003469 | 3300014497 | Bacteria | 9510 |
| 323 | Ga0157377_10000010 | 3300014745 | Bacteria | 380929 |
| 324 | Ga0157379_10010838 | 3300014968 | Bacteria | 7950 |
| 325 | Ga0157379_10026514 | 3300014968 | Bacteria | 5159 |
| 326 | Ga0157379_10068550 | 3300014968 | Bacteria | 3171 |
| 327 | Ga0157376_10003392 | 3300014969 | Bacteria | 10967 |
| 328 | Ga0157376_10103260 | 3300014969 | Bacteria | 2495 |
| 329 | Ga0182006_1000937 | 3300015261 | Bacteria | 19449 |
| 330 | Ga0182007_10000419 | 3300015262 | Bacteria | 25979 |
| 331 | Ga0182007_10000746 | 3300015262 | Bacteria | 18360 |
| 332 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 333 | Ga0163161_10003954 | 3300017792 | Bacteria | 10398 |
| 334 | Ga0163161_10011407 | 3300017792 | Bacteria | 6162 |
| 335 | Ga0163161_10032549 | 3300017792 | Bacteria | 3723 |
| 336 | Ga0163161_10041709 | 3300017792 | Bacteria | 3298 |
| 337 | Ga0163161_10060862 | 3300017792 | Bacteria | 2749 |
| 338 | Ga0163161_10066164 | 3300017792 | Bacteria | 2638 |
| 339 | Ga0163161_10073247 | 3300017792 | Bacteria | 2510 |
| 340 | Ga0163161_10219409 | 3300017792 | Bacteria | 1472 |
| 341 | Ga0213872_10000233 | 3300021361 | Bacteria | 48866 |
| 342 | Ga0213872_10001634 | 3300021361 | Bacteria | 14191 |
| 343 | Ga0209674_100024 | 3300025226 | Bacteria | 535481 |
| 344 | Ga0209563_100013 | 3300025230 | Bacteria | 941463 |
| 345 | Ga0209563_100069 | 3300025230 | Bacteria | 253154 |
| 346 | Ga0207427_102200 | 3300025231 | Bacteria | 5523 |
| 347 | Ga0209258_100071 | 3300025242 | Bacteria | 278319 |
| 348 | Ga0209258_100783 | 3300025242 | Bacteria | 19264 |
| 349 | Ga0207425_1000196 | 3300025245 | Bacteria | 48364 |
| 350 | Ga0207425_1000663 | 3300025245 | Bacteria | 18873 |
| 351 | Ga0209646_1000012 | 3300025246 | Bacteria | 573300 |
| 352 | Ga0209026_1000004 | 3300025250 | Bacteria | 949012 |
| 353 | Ga0209677_100092 | 3300025253 | Bacteria | 102482 |
| 354 | Ga0209677_101513 | 3300025253 | Bacteria | 9963 |
| 355 | Ga0209148_1010852 | 3300025254 | Bacteria | 1713 |
| 356 | Ga0209759_1000003 | 3300025256 | Bacteria | 792130 |
| 357 | Ga0209759_1001236 | 3300025256 | Bacteria | 15604 |
| 358 | Ga0209759_1009207 | 3300025256 | Bacteria | 3003 |
| 359 | Ga0209129_1000035 | 3300025258 | Bacteria | 329303 |
| 360 | Ga0209129_1000084 | 3300025258 | Bacteria | 182554 |
| 361 | Ga0209129_1001344 | 3300025258 | Bacteria | 13895 |
| 362 | Ga0209233_1000911 | 3300025261 | Bacteria | 12899 |
| 363 | Ga0209565_1000053 | 3300025263 | Bacteria | 210249 |
| 364 | Ga0209565_1000169 | 3300025263 | Bacteria | 84839 |
| 365 | Ga0209455_1000030 | 3300025272 | Bacteria | 533479 |
| 366 | Ga0209673_1000114 | 3300025273 | Bacteria | 178557 |
| 367 | Ga0209673_1002863 | 3300025273 | Bacteria | 10992 |
| 368 | Ga0209673_1016035 | 3300025273 | Bacteria | 2818 |
| 369 | Ga0209673_1042876 | 3300025273 | Bacteria | 1269 |
| 370 | Ga0209130_1000621 | 3300025284 | Bacteria | 33935 |
| 371 | Ga0209130_1001206 | 3300025284 | Bacteria | 18381 |
| 372 | Ga0209675_1000043 | 3300025291 | Bacteria | 235320 |
| 373 | Ga0209675_1000062 | 3300025291 | Bacteria | 178557 |
| 374 | Ga0209675_1000091 | 3300025291 | Bacteria | 146390 |
| 375 | Ga0209675_1001454 | 3300025291 | Bacteria | 13668 |
| 376 | Ga0209675_1002744 | 3300025291 | Bacteria | 8807 |
| 377 | Ga0209675_1005160 | 3300025291 | Bacteria | 5555 |
| 378 | Ga0209676_1000083 | 3300025292 | Bacteria | 279816 |
| 379 | Ga0209676_1000999 | 3300025292 | Bacteria | 33230 |
| 380 | Ga0209676_1001040 | 3300025292 | Bacteria | 32079 |
| 381 | Ga0209025_1000085 | 3300025294 | Bacteria | 263782 |
| 382 | Ga0209025_1000106 | 3300025294 | Bacteria | 222421 |
| 383 | Ga0209025_1000123 | 3300025294 | Bacteria | 204125 |
| 384 | Ga0209025_1000678 | 3300025294 | Bacteria | 58460 |
| 385 | Ga0209025_1000719 | 3300025294 | Bacteria | 56292 |
| 386 | Ga0209025_1000838 | 3300025294 | Bacteria | 48812 |
| 387 | Ga0209025_1000861 | 3300025294 | Bacteria | 47942 |
| 388 | Ga0209025_1005452 | 3300025294 | Bacteria | 10371 |
| 389 | Ga0209025_1016647 | 3300025294 | Bacteria | 4314 |
| 390 | Ga0209564_1000021 | 3300025295 | Bacteria | 571316 |
| 391 | Ga0209564_1000024 | 3300025295 | Bacteria | 535041 |
| 392 | Ga0209564_1000170 | 3300025295 | Bacteria | 156293 |
| 393 | Ga0209564_1001047 | 3300025295 | Bacteria | 33829 |
| 394 | Ga0209564_1001096 | 3300025295 | Bacteria | 32208 |
| 395 | Ga0209564_1002189 | 3300025295 | Bacteria | 16364 |
| 396 | Ga0209758_1000558 | 3300025297 | Bacteria | 58712 |
| 397 | Ga0209758_1000754 | 3300025297 | Bacteria | 46944 |
| 398 | Ga0209758_1001090 | 3300025297 | Bacteria | 35155 |
| 399 | Ga0209050_1000246 | 3300025298 | Bacteria | 116721 |
| 400 | Ga0209050_1000266 | 3300025298 | Bacteria | 111792 |
| 401 | Ga0209050_1002399 | 3300025298 | Bacteria | 16215 |
| 402 | Ga0209050_1002554 | 3300025298 | Bacteria | 15213 |
| 403 | Ga0209050_1006483 | 3300025298 | Bacteria | 6909 |
| 404 | Ga0209256_1000019 | 3300025299 | Bacteria | 558627 |
| 405 | Ga0209256_1000206 | 3300025299 | Bacteria | 111425 |
| 406 | Ga0209256_1000407 | 3300025299 | Bacteria | 68090 |
| 407 | Ga0209256_1000840 | 3300025299 | Bacteria | 38531 |
| 408 | Ga0209256_1001471 | 3300025299 | Bacteria | 24106 |
| 409 | Ga0209256_1005599 | 3300025299 | Bacteria | 7136 |
| 410 | Ga0207426_1000049 | 3300025302 | Bacteria | 401954 |
| 411 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 412 | Ga0209051_1000025 | 3300025303 | Bacteria | 415397 |
| 413 | Ga0209051_1000824 | 3300025303 | Bacteria | 32075 |
| 414 | Ga0209051_1001151 | 3300025303 | Bacteria | 24034 |
| 415 | Ga0209051_1002164 | 3300025303 | Bacteria | 14577 |
| 416 | Ga0209051_1002289 | 3300025303 | Bacteria | 13991 |
| 417 | Ga0209051_1010874 | 3300025303 | Bacteria | 4549 |
| 418 | Ga0209051_1016391 | 3300025303 | Bacteria | 3356 |
| 419 | Ga0209051_1024903 | 3300025303 | Bacteria | 2449 |
| 420 | Ga0209051_1027578 | 3300025303 | Bacteria | 2260 |
| 421 | Ga0209051_1031720 | 3300025303 | Bacteria | 2027 |
| 422 | Ga0209257_1000038 | 3300025304 | Bacteria | 609032 |
| 423 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 424 | Ga0209257_1000044 | 3300025304 | Bacteria | 486709 |
| 425 | Ga0209257_1000047 | 3300025304 | Bacteria | 460507 |
| 426 | Ga0209257_1000977 | 3300025304 | Bacteria | 38863 |
| 427 | Ga0209257_1002054 | 3300025304 | Bacteria | 21333 |
| 428 | Ga0209257_1004064 | 3300025304 | Bacteria | 11744 |
| 429 | Ga0209257_1006483 | 3300025304 | Bacteria | 7504 |
| 430 | Ga0209257_1025419 | 3300025304 | Bacteria | 2024 |
| 431 | Ga0207697_10009126 | 3300025315 | Bacteria | 4298 |
| 432 | Ga0207697_10020450 | 3300025315 | Bacteria | 2710 |
| 433 | Ga0207656_10025409 | 3300025321 | Bacteria | 2404 |
| 434 | Ga0207655_1001268 | 3300025728 | Bacteria | 24088 |
| 435 | Ga0207682_10014751 | 3300025893 | Bacteria | 3044 |
| 436 | Ga0207642_10073256 | 3300025899 | Bacteria | 1637 |
| 437 | Ga0207688_10019501 | 3300025901 | Bacteria | 3697 |
| 438 | Ga0207688_10189794 | 3300025901 | Bacteria | 1228 |
| 439 | Ga0207680_10006999 | 3300025903 | Bacteria | 5474 |
| 440 | Ga0207680_10056253 | 3300025903 | Bacteria | 2375 |
| 441 | Ga0207645_10014439 | 3300025907 | Bacteria | 5284 |
| 442 | Ga0207645_10021447 | 3300025907 | Bacteria | 4212 |
| 443 | Ga0207645_10024587 | 3300025907 | Bacteria | 3903 |
| 444 | Ga0207645_10028782 | 3300025907 | Bacteria | 3584 |
| 445 | Ga0207643_10021976 | 3300025908 | Bacteria | 3510 |
| 446 | Ga0207643_10082181 | 3300025908 | Bacteria | 1867 |
| 447 | Ga0207705_10213004 | 3300025909 | Bacteria | 1466 |
| 448 | Ga0207684_10086816 | 3300025910 | Bacteria | 2665 |
| 449 | Ga0207684_10196895 | 3300025910 | Bacteria | 1738 |
| 450 | Ga0207707_10009980 | 3300025912 | Bacteria | 8236 |
| 451 | Ga0207707_10014795 | 3300025912 | Bacteria | 6797 |
| 452 | Ga0207695_10005726 | 3300025913 | Bacteria | 16375 |
| 453 | Ga0207695_10006409 | 3300025913 | Bacteria | 15283 |
| 454 | Ga0207695_10144042 | 3300025913 | Bacteria | 2329 |
| 455 | Ga0207695_10195014 | 3300025913 | Bacteria | 1941 |
| 456 | Ga0207695_10323552 | 3300025913 | Bacteria | 1431 |
| 457 | Ga0207671_10002929 | 3300025914 | Bacteria | 17590 |
| 458 | Ga0207671_10101565 | 3300025914 | Bacteria | 2179 |
| 459 | Ga0207663_10000232 | 3300025916 | Bacteria | 24669 |
| 460 | Ga0207660_10047655 | 3300025917 | Bacteria | 3031 |
| 461 | Ga0207662_10055077 | 3300025918 | Bacteria | 2373 |
| 462 | Ga0207657_10006920 | 3300025919 | Bacteria | 11694 |
| 463 | Ga0207657_10011865 | 3300025919 | Bacteria | 8625 |
| 464 | Ga0207657_10034399 | 3300025919 | Bacteria | 4557 |
| 465 | Ga0207657_10088986 | 3300025919 | Bacteria | 2580 |
| 466 | Ga0207649_10000762 | 3300025920 | Bacteria | 20967 |
| 467 | Ga0207652_10048231 | 3300025921 | Bacteria | 3640 |
| 468 | Ga0207652_10308097 | 3300025921 | Bacteria | 1429 |
| 469 | Ga0207646_10004382 | 3300025922 | Bacteria | 15365 |
| 470 | Ga0207681_10000326 | 3300025923 | Bacteria | 34311 |
| 471 | Ga0207681_10005493 | 3300025923 | Bacteria | 7785 |
| 472 | Ga0207681_10031598 | 3300025923 | Bacteria | 3459 |
| 473 | Ga0207694_10198339 | 3300025924 | Bacteria | 1632 |
| 474 | Ga0207650_10000951 | 3300025925 | Bacteria | 21783 |
| 475 | Ga0207650_10004536 | 3300025925 | Bacteria | 9496 |
| 476 | Ga0207650_10009583 | 3300025925 | Bacteria | 6623 |
| 477 | Ga0207659_10001095 | 3300025926 | Bacteria | 16049 |
| 478 | Ga0207659_10011221 | 3300025926 | Bacteria | 5655 |
| 479 | Ga0207659_10023552 | 3300025926 | Bacteria | 4111 |
| 480 | Ga0207659_10039343 | 3300025926 | Bacteria | 3298 |
| 481 | Ga0207659_10310467 | 3300025926 | Bacteria | 1298 |
| 482 | Ga0207687_10005793 | 3300025927 | Bacteria | 8177 |
| 483 | Ga0207687_10007222 | 3300025927 | Bacteria | 7327 |
| 484 | Ga0207664_10090705 | 3300025929 | Bacteria | 2505 |
| 485 | Ga0207644_10004898 | 3300025931 | Bacteria | 8726 |
| 486 | Ga0207644_10142764 | 3300025931 | Bacteria | 1845 |
| 487 | Ga0207690_10002897 | 3300025932 | Bacteria | 10338 |
| 488 | Ga0207706_10008488 | 3300025933 | Bacteria | 9477 |
| 489 | Ga0207706_10172398 | 3300025933 | Bacteria | 1901 |
| 490 | Ga0207686_10011506 | 3300025934 | Bacteria | 4848 |
| 491 | Ga0207686_10047576 | 3300025934 | Bacteria | 2652 |
| 492 | Ga0207709_10000572 | 3300025935 | Bacteria | 31041 |
| 493 | Ga0207709_10000990 | 3300025935 | Bacteria | 21162 |
| 494 | Ga0207709_10001477 | 3300025935 | Bacteria | 16306 |
| 495 | Ga0207709_10017384 | 3300025935 | Bacteria | 4014 |
| 496 | Ga0207670_10087409 | 3300025936 | Bacteria | 2196 |
| 497 | Ga0207669_10030025 | 3300025937 | Bacteria | 3015 |
| 498 | Ga0207669_10144802 | 3300025937 | Bacteria | 1655 |
| 499 | Ga0207704_10017787 | 3300025938 | Bacteria | 3695 |
| 500 | Ga0207704_10027677 | 3300025938 | Bacteria | 3132 |
| 501 | Ga0207704_10056114 | 3300025938 | Bacteria | 2411 |
| 502 | Ga0207665_10118568 | 3300025939 | Bacteria | 1867 |
| 503 | Ga0207665_10218601 | 3300025939 | Bacteria | 1395 |
| 504 | Ga0207691_10008199 | 3300025940 | Bacteria | 10034 |
| 505 | Ga0207691_10012361 | 3300025940 | Bacteria | 8181 |
| 506 | Ga0207691_10048304 | 3300025940 | Bacteria | 3902 |
| 507 | Ga0207691_10066154 | 3300025940 | Bacteria | 3271 |
| 508 | Ga0207691_10075662 | 3300025940 | Bacteria | 3035 |
| 509 | Ga0207691_10101754 | 3300025940 | Bacteria | 2563 |
| 510 | Ga0207691_10172186 | 3300025940 | Bacteria | 1895 |
| 511 | Ga0207711_10001731 | 3300025941 | Bacteria | 20035 |
| 512 | Ga0207711_10014562 | 3300025941 | Bacteria | 6538 |
| 513 | Ga0207689_10001900 | 3300025942 | Bacteria | 19736 |
| 514 | Ga0207689_10004982 | 3300025942 | Bacteria | 11962 |
| 515 | Ga0207689_10030568 | 3300025942 | Bacteria | 4489 |
| 516 | Ga0207689_10039915 | 3300025942 | Bacteria | 3885 |
| 517 | Ga0207689_10065318 | 3300025942 | Bacteria | 2993 |
| 518 | Ga0207689_10097291 | 3300025942 | Bacteria | 2417 |
| 519 | Ga0207689_10128154 | 3300025942 | Bacteria | 2087 |
| 520 | Ga0207661_10032337 | 3300025944 | Bacteria | 4051 |
| 521 | Ga0207661_10134466 | 3300025944 | Bacteria | 2122 |
| 522 | Ga0207679_10000202 | 3300025945 | Bacteria | 47795 |
| 523 | Ga0207679_10002133 | 3300025945 | Bacteria | 12247 |
| 524 | Ga0207679_10020265 | 3300025945 | Bacteria | 4485 |
| 525 | Ga0207679_10044244 | 3300025945 | Bacteria | 3212 |
| 526 | Ga0207667_10020318 | 3300025949 | Bacteria | 7391 |
| 527 | Ga0207667_10028778 | 3300025949 | Bacteria | 6032 |
| 528 | Ga0207667_10055940 | 3300025949 | Bacteria | 4146 |
| 529 | Ga0207667_10153265 | 3300025949 | Bacteria | 2371 |
| 530 | Ga0207667_10304230 | 3300025949 | Bacteria | 1629 |
| 531 | Ga0207651_10002842 | 3300025960 | Bacteria | 8337 |
| 532 | Ga0207651_10024120 | 3300025960 | Bacteria | 3756 |
| 533 | Ga0207651_10080595 | 3300025960 | Bacteria | 2343 |
| 534 | Ga0207651_10087435 | 3300025960 | Bacteria | 2269 |
| 535 | Ga0207712_10014116 | 3300025961 | Bacteria | 5127 |
| 536 | Ga0207712_10040571 | 3300025961 | Bacteria | 3196 |
| 537 | Ga0207668_10011209 | 3300025972 | Bacteria | 5441 |
| 538 | Ga0207640_10033626 | 3300025981 | Bacteria | 3192 |
| 539 | Ga0207640_10176446 | 3300025981 | Bacteria | 1598 |
| 540 | Ga0207658_10001421 | 3300025986 | Bacteria | 18669 |
| 541 | Ga0207658_10002120 | 3300025986 | Bacteria | 14748 |
| 542 | Ga0207658_10004188 | 3300025986 | Bacteria | 10050 |
| 543 | Ga0207658_10034602 | 3300025986 | Bacteria | 3612 |
| 544 | Ga0207658_10096094 | 3300025986 | Bacteria | 2310 |
| 545 | Ga0207658_10193858 | 3300025986 | Bacteria | 1691 |
| 546 | Ga0207658_10266527 | 3300025986 | Bacteria | 1462 |
| 547 | Ga0207677_10002797 | 3300026023 | Bacteria | 9209 |
| 548 | Ga0207677_10009333 | 3300026023 | Bacteria | 5519 |
| 549 | Ga0207677_10010579 | 3300026023 | Bacteria | 5226 |
| 550 | Ga0207677_10025366 | 3300026023 | Bacteria | 3698 |
| 551 | Ga0207677_10025732 | 3300026023 | Bacteria | 3676 |
| 552 | Ga0207677_10048246 | 3300026023 | Bacteria | 2866 |
| 553 | Ga0207703_10001042 | 3300026035 | Bacteria | 26535 |
| 554 | Ga0207703_10003821 | 3300026035 | Bacteria | 12516 |
| 555 | Ga0207703_10013562 | 3300026035 | Bacteria | 6349 |
| 556 | Ga0207703_10049514 | 3300026035 | Bacteria | 3397 |
| 557 | Ga0207703_10195540 | 3300026035 | Bacteria | 1794 |
| 558 | Ga0207639_10012399 | 3300026041 | Bacteria | 5936 |
| 559 | Ga0207639_10019359 | 3300026041 | Bacteria | 4854 |
| 560 | Ga0207639_10180012 | 3300026041 | Bacteria | 1797 |
| 561 | Ga0207678_10093239 | 3300026067 | Bacteria | 2573 |
| 562 | Ga0207708_10005765 | 3300026075 | Bacteria | 9153 |
| 563 | Ga0207702_10000253 | 3300026078 | Bacteria | 62073 |
| 564 | Ga0207702_10273752 | 3300026078 | Bacteria | 1593 |
| 565 | Ga0207641_10002703 | 3300026088 | Bacteria | 16185 |
| 566 | Ga0207641_10005975 | 3300026088 | Bacteria | 10314 |
| 567 | Ga0207641_10041164 | 3300026088 | Bacteria | 3871 |
| 568 | Ga0207641_10110586 | 3300026088 | Bacteria | 2435 |
| 569 | Ga0207641_10427420 | 3300026088 | Bacteria | 1276 |
| 570 | Ga0207648_10000002 | 3300026089 | Bacteria | 307909 |
| 571 | Ga0207648_10000425 | 3300026089 | Bacteria | 46432 |
| 572 | Ga0207648_10008268 | 3300026089 | Bacteria | 10104 |
| 573 | Ga0207648_10011180 | 3300026089 | Bacteria | 8464 |
| 574 | Ga0207648_10016034 | 3300026089 | Bacteria | 6865 |
| 575 | Ga0207648_10016341 | 3300026089 | Bacteria | 6784 |
| 576 | Ga0207648_10055148 | 3300026089 | Bacteria | 3470 |
| 577 | Ga0207648_10213997 | 3300026089 | Bacteria | 1711 |
| 578 | Ga0207676_10005558 | 3300026095 | Bacteria | 8919 |
| 579 | Ga0207676_10008075 | 3300026095 | Bacteria | 7481 |
| 580 | Ga0207676_10028014 | 3300026095 | Bacteria | 4203 |
| 581 | Ga0207676_10258309 | 3300026095 | Bacteria | 1571 |
| 582 | Ga0207676_10396978 | 3300026095 | Bacteria | 1288 |
| 583 | Ga0207674_10019326 | 3300026116 | Bacteria | 7381 |
| 584 | Ga0207674_10019462 | 3300026116 | Bacteria | 7351 |
| 585 | Ga0207674_10298072 | 3300026116 | Bacteria | 1561 |
| 586 | Ga0207675_100002569 | 3300026118 | Bacteria | 17980 |
| 587 | Ga0207675_100005687 | 3300026118 | Bacteria | 11928 |
| 588 | Ga0207675_100014494 | 3300026118 | Bacteria | 7348 |
| 589 | Ga0207675_100057826 | 3300026118 | Bacteria | 3618 |
| 590 | Ga0207675_100403279 | 3300026118 | Bacteria | 1348 |
| 591 | Ga0207683_10003665 | 3300026121 | Bacteria | 13353 |
| 592 | Ga0207683_10006649 | 3300026121 | Bacteria | 9889 |
| 593 | Ga0207683_10029871 | 3300026121 | Bacteria | 4720 |
| 594 | Ga0207683_10044133 | 3300026121 | Bacteria | 3897 |
| 595 | Ga0207683_10063910 | 3300026121 | Bacteria | 3243 |
| 596 | Ga0207683_10361117 | 3300026121 | Bacteria | 1334 |
| 597 | Ga0207698_10032405 | 3300026142 | Bacteria | 3786 |
| 598 | Ga0207698_10044206 | 3300026142 | Bacteria | 3345 |
| 599 | Ga0207698_10149145 | 3300026142 | Bacteria | 2027 |
| 600 | Ga0207698_10152220 | 3300026142 | Bacteria | 2009 |
| 601 | Ga0207698_10187329 | 3300026142 | Bacteria | 1839 |
| 602 | Ga0209281_1000023 | 3300027111 | Bacteria | 519955 |
| 603 | Ga0209389_1002721 | 3300027296 | Bacteria | 13755 |
| 604 | Ga0209371_1008958 | 3300027312 | Bacteria | 3244 |
| 605 | Ga0209967_1000664 | 3300027364 | Bacteria | 4437 |
| 606 | Ga0209981_1000848 | 3300027378 | Bacteria | 3865 |
| 607 | Ga0210000_1006962 | 3300027462 | Bacteria | 1651 |
| 608 | Ga0209995_1005716 | 3300027471 | Bacteria | 1998 |
| 609 | Ga0209999_1002399 | 3300027543 | Bacteria | 3306 |
| 610 | Ga0209999_1004662 | 3300027543 | Bacteria | 2459 |
| 611 | Ga0209282_1001278 | 3300027666 | Bacteria | 13653 |
| 612 | Ga0209971_1005275 | 3300027682 | Bacteria | 3073 |
| 613 | Ga0209971_1008605 | 3300027682 | Bacteria | 2422 |
| 614 | Ga0209971_1019777 | 3300027682 | Bacteria | 1599 |
| 615 | Ga0209998_10024070 | 3300027717 | Bacteria | 1320 |
| 616 | Ga0209974_10002823 | 3300027876 | Bacteria | 6307 |
| 617 | Ga0207428_10055920 | 3300027907 | Bacteria | 3136 |
| 618 | Ga0207428_10200700 | 3300027907 | Bacteria | 1501 |
| 619 | Ga0207428_10223004 | 3300027907 | Bacteria | 1412 |
| 620 | Ga0268266_10032642 | 3300028379 | Bacteria | 4423 |
| 621 | Ga0268265_10002921 | 3300028380 | Bacteria | 12529 |
| 622 | Ga0268265_10004392 | 3300028380 | Bacteria | 9799 |
| 623 | Ga0268265_10039100 | 3300028380 | Bacteria | 3494 |
| 624 | Ga0268265_10057721 | 3300028380 | Bacteria | 2960 |
| 625 | Ga0268264_10001548 | 3300028381 | Bacteria | 21322 |
| 626 | Ga0268264_10014496 | 3300028381 | Bacteria | 6477 |
| 627 | Ga0268264_10442788 | 3300028381 | Bacteria | 1257 |
| 628 | Ga0268264_10468119 | 3300028381 | Bacteria | 1224 |
| 629 | Ga0265336_10000156 | 3300028666 | Bacteria | 48623 |
| 630 | Ga0307517_10001027 | 3300028786 | Bacteria | 47444 |
| 631 | Ga0307515_10000013 | 3300028794 | Bacteria | 568456 |
| 632 | Ga0307515_10000278 | 3300028794 | Bacteria | 125493 |
| 633 | Ga0307515_10000291 | 3300028794 | Bacteria | 123206 |
| 634 | Ga0307515_10002735 | 3300028794 | Bacteria | 37724 |
| 635 | Ga0307515_10004327 | 3300028794 | Bacteria | 29456 |
| 636 | Ga0307515_10009775 | 3300028794 | Bacteria | 18483 |
| 637 | Ga0307515_10029645 | 3300028794 | Bacteria | 9236 |
| 638 | Ga0307515_10033526 | 3300028794 | Bacteria | 8446 |
| 639 | Ga0307515_10035888 | 3300028794 | Bacteria | 8046 |
| 640 | Ga0307515_10042814 | 3300028794 | Bacteria | 7067 |
| 641 | Ga0307515_10062847 | 3300028794 | Bacteria | 5233 |
| 642 | Ga0265324_10000528 | 3300029957 | Bacteria | 26184 |
| 643 | Ga0268256_1010289 | 3300030500 | Bacteria | 3042 |
| 644 | Ga0307512_10025372 | 3300030522 | Bacteria | 5253 |
| 645 | Ga0307512_10036833 | 3300030522 | Bacteria | 4142 |
| 646 | Ga0316179_1065978 | 3300030734 | Bacteria | 1745 |
| 647 | Ga0316180_1114655 | 3300030736 | Bacteria | 3009 |
| 648 | Ga0316182_1157939 | 3300030745 | Bacteria | 3205 |
| 649 | Ga0316182_1185814 | 3300030745 | Bacteria | 2085 |
| 650 | Ga0265332_10000023 | 3300031238 | Bacteria | 211994 |
| 651 | Ga0265332_10000046 | 3300031238 | Bacteria | 113777 |
| 652 | Ga0265340_10005958 | 3300031247 | Bacteria | 6735 |
| 653 | Ga0265339_10089759 | 3300031249 | Bacteria | 1613 |
| 654 | Ga0265331_10007166 | 3300031250 | Bacteria | 6484 |
| 655 | Ga0265327_10000035 | 3300031251 | Bacteria | 314419 |
| 656 | Ga0265327_10000804 | 3300031251 | Bacteria | 47927 |
| 657 | Ga0265327_10001807 | 3300031251 | Bacteria | 25067 |
| 658 | Ga0265327_10078750 | 3300031251 | Bacteria | 1632 |
| 659 | Ga0307513_10292868 | 3300031456 | Bacteria | 1398 |
| 660 | Ga0307509_10000993 | 3300031507 | Bacteria | 48743 |
| 661 | Ga0307509_10012095 | 3300031507 | Bacteria | 10355 |
| 662 | Ga0307509_10052048 | 3300031507 | Bacteria | 4373 |
| 663 | Ga0307509_10113528 | 3300031507 | Bacteria | 2706 |
| 664 | Ga0307408_100000029 | 3300031548 | Bacteria | 227806 |
| 665 | Ga0307408_100013966 | 3300031548 | Bacteria | 5334 |
| 666 | Ga0307408_100150299 | 3300031548 | Bacteria | 1838 |
| 667 | Ga0307508_10000050 | 3300031616 | Bacteria | 135222 |
| 668 | Ga0307508_10016037 | 3300031616 | Bacteria | 6824 |
| 669 | Ga0307508_10041729 | 3300031616 | Bacteria | 4116 |
| 670 | Ga0307514_10011020 | 3300031649 | Bacteria | 7542 |
| 671 | Ga0307514_10124033 | 3300031649 | Bacteria | 1794 |
| 672 | Ga0265314_10000130 | 3300031711 | Bacteria | 113776 |
| 673 | Ga0265314_10002601 | 3300031711 | Bacteria | 18259 |
| 674 | Ga0316576_10158950 | 3300031727 | Bacteria | 1704 |
| 675 | Ga0316578_10049280 | 3300031728 | Bacteria | 2461 |
| 676 | Ga0307516_10000610 | 3300031730 | Bacteria | 48458 |
| 677 | Ga0307516_10000879 | 3300031730 | Bacteria | 41327 |
| 678 | Ga0307516_10009704 | 3300031730 | Bacteria | 10688 |
| 679 | Ga0307516_10018396 | 3300031730 | Bacteria | 7260 |
| 680 | Ga0307516_10044798 | 3300031730 | Bacteria | 4374 |
| 681 | Ga0307516_10087710 | 3300031730 | Bacteria | 2945 |
| 682 | Ga0307516_10094213 | 3300031730 | Bacteria | 2819 |
| 683 | Ga0307516_10200092 | 3300031730 | Bacteria | 1718 |
| 684 | Ga0307405_10000330 | 3300031731 | Bacteria | 17558 |
| 685 | Ga0316577_10000781 | 3300031733 | Bacteria | 13711 |
| 686 | Ga0307413_10078925 | 3300031824 | Bacteria | 2102 |
| 687 | Ga0307410_10118254 | 3300031852 | Bacteria | 1928 |
| 688 | Ga0307410_10148171 | 3300031852 | Bacteria | 1744 |
| 689 | Ga0307406_10010474 | 3300031901 | Bacteria | 5231 |
| 690 | Ga0307406_10036537 | 3300031901 | Bacteria | 3027 |
| 691 | Ga0307412_10002581 | 3300031911 | Bacteria | 10065 |
| 692 | Ga0307412_10347045 | 3300031911 | Bacteria | 1190 |
| 693 | Ga0307416_100048307 | 3300032002 | Bacteria | 3375 |
| 694 | Ga0307416_100182830 | 3300032002 | Bacteria | 1967 |
| 695 | Ga0307416_100303875 | 3300032002 | Bacteria | 1587 |
| 696 | Ga0307414_10081814 | 3300032004 | Bacteria | 2366 |
| 697 | Ga0307411_10012343 | 3300032005 | Bacteria | 4658 |
| 698 | Ga0307411_10053269 | 3300032005 | Bacteria | 2650 |
| 699 | Ga0307411_10060001 | 3300032005 | Bacteria | 2524 |
| 700 | Ga0307411_10116582 | 3300032005 | Bacteria | 1923 |
| 701 | Ga0307411_10122687 | 3300032005 | Bacteria | 1883 |
| 702 | Ga0316585_10001297 | 3300032137 | Bacteria | 6554 |
| 703 | Ga0307507_10211099 | 3300033179 | Bacteria | 1323 |
| 704 | Ga0307510_10000129 | 3300033180 | Bacteria | 60839 |
| 705 | Ga0307510_10088323 | 3300033180 | Bacteria | 2959 |
| 706 | Ga0373938_0009067 | 3300034957 | Bacteria | 1792 |
| 707 | Ga0373944_0025403 | 3300035089 | Bacteria | 1743 |
| 708 | Ga0373939_0000114 | 3300035114 | Bacteria | 24291 |
| 709 | Ga0373954_0000065 | 3300035118 | Bacteria | 37154 |
| 710 | Ga0316574_0021473 | 3300035398 | Bacteria | 3834 |
| 711 | Ga0373931_0001114 | 3300035691 | Bacteria | 11409 |
| 712 | Ga0373931_0004773 | 3300035691 | Bacteria | 6217 |
| 713 | Ga0373931_0008979 | 3300035691 | Bacteria | 4766 |
| 714 | Ga0373931_0033420 | 3300035691 | Bacteria | 2665 |
| 715 | Ga0373931_0050825 | 3300035691 | Bacteria | 2206 |
| 716 | Ga0373935_0003962 | 3300035692 | Bacteria | 8645 |
| 717 | Ga0373927_0011088 | 3300035695 | Bacteria | 6003 |
| 718 | Ga0373927_0028309 | 3300035695 | Bacteria | 3655 |
| 719 | Ga0373937_0000149 | 3300036401 | Bacteria | 67267 |
| 720 | Ga0373937_0013228 | 3300036401 | Bacteria | 7268 |
| 721 | Ga0373937_0013501 | 3300036401 | Bacteria | 7195 |
| 722 | Ga0373937_0060748 | 3300036401 | Bacteria | 3473 |
| 723 | Ga0373937_0435103 | 3300036401 | Bacteria | 1245 |
| 724 | Ga0316582_0009408 | 3300036647 | Bacteria | 5306 |
| 725 | Ga0316584_0041943 | 3300036712 | Bacteria | 3412 |
| 726 | Ga0316584_0042026 | 3300036712 | Bacteria | 3408 |
| 727 | Ga0373925_0004762 | 3300037068 | Bacteria | 10221 |
| 728 | Ga0373925_0006143 | 3300037068 | Bacteria | 8871 |
| 729 | Ga0373925_0018650 | 3300037068 | Bacteria | 5044 |
| 730 | Ga0373925_0054679 | 3300037068 | Bacteria | 2986 |
| 731 | Ga0395905_0001109 | 3300037471 | Bacteria | 33882 |
| 732 | Ga0395905_0005213 | 3300037471 | Bacteria | 13305 |
| 733 | Ga0395905_0005228 | 3300037471 | Bacteria | 13283 |
| 734 | Ga0395905_0012217 | 3300037471 | Bacteria | 8270 |
| 735 | Ga0395905_0113555 | 3300037471 | Bacteria | 2545 |
| 736 | Ga0395901_0205970 | 3300038443 | Bacteria | 2061 |
| 737 | Ga0400483_026673 | 3300039062 | Bacteria | 10412 |
| 738 | Ga0436361_0273200 | 3300039447 | Bacteria | 12118 |
| 739 | Ga0436361_0391372 | 3300039447 | Bacteria | 7663 |
| 740 | Ga0436361_0504982 | 3300039447 | Bacteria | 102576 |
| 741 | Ga0436361_0941839 | 3300039447 | Bacteria | 174965 |
| 742 | Ga0436361_0958334 | 3300039447 | Bacteria | 4009 |
| 743 | Ga0436361_1013275 | 3300039447 | Bacteria | 10012 |
| 744 | Ga0436361_1167303 | 3300039447 | Bacteria | 20106 |
| 745 | Ga0436361_1187903 | 3300039447 | Bacteria | 10313 |
| 746 | Ga0436363_0328320 | 3300039450 | Bacteria | 1340 |
| 747 | Ga0439436_0016872 | 3300041404 | Bacteria | 2188 |
| 748 | Ga0451800_1314933 | 3300041459 | Bacteria | 2910 |
| 749 | Ga0439443_000181 | 3300042003 | Bacteria | 4606 |
| 750 | Ga0439445_0007246 | 3300042004 | Bacteria | 2570 |
| 751 | Ga0439432_003503 | 3300042006 | Bacteria | 5813 |
| 752 | Ga0439449_0000582 | 3300042007 | Bacteria | 13681 |
| 753 | Ga0439449_0003507 | 3300042007 | Bacteria | 6095 |
| 754 | Ga0450888_001580 | 3300042126 | Bacteria | 2191 |
| 755 | Ga0450898_000630 | 3300042134 | Bacteria | 4231 |
| 756 | Ga0450889_001137 | 3300042144 | Bacteria | 2778 |
| 757 | Ga0439434_0001050 | 3300042435 | Bacteria | 8007 |
| 758 | Ga0439435_0000063 | 3300042436 | Bacteria | 12691 |
| 759 | Ga0439435_0009565 | 3300042436 | Bacteria | 2277 |
| 760 | Ga0439460_0000592 | 3300042461 | Bacteria | 7966 |
| 761 | Ga0439460_0014862 | 3300042461 | Bacteria | 2052 |
| 762 | Ga0450918_000470 | 3300042531 | Bacteria | 8582 |
| 763 | Ga0450918_001277 | 3300042531 | Bacteria | 5105 |
| 764 | Ga0450893_0003122 | 3300042532 | Bacteria | 2600 |
| 765 | Ga0451577_0018358 | 3300042876 | Bacteria | 6445 |
| 766 | Ga0451577_0026109 | 3300042876 | Bacteria | 5291 |
| 767 | Ga0451577_0158978 | 3300042876 | Bacteria | 2034 |
| 768 | Ga0451577_0258952 | 3300042876 | Bacteria | 1575 |
| 769 | Ga0466969_0013133 | 3300044656 | Bacteria | 4363 |
| 770 | Ga0453683_0000171 | 3300044673 | Bacteria | 89761 |
| 771 | Ga0453683_0004241 | 3300044673 | Bacteria | 10235 |
| 772 | Ga0453683_0047194 | 3300044673 | Bacteria | 2700 |
| 773 | Ga0466966_0002762 | 3300044684 | Bacteria | 11531 |
| 774 | Ga0466966_0038911 | 3300044684 | Bacteria | 3063 |
| 775 | Ga0466961_0033795 | 3300044693 | Bacteria | 3285 |
| 776 | Ga0466964_0109901 | 3300044706 | Bacteria | 1228 |
| 777 | Ga0453684_0020279 | 3300044712 | Bacteria | 10042 |
| 778 | Ga0453684_0026597 | 3300044712 | Bacteria | 8344 |
| 779 | Ga0453684_0075128 | 3300044712 | Bacteria | 4249 |
| 780 | Ga0453684_0156564 | 3300044712 | Bacteria | 2700 |
| 781 | Ga0466971_0033203 | 3300044719 | Bacteria | 2312 |
| 782 | Ga0466957_0004692 | 3300044842 | Bacteria | 7645 |
| 783 | Ga0466959_0000147 | 3300045049 | Bacteria | 46013 |
| 784 | Ga0451576_0000435 | 3300045051 | Bacteria | 96004 |
| 785 | Ga0451576_0013663 | 3300045051 | Bacteria | 9071 |
| 786 | Ga0451576_0177309 | 3300045051 | Bacteria | 2225 |
| 787 | Ga0451576_0185792 | 3300045051 | Bacteria | 2170 |
| 788 | Ga0451576_0200269 | 3300045051 | Bacteria | 2086 |
| 789 | Ga0466967_0140966 | 3300045976 | Bacteria | 2245 |
| 790 | Ga0495592_0000421 | 3300046454 | Bacteria | 32129 |
| 791 | Ga0495592_0004067 | 3300046454 | Bacteria | 10636 |
| 792 | Ga0495590_0011692 | 3300046457 | Bacteria | 3278 |
| 793 | Ga0495650_0006869 | 3300046471 | Bacteria | 6998 |
| 794 | Ga0495580_0004160 | 3300046472 | Bacteria | 12166 |
| 795 | Ga0495580_0005957 | 3300046472 | Bacteria | 9998 |
| 796 | Ga0495662_0002439 | 3300046476 | Bacteria | 9352 |
| 797 | Ga0495583_0000018 | 3300046506 | Bacteria | 306541 |
| 798 | Ga0495606_0000870 | 3300046507 | Bacteria | 45205 |
| 799 | Ga0495608_0002951 | 3300046511 | Bacteria | 12159 |
| 800 | Ga0495608_0159986 | 3300046511 | Bacteria | 1432 |
| 801 | Ga0495618_0005161 | 3300046514 | Bacteria | 7983 |
| 802 | Ga0495628_0001501 | 3300046516 | Bacteria | 21386 |
| 803 | Ga0495630_0013699 | 3300046517 | Bacteria | 5895 |
| 804 | Ga0495630_0067400 | 3300046517 | Bacteria | 2691 |
| 805 | Ga0495631_0000253 | 3300046518 | Bacteria | 37177 |
| 806 | Ga0495666_0001113 | 3300046526 | Bacteria | 12871 |
| 807 | Ga0495642_0019344 | 3300046528 | Bacteria | 2669 |
| 808 | Ga0495642_0027259 | 3300046528 | Bacteria | 2273 |
| 809 | Ga0495640_0001888 | 3300046533 | Bacteria | 16684 |
| 810 | Ga0495586_0000899 | 3300046535 | Bacteria | 16977 |
| 811 | Ga0495587_0028894 | 3300046536 | Bacteria | 3369 |
| 812 | Ga0495645_0133091 | 3300046543 | Bacteria | 1741 |
| 813 | Ga0495656_0000093 | 3300046615 | Bacteria | 38558 |
| 814 | Ga0495668_0010217 | 3300046616 | Bacteria | 5700 |
| 815 | Ga0495634_0009473 | 3300046642 | Bacteria | 7182 |
| 816 | Ga0495625_0013462 | 3300046660 | Bacteria | 6574 |
| 817 | Ga0495625_0048746 | 3300046660 | Bacteria | 3048 |
| 818 | Ga0495657_0027599 | 3300046675 | Bacteria | 4004 |
| 819 | Ga0495599_0008055 | 3300046678 | Bacteria | 6396 |
| 820 | Ga0495658_0066636 | 3300046683 | Bacteria | 2080 |
| 821 | Ga0495658_0115437 | 3300046683 | Bacteria | 1618 |
| 822 | Ga0495669_0044076 | 3300046684 | Bacteria | 1986 |
| 823 | Ga0495613_0092977 | 3300046689 | Bacteria | 2183 |
| 824 | Ga0495624_0012670 | 3300046690 | Bacteria | 5759 |
| 825 | Ga0495649_0001395 | 3300046694 | Bacteria | 18238 |
| 826 | Ga0495649_0003876 | 3300046694 | Bacteria | 9896 |
| 827 | Ga0495589_0001942 | 3300046794 | Bacteria | 11710 |
| 828 | Ga0495600_0005182 | 3300046809 | Bacteria | 7835 |
| 829 | Ga0495604_0001777 | 3300047317 | Bacteria | 17568 |
| 830 | Ga0495604_0096671 | 3300047317 | Bacteria | 2179 |
| 831 | Ga0495636_0014121 | 3300047318 | Bacteria | 3175 |
| 832 | Ga0495676_0008226 | 3300047321 | Bacteria | 9567 |
| 833 | Ga0495680_0003539 | 3300047322 | Bacteria | 15309 |
| 834 | Ga0495686_0008016 | 3300047472 | Bacteria | 7830 |
| 835 | Ga0496101_0053427 | 3300048904 | Bacteria | 2915 |
| 836 | Ga0496101_0088063 | 3300048904 | Bacteria | 2305 |
| 837 | Ga0496101_0284153 | 3300048904 | Bacteria | 1294 |
| 838 | Ga0496104_0087476 | 3300048907 | Bacteria | 2976 |
| 839 | Ga0496105_0069379 | 3300048908 | Bacteria | 2913 |
| 840 | Ga0496106_0014315 | 3300048909 | Bacteria | 5861 |
| 841 | Ga0496108_0099831 | 3300048911 | Bacteria | 2475 |
| 842 | Ga0496109_0038844 | 3300048912 | Bacteria | 4306 |
| 843 | Ga0496109_0263446 | 3300048912 | Bacteria | 1624 |
| 844 | Ga0496112_0000331 | 3300048915 | Bacteria | 30608 |
| 845 | Ga0496115_0047347 | 3300048918 | Bacteria | 3438 |
| 846 | Ga0496116_0044569 | 3300048919 | Bacteria | 3012 |
| 847 | Ga0496117_0012516 | 3300048920 | Bacteria | 7468 |
| 848 | Ga0496124_0169162 | 3300048927 | Bacteria | 1695 |
| 849 | Ga0501031_0023508 | 3300049568 | Bacteria | 4017 |
| 850 | Ga0501031_0125388 | 3300049568 | Bacteria | 1677 |
| 851 | Ga0501031_0174242 | 3300049568 | Bacteria | 1405 |
| 852 | Ga0501032_0007889 | 3300049569 | Bacteria | 7753 |
| 853 | Ga0501032_0014778 | 3300049569 | Bacteria | 5525 |
| 854 | Ga0501032_0144102 | 3300049569 | Bacteria | 1568 |
| 855 | Ga0501033_0005063 | 3300049570 | Bacteria | 10494 |
| 856 | Ga0501033_0019086 | 3300049570 | Bacteria | 5184 |
| 857 | Ga0501033_0020417 | 3300049570 | Bacteria | 5003 |
| 858 | Ga0501033_0107758 | 3300049570 | Bacteria | 2029 |
| 859 | Ga0501033_0207659 | 3300049570 | Bacteria | 1397 |
| 860 | Ga0501034_0000056 | 3300049571 | Bacteria | 202540 |
| 861 | Ga0501034_0069615 | 3300049571 | Bacteria | 3529 |
| 862 | Ga0501034_0207246 | 3300049571 | Bacteria | 1916 |
| 863 | Ga0501034_0350933 | 3300049571 | Bacteria | 1403 |
| 864 | Ga0501036_0054326 | 3300049572 | Bacteria | 3392 |
| 865 | Ga0501036_0093216 | 3300049572 | Bacteria | 2544 |
| 866 | Ga0501036_0116897 | 3300049572 | Bacteria | 2252 |
| 867 | Ga0501036_0130092 | 3300049572 | Bacteria | 2125 |
| 868 | Ga0501036_0189737 | 3300049572 | Bacteria | 1729 |
| 869 | Ga0501037_0032922 | 3300049573 | Bacteria | 3830 |
| 870 | Ga0501037_0073157 | 3300049573 | Bacteria | 2492 |
| 871 | Ga0501037_0080116 | 3300049573 | Bacteria | 2370 |
| 872 | Ga0501037_0110091 | 3300049573 | Bacteria | 1984 |
| 873 | Ga0501037_0138111 | 3300049573 | Bacteria | 1745 |
| 874 | Ga0501037_0162159 | 3300049573 | Bacteria | 1593 |
| 875 | Ga0501038_0002910 | 3300049574 | Bacteria | 15960 |
| 876 | Ga0501038_0008449 | 3300049574 | Bacteria | 9471 |
| 877 | Ga0501038_0055820 | 3300049574 | Bacteria | 3392 |
| 878 | Ga0501038_0096755 | 3300049574 | Bacteria | 2463 |
| 879 | Ga0501038_0170626 | 3300049574 | Bacteria | 1761 |
| 880 | Ga0501039_0003889 | 3300049575 | Bacteria | 11211 |
| 881 | Ga0501039_0038682 | 3300049575 | Bacteria | 3683 |
| 882 | Ga0501039_0046331 | 3300049575 | Bacteria | 3359 |
| 883 | Ga0501039_0268752 | 3300049575 | Bacteria | 1340 |
| 884 | Ga0501040_0001180 | 3300049576 | Bacteria | 16629 |
| 885 | Ga0501040_0004683 | 3300049576 | Bacteria | 8875 |
| 886 | Ga0501040_0022079 | 3300049576 | Bacteria | 4257 |
| 887 | Ga0501040_0240116 | 3300049576 | Bacteria | 1291 |
| 888 | Ga0501041_0000037 | 3300049577 | Bacteria | 44326 |
| 889 | Ga0501041_0011861 | 3300049577 | Bacteria | 5159 |
| 890 | Ga0501041_0119966 | 3300049577 | Bacteria | 1634 |
| 891 | Ga0501042_0003967 | 3300049578 | Bacteria | 9367 |
| 892 | Ga0501042_0004460 | 3300049578 | Bacteria | 8925 |
| 893 | Ga0501043_0000071 | 3300049579 | Bacteria | 89105 |
| 894 | Ga0501043_0090945 | 3300049579 | Bacteria | 2399 |
| 895 | Ga0501046_0000034 | 3300049580 | Bacteria | 173742 |
| 896 | Ga0501046_0003675 | 3300049580 | Bacteria | 14058 |
| 897 | Ga0501046_0004629 | 3300049580 | Bacteria | 12429 |
| 898 | Ga0501046_0009080 | 3300049580 | Bacteria | 8619 |
| 899 | Ga0501046_0069261 | 3300049580 | Bacteria | 2745 |
| 900 | Ga0501046_0082278 | 3300049580 | Bacteria | 2486 |
| 901 | Ga0501046_0182490 | 3300049580 | Bacteria | 1568 |
| 902 | Ga0501046_0184314 | 3300049580 | Bacteria | 1559 |
| 903 | Ga0501047_0000042 | 3300049581 | Bacteria | 176603 |
| 904 | Ga0501047_0000087 | 3300049581 | Bacteria | 117516 |
| 905 | Ga0501047_0001227 | 3300049581 | Bacteria | 25448 |
| 906 | Ga0501047_0024956 | 3300049581 | Bacteria | 5741 |
| 907 | Ga0501047_0073348 | 3300049581 | Bacteria | 3295 |
| 908 | Ga0501047_0109307 | 3300049581 | Bacteria | 2648 |
| 909 | Ga0501047_0202667 | 3300049581 | Bacteria | 1844 |
| 910 | Ga0501047_0210179 | 3300049581 | Bacteria | 1804 |
| 911 | Ga0501047_0264629 | 3300049581 | Bacteria | 1566 |
| 912 | Ga0501048_0000019 | 3300049582 | Bacteria | 71064 |
| 913 | Ga0501048_0012896 | 3300049582 | Bacteria | 6208 |
| 914 | Ga0501048_0031097 | 3300049582 | Bacteria | 3862 |
| 915 | Ga0501048_0070841 | 3300049582 | Bacteria | 2461 |
| 916 | Ga0501048_0074530 | 3300049582 | Bacteria | 2394 |
| 917 | Ga0501067_0005627 | 3300049583 | Bacteria | 6958 |
| 918 | Ga0501067_0028447 | 3300049583 | Bacteria | 3097 |
| 919 | Ga0501068_0006477 | 3300049584 | Bacteria | 6456 |
| 920 | Ga0501068_0062549 | 3300049584 | Bacteria | 2263 |
| 921 | Ga0501068_0112392 | 3300049584 | Bacteria | 1694 |
| 922 | Ga0501068_0248448 | 3300049584 | Bacteria | 1133 |
| 923 | Ga0501069_0011227 | 3300049585 | Bacteria | 4751 |
| 924 | Ga0501069_0046669 | 3300049585 | Bacteria | 2403 |
| 925 | Ga0501070_0022567 | 3300049586 | Bacteria | 5271 |
| 926 | Ga0501070_0022604 | 3300049586 | Bacteria | 5265 |
| 927 | Ga0501070_0164994 | 3300049586 | Bacteria | 1825 |
| 928 | Ga0501071_0000765 | 3300049587 | Bacteria | 17066 |
| 929 | Ga0501071_0003144 | 3300049587 | Bacteria | 10261 |
| 930 | Ga0501071_0061475 | 3300049587 | Bacteria | 2720 |
| 931 | Ga0501071_0150287 | 3300049587 | Bacteria | 1737 |
| 932 | Ga0501071_0187260 | 3300049587 | Bacteria | 1552 |
| 933 | Ga0501072_0000314 | 3300049588 | Bacteria | 34441 |
| 934 | Ga0501072_0000757 | 3300049588 | Bacteria | 23565 |
| 935 | Ga0501072_0018429 | 3300049588 | Bacteria | 5375 |
| 936 | Ga0501072_0032308 | 3300049588 | Bacteria | 4099 |
| 937 | Ga0501072_0064143 | 3300049588 | Bacteria | 2897 |
| 938 | Ga0501072_0140006 | 3300049588 | Bacteria | 1929 |
| 939 | Ga0501072_0185094 | 3300049588 | Bacteria | 1661 |
| 940 | Ga0501073_0017602 | 3300049589 | Bacteria | 5175 |
| 941 | Ga0501073_0084575 | 3300049589 | Bacteria | 2207 |
| 942 | Ga0501073_0129165 | 3300049589 | Bacteria | 1751 |
| 943 | Ga0501073_0143711 | 3300049589 | Bacteria | 1653 |
| 944 | Ga0501073_0236669 | 3300049589 | Bacteria | 1261 |
| 945 | Ga0501074_0050270 | 3300049590 | Bacteria | 3009 |
| 946 | Ga0501074_0099929 | 3300049590 | Bacteria | 2076 |
| 947 | Ga0501074_0107740 | 3300049590 | Bacteria | 1995 |
| 948 | Ga0501075_0001817 | 3300049591 | Bacteria | 14067 |
| 949 | Ga0501075_0002514 | 3300049591 | Bacteria | 12227 |
| 950 | Ga0501075_0005925 | 3300049591 | Bacteria | 8360 |
| 951 | Ga0501075_0064610 | 3300049591 | Bacteria | 2760 |
| 952 | Ga0501075_0189266 | 3300049591 | Bacteria | 1570 |
| 953 | Ga0501076_0000285 | 3300049592 | Bacteria | 31507 |
| 954 | Ga0501076_0002261 | 3300049592 | Bacteria | 13176 |
| 955 | Ga0501076_0004951 | 3300049592 | Bacteria | 9538 |
| 956 | Ga0501076_0089029 | 3300049592 | Bacteria | 2481 |
| 957 | Ga0501076_0196643 | 3300049592 | Bacteria | 1646 |
| 958 | Ga0501077_0000210 | 3300049593 | Bacteria | 34104 |
| 959 | Ga0501077_0030845 | 3300049593 | Bacteria | 3412 |
| 960 | Ga0501077_0098789 | 3300049593 | Bacteria | 1850 |
| 961 | Ga0501077_0107972 | 3300049593 | Bacteria | 1763 |
| 962 | Ga0501077_0189880 | 3300049593 | Bacteria | 1305 |
| 963 | Ga0501198_000009 | 3300049649 | Bacteria | 122302 |
| 964 | Ga0501222_000001 | 3300049662 | Bacteria | 307689 |
| 965 | Ga0501223_010748 | 3300049663 | Bacteria | 1840 |
| 966 | Ga0501252_003776 | 3300049682 | Bacteria | 1583 |
| 967 | Ga0501229_000045 | 3300049706 | Bacteria | 12123 |
| 968 | Ga0501079_0000228 | 3300049741 | Bacteria | 33621 |
| 969 | Ga0501079_0005448 | 3300049741 | Bacteria | 9483 |
| 970 | Ga0501079_0005775 | 3300049741 | Bacteria | 9249 |
| 971 | Ga0501079_0013504 | 3300049741 | Bacteria | 6227 |
| 972 | Ga0501079_0039028 | 3300049741 | Bacteria | 3662 |
| 973 | Ga0501079_0042908 | 3300049741 | Bacteria | 3491 |
| 974 | Ga0501080_0001366 | 3300049742 | Bacteria | 20410 |
| 975 | Ga0501080_0016812 | 3300049742 | Bacteria | 6755 |
| 976 | Ga0501080_0020435 | 3300049742 | Bacteria | 6129 |
| 977 | Ga0501080_0055491 | 3300049742 | Bacteria | 3690 |
| 978 | Ga0501080_0086091 | 3300049742 | Bacteria | 2919 |
| 979 | Ga0501080_0135011 | 3300049742 | Bacteria | 2283 |
| 980 | Ga0501080_0147695 | 3300049742 | Bacteria | 2173 |
| 981 | Ga0501080_0394034 | 3300049742 | Bacteria | 1246 |
| 982 | Ga0501081_0000513 | 3300049743 | Bacteria | 21769 |
| 983 | Ga0501081_0000759 | 3300049743 | Bacteria | 18898 |
| 984 | Ga0501083_0010144 | 3300049744 | Bacteria | 6637 |
| 985 | Ga0501083_0026026 | 3300049744 | Bacteria | 4046 |
| 986 | Ga0501083_0034046 | 3300049744 | Bacteria | 3484 |
| 987 | Ga0501083_0091358 | 3300049744 | Bacteria | 2010 |
| 988 | Ga0501035_0026558 | 3300049822 | Bacteria | 5296 |
| 989 | Ga0501035_0089285 | 3300049822 | Bacteria | 2715 |
| 990 | Ga0501035_0089468 | 3300049822 | Bacteria | 2711 |
| 991 | Ga0501035_0224078 | 3300049822 | Bacteria | 1604 |
| 992 | Ga0501044_0018370 | 3300049823 | Bacteria | 7492 |
| 993 | Ga0501044_0109836 | 3300049823 | Bacteria | 2766 |
| 994 | Ga0501045_0000680 | 3300049824 | Bacteria | 21550 |
| 995 | Ga0501045_0001421 | 3300049824 | Bacteria | 15960 |
| 996 | Ga0501045_0003900 | 3300049824 | Bacteria | 10269 |
| 997 | Ga0501045_0015438 | 3300049824 | Bacteria | 5418 |
| 998 | nmdc:mga03683_17689_c1 | 3300050489 | Bacteria | 2702 |
| 999 | nmdc:mga0k408_17882_c1 | 3300050493 | Bacteria | 3952 |
| 1000 | nmdc:mga0k408_19674_c1 | 3300050493 | Bacteria | 3776 |
| 1001 | nmdc:mga0k408_223_c2 | 3300050493 | Bacteria | 25073 |
| 1002 | nmdc:mga0k408_412_c1 | 3300050493 | Bacteria | 23440 |
| 1003 | nmdc:mga0k408_6089_c1 | 3300050493 | Bacteria | 6426 |
| 1004 | nmdc:mga07m45_1175_c1 | 3300050496 | Bacteria | 11788 |
| 1005 | nmdc:mga07m45_183_c1 | 3300050496 | Bacteria | 24910 |
| 1006 | nmdc:mga07m45_38640_c1 | 3300050496 | Bacteria | 2664 |
| 1007 | nmdc:mga07m45_4586_c1 | 3300050496 | Bacteria | 6401 |
| 1008 | nmdc:mga07m45_4942_c1 | 3300050496 | Bacteria | 6572 |
| 1009 | nmdc:mga07m45_5166_c1 | 3300050496 | Bacteria | 6470 |
| 1010 | nmdc:mga07m45_92666_c1 | 3300050496 | Bacteria | 1732 |
| 1011 | nmdc:mga05p37_2494_c1 | 3300050507 | Bacteria | 21411 |
| 1012 | nmdc:mga05p37_387488_c1 | 3300050507 | Bacteria | 1635 |
| 1013 | nmdc:mga09592_132724_c1 | 3300050508 | Bacteria | 2144 |
| 1014 | nmdc:mga09592_16423_c1 | 3300050508 | Bacteria | 6055 |
| 1015 | nmdc:mga09592_26781_c1 | 3300050508 | Bacteria | 4780 |
| 1016 | nmdc:mga09592_540_c1 | 3300050508 | Bacteria | 28649 |
| 1017 | nmdc:mga0qj67_59582_c1 | 3300050509 | Bacteria | 3028 |
| 1018 | nmdc:mga06r32_518483_c1 | 3300050510 | Bacteria | 1168 |
| 1019 | nmdc:mga08y16_437273_c1 | 3300050511 | Bacteria | 1336 |
| 1020 | nmdc:mga08y16_60479_c1 | 3300050511 | Bacteria | 3956 |
| 1021 | nmdc:mga0n895_10157_c1 | 3300050512 | Bacteria | 8290 |
| 1022 | nmdc:mga0n895_1049_c1 | 3300050512 | Bacteria | 20112 |
| 1023 | nmdc:mga0n895_242302_c1 | 3300050512 | Bacteria | 1830 |
| 1024 | nmdc:mga0n895_342592_c1 | 3300050512 | Bacteria | 1514 |
| 1025 | nmdc:mga0n895_49431_c1 | 3300050512 | Bacteria | 4120 |
| 1026 | nmdc:mga0rr50_16126_c1 | 3300050513 | Bacteria | 4952 |
| 1027 | nmdc:mga08x19_16713_c1 | 3300050514 | Bacteria | 4479 |
| 1028 | nmdc:mga08x19_4865_c1 | 3300050514 | Bacteria | 7941 |
| 1029 | nmdc:mga0a205_10465_c1 | 3300050515 | Bacteria | 8521 |
| 1030 | nmdc:mga0a205_42325_c1 | 3300050515 | Bacteria | 4388 |
| 1031 | Ga0495601_0048211 | 3300053077 | Bacteria | 2683 |
| 1032 | Ga0495601_0144958 | 3300053077 | Bacteria | 1550 |
| 1033 | Ga0495612_0132672 | 3300053078 | Bacteria | 1077 |
| 1034 | Ga0500635_0000112 | 3300053080 | Bacteria | 49317 |
| 1035 | Ga0500578_0000057 | 3300053086 | Bacteria | 120178 |
| 1036 | Ga0500651_0001184 | 3300053093 | Bacteria | 12929 |
| 1037 | Ga0500571_000088 | 3300053110 | Bacteria | 29136 |
| 1038 | Ga0500652_003063 | 3300053131 | Bacteria | 5042 |
| 1039 | Ga0500658_0002407 | 3300053134 | Bacteria | 7249 |
| 1040 | Ga0500568_0023742 | 3300053139 | Bacteria | 2605 |
| 1041 | Ga0500636_0000512 | 3300053177 | Bacteria | 21104 |
| 1042 | Ga0500637_0121518 | 3300053178 | Bacteria | 1515 |
| 1043 | Ga0501084_0000162 | 3300054114 | Bacteria | 51385 |
| 1044 | Ga0501084_0020266 | 3300054114 | Bacteria | 5544 |
| 1045 | Ga0501084_0036899 | 3300054114 | Bacteria | 4083 |
| 1046 | Ga0501084_0104417 | 3300054114 | Bacteria | 2380 |
| 1047 | Ga0590071_001911 | 3300059421 | Bacteria | 5337 |
| 1048 | Ga0501082_0001350 | 3300060353 | Bacteria | 21559 |
| 1049 | Ga0501082_0006062 | 3300060353 | Bacteria | 10494 |
| 1050 | Ga0501082_0006637 | 3300060353 | Bacteria | 10013 |
| 1051 | Ga0501082_0016997 | 3300060353 | Bacteria | 6264 |
| 1052 | Ga0501082_0027237 | 3300060353 | Bacteria | 4921 |
| 1053 | Ga0501082_0034080 | 3300060353 | Bacteria | 4392 |
| 1054 | Ga0501082_0035171 | 3300060353 | Bacteria | 4318 |
| 1055 | Ga0501082_0070573 | 3300060353 | Bacteria | 3008 |
| 1056 | Ga0466962_0033972 | 3300061719 | Bacteria | 2440 |
| 1057 | Ga0466962_0051545 | 3300061719 | Bacteria | 1968 |
| 1058 | Ga0530510_0000091 | 3300061734 | Bacteria | 48589 |
| 1059 | Ga0530510_0001285 | 3300061734 | Bacteria | 16766 |
| 1060 | Ga0530510_0008179 | 3300061734 | Bacteria | 7296 |
| 1061 | Ga0530510_0021161 | 3300061734 | Bacteria | 4626 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049575 | Ga0501039_0268752 | Ga0501039_0268752_26_937 | 294 |
| 2 | 3300050512 | nmdc:mga0n895_342592_c1 | nmdc:mga0n895_342592_c1_584_1504 | 297 |
| 3 | 3300044706 | Ga0466964_0109901 | Ga0466964_0109901_231_1217 | 315 |
| 4 | 3300053078 | Ga0495612_0132672 | Ga0495612_0132672_17_1045 | 315 |
| 5 | 3300025916 | Ga0207663_10000232 | Ga0207663_1000023218 | 328 |
| 6 | 3300025944 | Ga0207661_10032337 | Ga0207661_100323372 | 328 |
| 7 | 3300049578 | Ga0501042_0003967 | Ga0501042_0003967_17_1033 | 329 |
| 8 | 3300049584 | Ga0501068_0248448 | Ga0501068_0248448_97_1113 | 329 |
| 9 | 3300046476 | Ga0495662_0002439 | Ga0495662_0002439_3653_4732 | 344 |
| 10 | 3300046517 | Ga0495630_0067400 | Ga0495630_0067400_171_1250 | 344 |
| 11 | 3300028666 | Ga0265336_10000156 | Ga0265336_1000015610 | 346 |
| 12 | 3300029957 | Ga0265324_10000528 | Ga0265324_1000052819 | 346 |
| 13 | 3300005467 | Ga0070706_100089850 | Ga0070706_1000898502 | 347 |
| 14 | 3300005468 | Ga0070707_100011124 | Ga0070707_1000111246 | 347 |
| 15 | 3300005518 | Ga0070699_100057090 | Ga0070699_1000570903 | 347 |
| 16 | 3300025910 | Ga0207684_10086816 | Ga0207684_100868162 | 347 |
| 17 | 3300025922 | Ga0207646_10004382 | Ga0207646_1000438213 | 347 |
| 18 | 3300044673 | Ga0453683_0047194 | Ga0453683_0047194_374_1432 | 347 |
| 19 | 3300006847 | Ga0075431_100031935 | Ga0075431_1000319351 | 348 |
| 20 | 3300050510 | nmdc:mga06r32_518483_c1 | nmdc:mga06r32_518483_c1_64_1125 | 348 |
| 21 | 3300003214 | JGI25165J46597_1008243 | JGI25165J46597_10082432 | 349 |
| 22 | 3300003911 | JGI25405J52794_10005070 | JGI25405J52794_100050701 | 349 |
| 23 | 3300005290 | Ga0065712_10000147 | Ga0065712_100001471 | 349 |
| 24 | 3300005293 | Ga0065715_10000258 | Ga0065715_1000025814 | 349 |
| 25 | 3300005338 | Ga0068868_100140897 | Ga0068868_1001408972 | 349 |
| 26 | 3300005439 | Ga0070711_100000783 | Ga0070711_1000007834 | 349 |
| 27 | 3300005445 | Ga0070708_100018219 | Ga0070708_1000182192 | 349 |
| 28 | 3300005518 | Ga0070699_100009099 | Ga0070699_1000090993 | 349 |
| 29 | 3300005518 | Ga0070699_100082511 | Ga0070699_1000825113 | 349 |
| 30 | 3300005536 | Ga0070697_100056148 | Ga0070697_1000561483 | 349 |
| 31 | 3300005539 | Ga0068853_100057828 | Ga0068853_1000578282 | 349 |
| 32 | 3300005564 | Ga0070664_100004792 | Ga0070664_1000047922 | 349 |
| 33 | 3300006163 | Ga0070715_10051994 | Ga0070715_100519943 | 349 |
| 34 | 3300006852 | Ga0075433_10004322 | Ga0075433_100043227 | 349 |
| 35 | 3300006871 | Ga0075434_100000696 | Ga0075434_10000069622 | 349 |
| 36 | 3300006871 | Ga0075434_100018694 | Ga0075434_1000186944 | 349 |
| 37 | 3300006871 | Ga0075434_100411784 | Ga0075434_1004117841 | 349 |
| 38 | 3300007076 | Ga0075435_100006841 | Ga0075435_1000068413 | 349 |
| 39 | 3300009094 | Ga0111539_10523992 | Ga0111539_105239922 | 349 |
| 40 | 3300009147 | Ga0114129_10225945 | Ga0114129_102259452 | 349 |
| 41 | 3300009176 | Ga0105242_10009565 | Ga0105242_100095653 | 349 |
| 42 | 3300009545 | Ga0105237_10058446 | Ga0105237_100584463 | 349 |
| 43 | 3300010375 | Ga0105239_10387452 | Ga0105239_103874521 | 349 |
| 44 | 3300025231 | Ga0207427_102200 | Ga0207427_1022005 | 349 |
| 45 | 3300025261 | Ga0209233_1000911 | Ga0209233_10009112 | 349 |
| 46 | 3300025910 | Ga0207684_10196895 | Ga0207684_101968952 | 349 |
| 47 | 3300025939 | Ga0207665_10118568 | Ga0207665_101185682 | 349 |
| 48 | 3300025939 | Ga0207665_10218601 | Ga0207665_102186012 | 349 |
| 49 | 3300027907 | Ga0207428_10200700 | Ga0207428_102007002 | 349 |
| 50 | 3300031728 | Ga0316578_10049280 | Ga0316578_100492802 | 349 |
| 51 | 3300031733 | Ga0316577_10000781 | Ga0316577_1000078114 | 349 |
| 52 | 3300032137 | Ga0316585_10001297 | Ga0316585_100012975 | 349 |
| 53 | 3300035691 | Ga0373931_0008979 | Ga0373931_0008979_3226_4305 | 349 |
| 54 | 3300036401 | Ga0373937_0435103 | Ga0373937_0435103_11_1141 | 349 |
| 55 | 3300036647 | Ga0316582_0009408 | Ga0316582_0009408_1695_2765 | 349 |
| 56 | 3300036712 | Ga0316584_0042026 | Ga0316584_0042026_1123_2193 | 349 |
| 57 | 3300039062 | Ga0400483_026673 | Ga0400483_026673_2855_3907 | 349 |
| 58 | 3300039447 | Ga0436361_0273200 | Ga0436361_0273200_2063_3121 | 349 |
| 59 | 3300039447 | Ga0436361_0391372 | Ga0436361_0391372_578_1636 | 349 |
| 60 | 3300041404 | Ga0439436_0016872 | Ga0439436_0016872_39_1112 | 349 |
| 61 | 3300042876 | Ga0451577_0158978 | Ga0451577_0158978_854_1921 | 349 |
| 62 | 3300042876 | Ga0451577_0258952 | Ga0451577_0258952_45_1124 | 349 |
| 63 | 3300044712 | Ga0453684_0020279 | Ga0453684_0020279_6151_7218 | 349 |
| 64 | 3300044712 | Ga0453684_0026597 | Ga0453684_0026597_3627_4694 | 349 |
| 65 | 3300044712 | Ga0453684_0075128 | Ga0453684_0075128_2036_3103 | 349 |
| 66 | 3300045051 | Ga0451576_0000435 | Ga0451576_0000435_88650_89717 | 349 |
| 67 | 3300045051 | Ga0451576_0177309 | Ga0451576_0177309_936_2003 | 349 |
| 68 | 3300046472 | Ga0495580_0005957 | Ga0495580_0005957_5210_6286 | 349 |
| 69 | 3300048904 | Ga0496101_0284153 | Ga0496101_0284153_186_1265 | 349 |
| 70 | 3300048915 | Ga0496112_0000331 | Ga0496112_0000331_14931_16010 | 349 |
| 71 | 3300049568 | Ga0501031_0125388 | Ga0501031_0125388_58_1137 | 349 |
| 72 | 3300049568 | Ga0501031_0174242 | Ga0501031_0174242_28_1098 | 349 |
| 73 | 3300049569 | Ga0501032_0014778 | Ga0501032_0014778_230_1300 | 349 |
| 74 | 3300049569 | Ga0501032_0144102 | Ga0501032_0144102_232_1305 | 349 |
| 75 | 3300049570 | Ga0501033_0005063 | Ga0501033_0005063_335_1408 | 349 |
| 76 | 3300049570 | Ga0501033_0020417 | Ga0501033_0020417_356_1426 | 349 |
| 77 | 3300049570 | Ga0501033_0107758 | Ga0501033_0107758_296_1369 | 349 |
| 78 | 3300049570 | Ga0501033_0207659 | Ga0501033_0207659_73_1152 | 349 |
| 79 | 3300049571 | Ga0501034_0207246 | Ga0501034_0207246_285_1358 | 349 |
| 80 | 3300049571 | Ga0501034_0350933 | Ga0501034_0350933_241_1311 | 349 |
| 81 | 3300049572 | Ga0501036_0093216 | Ga0501036_0093216_180_1253 | 349 |
| 82 | 3300049572 | Ga0501036_0116897 | Ga0501036_0116897_338_1411 | 349 |
| 83 | 3300049573 | Ga0501037_0032922 | Ga0501037_0032922_2597_3670 | 349 |
| 84 | 3300049573 | Ga0501037_0080116 | Ga0501037_0080116_144_1223 | 349 |
| 85 | 3300049573 | Ga0501037_0162159 | Ga0501037_0162159_207_1280 | 349 |
| 86 | 3300049574 | Ga0501038_0002910 | Ga0501038_0002910_2542_3621 | 349 |
| 87 | 3300049574 | Ga0501038_0055820 | Ga0501038_0055820_2090_3163 | 349 |
| 88 | 3300049575 | Ga0501039_0003889 | Ga0501039_0003889_3886_4965 | 349 |
| 89 | 3300049576 | Ga0501040_0001180 | Ga0501040_0001180_6795_7859 | 349 |
| 90 | 3300049576 | Ga0501040_0004683 | Ga0501040_0004683_3052_4131 | 349 |
| 91 | 3300049577 | Ga0501041_0000037 | Ga0501041_0000037_9613_10692 | 349 |
| 92 | 3300049580 | Ga0501046_0004629 | Ga0501046_0004629_5633_6712 | 349 |
| 93 | 3300049580 | Ga0501046_0182490 | Ga0501046_0182490_436_1506 | 349 |
| 94 | 3300049581 | Ga0501047_0210179 | Ga0501047_0210179_293_1366 | 349 |
| 95 | 3300049581 | Ga0501047_0264629 | Ga0501047_0264629_354_1424 | 349 |
| 96 | 3300049582 | Ga0501048_0031097 | Ga0501048_0031097_351_1424 | 349 |
| 97 | 3300049582 | Ga0501048_0074530 | Ga0501048_0074530_1083_2153 | 349 |
| 98 | 3300049584 | Ga0501068_0006477 | Ga0501068_0006477_185_1255 | 349 |
| 99 | 3300049584 | Ga0501068_0112392 | Ga0501068_0112392_344_1417 | 349 |
| 100 | 3300049585 | Ga0501069_0011227 | Ga0501069_0011227_3562_4632 | 349 |
| 101 | 3300049586 | Ga0501070_0022567 | Ga0501070_0022567_354_1427 | 349 |
| 102 | 3300049586 | Ga0501070_0022604 | Ga0501070_0022604_273_1346 | 349 |
| 103 | 3300049586 | Ga0501070_0164994 | Ga0501070_0164994_486_1556 | 349 |
| 104 | 3300049587 | Ga0501071_0000765 | Ga0501071_0000765_10320_11399 | 349 |
| 105 | 3300049587 | Ga0501071_0003144 | Ga0501071_0003144_261_1331 | 349 |
| 106 | 3300049587 | Ga0501071_0187260 | Ga0501071_0187260_274_1335 | 349 |
| 107 | 3300049588 | Ga0501072_0000314 | Ga0501072_0000314_20982_22061 | 349 |
| 108 | 3300049589 | Ga0501073_0129165 | Ga0501073_0129165_246_1316 | 349 |
| 109 | 3300049589 | Ga0501073_0236669 | Ga0501073_0236669_75_1154 | 349 |
| 110 | 3300049590 | Ga0501074_0050270 | Ga0501074_0050270_183_1256 | 349 |
| 111 | 3300049590 | Ga0501074_0099929 | Ga0501074_0099929_405_1475 | 349 |
| 112 | 3300049591 | Ga0501075_0002514 | Ga0501075_0002514_10180_11259 | 349 |
| 113 | 3300049591 | Ga0501075_0189266 | Ga0501075_0189266_143_1222 | 349 |
| 114 | 3300049592 | Ga0501076_0004951 | Ga0501076_0004951_282_1361 | 349 |
| 115 | 3300049593 | Ga0501077_0000210 | Ga0501077_0000210_24727_25806 | 349 |
| 116 | 3300049741 | Ga0501079_0000228 | Ga0501079_0000228_12343_13422 | 349 |
| 117 | 3300049741 | Ga0501079_0005448 | Ga0501079_0005448_8223_9293 | 349 |
| 118 | 3300049741 | Ga0501079_0013504 | Ga0501079_0013504_290_1363 | 349 |
| 119 | 3300049741 | Ga0501079_0042908 | Ga0501079_0042908_2272_3345 | 349 |
| 120 | 3300049742 | Ga0501080_0086091 | Ga0501080_0086091_93_1163 | 349 |
| 121 | 3300049742 | Ga0501080_0394034 | Ga0501080_0394034_125_1204 | 349 |
| 122 | 3300049743 | Ga0501081_0000513 | Ga0501081_0000513_20528_21607 | 349 |
| 123 | 3300049744 | Ga0501083_0010144 | Ga0501083_0010144_5283_6362 | 349 |
| 124 | 3300049822 | Ga0501035_0026558 | Ga0501035_0026558_304_1377 | 349 |
| 125 | 3300049822 | Ga0501035_0089468 | Ga0501035_0089468_246_1316 | 349 |
| 126 | 3300049823 | Ga0501044_0109836 | Ga0501044_0109836_1623_2693 | 349 |
| 127 | 3300049824 | Ga0501045_0000680 | Ga0501045_0000680_10018_11097 | 349 |
| 128 | 3300050507 | nmdc:mga05p37_387488_c1 | nmdc:mga05p37_387488_c1_525_1604 | 349 |
| 129 | 3300050512 | nmdc:mga0n895_10157_c1 | nmdc:mga0n895_10157_c1_3354_4433 | 349 |
| 130 | 3300050512 | nmdc:mga0n895_242302_c1 | nmdc:mga0n895_242302_c1_363_1430 | 349 |
| 131 | 3300050513 | nmdc:mga0rr50_16126_c1 | nmdc:mga0rr50_16126_c1_3312_4379 | 349 |
| 132 | 3300050515 | nmdc:mga0a205_10465_c1 | nmdc:mga0a205_10465_c1_4327_5403 | 349 |
| 133 | 3300053177 | Ga0500636_0000512 | Ga0500636_0000512_9613_10680 | 349 |
| 134 | 3300054114 | Ga0501084_0000162 | Ga0501084_0000162_38050_39129 | 349 |
| 135 | 3300054114 | Ga0501084_0036899 | Ga0501084_0036899_2793_3863 | 349 |
| 136 | 3300060353 | Ga0501082_0001350 | Ga0501082_0001350_12381_13460 | 349 |
| 137 | 3300060353 | Ga0501082_0016997 | Ga0501082_0016997_4870_5943 | 349 |
| 138 | 3300060353 | Ga0501082_0027237 | Ga0501082_0027237_3605_4675 | 349 |
| 139 | 3300061734 | Ga0530510_0021161 | Ga0530510_0021161_2579_3658 | 349 |
| 140 | 3300035398 | Ga0316574_0021473 | Ga0316574_0021473_264_1331 | 350 |
| 141 | 3300049593 | Ga0501077_0189880 | Ga0501077_0189880_113_1216 | 350 |
| 142 | 3300050511 | nmdc:mga08y16_437273_c1 | nmdc:mga08y16_437273_c1_217_1326 | 350 |
| 143 | 3300027682 | Ga0209971_1019777 | Ga0209971_10197772 | 351 |
| 144 | 3300027717 | Ga0209998_10024070 | Ga0209998_100240702 | 351 |
| 145 | 3300042004 | Ga0439445_0007246 | Ga0439445_0007246_1307_2392 | 351 |
| 146 | 3300042007 | Ga0439449_0000582 | Ga0439449_0000582_10595_11680 | 351 |
| 147 | 3300031249 | Ga0265339_10089759 | Ga0265339_100897592 | 352 |
| 148 | 3300031727 | Ga0316576_10158950 | Ga0316576_101589502 | 352 |
| 149 | 3300036712 | Ga0316584_0041943 | Ga0316584_0041943_2054_3130 | 352 |
| 150 | 3300045051 | Ga0451576_0200269 | Ga0451576_0200269_40_1122 | 352 |
| 151 | 3300005444 | Ga0070694_100108565 | Ga0070694_1001085651 | 353 |
| 152 | 3300044673 | Ga0453683_0000171 | Ga0453683_0000171_13394_14485 | 353 |
| 153 | 3300046683 | Ga0495658_0115437 | Ga0495658_0115437_72_1166 | 353 |
| 154 | 3300050509 | nmdc:mga0qj67_59582_c1 | nmdc:mga0qj67_59582_c1_745_1854 | 353 |
| 155 | iso_pu_bacteria | 2929160207 | 2929168577 | 353 |
| 156 | 3300037471 | Ga0395905_0113555 | Ga0395905_0113555_1152_2270 | 355 |
| 157 | 3300053077 | Ga0495601_0144958 | Ga0495601_0144958_376_1452 | 355 |
| 158 | iso_pu_bacteria | 2671180531 | 2673165926 | 355 |
| 159 | 3300005293 | Ga0065715_10119204 | Ga0065715_101192042 | 356 |
| 160 | 3300005333 | Ga0070677_10011030 | Ga0070677_100110302 | 356 |
| 161 | 3300005334 | Ga0068869_100048618 | Ga0068869_1000486183 | 356 |
| 162 | 3300005337 | Ga0070682_100016479 | Ga0070682_1000164793 | 356 |
| 163 | 3300005339 | Ga0070660_100007413 | Ga0070660_1000074137 | 356 |
| 164 | 3300005341 | Ga0070691_10012002 | Ga0070691_100120022 | 356 |
| 165 | 3300005367 | Ga0070667_100084380 | Ga0070667_1000843803 | 356 |
| 166 | 3300005440 | Ga0070705_100162997 | Ga0070705_1001629971 | 356 |
| 167 | 3300005456 | Ga0070678_100062095 | Ga0070678_1000620952 | 356 |
| 168 | 3300005458 | Ga0070681_10018558 | Ga0070681_100185582 | 356 |
| 169 | 3300005459 | Ga0068867_100203839 | Ga0068867_1002038391 | 356 |
| 170 | 3300005539 | Ga0068853_100105037 | Ga0068853_1001050372 | 356 |
| 171 | 3300005543 | Ga0070672_100193817 | Ga0070672_1001938172 | 356 |
| 172 | 3300005545 | Ga0070695_100023046 | Ga0070695_1000230462 | 356 |
| 173 | 3300005547 | Ga0070693_100062021 | Ga0070693_1000620212 | 356 |
| 174 | 3300005548 | Ga0070665_100210804 | Ga0070665_1002108042 | 356 |
| 175 | 3300005563 | Ga0068855_100344535 | Ga0068855_1003445352 | 356 |
| 176 | 3300005842 | Ga0068858_100328027 | Ga0068858_1003280271 | 356 |
| 177 | 3300006871 | Ga0075434_100039756 | Ga0075434_1000397564 | 356 |
| 178 | 3300009176 | Ga0105242_10041885 | Ga0105242_100418851 | 356 |
| 179 | 3300009553 | Ga0105249_10120150 | Ga0105249_101201502 | 356 |
| 180 | 3300010375 | Ga0105239_10042014 | Ga0105239_100420145 | 356 |
| 181 | 3300013306 | Ga0163162_10015143 | Ga0163162_100151438 | 356 |
| 182 | 3300025315 | Ga0207697_10009126 | Ga0207697_100091263 | 356 |
| 183 | 3300025893 | Ga0207682_10014751 | Ga0207682_100147513 | 356 |
| 184 | 3300025901 | Ga0207688_10019501 | Ga0207688_100195013 | 356 |
| 185 | 3300025907 | Ga0207645_10024587 | Ga0207645_100245872 | 356 |
| 186 | 3300025912 | Ga0207707_10014795 | Ga0207707_100147959 | 356 |
| 187 | 3300025919 | Ga0207657_10011865 | Ga0207657_100118658 | 356 |
| 188 | 3300025923 | Ga0207681_10031598 | Ga0207681_100315985 | 356 |
| 189 | 3300025925 | Ga0207650_10000951 | Ga0207650_100009519 | 356 |
| 190 | 3300025933 | Ga0207706_10008488 | Ga0207706_100084885 | 356 |
| 191 | 3300025940 | Ga0207691_10075662 | Ga0207691_100756622 | 356 |
| 192 | 3300025942 | Ga0207689_10030568 | Ga0207689_100305682 | 356 |
| 193 | 3300025945 | Ga0207679_10002133 | Ga0207679_100021336 | 356 |
| 194 | 3300025949 | Ga0207667_10153265 | Ga0207667_101532652 | 356 |
| 195 | 3300026041 | Ga0207639_10019359 | Ga0207639_100193594 | 356 |
| 196 | 3300026121 | Ga0207683_10003665 | Ga0207683_100036652 | 356 |
| 197 | 3300031730 | Ga0307516_10009704 | Ga0307516_100097047 | 356 |
| 198 | 3300048912 | Ga0496109_0263446 | Ga0496109_0263446_138_1253 | 356 |
| 199 | 3300049580 | Ga0501046_0184314 | Ga0501046_0184314_350_1474 | 356 |
| 200 | 3300049588 | Ga0501072_0140006 | Ga0501072_0140006_497_1621 | 356 |
| 201 | 3300049591 | Ga0501075_0064610 | Ga0501075_0064610_809_1933 | 356 |
| 202 | 3300049592 | Ga0501076_0089029 | Ga0501076_0089029_80_1204 | 356 |
| 203 | 3300049593 | Ga0501077_0030845 | Ga0501077_0030845_1499_2623 | 356 |
| 204 | 3300049741 | Ga0501079_0039028 | Ga0501079_0039028_1042_2166 | 356 |
| 205 | 3300049744 | Ga0501083_0091358 | Ga0501083_0091358_438_1562 | 356 |
| 206 | 3300050515 | nmdc:mga0a205_42325_c1 | nmdc:mga0a205_42325_c1_1245_2360 | 356 |
| 207 | 3300061734 | Ga0530510_0008179 | Ga0530510_0008179_1426_2550 | 356 |
| 208 | 3300005340 | Ga0070689_100307745 | Ga0070689_1003077451 | 357 |
| 209 | 3300005343 | Ga0070687_100044584 | Ga0070687_1000445843 | 357 |
| 210 | 3300005347 | Ga0070668_100019536 | Ga0070668_1000195364 | 357 |
| 211 | 3300005353 | Ga0070669_100009475 | Ga0070669_1000094756 | 357 |
| 212 | 3300005364 | Ga0070673_100258487 | Ga0070673_1002584871 | 357 |
| 213 | 3300005459 | Ga0068867_100011508 | Ga0068867_1000115086 | 357 |
| 214 | 3300005544 | Ga0070686_100021988 | Ga0070686_1000219883 | 357 |
| 215 | 3300005615 | Ga0070702_100052322 | Ga0070702_1000523223 | 357 |
| 216 | 3300005719 | Ga0068861_100011512 | Ga0068861_1000115122 | 357 |
| 217 | 3300005840 | Ga0068870_10010553 | Ga0068870_100105532 | 357 |
| 218 | 3300005844 | Ga0068862_100007612 | Ga0068862_10000761210 | 357 |
| 219 | 3300006237 | Ga0097621_100001554 | Ga0097621_10000155416 | 357 |
| 220 | 3300006358 | Ga0068871_100006024 | Ga0068871_1000060243 | 357 |
| 221 | 3300006844 | Ga0075428_100189717 | Ga0075428_1001897172 | 357 |
| 222 | 3300006880 | Ga0075429_100028408 | Ga0075429_1000284084 | 357 |
| 223 | 3300009094 | Ga0111539_10410510 | Ga0111539_104105102 | 357 |
| 224 | 3300009147 | Ga0114129_10029909 | Ga0114129_100299097 | 357 |
| 225 | 3300009147 | Ga0114129_10098052 | Ga0114129_100980523 | 357 |
| 226 | 3300009148 | Ga0105243_10022803 | Ga0105243_100228034 | 357 |
| 227 | 3300009553 | Ga0105249_10007455 | Ga0105249_100074556 | 357 |
| 228 | 3300013306 | Ga0163162_10235678 | Ga0163162_102356782 | 357 |
| 229 | 3300025918 | Ga0207662_10055077 | Ga0207662_100550773 | 357 |
| 230 | 3300025923 | Ga0207681_10005493 | Ga0207681_100054934 | 357 |
| 231 | 3300025935 | Ga0207709_10017384 | Ga0207709_100173843 | 357 |
| 232 | 3300025938 | Ga0207704_10027677 | Ga0207704_100276772 | 357 |
| 233 | 3300025942 | Ga0207689_10039915 | Ga0207689_100399153 | 357 |
| 234 | 3300025961 | Ga0207712_10014116 | Ga0207712_100141164 | 357 |
| 235 | 3300025972 | Ga0207668_10011209 | Ga0207668_100112092 | 357 |
| 236 | 3300026075 | Ga0207708_10005765 | Ga0207708_100057656 | 357 |
| 237 | 3300026089 | Ga0207648_10008268 | Ga0207648_100082684 | 357 |
| 238 | 3300026118 | Ga0207675_100403279 | Ga0207675_1004032791 | 357 |
| 239 | 3300027364 | Ga0209967_1000664 | Ga0209967_10006644 | 357 |
| 240 | 3300027378 | Ga0209981_1000848 | Ga0209981_10008482 | 357 |
| 241 | 3300027462 | Ga0210000_1006962 | Ga0210000_10069621 | 357 |
| 242 | 3300027471 | Ga0209995_1005716 | Ga0209995_10057161 | 357 |
| 243 | 3300027543 | Ga0209999_1002399 | Ga0209999_10023993 | 357 |
| 244 | 3300027543 | Ga0209999_1004662 | Ga0209999_10046622 | 357 |
| 245 | 3300027682 | Ga0209971_1005275 | Ga0209971_10052754 | 357 |
| 246 | 3300027907 | Ga0207428_10055920 | Ga0207428_100559203 | 357 |
| 247 | 3300027907 | Ga0207428_10223004 | Ga0207428_102230042 | 357 |
| 248 | 3300028380 | Ga0268265_10004392 | Ga0268265_100043923 | 357 |
| 249 | 3300034957 | Ga0373938_0009067 | Ga0373938_0009067_704_1780 | 357 |
| 250 | 3300042003 | Ga0439443_000181 | Ga0439443_000181_3082_4167 | 357 |
| 251 | 3300042435 | Ga0439434_0001050 | Ga0439434_0001050_738_1823 | 357 |
| 252 | 3300042436 | Ga0439435_0000063 | Ga0439435_0000063_6785_7870 | 357 |
| 253 | 3300042436 | Ga0439435_0009565 | Ga0439435_0009565_608_1696 | 357 |
| 254 | 3300042461 | Ga0439460_0000592 | Ga0439460_0000592_6072_7157 | 357 |
| 255 | 3300042461 | Ga0439460_0014862 | Ga0439460_0014862_825_1913 | 357 |
| 256 | 3300049576 | Ga0501040_0022079 | Ga0501040_0022079_731_1816 | 357 |
| 257 | 3300049576 | Ga0501040_0240116 | Ga0501040_0240116_52_1137 | 357 |
| 258 | 3300049577 | Ga0501041_0011861 | Ga0501041_0011861_2793_3878 | 357 |
| 259 | 3300049580 | Ga0501046_0069261 | Ga0501046_0069261_1082_2167 | 357 |
| 260 | 3300049582 | Ga0501048_0012896 | Ga0501048_0012896_4954_6039 | 357 |
| 261 | 3300049587 | Ga0501071_0061475 | Ga0501071_0061475_552_1637 | 357 |
| 262 | 3300049587 | Ga0501071_0150287 | Ga0501071_0150287_94_1170 | 357 |
| 263 | 3300049588 | Ga0501072_0000757 | Ga0501072_0000757_10629_11714 | 357 |
| 264 | 3300049592 | Ga0501076_0000285 | Ga0501076_0000285_16538_17623 | 357 |
| 265 | 3300049592 | Ga0501076_0196643 | Ga0501076_0196643_512_1618 | 357 |
| 266 | 3300049741 | Ga0501079_0005775 | Ga0501079_0005775_7818_8903 | 357 |
| 267 | 3300049742 | Ga0501080_0055491 | Ga0501080_0055491_994_2079 | 357 |
| 268 | 3300049743 | Ga0501081_0000759 | Ga0501081_0000759_7416_8501 | 357 |
| 269 | 3300049822 | Ga0501035_0089285 | Ga0501035_0089285_1358_2443 | 357 |
| 270 | 3300049824 | Ga0501045_0003900 | Ga0501045_0003900_5708_6793 | 357 |
| 271 | 3300050508 | nmdc:mga09592_132724_c1 | nmdc:mga09592_132724_c1_584_1663 | 357 |
| 272 | 3300050508 | nmdc:mga09592_26781_c1 | nmdc:mga09592_26781_c1_1429_2517 | 357 |
| 273 | 3300050511 | nmdc:mga08y16_60479_c1 | nmdc:mga08y16_60479_c1_747_1829 | 357 |
| 274 | 3300054114 | Ga0501084_0020266 | Ga0501084_0020266_1562_2647 | 357 |
| 275 | 3300054114 | Ga0501084_0104417 | Ga0501084_0104417_1217_2323 | 357 |
| 276 | 3300060353 | Ga0501082_0070573 | Ga0501082_0070573_1112_2197 | 357 |
| 277 | 3300061719 | Ga0466962_0051545 | Ga0466962_0051545_572_1720 | 357 |
| 278 | 3300061734 | Ga0530510_0000091 | Ga0530510_0000091_21922_23007 | 357 |
| 279 | 3300046675 | Ga0495657_0027599 | Ga0495657_0027599_2089_3180 | 358 |
| 280 | 3300047317 | Ga0495604_0096671 | Ga0495604_0096671_790_1881 | 358 |
| 281 | 3300005327 | Ga0070658_10210702 | Ga0070658_102107021 | 359 |
| 282 | 3300025914 | Ga0207671_10002929 | Ga0207671_1000292915 | 359 |
| 283 | 3300032002 | Ga0307416_100182830 | Ga0307416_1001828302 | 359 |
| 284 | 3300005444 | Ga0070694_100003005 | Ga0070694_10000300512 | 360 |
| 285 | 3300005617 | Ga0068859_100003043 | Ga0068859_1000030432 | 360 |
| 286 | 3300006931 | Ga0097620_100003043 | Ga0097620_1000030432 | 360 |
| 287 | 3300009176 | Ga0105242_10003452 | Ga0105242_100034521 | 360 |
| 288 | 3300025942 | Ga0207689_10097291 | Ga0207689_100972913 | 360 |
| 289 | 3300025986 | Ga0207658_10096094 | Ga0207658_100960942 | 360 |
| 290 | 3300042876 | Ga0451577_0018358 | Ga0451577_0018358_1193_2320 | 360 |
| 291 | 3300049568 | Ga0501031_0023508 | Ga0501031_0023508_1574_2719 | 360 |
| 292 | 3300049569 | Ga0501032_0007889 | Ga0501032_0007889_6586_7731 | 360 |
| 293 | 3300049570 | Ga0501033_0019086 | Ga0501033_0019086_1660_2805 | 360 |
| 294 | 3300049571 | Ga0501034_0069615 | Ga0501034_0069615_2339_3484 | 360 |
| 295 | 3300049572 | Ga0501036_0054326 | Ga0501036_0054326_100_1245 | 360 |
| 296 | 3300049572 | Ga0501036_0130092 | Ga0501036_0130092_447_1592 | 360 |
| 297 | 3300049572 | Ga0501036_0189737 | Ga0501036_0189737_546_1691 | 360 |
| 298 | 3300049573 | Ga0501037_0073157 | Ga0501037_0073157_299_1444 | 360 |
| 299 | 3300049573 | Ga0501037_0110091 | Ga0501037_0110091_209_1354 | 360 |
| 300 | 3300049573 | Ga0501037_0138111 | Ga0501037_0138111_284_1429 | 360 |
| 301 | 3300049574 | Ga0501038_0008449 | Ga0501038_0008449_5532_6677 | 360 |
| 302 | 3300049574 | Ga0501038_0170626 | Ga0501038_0170626_177_1322 | 360 |
| 303 | 3300049575 | Ga0501039_0038682 | Ga0501039_0038682_46_1191 | 360 |
| 304 | 3300049579 | Ga0501043_0090945 | Ga0501043_0090945_1209_2354 | 360 |
| 305 | 3300049580 | Ga0501046_0009080 | Ga0501046_0009080_5526_6671 | 360 |
| 306 | 3300049580 | Ga0501046_0082278 | Ga0501046_0082278_1208_2353 | 360 |
| 307 | 3300049581 | Ga0501047_0001227 | Ga0501047_0001227_1663_2808 | 360 |
| 308 | 3300049581 | Ga0501047_0024956 | Ga0501047_0024956_4242_5387 | 360 |
| 309 | 3300049581 | Ga0501047_0202667 | Ga0501047_0202667_667_1812 | 360 |
| 310 | 3300049582 | Ga0501048_0070841 | Ga0501048_0070841_1284_2429 | 360 |
| 311 | 3300049583 | Ga0501067_0005627 | Ga0501067_0005627_4404_5549 | 360 |
| 312 | 3300049584 | Ga0501068_0062549 | Ga0501068_0062549_990_2135 | 360 |
| 313 | 3300049585 | Ga0501069_0046669 | Ga0501069_0046669_947_2092 | 360 |
| 314 | 3300049588 | Ga0501072_0064143 | Ga0501072_0064143_1724_2869 | 360 |
| 315 | 3300049588 | Ga0501072_0185094 | Ga0501072_0185094_380_1525 | 360 |
| 316 | 3300049589 | Ga0501073_0017602 | Ga0501073_0017602_3454_4599 | 360 |
| 317 | 3300049589 | Ga0501073_0084575 | Ga0501073_0084575_46_1191 | 360 |
| 318 | 3300049589 | Ga0501073_0143711 | Ga0501073_0143711_493_1638 | 360 |
| 319 | 3300049593 | Ga0501077_0098789 | Ga0501077_0098789_695_1837 | 360 |
| 320 | 3300049593 | Ga0501077_0107972 | Ga0501077_0107972_67_1212 | 360 |
| 321 | 3300049742 | Ga0501080_0016812 | Ga0501080_0016812_5565_6710 | 360 |
| 322 | 3300049742 | Ga0501080_0135011 | Ga0501080_0135011_1093_2238 | 360 |
| 323 | 3300049742 | Ga0501080_0147695 | Ga0501080_0147695_51_1196 | 360 |
| 324 | 3300049744 | Ga0501083_0026026 | Ga0501083_0026026_747_1892 | 360 |
| 325 | 3300049744 | Ga0501083_0034046 | Ga0501083_0034046_2307_3452 | 360 |
| 326 | 3300049822 | Ga0501035_0224078 | Ga0501035_0224078_361_1506 | 360 |
| 327 | 3300049823 | Ga0501044_0018370 | Ga0501044_0018370_2106_3251 | 360 |
| 328 | 3300060353 | Ga0501082_0006062 | Ga0501082_0006062_8674_9819 | 360 |
| 329 | 3300060353 | Ga0501082_0034080 | Ga0501082_0034080_2814_3959 | 360 |
| 330 | 3300060353 | Ga0501082_0035171 | Ga0501082_0035171_434_1579 | 360 |
| 331 | 3300005295 | Ga0065707_10217691 | Ga0065707_102176911 | 361 |
| 332 | 3300005339 | Ga0070660_100020125 | Ga0070660_1000201252 | 361 |
| 333 | 3300005440 | Ga0070705_100002282 | Ga0070705_1000022826 | 361 |
| 334 | 3300005458 | Ga0070681_10110596 | Ga0070681_101105961 | 361 |
| 335 | 3300005458 | Ga0070681_10442238 | Ga0070681_104422381 | 361 |
| 336 | 3300005530 | Ga0070679_100004838 | Ga0070679_1000048384 | 361 |
| 337 | 3300005536 | Ga0070697_100001057 | Ga0070697_10000105720 | 361 |
| 338 | 3300005545 | Ga0070695_100021796 | Ga0070695_1000217963 | 361 |
| 339 | 3300005546 | Ga0070696_100004324 | Ga0070696_1000043245 | 361 |
| 340 | 3300005563 | Ga0068855_100006754 | Ga0068855_1000067544 | 361 |
| 341 | 3300006871 | Ga0075434_100002860 | Ga0075434_1000028603 | 361 |
| 342 | 3300006914 | Ga0075436_100007333 | Ga0075436_1000073332 | 361 |
| 343 | 3300009093 | Ga0105240_10005995 | Ga0105240_100059958 | 361 |
| 344 | 3300025909 | Ga0207705_10213004 | Ga0207705_102130042 | 361 |
| 345 | 3300025912 | Ga0207707_10009980 | Ga0207707_100099801 | 361 |
| 346 | 3300025919 | Ga0207657_10006920 | Ga0207657_100069205 | 361 |
| 347 | 3300025921 | Ga0207652_10048231 | Ga0207652_100482313 | 361 |
| 348 | 3300025949 | Ga0207667_10028778 | Ga0207667_100287783 | 361 |
| 349 | 3300035118 | Ga0373954_0000065 | Ga0373954_0000065_34535_35644 | 361 |
| 350 | 3300036401 | Ga0373937_0000149 | Ga0373937_0000149_54974_56083 | 361 |
| 351 | 3300036401 | Ga0373937_0013228 | Ga0373937_0013228_995_2101 | 361 |
| 352 | 3300037068 | Ga0373925_0006143 | Ga0373925_0006143_2874_3971 | 361 |
| 353 | 3300046454 | Ga0495592_0004067 | Ga0495592_0004067_2731_3837 | 361 |
| 354 | 3300046511 | Ga0495608_0002951 | Ga0495608_0002951_4309_5415 | 361 |
| 355 | 3300046514 | Ga0495618_0005161 | Ga0495618_0005161_4947_6053 | 361 |
| 356 | 3300046516 | Ga0495628_0001501 | Ga0495628_0001501_14914_16020 | 361 |
| 357 | 3300046517 | Ga0495630_0013699 | Ga0495630_0013699_52_1158 | 361 |
| 358 | 3300046533 | Ga0495640_0001888 | Ga0495640_0001888_10461_11567 | 361 |
| 359 | 3300046535 | Ga0495586_0000899 | Ga0495586_0000899_9703_10809 | 361 |
| 360 | 3300046536 | Ga0495587_0028894 | Ga0495587_0028894_1382_2488 | 361 |
| 361 | 3300046543 | Ga0495645_0133091 | Ga0495645_0133091_339_1445 | 361 |
| 362 | 3300046642 | Ga0495634_0009473 | Ga0495634_0009473_5151_6257 | 361 |
| 363 | 3300046678 | Ga0495599_0008055 | Ga0495599_0008055_149_1255 | 361 |
| 364 | 3300046683 | Ga0495658_0066636 | Ga0495658_0066636_567_1673 | 361 |
| 365 | 3300046689 | Ga0495613_0092977 | Ga0495613_0092977_1037_2143 | 361 |
| 366 | 3300046809 | Ga0495600_0005182 | Ga0495600_0005182_557_1663 | 361 |
| 367 | 3300047317 | Ga0495604_0001777 | Ga0495604_0001777_2923_4029 | 361 |
| 368 | 3300047318 | Ga0495636_0014121 | Ga0495636_0014121_832_1938 | 361 |
| 369 | 3300047322 | Ga0495680_0003539 | Ga0495680_0003539_6316_7422 | 361 |
| 370 | 3300049583 | Ga0501067_0028447 | Ga0501067_0028447_1710_2807 | 361 |
| 371 | 3300050512 | nmdc:mga0n895_49431_c1 | nmdc:mga0n895_49431_c1_2117_3220 | 361 |
| 372 | 3300050514 | nmdc:mga08x19_4865_c1 | nmdc:mga08x19_4865_c1_435_1547 | 361 |
| 373 | 3300053077 | Ga0495601_0048211 | Ga0495601_0048211_610_1716 | 361 |
| 374 | 3300003203 | JGI25406J46586_10019026 | JGI25406J46586_100190263 | 362 |
| 375 | 3300005536 | Ga0070697_100003400 | Ga0070697_1000034005 | 362 |
| 376 | 3300005545 | Ga0070695_100004094 | Ga0070695_1000040948 | 362 |
| 377 | 3300005841 | Ga0068863_100223710 | Ga0068863_1002237101 | 362 |
| 378 | 3300005985 | Ga0081539_10001364 | Ga0081539_1000136424 | 362 |
| 379 | 3300006880 | Ga0075429_100000871 | Ga0075429_10000087114 | 362 |
| 380 | 3300006914 | Ga0075436_100276564 | Ga0075436_1002765641 | 362 |
| 381 | 3300009147 | Ga0114129_10015710 | Ga0114129_100157103 | 362 |
| 382 | 3300025303 | Ga0209051_1027578 | Ga0209051_10275782 | 362 |
| 383 | 3300025908 | Ga0207643_10082181 | Ga0207643_100821811 | 362 |
| 384 | 3300025929 | Ga0207664_10090705 | Ga0207664_100907053 | 362 |
| 385 | 3300026088 | Ga0207641_10427420 | Ga0207641_104274201 | 362 |
| 386 | 3300031730 | Ga0307516_10000610 | Ga0307516_1000061038 | 362 |
| 387 | 3300035692 | Ga0373935_0003962 | Ga0373935_0003962_6589_7698 | 362 |
| 388 | 3300035695 | Ga0373927_0011088 | Ga0373927_0011088_1275_2384 | 362 |
| 389 | 3300036401 | Ga0373937_0013501 | Ga0373937_0013501_2438_3583 | 362 |
| 390 | 3300037068 | Ga0373925_0054679 | Ga0373925_0054679_350_1459 | 362 |
| 391 | 3300045051 | Ga0451576_0185792 | Ga0451576_0185792_168_1274 | 362 |
| 392 | 3300046528 | Ga0495642_0019344 | Ga0495642_0019344_1399_2505 | 362 |
| 393 | 3300046684 | Ga0495669_0044076 | Ga0495669_0044076_255_1361 | 362 |
| 394 | 3300049574 | Ga0501038_0096755 | Ga0501038_0096755_205_1350 | 362 |
| 395 | 3300049575 | Ga0501039_0046331 | Ga0501039_0046331_353_1498 | 362 |
| 396 | 3300049577 | Ga0501041_0119966 | Ga0501041_0119966_280_1425 | 362 |
| 397 | 3300049578 | Ga0501042_0004460 | Ga0501042_0004460_1393_2538 | 362 |
| 398 | 3300049588 | Ga0501072_0018429 | Ga0501072_0018429_1083_2234 | 362 |
| 399 | 3300049588 | Ga0501072_0032308 | Ga0501072_0032308_990_2135 | 362 |
| 400 | 3300049590 | Ga0501074_0107740 | Ga0501074_0107740_633_1778 | 362 |
| 401 | 3300049591 | Ga0501075_0001817 | Ga0501075_0001817_4134_5279 | 362 |
| 402 | 3300049591 | Ga0501075_0005925 | Ga0501075_0005925_1306_2457 | 362 |
| 403 | 3300049592 | Ga0501076_0002261 | Ga0501076_0002261_5268_6413 | 362 |
| 404 | 3300049742 | Ga0501080_0001366 | Ga0501080_0001366_4092_5243 | 362 |
| 405 | 3300049742 | Ga0501080_0020435 | Ga0501080_0020435_4873_6018 | 362 |
| 406 | 3300049824 | Ga0501045_0001421 | Ga0501045_0001421_7423_8568 | 362 |
| 407 | 3300050507 | nmdc:mga05p37_2494_c1 | nmdc:mga05p37_2494_c1_8453_9574 | 362 |
| 408 | 3300050508 | nmdc:mga09592_540_c1 | nmdc:mga09592_540_c1_21211_22332 | 362 |
| 409 | 3300050512 | nmdc:mga0n895_1049_c1 | nmdc:mga0n895_1049_c1_16351_17451 | 362 |
| 410 | 3300050514 | nmdc:mga08x19_16713_c1 | nmdc:mga08x19_16713_c1_742_1860 | 362 |
| 411 | 3300060353 | Ga0501082_0006637 | Ga0501082_0006637_141_1286 | 362 |
| 412 | 3300061734 | Ga0530510_0001285 | Ga0530510_0001285_13138_14283 | 362 |
| 413 | iso_pu_bacteria | 2831265667 | 2831269637 | 362 |
| 414 | 3300028794 | Ga0307515_10062847 | Ga0307515_100628473 | 363 |
| 415 | 3300006931 | Ga0097620_100252801 | Ga0097620_1002528012 | 364 |
| 416 | 3300014325 | Ga0163163_10016806 | Ga0163163_100168063 | 364 |
| 417 | 3300025913 | Ga0207695_10144042 | Ga0207695_101440422 | 364 |
| 418 | 3300025949 | Ga0207667_10304230 | Ga0207667_103042302 | 364 |
| 419 | 3300026035 | Ga0207703_10049514 | Ga0207703_100495142 | 364 |
| 420 | 3300028794 | Ga0307515_10000291 | Ga0307515_100002914 | 365 |
| 421 | 3300005356 | Ga0070674_100033911 | Ga0070674_1000339114 | 366 |
| 422 | 3300006353 | Ga0075370_10040010 | Ga0075370_100400102 | 366 |
| 423 | 3300009093 | Ga0105240_10016496 | Ga0105240_100164966 | 366 |
| 424 | 3300009545 | Ga0105237_10000080 | Ga0105237_10000080105 | 366 |
| 425 | 3300009551 | Ga0105238_10022002 | Ga0105238_100220022 | 366 |
| 426 | 3300010375 | Ga0105239_10000116 | Ga0105239_100001162 | 366 |
| 427 | 3300025913 | Ga0207695_10006409 | Ga0207695_100064097 | 366 |
| 428 | 3300028794 | Ga0307515_10000013 | Ga0307515_10000013308 | 366 |
| 429 | 3300046511 | Ga0495608_0159986 | Ga0495608_0159986_204_1367 | 366 |
| 430 | 3300025942 | Ga0207689_10065318 | Ga0207689_100653181 | 367 |
| 431 | 3300031251 | Ga0265327_10000804 | Ga0265327_1000080440 | 367 |
| 432 | 3300035691 | Ga0373931_0004773 | Ga0373931_0004773_1564_2691 | 367 |
| 433 | 3300037471 | Ga0395905_0001109 | Ga0395905_0001109_25548_26666 | 367 |
| 434 | 3300048912 | Ga0496109_0038844 | Ga0496109_0038844_485_1603 | 367 |
| 435 | iso_pu_bacteria | 2585428057 | 2587726056 | 367 |
| 436 | iso_pu_bacteria | 2585428058 | 2587735786 | 367 |
| 437 | iso_pu_bacteria | 2585428062 | 2587756501 | 367 |
| 438 | iso_pu_bacteria | 2588253510 | 2588290383 | 367 |
| 439 | iso_pu_bacteria | 2643221592 | 2643967692 | 367 |
| 440 | iso_pu_bacteria | 2643221625 | 2644140514 | 367 |
| 441 | iso_pu_bacteria | 2643221644 | 2644245130 | 367 |
| 442 | iso_pu_bacteria | 2643221648 | 2644273481 | 367 |
| 443 | iso_pu_bacteria | 2886848708 | 2886852231 | 367 |
| 444 | iso_pu_bacteria | 2928115317 | 2928117231 | 367 |
| 445 | 3300002738 | JGI25154J39366_1002640 | JGI25154J39366_10026404 | 368 |
| 446 | 3300002741 | JGI25157J39369_1000038 | JGI25157J39369_10000387 | 368 |
| 447 | 3300003752 | Ga0055539_1000775 | Ga0055539_10007752 | 368 |
| 448 | 3300003752 | Ga0055539_1002200 | Ga0055539_10022002 | 368 |
| 449 | 3300003756 | Ga0055533_1000026 | Ga0055533_1000026209 | 368 |
| 450 | 3300003761 | Ga0055535_1000056 | Ga0055535_1000056115 | 368 |
| 451 | 3300003763 | Ga0055529_1000103 | Ga0055529_100010398 | 368 |
| 452 | 3300005327 | Ga0070658_10014105 | Ga0070658_100141052 | 368 |
| 453 | 3300005339 | Ga0070660_100151384 | Ga0070660_1001513841 | 368 |
| 454 | 3300005364 | Ga0070673_100032276 | Ga0070673_1000322762 | 368 |
| 455 | 3300005563 | Ga0068855_100017132 | Ga0068855_1000171321 | 368 |
| 456 | 3300005563 | Ga0068855_100200638 | Ga0068855_1002006382 | 368 |
| 457 | 3300005578 | Ga0068854_100029405 | Ga0068854_1000294052 | 368 |
| 458 | 3300005614 | Ga0068856_100002420 | Ga0068856_10000242011 | 368 |
| 459 | 3300006195 | Ga0075366_10113846 | Ga0075366_101138461 | 368 |
| 460 | 3300006353 | Ga0075370_10002202 | Ga0075370_100022024 | 368 |
| 461 | 3300009148 | Ga0105243_10073728 | Ga0105243_100737282 | 368 |
| 462 | 3300011119 | Ga0105246_10089094 | Ga0105246_100890941 | 368 |
| 463 | 3300025226 | Ga0209674_100024 | Ga0209674_10002492 | 368 |
| 464 | 3300025230 | Ga0209563_100069 | Ga0209563_10006992 | 368 |
| 465 | 3300025242 | Ga0209258_100071 | Ga0209258_1000718 | 368 |
| 466 | 3300025242 | Ga0209258_100783 | Ga0209258_1007836 | 368 |
| 467 | 3300025246 | Ga0209646_1000012 | Ga0209646_1000012412 | 368 |
| 468 | 3300025250 | Ga0209026_1000004 | Ga0209026_1000004208 | 368 |
| 469 | 3300025253 | Ga0209677_100092 | Ga0209677_10009210 | 368 |
| 470 | 3300025253 | Ga0209677_101513 | Ga0209677_1015137 | 368 |
| 471 | 3300025254 | Ga0209148_1010852 | Ga0209148_10108522 | 368 |
| 472 | 3300025256 | Ga0209759_1000003 | Ga0209759_1000003520 | 368 |
| 473 | 3300025256 | Ga0209759_1001236 | Ga0209759_10012365 | 368 |
| 474 | 3300025256 | Ga0209759_1009207 | Ga0209759_10092071 | 368 |
| 475 | 3300025272 | Ga0209455_1000030 | Ga0209455_1000030263 | 368 |
| 476 | 3300025913 | Ga0207695_10005726 | Ga0207695_100057263 | 368 |
| 477 | 3300025913 | Ga0207695_10323552 | Ga0207695_103235521 | 368 |
| 478 | 3300025919 | Ga0207657_10088986 | Ga0207657_100889862 | 368 |
| 479 | 3300025949 | Ga0207667_10055940 | Ga0207667_100559401 | 368 |
| 480 | 3300025960 | Ga0207651_10080595 | Ga0207651_100805952 | 368 |
| 481 | 3300025981 | Ga0207640_10033626 | Ga0207640_100336261 | 368 |
| 482 | 3300026078 | Ga0207702_10000253 | Ga0207702_1000025326 | 368 |
| 483 | 3300026116 | Ga0207674_10019326 | Ga0207674_100193267 | 368 |
| 484 | 3300031730 | Ga0307516_10018396 | Ga0307516_100183965 | 368 |
| 485 | 3300039447 | Ga0436361_0958334 | Ga0436361_0958334_875_2008 | 368 |
| 486 | 3300046506 | Ga0495583_0000018 | Ga0495583_0000018_35721_36851 | 368 |
| 487 | 3300046507 | Ga0495606_0000870 | Ga0495606_0000870_35205_36335 | 368 |
| 488 | 3300046616 | Ga0495668_0010217 | Ga0495668_0010217_2066_3196 | 368 |
| 489 | 3300046660 | Ga0495625_0048746 | Ga0495625_0048746_1196_2326 | 368 |
| 490 | 3300046694 | Ga0495649_0001395 | Ga0495649_0001395_9223_10353 | 368 |
| 491 | 3300046794 | Ga0495589_0001942 | Ga0495589_0001942_10270_11400 | 368 |
| 492 | 3300047472 | Ga0495686_0008016 | Ga0495686_0008016_5965_7095 | 368 |
| 493 | 3300048907 | Ga0496104_0087476 | Ga0496104_0087476_35_1192 | 368 |
| 494 | 3300050496 | nmdc:mga07m45_4586_c1 | nmdc:mga07m45_4586_c1_479_1612 | 368 |
| 495 | 3300053080 | Ga0500635_0000112 | Ga0500635_0000112_47596_48726 | 368 |
| 496 | iso_pu_bacteria | 2513020051 | 2513228283 | 368 |
| 497 | iso_pu_bacteria | 2643221585 | 2643936542 | 368 |
| 498 | iso_pu_bacteria | 2643221596 | 2643990192 | 368 |
| 499 | iso_pu_bacteria | 2643221609 | 2644059266 | 368 |
| 500 | iso_pu_bacteria | 2643221611 | 2644075696 | 368 |
| 501 | iso_pu_bacteria | 2643221628 | 2644161359 | 368 |
| 502 | iso_pu_bacteria | 2643221652 | 2644295683 | 368 |
| 503 | iso_pu_bacteria | 2643221654 | 2644305278 | 368 |
| 504 | iso_pu_bacteria | 2643221656 | 2644317898 | 368 |
| 505 | iso_pu_bacteria | 2643221658 | 2644324076 | 368 |
| 506 | iso_pu_bacteria | 2643221672 | 2644400738 | 368 |
| 507 | iso_pu_bacteria | 2643221683 | 2644465977 | 368 |
| 508 | iso_pu_bacteria | 2738541277 | 2738720702 | 368 |
| 509 | iso_pu_bacteria | 2738541307 | 2738882302 | 368 |
| 510 | iso_pu_bacteria | 2738541337 | 2739058350 | 368 |
| 511 | iso_pu_bacteria | 2738543019 | 2739279901 | 368 |
| 512 | iso_pu_bacteria | 2831864461 | 2831867932 | 368 |
| 513 | iso_pu_bacteria | 2842677519 | 2842680891 | 368 |
| 514 | iso_pu_bacteria | 2842747753 | 2842749700 | 368 |
| 515 | iso_pu_bacteria | 2885198086 | 2885201824 | 368 |
| 516 | iso_pu_bacteria | 2885211737 | 2885215466 | 368 |
| 517 | iso_pu_bacteria | 2904449895 | 2904453977 | 368 |
| 518 | iso_pu_bacteria | 2904456579 | 2904459485 | 368 |
| 519 | iso_pu_bacteria | 2904541872 | 2904549904 | 368 |
| 520 | iso_pu_bacteria | 2919462493 | 2919465444 | 368 |
| 521 | iso_pu_bacteria | 2928084124 | 2928089718 | 368 |
| 522 | iso_pu_bacteria | 2929160207 | 2929161335 | 368 |
| 523 | iso_pu_bacteria | 2929520902 | 2929521599 | 368 |
| 524 | iso_pu_bacteria | 2932422444 | 2932425459 | 368 |
| 525 | iso_pu_bacteria | 2945909444 | 2945914198 | 368 |
| 526 | iso_pu_bacteria | 2945945610 | 2945949767 | 368 |
| 527 | iso_pu_bacteria | 2945972063 | 2945973788 | 368 |
| 528 | iso_pu_bacteria | 2945984333 | 2945990418 | 368 |
| 529 | iso_pu_bacteria | 2954767861 | 2954770622 | 368 |
| 530 | iso_pu_bacteria | 2990710928 | 2990711089 | 368 |
| 531 | 3300005295 | Ga0065707_10082206 | Ga0065707_1008220613 | 369 |
| 532 | 3300005330 | Ga0070690_100118899 | Ga0070690_1001188992 | 369 |
| 533 | 3300005331 | Ga0070670_100107217 | Ga0070670_1001072172 | 369 |
| 534 | 3300005334 | Ga0068869_100033962 | Ga0068869_1000339622 | 369 |
| 535 | 3300005338 | Ga0068868_100003190 | Ga0068868_1000031906 | 369 |
| 536 | 3300005354 | Ga0070675_100000556 | Ga0070675_10000055619 | 369 |
| 537 | 3300005364 | Ga0070673_100001332 | Ga0070673_1000013326 | 369 |
| 538 | 3300005367 | Ga0070667_100009343 | Ga0070667_1000093437 | 369 |
| 539 | 3300005455 | Ga0070663_100087356 | Ga0070663_1000873562 | 369 |
| 540 | 3300005459 | Ga0068867_100005767 | Ga0068867_1000057679 | 369 |
| 541 | 3300005543 | Ga0070672_100052702 | Ga0070672_1000527023 | 369 |
| 542 | 3300005563 | Ga0068855_100001374 | Ga0068855_10000137414 | 369 |
| 543 | 3300005614 | Ga0068856_100278118 | Ga0068856_1002781182 | 369 |
| 544 | 3300005617 | Ga0068859_100009651 | Ga0068859_1000096516 | 369 |
| 545 | 3300005617 | Ga0068859_100053138 | Ga0068859_1000531384 | 369 |
| 546 | 3300005618 | Ga0068864_100003888 | Ga0068864_1000038886 | 369 |
| 547 | 3300005618 | Ga0068864_100027072 | Ga0068864_1000270724 | 369 |
| 548 | 3300005718 | Ga0068866_10003133 | Ga0068866_100031333 | 369 |
| 549 | 3300005841 | Ga0068863_100004228 | Ga0068863_1000042284 | 369 |
| 550 | 3300005841 | Ga0068863_100357676 | Ga0068863_1003576761 | 369 |
| 551 | 3300005842 | Ga0068858_100000225 | Ga0068858_10000022552 | 369 |
| 552 | 3300005842 | Ga0068858_100025199 | Ga0068858_1000251994 | 369 |
| 553 | 3300005842 | Ga0068858_100027701 | Ga0068858_1000277012 | 369 |
| 554 | 3300005843 | Ga0068860_100035553 | Ga0068860_1000355535 | 369 |
| 555 | 3300005843 | Ga0068860_100047687 | Ga0068860_1000476872 | 369 |
| 556 | 3300005843 | Ga0068860_100124880 | Ga0068860_1001248803 | 369 |
| 557 | 3300005844 | Ga0068862_100002168 | Ga0068862_1000021682 | 369 |
| 558 | 3300005844 | Ga0068862_100193874 | Ga0068862_1001938742 | 369 |
| 559 | 3300006237 | Ga0097621_100026728 | Ga0097621_1000267284 | 369 |
| 560 | 3300006358 | Ga0068871_100043531 | Ga0068871_1000435311 | 369 |
| 561 | 3300006881 | Ga0068865_100001798 | Ga0068865_1000017987 | 369 |
| 562 | 3300006931 | Ga0097620_100009651 | Ga0097620_1000096516 | 369 |
| 563 | 3300006931 | Ga0097620_100053135 | Ga0097620_1000531353 | 369 |
| 564 | 3300009093 | Ga0105240_10064424 | Ga0105240_100644244 | 369 |
| 565 | 3300009551 | Ga0105238_10006890 | Ga0105238_100068905 | 369 |
| 566 | 3300013297 | Ga0157378_10043514 | Ga0157378_100435142 | 369 |
| 567 | 3300013306 | Ga0163162_10060815 | Ga0163162_100608153 | 369 |
| 568 | 3300013308 | Ga0157375_10020633 | Ga0157375_100206333 | 369 |
| 569 | 3300014968 | Ga0157379_10026514 | Ga0157379_100265143 | 369 |
| 570 | 3300017792 | Ga0163161_10011407 | Ga0163161_100114073 | 369 |
| 571 | 3300017792 | Ga0163161_10060862 | Ga0163161_100608622 | 369 |
| 572 | 3300025321 | Ga0207656_10025409 | Ga0207656_100254092 | 369 |
| 573 | 3300025899 | Ga0207642_10073256 | Ga0207642_100732561 | 369 |
| 574 | 3300025903 | Ga0207680_10006999 | Ga0207680_100069995 | 369 |
| 575 | 3300025926 | Ga0207659_10001095 | Ga0207659_1000109510 | 369 |
| 576 | 3300025936 | Ga0207670_10087409 | Ga0207670_100874092 | 369 |
| 577 | 3300025938 | Ga0207704_10017787 | Ga0207704_100177872 | 369 |
| 578 | 3300025940 | Ga0207691_10048304 | Ga0207691_100483043 | 369 |
| 579 | 3300025940 | Ga0207691_10172186 | Ga0207691_101721861 | 369 |
| 580 | 3300025960 | Ga0207651_10002842 | Ga0207651_100028424 | 369 |
| 581 | 3300025986 | Ga0207658_10004188 | Ga0207658_100041886 | 369 |
| 582 | 3300026023 | Ga0207677_10002797 | Ga0207677_100027977 | 369 |
| 583 | 3300026035 | Ga0207703_10003821 | Ga0207703_100038216 | 369 |
| 584 | 3300026035 | Ga0207703_10195540 | Ga0207703_101955402 | 369 |
| 585 | 3300026067 | Ga0207678_10093239 | Ga0207678_100932391 | 369 |
| 586 | 3300026088 | Ga0207641_10002703 | Ga0207641_100027036 | 369 |
| 587 | 3300026088 | Ga0207641_10110586 | Ga0207641_101105863 | 369 |
| 588 | 3300026089 | Ga0207648_10000425 | Ga0207648_100004257 | 369 |
| 589 | 3300026095 | Ga0207676_10008075 | Ga0207676_100080756 | 369 |
| 590 | 3300026118 | Ga0207675_100014494 | Ga0207675_1000144942 | 369 |
| 591 | 3300026121 | Ga0207683_10006649 | Ga0207683_100066494 | 369 |
| 592 | 3300028380 | Ga0268265_10002921 | Ga0268265_1000292113 | 369 |
| 593 | 3300028381 | Ga0268264_10014496 | Ga0268264_100144967 | 369 |
| 594 | 3300028381 | Ga0268264_10442788 | Ga0268264_104427881 | 369 |
| 595 | 3300031548 | Ga0307408_100150299 | Ga0307408_1001502991 | 369 |
| 596 | 3300031852 | Ga0307410_10148171 | Ga0307410_101481711 | 369 |
| 597 | 3300032005 | Ga0307411_10060001 | Ga0307411_100600012 | 369 |
| 598 | 3300035089 | Ga0373944_0025403 | Ga0373944_0025403_471_1601 | 369 |
| 599 | 3300035695 | Ga0373927_0028309 | Ga0373927_0028309_2456_3586 | 369 |
| 600 | 3300037068 | Ga0373925_0004762 | Ga0373925_0004762_3124_4254 | 369 |
| 601 | 3300049649 | Ga0501198_000009 | Ga0501198_000009_6567_7682 | 369 |
| 602 | 3300049662 | Ga0501222_000001 | Ga0501222_000001_177277_178392 | 369 |
| 603 | 3300050493 | nmdc:mga0k408_19674_c1 | nmdc:mga0k408_19674_c1_1819_2955 | 369 |
| 604 | 3300050508 | nmdc:mga09592_16423_c1 | nmdc:mga09592_16423_c1_548_1711 | 369 |
| 605 | 3300053178 | Ga0500637_0121518 | Ga0500637_0121518_341_1492 | 369 |
| 606 | iso_pu_bacteria | 2643221639 | 2644222382 | 369 |
| 607 | iso_pu_bacteria | 2643221646 | 2644256392 | 369 |
| 608 | iso_pu_bacteria | 2858688981 | 2858696046 | 369 |
| 609 | 3300002773 | JGI25152J39213_1000972 | JGI25152J39213_100097213 | 370 |
| 610 | 3300003215 | JGI25153J46596_10001411 | JGI25153J46596_100014115 | 370 |
| 611 | 3300003215 | JGI25153J46596_10002253 | JGI25153J46596_100022534 | 370 |
| 612 | 3300003308 | Ga0006777J48905_1070856 | Ga0006777J48905_10708562 | 370 |
| 613 | 3300003771 | Ga0055526_1002321 | Ga0055526_100232113 | 370 |
| 614 | 3300003791 | Ga0055530_10008382 | Ga0055530_100083822 | 370 |
| 615 | 3300003792 | Ga0055540_1000007 | Ga0055540_1000007179 | 370 |
| 616 | 3300005262 | Ga0065165_1001186 | Ga0065165_10011864 | 370 |
| 617 | 3300005328 | Ga0070676_10009149 | Ga0070676_100091493 | 370 |
| 618 | 3300005328 | Ga0070676_10047522 | Ga0070676_100475221 | 370 |
| 619 | 3300005329 | Ga0070683_100109663 | Ga0070683_1001096632 | 370 |
| 620 | 3300005331 | Ga0070670_100003594 | Ga0070670_1000035947 | 370 |
| 621 | 3300005331 | Ga0070670_100018524 | Ga0070670_1000185246 | 370 |
| 622 | 3300005331 | Ga0070670_100022809 | Ga0070670_1000228095 | 370 |
| 623 | 3300005331 | Ga0070670_100254397 | Ga0070670_1002543972 | 370 |
| 624 | 3300005333 | Ga0070677_10004354 | Ga0070677_100043543 | 370 |
| 625 | 3300005334 | Ga0068869_100006597 | Ga0068869_1000065979 | 370 |
| 626 | 3300005334 | Ga0068869_100008593 | Ga0068869_1000085931 | 370 |
| 627 | 3300005335 | Ga0070666_10029713 | Ga0070666_100297134 | 370 |
| 628 | 3300005336 | Ga0070680_100010602 | Ga0070680_1000106026 | 370 |
| 629 | 3300005338 | Ga0068868_100005381 | Ga0068868_1000053815 | 370 |
| 630 | 3300005339 | Ga0070660_100039265 | Ga0070660_1000392652 | 370 |
| 631 | 3300005344 | Ga0070661_100000108 | Ga0070661_1000001081 | 370 |
| 632 | 3300005347 | Ga0070668_100118463 | Ga0070668_1001184632 | 370 |
| 633 | 3300005353 | Ga0070669_100006476 | Ga0070669_1000064761 | 370 |
| 634 | 3300005354 | Ga0070675_100005294 | Ga0070675_1000052942 | 370 |
| 635 | 3300005354 | Ga0070675_100009078 | Ga0070675_1000090785 | 370 |
| 636 | 3300005354 | Ga0070675_100071018 | Ga0070675_1000710183 | 370 |
| 637 | 3300005355 | Ga0070671_100006922 | Ga0070671_1000069225 | 370 |
| 638 | 3300005355 | Ga0070671_100034758 | Ga0070671_1000347583 | 370 |
| 639 | 3300005364 | Ga0070673_100167424 | Ga0070673_1001674242 | 370 |
| 640 | 3300005366 | Ga0070659_100001701 | Ga0070659_10000170113 | 370 |
| 641 | 3300005367 | Ga0070667_100014368 | Ga0070667_1000143681 | 370 |
| 642 | 3300005367 | Ga0070667_100061042 | Ga0070667_1000610422 | 370 |
| 643 | 3300005438 | Ga0070701_10099426 | Ga0070701_100994261 | 370 |
| 644 | 3300005456 | Ga0070678_100005119 | Ga0070678_1000051195 | 370 |
| 645 | 3300005457 | Ga0070662_100049993 | Ga0070662_1000499932 | 370 |
| 646 | 3300005459 | Ga0068867_100000004 | Ga0068867_100000004157 | 370 |
| 647 | 3300005459 | Ga0068867_100026143 | Ga0068867_1000261433 | 370 |
| 648 | 3300005535 | Ga0070684_100226424 | Ga0070684_1002264242 | 370 |
| 649 | 3300005539 | Ga0068853_100235700 | Ga0068853_1002357001 | 370 |
| 650 | 3300005543 | Ga0070672_100005974 | Ga0070672_1000059744 | 370 |
| 651 | 3300005543 | Ga0070672_100006624 | Ga0070672_1000066241 | 370 |
| 652 | 3300005543 | Ga0070672_100039105 | Ga0070672_1000391055 | 370 |
| 653 | 3300005563 | Ga0068855_100158335 | Ga0068855_1001583353 | 370 |
| 654 | 3300005563 | Ga0068855_100162039 | Ga0068855_1001620393 | 370 |
| 655 | 3300005564 | Ga0070664_100023637 | Ga0070664_1000236373 | 370 |
| 656 | 3300005577 | Ga0068857_100188190 | Ga0068857_1001881902 | 370 |
| 657 | 3300005578 | Ga0068854_100082900 | Ga0068854_1000829003 | 370 |
| 658 | 3300005616 | Ga0068852_100033112 | Ga0068852_1000331121 | 370 |
| 659 | 3300005616 | Ga0068852_100070988 | Ga0068852_1000709883 | 370 |
| 660 | 3300005616 | Ga0068852_100104725 | Ga0068852_1001047252 | 370 |
| 661 | 3300005616 | Ga0068852_100105281 | Ga0068852_1001052813 | 370 |
| 662 | 3300005616 | Ga0068852_100118376 | Ga0068852_1001183762 | 370 |
| 663 | 3300005616 | Ga0068852_100127122 | Ga0068852_1001271222 | 370 |
| 664 | 3300005618 | Ga0068864_100021530 | Ga0068864_1000215305 | 370 |
| 665 | 3300005718 | Ga0068866_10015069 | Ga0068866_100150693 | 370 |
| 666 | 3300005719 | Ga0068861_100004049 | Ga0068861_1000040496 | 370 |
| 667 | 3300005840 | Ga0068870_10010073 | Ga0068870_100100732 | 370 |
| 668 | 3300005841 | Ga0068863_100016559 | Ga0068863_1000165594 | 370 |
| 669 | 3300005842 | Ga0068858_100004355 | Ga0068858_1000043557 | 370 |
| 670 | 3300005842 | Ga0068858_100029372 | Ga0068858_1000293722 | 370 |
| 671 | 3300005843 | Ga0068860_100006985 | Ga0068860_1000069859 | 370 |
| 672 | 3300006178 | Ga0075367_10057940 | Ga0075367_100579402 | 370 |
| 673 | 3300006195 | Ga0075366_10012244 | Ga0075366_100122443 | 370 |
| 674 | 3300006195 | Ga0075366_10043163 | Ga0075366_100431632 | 370 |
| 675 | 3300006195 | Ga0075366_10045445 | Ga0075366_100454453 | 370 |
| 676 | 3300006237 | Ga0097621_100019015 | Ga0097621_1000190155 | 370 |
| 677 | 3300006358 | Ga0068871_100142943 | Ga0068871_1001429433 | 370 |
| 678 | 3300006358 | Ga0068871_100161849 | Ga0068871_1001618491 | 370 |
| 679 | 3300006881 | Ga0068865_100055026 | Ga0068865_1000550263 | 370 |
| 680 | 3300006944 | Ga0099823_1000232 | Ga0099823_100023217 | 370 |
| 681 | 3300006946 | Ga0079104_1000009 | Ga0079104_1000009121 | 370 |
| 682 | 3300009098 | Ga0105245_10159428 | Ga0105245_101594282 | 370 |
| 683 | 3300009148 | Ga0105243_10003290 | Ga0105243_1000329010 | 370 |
| 684 | 3300009177 | Ga0105248_10032848 | Ga0105248_100328485 | 370 |
| 685 | 3300009551 | Ga0105238_10056231 | Ga0105238_100562313 | 370 |
| 686 | 3300012497 | Ga0157319_1000004 | Ga0157319_1000004128 | 370 |
| 687 | 3300013105 | Ga0157369_10092342 | Ga0157369_100923422 | 370 |
| 688 | 3300013296 | Ga0157374_10178621 | Ga0157374_101786212 | 370 |
| 689 | 3300013306 | Ga0163162_10015161 | Ga0163162_100151617 | 370 |
| 690 | 3300013308 | Ga0157375_10005490 | Ga0157375_100054906 | 370 |
| 691 | 3300013308 | Ga0157375_10014943 | Ga0157375_100149437 | 370 |
| 692 | 3300014326 | Ga0157380_10009516 | Ga0157380_100095167 | 370 |
| 693 | 3300014745 | Ga0157377_10000010 | Ga0157377_10000010217 | 370 |
| 694 | 3300014968 | Ga0157379_10010838 | Ga0157379_100108387 | 370 |
| 695 | 3300014968 | Ga0157379_10068550 | Ga0157379_100685504 | 370 |
| 696 | 3300014969 | Ga0157376_10103260 | Ga0157376_101032602 | 370 |
| 697 | 3300017792 | Ga0163161_10032549 | Ga0163161_100325495 | 370 |
| 698 | 3300017792 | Ga0163161_10041709 | Ga0163161_100417093 | 370 |
| 699 | 3300021361 | Ga0213872_10000233 | Ga0213872_100002332 | 370 |
| 700 | 3300025245 | Ga0207425_1000196 | Ga0207425_100019613 | 370 |
| 701 | 3300025258 | Ga0209129_1000035 | Ga0209129_100003514 | 370 |
| 702 | 3300025273 | Ga0209673_1002863 | Ga0209673_10028633 | 370 |
| 703 | 3300025295 | Ga0209564_1000024 | Ga0209564_1000024208 | 370 |
| 704 | 3300025297 | Ga0209758_1000558 | Ga0209758_100055820 | 370 |
| 705 | 3300025297 | Ga0209758_1001090 | Ga0209758_100109012 | 370 |
| 706 | 3300025298 | Ga0209050_1000246 | Ga0209050_1000246123 | 370 |
| 707 | 3300025298 | Ga0209050_1000266 | Ga0209050_100026613 | 370 |
| 708 | 3300025298 | Ga0209050_1002399 | Ga0209050_10023998 | 370 |
| 709 | 3300025299 | Ga0209256_1000019 | Ga0209256_1000019177 | 370 |
| 710 | 3300025299 | Ga0209256_1000840 | Ga0209256_10008401 | 370 |
| 711 | 3300025299 | Ga0209256_1005599 | Ga0209256_10055999 | 370 |
| 712 | 3300025303 | Ga0209051_1000004 | Ga0209051_1000004233 | 370 |
| 713 | 3300025303 | Ga0209051_1010874 | Ga0209051_10108741 | 370 |
| 714 | 3300025304 | Ga0209257_1000038 | Ga0209257_1000038367 | 370 |
| 715 | 3300025304 | Ga0209257_1000044 | Ga0209257_1000044192 | 370 |
| 716 | 3300025304 | Ga0209257_1002054 | Ga0209257_10020541 | 370 |
| 717 | 3300025304 | Ga0209257_1006483 | Ga0209257_10064839 | 370 |
| 718 | 3300025315 | Ga0207697_10020450 | Ga0207697_100204503 | 370 |
| 719 | 3300025901 | Ga0207688_10189794 | Ga0207688_101897941 | 370 |
| 720 | 3300025907 | Ga0207645_10014439 | Ga0207645_100144393 | 370 |
| 721 | 3300025907 | Ga0207645_10028782 | Ga0207645_100287825 | 370 |
| 722 | 3300025908 | Ga0207643_10021976 | Ga0207643_100219763 | 370 |
| 723 | 3300025917 | Ga0207660_10047655 | Ga0207660_100476553 | 370 |
| 724 | 3300025919 | Ga0207657_10034399 | Ga0207657_100343993 | 370 |
| 725 | 3300025920 | Ga0207649_10000762 | Ga0207649_1000076219 | 370 |
| 726 | 3300025921 | Ga0207652_10308097 | Ga0207652_103080971 | 370 |
| 727 | 3300025923 | Ga0207681_10000326 | Ga0207681_1000032613 | 370 |
| 728 | 3300025925 | Ga0207650_10004536 | Ga0207650_100045363 | 370 |
| 729 | 3300025925 | Ga0207650_10009583 | Ga0207650_100095836 | 370 |
| 730 | 3300025926 | Ga0207659_10011221 | Ga0207659_100112216 | 370 |
| 731 | 3300025926 | Ga0207659_10023552 | Ga0207659_100235522 | 370 |
| 732 | 3300025926 | Ga0207659_10039343 | Ga0207659_100393433 | 370 |
| 733 | 3300025926 | Ga0207659_10310467 | Ga0207659_103104671 | 370 |
| 734 | 3300025927 | Ga0207687_10007222 | Ga0207687_100072229 | 370 |
| 735 | 3300025931 | Ga0207644_10004898 | Ga0207644_100048985 | 370 |
| 736 | 3300025932 | Ga0207690_10002897 | Ga0207690_100028979 | 370 |
| 737 | 3300025934 | Ga0207686_10047576 | Ga0207686_100475762 | 370 |
| 738 | 3300025935 | Ga0207709_10000990 | Ga0207709_100009904 | 370 |
| 739 | 3300025937 | Ga0207669_10030025 | Ga0207669_100300254 | 370 |
| 740 | 3300025937 | Ga0207669_10144802 | Ga0207669_101448021 | 370 |
| 741 | 3300025940 | Ga0207691_10008199 | Ga0207691_100081993 | 370 |
| 742 | 3300025940 | Ga0207691_10012361 | Ga0207691_100123613 | 370 |
| 743 | 3300025940 | Ga0207691_10066154 | Ga0207691_100661544 | 370 |
| 744 | 3300025941 | Ga0207711_10001731 | Ga0207711_1000173116 | 370 |
| 745 | 3300025941 | Ga0207711_10014562 | Ga0207711_100145622 | 370 |
| 746 | 3300025942 | Ga0207689_10001900 | Ga0207689_100019004 | 370 |
| 747 | 3300025942 | Ga0207689_10004982 | Ga0207689_100049828 | 370 |
| 748 | 3300025944 | Ga0207661_10134466 | Ga0207661_101344661 | 370 |
| 749 | 3300025945 | Ga0207679_10000202 | Ga0207679_100002028 | 370 |
| 750 | 3300025945 | Ga0207679_10020265 | Ga0207679_100202655 | 370 |
| 751 | 3300025949 | Ga0207667_10020318 | Ga0207667_100203188 | 370 |
| 752 | 3300025960 | Ga0207651_10024120 | Ga0207651_100241203 | 370 |
| 753 | 3300025960 | Ga0207651_10087435 | Ga0207651_100874352 | 370 |
| 754 | 3300025961 | Ga0207712_10040571 | Ga0207712_100405712 | 370 |
| 755 | 3300025981 | Ga0207640_10176446 | Ga0207640_101764462 | 370 |
| 756 | 3300025986 | Ga0207658_10001421 | Ga0207658_1000142111 | 370 |
| 757 | 3300025986 | Ga0207658_10002120 | Ga0207658_100021208 | 370 |
| 758 | 3300025986 | Ga0207658_10034602 | Ga0207658_100346023 | 370 |
| 759 | 3300025986 | Ga0207658_10266527 | Ga0207658_102665271 | 370 |
| 760 | 3300026023 | Ga0207677_10025366 | Ga0207677_100253662 | 370 |
| 761 | 3300026023 | Ga0207677_10025732 | Ga0207677_100257322 | 370 |
| 762 | 3300026023 | Ga0207677_10048246 | Ga0207677_100482463 | 370 |
| 763 | 3300026035 | Ga0207703_10001042 | Ga0207703_1000104223 | 370 |
| 764 | 3300026035 | Ga0207703_10013562 | Ga0207703_100135622 | 370 |
| 765 | 3300026041 | Ga0207639_10012399 | Ga0207639_100123991 | 370 |
| 766 | 3300026041 | Ga0207639_10180012 | Ga0207639_101800122 | 370 |
| 767 | 3300026078 | Ga0207702_10273752 | Ga0207702_102737521 | 370 |
| 768 | 3300026088 | Ga0207641_10005975 | Ga0207641_100059759 | 370 |
| 769 | 3300026088 | Ga0207641_10041164 | Ga0207641_100411643 | 370 |
| 770 | 3300026089 | Ga0207648_10000002 | Ga0207648_10000002154 | 370 |
| 771 | 3300026089 | Ga0207648_10011180 | Ga0207648_100111806 | 370 |
| 772 | 3300026089 | Ga0207648_10016034 | Ga0207648_100160341 | 370 |
| 773 | 3300026089 | Ga0207648_10016341 | Ga0207648_100163412 | 370 |
| 774 | 3300026095 | Ga0207676_10005558 | Ga0207676_100055583 | 370 |
| 775 | 3300026095 | Ga0207676_10028014 | Ga0207676_100280144 | 370 |
| 776 | 3300026095 | Ga0207676_10258309 | Ga0207676_102583092 | 370 |
| 777 | 3300026116 | Ga0207674_10298072 | Ga0207674_102980722 | 370 |
| 778 | 3300026118 | Ga0207675_100002569 | Ga0207675_1000025692 | 370 |
| 779 | 3300026118 | Ga0207675_100005687 | Ga0207675_1000056875 | 370 |
| 780 | 3300026118 | Ga0207675_100057826 | Ga0207675_1000578264 | 370 |
| 781 | 3300026121 | Ga0207683_10029871 | Ga0207683_100298714 | 370 |
| 782 | 3300026121 | Ga0207683_10044133 | Ga0207683_100441334 | 370 |
| 783 | 3300026142 | Ga0207698_10032405 | Ga0207698_100324053 | 370 |
| 784 | 3300026142 | Ga0207698_10044206 | Ga0207698_100442064 | 370 |
| 785 | 3300026142 | Ga0207698_10149145 | Ga0207698_101491452 | 370 |
| 786 | 3300026142 | Ga0207698_10152220 | Ga0207698_101522202 | 370 |
| 787 | 3300027111 | Ga0209281_1000023 | Ga0209281_1000023266 | 370 |
| 788 | 3300027296 | Ga0209389_1002721 | Ga0209389_10027213 | 370 |
| 789 | 3300027312 | Ga0209371_1008958 | Ga0209371_10089584 | 370 |
| 790 | 3300027876 | Ga0209974_10002823 | Ga0209974_100028234 | 370 |
| 791 | 3300028380 | Ga0268265_10057721 | Ga0268265_100577213 | 370 |
| 792 | 3300028381 | Ga0268264_10001548 | Ga0268264_1000154814 | 370 |
| 793 | 3300028794 | Ga0307515_10002735 | Ga0307515_1000273528 | 370 |
| 794 | 3300028794 | Ga0307515_10004327 | Ga0307515_1000432712 | 370 |
| 795 | 3300028794 | Ga0307515_10009775 | Ga0307515_100097756 | 370 |
| 796 | 3300030500 | Ga0268256_1010289 | Ga0268256_10102894 | 370 |
| 797 | 3300030522 | Ga0307512_10025372 | Ga0307512_100253724 | 370 |
| 798 | 3300031250 | Ga0265331_10007166 | Ga0265331_100071663 | 370 |
| 799 | 3300031251 | Ga0265327_10000035 | Ga0265327_10000035142 | 370 |
| 800 | 3300031548 | Ga0307408_100000029 | Ga0307408_10000002910 | 370 |
| 801 | 3300031548 | Ga0307408_100013966 | Ga0307408_1000139662 | 370 |
| 802 | 3300031616 | Ga0307508_10000050 | Ga0307508_1000005074 | 370 |
| 803 | 3300031711 | Ga0265314_10002601 | Ga0265314_1000260119 | 370 |
| 804 | 3300031730 | Ga0307516_10000879 | Ga0307516_1000087924 | 370 |
| 805 | 3300031730 | Ga0307516_10087710 | Ga0307516_100877102 | 370 |
| 806 | 3300031731 | Ga0307405_10000330 | Ga0307405_1000033010 | 370 |
| 807 | 3300031824 | Ga0307413_10078925 | Ga0307413_100789252 | 370 |
| 808 | 3300031852 | Ga0307410_10118254 | Ga0307410_101182542 | 370 |
| 809 | 3300031901 | Ga0307406_10010474 | Ga0307406_100104741 | 370 |
| 810 | 3300031911 | Ga0307412_10002581 | Ga0307412_100025814 | 370 |
| 811 | 3300031911 | Ga0307412_10347045 | Ga0307412_103470451 | 370 |
| 812 | 3300032002 | Ga0307416_100048307 | Ga0307416_1000483075 | 370 |
| 813 | 3300032002 | Ga0307416_100303875 | Ga0307416_1003038751 | 370 |
| 814 | 3300032004 | Ga0307414_10081814 | Ga0307414_100818142 | 370 |
| 815 | 3300032005 | Ga0307411_10012343 | Ga0307411_100123432 | 370 |
| 816 | 3300032005 | Ga0307411_10116582 | Ga0307411_101165822 | 370 |
| 817 | 3300035114 | Ga0373939_0000114 | Ga0373939_0000114_7475_8599 | 370 |
| 818 | 3300035691 | Ga0373931_0001114 | Ga0373931_0001114_3515_4633 | 370 |
| 819 | 3300035691 | Ga0373931_0033420 | Ga0373931_0033420_792_1946 | 370 |
| 820 | 3300035691 | Ga0373931_0050825 | Ga0373931_0050825_903_2027 | 370 |
| 821 | 3300037068 | Ga0373925_0018650 | Ga0373925_0018650_3190_4314 | 370 |
| 822 | 3300037471 | Ga0395905_0005213 | Ga0395905_0005213_4823_5953 | 370 |
| 823 | 3300037471 | Ga0395905_0012217 | Ga0395905_0012217_4651_5775 | 370 |
| 824 | 3300039447 | Ga0436361_1013275 | Ga0436361_1013275_1437_2561 | 370 |
| 825 | 3300039447 | Ga0436361_1167303 | Ga0436361_1167303_13197_14321 | 370 |
| 826 | 3300039447 | Ga0436361_1187903 | Ga0436361_1187903_1442_2566 | 370 |
| 827 | 3300039450 | Ga0436363_0328320 | Ga0436363_0328320_61_1203 | 370 |
| 828 | 3300041459 | Ga0451800_1314933 | Ga0451800_1314933_468_1586 | 370 |
| 829 | 3300042126 | Ga0450888_001580 | Ga0450888_001580_372_1496 | 370 |
| 830 | 3300042144 | Ga0450889_001137 | Ga0450889_001137_334_1458 | 370 |
| 831 | 3300042531 | Ga0450918_000470 | Ga0450918_000470_2235_3353 | 370 |
| 832 | 3300042532 | Ga0450893_0003122 | Ga0450893_0003122_195_1319 | 370 |
| 833 | 3300046690 | Ga0495624_0012670 | Ga0495624_0012670_2777_3895 | 370 |
| 834 | 3300048908 | Ga0496105_0069379 | Ga0496105_0069379_1504_2652 | 370 |
| 835 | 3300048909 | Ga0496106_0014315 | Ga0496106_0014315_3604_4758 | 370 |
| 836 | 3300048911 | Ga0496108_0099831 | Ga0496108_0099831_485_1639 | 370 |
| 837 | 3300048918 | Ga0496115_0047347 | Ga0496115_0047347_1311_2465 | 370 |
| 838 | 3300049579 | Ga0501043_0000071 | Ga0501043_0000071_61087_62205 | 370 |
| 839 | 3300049580 | Ga0501046_0003675 | Ga0501046_0003675_12349_13467 | 370 |
| 840 | 3300049581 | Ga0501047_0000087 | Ga0501047_0000087_55133_56251 | 370 |
| 841 | 3300049581 | Ga0501047_0073348 | Ga0501047_0073348_1793_2908 | 370 |
| 842 | 3300049663 | Ga0501223_010748 | Ga0501223_010748_393_1517 | 370 |
| 843 | 3300049682 | Ga0501252_003776 | Ga0501252_003776_359_1477 | 370 |
| 844 | 3300049706 | Ga0501229_000045 | Ga0501229_000045_604_1728 | 370 |
| 845 | 3300049824 | Ga0501045_0015438 | Ga0501045_0015438_3619_4737 | 370 |
| 846 | 3300050496 | nmdc:mga07m45_5166_c1 | nmdc:mga07m45_5166_c1_1495_2619 | 370 |
| 847 | 3300053086 | Ga0500578_0000057 | Ga0500578_0000057_51918_53036 | 370 |
| 848 | 3300053131 | Ga0500652_003063 | Ga0500652_003063_468_1589 | 370 |
| 849 | iso_pu_bacteria | 2738543013 | 2739251926 | 370 |
| 850 | 3300003187 | JGI25151J46595_10000362 | JGI25151J46595_1000036238 | 371 |
| 851 | 3300003759 | Ga0055525_1000004 | Ga0055525_1000004119 | 371 |
| 852 | 3300003771 | Ga0055526_1000374 | Ga0055526_100037425 | 371 |
| 853 | 3300003771 | Ga0055526_1002595 | Ga0055526_10025958 | 371 |
| 854 | 3300003773 | Ga0055537_1001076 | Ga0055537_10010765 | 371 |
| 855 | 3300003775 | Ga0055524_1001870 | Ga0055524_10018704 | 371 |
| 856 | 3300003775 | Ga0055524_1010050 | Ga0055524_10100503 | 371 |
| 857 | 3300003784 | Ga0055534_1000233 | Ga0055534_10002331 | 371 |
| 858 | 3300005262 | Ga0065165_1000116 | Ga0065165_100011695 | 371 |
| 859 | 3300005328 | Ga0070676_10005340 | Ga0070676_100053403 | 371 |
| 860 | 3300005331 | Ga0070670_100083123 | Ga0070670_1000831233 | 371 |
| 861 | 3300005334 | Ga0068869_100055320 | Ga0068869_1000553203 | 371 |
| 862 | 3300005338 | Ga0068868_100034195 | Ga0068868_1000341952 | 371 |
| 863 | 3300005338 | Ga0068868_100060430 | Ga0068868_1000604302 | 371 |
| 864 | 3300005355 | Ga0070671_100066536 | Ga0070671_1000665363 | 371 |
| 865 | 3300005364 | Ga0070673_100141459 | Ga0070673_1001414591 | 371 |
| 866 | 3300005455 | Ga0070663_100029920 | Ga0070663_1000299204 | 371 |
| 867 | 3300005459 | Ga0068867_100176513 | Ga0068867_1001765131 | 371 |
| 868 | 3300005539 | Ga0068853_100086109 | Ga0068853_1000861092 | 371 |
| 869 | 3300005563 | Ga0068855_100039778 | Ga0068855_1000397782 | 371 |
| 870 | 3300005840 | Ga0068870_10016725 | Ga0068870_100167253 | 371 |
| 871 | 3300005841 | Ga0068863_100009638 | Ga0068863_1000096388 | 371 |
| 872 | 3300005843 | Ga0068860_100494227 | Ga0068860_1004942271 | 371 |
| 873 | 3300006051 | Ga0075364_10070186 | Ga0075364_100701861 | 371 |
| 874 | 3300006178 | Ga0075367_10003802 | Ga0075367_100038027 | 371 |
| 875 | 3300006178 | Ga0075367_10089237 | Ga0075367_100892373 | 371 |
| 876 | 3300006195 | Ga0075366_10008033 | Ga0075366_100080333 | 371 |
| 877 | 3300006195 | Ga0075366_10065786 | Ga0075366_100657863 | 371 |
| 878 | 3300006353 | Ga0075370_10004362 | Ga0075370_100043622 | 371 |
| 879 | 3300006353 | Ga0075370_10011497 | Ga0075370_100114975 | 371 |
| 880 | 3300006353 | Ga0075370_10017865 | Ga0075370_100178654 | 371 |
| 881 | 3300006353 | Ga0075370_10050205 | Ga0075370_100502051 | 371 |
| 882 | 3300006353 | Ga0075370_10060228 | Ga0075370_100602282 | 371 |
| 883 | 3300009148 | Ga0105243_10203124 | Ga0105243_102031241 | 371 |
| 884 | 3300009545 | Ga0105237_10021585 | Ga0105237_100215856 | 371 |
| 885 | 3300013308 | Ga0157375_10025537 | Ga0157375_100255373 | 371 |
| 886 | 3300014969 | Ga0157376_10003392 | Ga0157376_100033924 | 371 |
| 887 | 3300015683 | Ga0183362_10003 | Ga0183362_10003861 | 371 |
| 888 | 3300021361 | Ga0213872_10001634 | Ga0213872_100016347 | 371 |
| 889 | 3300025230 | Ga0209563_100013 | Ga0209563_100013119 | 371 |
| 890 | 3300025263 | Ga0209565_1000053 | Ga0209565_100005315 | 371 |
| 891 | 3300025273 | Ga0209673_1016035 | Ga0209673_10160352 | 371 |
| 892 | 3300025273 | Ga0209673_1042876 | Ga0209673_10428761 | 371 |
| 893 | 3300025291 | Ga0209675_1000091 | Ga0209675_100009115 | 371 |
| 894 | 3300025291 | Ga0209675_1005160 | Ga0209675_10051604 | 371 |
| 895 | 3300025294 | Ga0209025_1000085 | Ga0209025_1000085176 | 371 |
| 896 | 3300025294 | Ga0209025_1000123 | Ga0209025_100012338 | 371 |
| 897 | 3300025294 | Ga0209025_1000838 | Ga0209025_100083813 | 371 |
| 898 | 3300025295 | Ga0209564_1000021 | Ga0209564_1000021293 | 371 |
| 899 | 3300025295 | Ga0209564_1000170 | Ga0209564_100017037 | 371 |
| 900 | 3300025295 | Ga0209564_1002189 | Ga0209564_10021894 | 371 |
| 901 | 3300025298 | Ga0209050_1006483 | Ga0209050_10064833 | 371 |
| 902 | 3300025299 | Ga0209256_1000407 | Ga0209256_100040713 | 371 |
| 903 | 3300025299 | Ga0209256_1001471 | Ga0209256_100147112 | 371 |
| 904 | 3300025303 | Ga0209051_1002164 | Ga0209051_10021644 | 371 |
| 905 | 3300025303 | Ga0209051_1016391 | Ga0209051_10163913 | 371 |
| 906 | 3300025304 | Ga0209257_1000047 | Ga0209257_1000047107 | 371 |
| 907 | 3300025907 | Ga0207645_10021447 | Ga0207645_100214474 | 371 |
| 908 | 3300025914 | Ga0207671_10101565 | Ga0207671_101015652 | 371 |
| 909 | 3300025927 | Ga0207687_10005793 | Ga0207687_100057934 | 371 |
| 910 | 3300025931 | Ga0207644_10142764 | Ga0207644_101427642 | 371 |
| 911 | 3300025938 | Ga0207704_10056114 | Ga0207704_100561143 | 371 |
| 912 | 3300025942 | Ga0207689_10128154 | Ga0207689_101281542 | 371 |
| 913 | 3300026023 | Ga0207677_10009333 | Ga0207677_100093335 | 371 |
| 914 | 3300026023 | Ga0207677_10010579 | Ga0207677_100105793 | 371 |
| 915 | 3300026089 | Ga0207648_10213997 | Ga0207648_102139973 | 371 |
| 916 | 3300026095 | Ga0207676_10396978 | Ga0207676_103969781 | 371 |
| 917 | 3300026116 | Ga0207674_10019462 | Ga0207674_100194626 | 371 |
| 918 | 3300028381 | Ga0268264_10468119 | Ga0268264_104681191 | 371 |
| 919 | 3300028786 | Ga0307517_10001027 | Ga0307517_1000102730 | 371 |
| 920 | 3300028794 | Ga0307515_10029645 | Ga0307515_100296451 | 371 |
| 921 | 3300028794 | Ga0307515_10033526 | Ga0307515_100335262 | 371 |
| 922 | 3300028794 | Ga0307515_10035888 | Ga0307515_100358886 | 371 |
| 923 | 3300028794 | Ga0307515_10042814 | Ga0307515_100428142 | 371 |
| 924 | 3300030522 | Ga0307512_10036833 | Ga0307512_100368332 | 371 |
| 925 | 3300031456 | Ga0307513_10292868 | Ga0307513_102928681 | 371 |
| 926 | 3300031507 | Ga0307509_10000993 | Ga0307509_1000099330 | 371 |
| 927 | 3300031507 | Ga0307509_10012095 | Ga0307509_1001209511 | 371 |
| 928 | 3300031507 | Ga0307509_10052048 | Ga0307509_100520484 | 371 |
| 929 | 3300031507 | Ga0307509_10113528 | Ga0307509_101135282 | 371 |
| 930 | 3300031616 | Ga0307508_10016037 | Ga0307508_100160373 | 371 |
| 931 | 3300031616 | Ga0307508_10041729 | Ga0307508_100417293 | 371 |
| 932 | 3300031649 | Ga0307514_10011020 | Ga0307514_100110204 | 371 |
| 933 | 3300031730 | Ga0307516_10094213 | Ga0307516_100942134 | 371 |
| 934 | 3300031730 | Ga0307516_10200092 | Ga0307516_102000922 | 371 |
| 935 | 3300033179 | Ga0307507_10211099 | Ga0307507_102110991 | 371 |
| 936 | 3300033180 | Ga0307510_10000129 | Ga0307510_100001291 | 371 |
| 937 | 3300033180 | Ga0307510_10088323 | Ga0307510_100883232 | 371 |
| 938 | 3300036401 | Ga0373937_0060748 | Ga0373937_0060748_2064_3323 | 371 |
| 939 | 3300037471 | Ga0395905_0005228 | Ga0395905_0005228_5599_6726 | 371 |
| 940 | 3300039447 | Ga0436361_0504982 | Ga0436361_0504982_57458_58597 | 371 |
| 941 | 3300039447 | Ga0436361_0941839 | Ga0436361_0941839_168136_169266 | 371 |
| 942 | 3300042007 | Ga0439449_0003507 | Ga0439449_0003507_4261_5403 | 371 |
| 943 | 3300046454 | Ga0495592_0000421 | Ga0495592_0000421_5450_6571 | 371 |
| 944 | 3300046457 | Ga0495590_0011692 | Ga0495590_0011692_242_1369 | 371 |
| 945 | 3300046471 | Ga0495650_0006869 | Ga0495650_0006869_4423_5568 | 371 |
| 946 | 3300046472 | Ga0495580_0004160 | Ga0495580_0004160_10387_11529 | 371 |
| 947 | 3300046526 | Ga0495666_0001113 | Ga0495666_0001113_1599_2741 | 371 |
| 948 | 3300046660 | Ga0495625_0013462 | Ga0495625_0013462_2802_3944 | 371 |
| 949 | 3300046694 | Ga0495649_0003876 | Ga0495649_0003876_5960_7102 | 371 |
| 950 | 3300048919 | Ga0496116_0044569 | Ga0496116_0044569_103_1242 | 371 |
| 951 | 3300049571 | Ga0501034_0000056 | Ga0501034_0000056_163146_164288 | 371 |
| 952 | 3300050489 | nmdc:mga03683_17689_c1 | nmdc:mga03683_17689_c1_23_1165 | 371 |
| 953 | 3300050493 | nmdc:mga0k408_223_c2 | nmdc:mga0k408_223_c2_1932_3074 | 371 |
| 954 | 3300050493 | nmdc:mga0k408_412_c1 | nmdc:mga0k408_412_c1_18040_19173 | 371 |
| 955 | 3300050493 | nmdc:mga0k408_6089_c1 | nmdc:mga0k408_6089_c1_5187_6329 | 371 |
| 956 | 3300050496 | nmdc:mga07m45_1175_c1 | nmdc:mga07m45_1175_c1_177_1319 | 371 |
| 957 | 3300050496 | nmdc:mga07m45_183_c1 | nmdc:mga07m45_183_c1_2074_3216 | 371 |
| 958 | 3300050496 | nmdc:mga07m45_38640_c1 | nmdc:mga07m45_38640_c1_857_1978 | 371 |
| 959 | 3300059421 | Ga0590071_001911 | Ga0590071_001911_2386_3522 | 371 |
| 960 | 3300001979 | JGI24740J21852_10052861 | JGI24740J21852_100528611 | 372 |
| 961 | 3300002774 | JGI25150J39212_1006600 | JGI25150J39212_10066002 | 372 |
| 962 | 3300003187 | JGI25151J46595_10000972 | JGI25151J46595_1000097210 | 372 |
| 963 | 3300003187 | JGI25151J46595_10001552 | JGI25151J46595_100015526 | 372 |
| 964 | 3300003187 | JGI25151J46595_10026424 | JGI25151J46595_100264242 | 372 |
| 965 | 3300003374 | JGI25161J50226_1003108 | JGI25161J50226_10031083 | 372 |
| 966 | 3300003781 | Ga0055536_1000112 | Ga0055536_100011257 | 372 |
| 967 | 3300003781 | Ga0055536_1005250 | Ga0055536_10052502 | 372 |
| 968 | 3300003784 | Ga0055534_1000536 | Ga0055534_10005366 | 372 |
| 969 | 3300003784 | Ga0055534_1002239 | Ga0055534_10022392 | 372 |
| 970 | 3300003784 | Ga0055534_1002715 | Ga0055534_10027152 | 372 |
| 971 | 3300003792 | Ga0055540_1004117 | Ga0055540_10041172 | 372 |
| 972 | 3300003794 | Ga0055531_10003405 | Ga0055531_100034057 | 372 |
| 973 | 3300005289 | Ga0065704_10156447 | Ga0065704_101564471 | 372 |
| 974 | 3300005456 | Ga0070678_100347224 | Ga0070678_1003472241 | 372 |
| 975 | 3300005548 | Ga0070665_100055139 | Ga0070665_1000551392 | 372 |
| 976 | 3300005548 | Ga0070665_100385225 | Ga0070665_1003852251 | 372 |
| 977 | 3300005564 | Ga0070664_100019559 | Ga0070664_1000195593 | 372 |
| 978 | 3300006038 | Ga0075365_10117637 | Ga0075365_101176372 | 372 |
| 979 | 3300006178 | Ga0075367_10085948 | Ga0075367_100859483 | 372 |
| 980 | 3300006195 | Ga0075366_10005214 | Ga0075366_100052147 | 372 |
| 981 | 3300006353 | Ga0075370_10001068 | Ga0075370_100010683 | 372 |
| 982 | 3300006353 | Ga0075370_10001217 | Ga0075370_1000121711 | 372 |
| 983 | 3300006353 | Ga0075370_10002762 | Ga0075370_100027626 | 372 |
| 984 | 3300006353 | Ga0075370_10005946 | Ga0075370_100059463 | 372 |
| 985 | 3300006353 | Ga0075370_10074305 | Ga0075370_100743052 | 372 |
| 986 | 3300006846 | Ga0075430_100082419 | Ga0075430_1000824192 | 372 |
| 987 | 3300006948 | Ga0099826_10002824 | Ga0099826_100028248 | 372 |
| 988 | 3300009098 | Ga0105245_10438964 | Ga0105245_104389641 | 372 |
| 989 | 3300009148 | Ga0105243_10004194 | Ga0105243_100041943 | 372 |
| 990 | 3300009148 | Ga0105243_10037020 | Ga0105243_100370203 | 372 |
| 991 | 3300009176 | Ga0105242_10001421 | Ga0105242_100014214 | 372 |
| 992 | 3300009176 | Ga0105242_10117104 | Ga0105242_101171042 | 372 |
| 993 | 3300009545 | Ga0105237_10015429 | Ga0105237_100154294 | 372 |
| 994 | 3300009551 | Ga0105238_10317745 | Ga0105238_103177451 | 372 |
| 995 | 3300013104 | Ga0157370_10008219 | Ga0157370_100082193 | 372 |
| 996 | 3300013105 | Ga0157369_10005838 | Ga0157369_1000583813 | 372 |
| 997 | 3300013306 | Ga0163162_10121871 | Ga0163162_101218711 | 372 |
| 998 | 3300014497 | Ga0182008_10001216 | Ga0182008_100012169 | 372 |
| 999 | 3300014497 | Ga0182008_10003469 | Ga0182008_100034691 | 372 |
| 1000 | 3300015261 | Ga0182006_1000937 | Ga0182006_10009378 | 372 |
| 1001 | 3300015262 | Ga0182007_10000419 | Ga0182007_100004199 | 372 |
| 1002 | 3300015262 | Ga0182007_10000746 | Ga0182007_100007465 | 372 |
| 1003 | 3300017792 | Ga0163161_10003954 | Ga0163161_1000395410 | 372 |
| 1004 | 3300017792 | Ga0163161_10066164 | Ga0163161_100661642 | 372 |
| 1005 | 3300017792 | Ga0163161_10073247 | Ga0163161_100732473 | 372 |
| 1006 | 3300017792 | Ga0163161_10219409 | Ga0163161_102194092 | 372 |
| 1007 | 3300025245 | Ga0207425_1000663 | Ga0207425_10006638 | 372 |
| 1008 | 3300025258 | Ga0209129_1000084 | Ga0209129_100008411 | 372 |
| 1009 | 3300025258 | Ga0209129_1001344 | Ga0209129_10013443 | 372 |
| 1010 | 3300025263 | Ga0209565_1000169 | Ga0209565_100016912 | 372 |
| 1011 | 3300025273 | Ga0209673_1000114 | Ga0209673_100011412 | 372 |
| 1012 | 3300025284 | Ga0209130_1000621 | Ga0209130_100062111 | 372 |
| 1013 | 3300025284 | Ga0209130_1001206 | Ga0209130_10012063 | 372 |
| 1014 | 3300025291 | Ga0209675_1000043 | Ga0209675_1000043151 | 372 |
| 1015 | 3300025291 | Ga0209675_1000062 | Ga0209675_100006212 | 372 |
| 1016 | 3300025291 | Ga0209675_1001454 | Ga0209675_100145411 | 372 |
| 1017 | 3300025291 | Ga0209675_1002744 | Ga0209675_10027448 | 372 |
| 1018 | 3300025292 | Ga0209676_1000083 | Ga0209676_1000083198 | 372 |
| 1019 | 3300025292 | Ga0209676_1000999 | Ga0209676_100099921 | 372 |
| 1020 | 3300025292 | Ga0209676_1001040 | Ga0209676_100104012 | 372 |
| 1021 | 3300025294 | Ga0209025_1000106 | Ga0209025_1000106142 | 372 |
| 1022 | 3300025294 | Ga0209025_1000678 | Ga0209025_100067831 | 372 |
| 1023 | 3300025294 | Ga0209025_1000719 | Ga0209025_100071922 | 372 |
| 1024 | 3300025294 | Ga0209025_1000861 | Ga0209025_100086114 | 372 |
| 1025 | 3300025294 | Ga0209025_1005452 | Ga0209025_10054521 | 372 |
| 1026 | 3300025294 | Ga0209025_1016647 | Ga0209025_10166474 | 372 |
| 1027 | 3300025295 | Ga0209564_1001047 | Ga0209564_100104724 | 372 |
| 1028 | 3300025295 | Ga0209564_1001096 | Ga0209564_100109621 | 372 |
| 1029 | 3300025297 | Ga0209758_1000754 | Ga0209758_100075423 | 372 |
| 1030 | 3300025298 | Ga0209050_1002554 | Ga0209050_10025545 | 372 |
| 1031 | 3300025299 | Ga0209256_1000206 | Ga0209256_100020636 | 372 |
| 1032 | 3300025302 | Ga0207426_1000049 | Ga0207426_1000049172 | 372 |
| 1033 | 3300025303 | Ga0209051_1000025 | Ga0209051_1000025311 | 372 |
| 1034 | 3300025303 | Ga0209051_1000824 | Ga0209051_100082412 | 372 |
| 1035 | 3300025303 | Ga0209051_1001151 | Ga0209051_100115114 | 372 |
| 1036 | 3300025303 | Ga0209051_1002289 | Ga0209051_100228912 | 372 |
| 1037 | 3300025303 | Ga0209051_1024903 | Ga0209051_10249032 | 372 |
| 1038 | 3300025303 | Ga0209051_1031720 | Ga0209051_10317202 | 372 |
| 1039 | 3300025304 | Ga0209257_1000039 | Ga0209257_1000039297 | 372 |
| 1040 | 3300025304 | Ga0209257_1000977 | Ga0209257_100097714 | 372 |
| 1041 | 3300025304 | Ga0209257_1004064 | Ga0209257_100406411 | 372 |
| 1042 | 3300025304 | Ga0209257_1025419 | Ga0209257_10254192 | 372 |
| 1043 | 3300025728 | Ga0207655_1001268 | Ga0207655_100126819 | 372 |
| 1044 | 3300025903 | Ga0207680_10056253 | Ga0207680_100562532 | 372 |
| 1045 | 3300025913 | Ga0207695_10195014 | Ga0207695_101950141 | 372 |
| 1046 | 3300025924 | Ga0207694_10198339 | Ga0207694_101983391 | 372 |
| 1047 | 3300025933 | Ga0207706_10172398 | Ga0207706_101723981 | 372 |
| 1048 | 3300025934 | Ga0207686_10011506 | Ga0207686_100115063 | 372 |
| 1049 | 3300025935 | Ga0207709_10000572 | Ga0207709_1000057220 | 372 |
| 1050 | 3300025935 | Ga0207709_10001477 | Ga0207709_100014774 | 372 |
| 1051 | 3300025940 | Ga0207691_10101754 | Ga0207691_101017543 | 372 |
| 1052 | 3300025945 | Ga0207679_10044244 | Ga0207679_100442442 | 372 |
| 1053 | 3300025986 | Ga0207658_10193858 | Ga0207658_101938582 | 372 |
| 1054 | 3300026089 | Ga0207648_10055148 | Ga0207648_100551483 | 372 |
| 1055 | 3300026121 | Ga0207683_10063910 | Ga0207683_100639103 | 372 |
| 1056 | 3300026121 | Ga0207683_10361117 | Ga0207683_103611171 | 372 |
| 1057 | 3300026142 | Ga0207698_10187329 | Ga0207698_101873292 | 372 |
| 1058 | 3300027666 | Ga0209282_1001278 | Ga0209282_10012786 | 372 |
| 1059 | 3300027682 | Ga0209971_1008605 | Ga0209971_10086053 | 372 |
| 1060 | 3300028379 | Ga0268266_10032642 | Ga0268266_100326423 | 372 |
| 1061 | 3300028380 | Ga0268265_10039100 | Ga0268265_100391002 | 372 |
| 1062 | 3300028794 | Ga0307515_10000278 | Ga0307515_1000027846 | 372 |
| 1063 | 3300030734 | Ga0316179_1065978 | Ga0316179_10659782 | 372 |
| 1064 | 3300030736 | Ga0316180_1114655 | Ga0316180_11146553 | 372 |
| 1065 | 3300030745 | Ga0316182_1157939 | Ga0316182_11579392 | 372 |
| 1066 | 3300030745 | Ga0316182_1185814 | Ga0316182_11858141 | 372 |
| 1067 | 3300031238 | Ga0265332_10000023 | Ga0265332_1000002395 | 372 |
| 1068 | 3300031238 | Ga0265332_10000046 | Ga0265332_1000004694 | 372 |
| 1069 | 3300031247 | Ga0265340_10005958 | Ga0265340_100059584 | 372 |
| 1070 | 3300031251 | Ga0265327_10001807 | Ga0265327_1000180722 | 372 |
| 1071 | 3300031251 | Ga0265327_10078750 | Ga0265327_100787501 | 372 |
| 1072 | 3300031649 | Ga0307514_10124033 | Ga0307514_101240332 | 372 |
| 1073 | 3300031711 | Ga0265314_10000130 | Ga0265314_100001302 | 372 |
| 1074 | 3300031730 | Ga0307516_10044798 | Ga0307516_100447984 | 372 |
| 1075 | 3300031901 | Ga0307406_10036537 | Ga0307406_100365373 | 372 |
| 1076 | 3300032005 | Ga0307411_10053269 | Ga0307411_100532693 | 372 |
| 1077 | 3300032005 | Ga0307411_10122687 | Ga0307411_101226872 | 372 |
| 1078 | 3300038443 | Ga0395901_0205970 | Ga0395901_0205970_304_1440 | 372 |
| 1079 | 3300042006 | Ga0439432_003503 | Ga0439432_003503_128_1246 | 372 |
| 1080 | 3300042134 | Ga0450898_000630 | Ga0450898_000630_735_1856 | 372 |
| 1081 | 3300042531 | Ga0450918_001277 | Ga0450918_001277_3193_4311 | 372 |
| 1082 | 3300042876 | Ga0451577_0026109 | Ga0451577_0026109_2252_3394 | 372 |
| 1083 | 3300044656 | Ga0466969_0013133 | Ga0466969_0013133_1602_2738 | 372 |
| 1084 | 3300044673 | Ga0453683_0004241 | Ga0453683_0004241_1083_2207 | 372 |
| 1085 | 3300044684 | Ga0466966_0002762 | Ga0466966_0002762_4809_5945 | 372 |
| 1086 | 3300044684 | Ga0466966_0038911 | Ga0466966_0038911_1479_2603 | 372 |
| 1087 | 3300044693 | Ga0466961_0033795 | Ga0466961_0033795_755_1891 | 372 |
| 1088 | 3300044712 | Ga0453684_0156564 | Ga0453684_0156564_1130_2272 | 372 |
| 1089 | 3300044719 | Ga0466971_0033203 | Ga0466971_0033203_755_1891 | 372 |
| 1090 | 3300044842 | Ga0466957_0004692 | Ga0466957_0004692_4737_5873 | 372 |
| 1091 | 3300045049 | Ga0466959_0000147 | Ga0466959_0000147_35551_36687 | 372 |
| 1092 | 3300045051 | Ga0451576_0013663 | Ga0451576_0013663_4868_6010 | 372 |
| 1093 | 3300045976 | Ga0466967_0140966 | Ga0466967_0140966_579_1715 | 372 |
| 1094 | 3300046518 | Ga0495631_0000253 | Ga0495631_0000253_34408_35526 | 372 |
| 1095 | 3300046528 | Ga0495642_0027259 | Ga0495642_0027259_635_1759 | 372 |
| 1096 | 3300046615 | Ga0495656_0000093 | Ga0495656_0000093_10919_12037 | 372 |
| 1097 | 3300047321 | Ga0495676_0008226 | Ga0495676_0008226_7872_8990 | 372 |
| 1098 | 3300048904 | Ga0496101_0053427 | Ga0496101_0053427_130_1248 | 372 |
| 1099 | 3300048904 | Ga0496101_0088063 | Ga0496101_0088063_665_1783 | 372 |
| 1100 | 3300048920 | Ga0496117_0012516 | Ga0496117_0012516_4754_5872 | 372 |
| 1101 | 3300048927 | Ga0496124_0169162 | Ga0496124_0169162_361_1479 | 372 |
| 1102 | 3300049580 | Ga0501046_0000034 | Ga0501046_0000034_86803_88116 | 372 |
| 1103 | 3300049581 | Ga0501047_0000042 | Ga0501047_0000042_88484_89797 | 372 |
| 1104 | 3300049581 | Ga0501047_0109307 | Ga0501047_0109307_897_2021 | 372 |
| 1105 | 3300049582 | Ga0501048_0000019 | Ga0501048_0000019_21406_22719 | 372 |
| 1106 | 3300050493 | nmdc:mga0k408_17882_c1 | nmdc:mga0k408_17882_c1_808_1941 | 372 |
| 1107 | 3300050496 | nmdc:mga07m45_4942_c1 | nmdc:mga07m45_4942_c1_809_1951 | 372 |
| 1108 | 3300050496 | nmdc:mga07m45_92666_c1 | nmdc:mga07m45_92666_c1_453_1571 | 372 |
| 1109 | 3300053093 | Ga0500651_0001184 | Ga0500651_0001184_10499_11617 | 372 |
| 1110 | 3300053110 | Ga0500571_000088 | Ga0500571_000088_4446_5564 | 372 |
| 1111 | 3300053134 | Ga0500658_0002407 | Ga0500658_0002407_5921_7039 | 372 |
| 1112 | 3300053139 | Ga0500568_0023742 | Ga0500568_0023742_1352_2470 | 372 |
| 1113 | 3300061719 | Ga0466962_0033972 | Ga0466962_0033972_755_1891 | 372 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1qr7-assembly1.cif.gz_C | crystal structure of phenylalanine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase from escherichia coli complexed with pb2+ and pep | 0.9876 | 26 | 372 |
| 5d09-assembly1.cif.gz_D | neisseria meningitidis 3 deoxy-d-arabino-heptulosonate 7-phosphate synthase phe211ala variant | 0.9875 | 32 | 371 |
| 5cz0-assembly1.cif.gz_C | neisseria meningitidis 3 dexy-d-arabino-heptulosonate 7-phosphate synthase glu98ala variant | 0.9868 | 32 | 371 |
| 5d09-assembly1.cif.gz_C | neisseria meningitidis 3 deoxy-d-arabino-heptulosonate 7-phosphate synthase phe211ala variant | 0.9867 | 32 | 371 |
| 5dcd-assembly1.cif.gz_B | neisseria meningitidis 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase regulated (tyrosine) | 0.9865 | 23 | 370 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6aglB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9739 | 27 | 366 | 3.20.20.70 |
| 6aglB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.956 | 27 | 366 | 3.20.20.70 |
| 1ofpA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9548 | 23 | 371 | 3.20.20.70 |
| 1of6A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9546 | 23 | 371 | 3.20.20.70 |
| 1ofpA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9395 | 23 | 371 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0YAS2-F1-model_v4 | 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (3-deoxy-D-arabino-heptulosonate 7-phosphate synthase) (DAHP synthase) (Phospho-2-keto-3-deoxyheptonate aldolase) | 0.9982 | 128 | 371 |
GO:0003849
GO:0005737 GO:0008652 GO:0009073 GO:0009423 |
| AF-A0A2R7NKD4-F1-model_v4 | 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (3-deoxy-D-arabino-heptulosonate 7-phosphate synthase) (DAHP synthase) (Phospho-2-keto-3-deoxyheptonate aldolase) | 0.9952 | 77 | 371 |
GO:0003849
GO:0005737 GO:0008652 GO:0009073 GO:0009423 |
| AF-A0A519J7T6-F1-model_v4 | deleted | 0.9951 | 76 | 371 |
|
| AF-A0A1J5PI59-F1-model_v4 | 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (3-deoxy-D-arabino-heptulosonate 7-phosphate synthase) (DAHP synthase) (Phospho-2-keto-3-deoxyheptonate aldolase) | 0.9949 | 156 | 371 |
GO:0003849
GO:0005737 GO:0008652 GO:0009073 |
| AF-A0A1E4QQW9-F1-model_v4 | deleted | 0.9926 | 16 | 371 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar