F488962
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1046 | 455 | 2092 | 358 |
Family's Representative Sequence
| Representative Sequence | 3300039453|Ga0436362_0788498|Ga0436362_0788498_63_1325 |
| Length | 420 |
| Sequence | MVSTGLTRARRFEAALALDPIPASKVQTAPLQFAELPRKPRQAFATGWRKKEMSVNNDQKIIKNKVGLLNLADMLGSVSEACKVMGYSRDSFYRFKELYEKGGELALKEISRRKPCLKNRVESHIEQAIVEMAIEQPAFGQVRIANELTKRGLFVSPTGVRSVWLRHDLQTFAKRLKALEAKLAQEPGQVLTESQVRAIEKAKQDKEAHGEIETAHPGYLGAQDTYYVGTIKSIGRIYQQTFIDTYAKVAFAKLYDRKNALVAADMLNDRVLPFFEENDVPLLRILTDRGTEYCGQREHHEYQLYLAVENIDHSKTRAKSPQTNGICERFHRTMQDEFYSVAFRKRLYTSLDQLQADLDKWLEEYNQLRPHSGKYCFGKTPMQTFLDSKHLAQEKQLDRFAVATSPDQLSPRAARAATVS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 6 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 15 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 18 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 19 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 20 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 21 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 22 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 23 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 24 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 25 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 26 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 32 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 88 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 89 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 90 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 91 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 92 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 93 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 100 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 101 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 103 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 112 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 113 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 114 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 115 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 116 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 117 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 118 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 120 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 136 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 152 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 153 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 154 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 156 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 157 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 158 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 159 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 160 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 161 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 162 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 163 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 165 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 240 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 244 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 245 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 248 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 249 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 250 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 251 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 252 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 253 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 254 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 255 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 256 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 257 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 258 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 259 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 260 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 261 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 262 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 263 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 264 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 265 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 266 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 267 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 268 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 269 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 273 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 274 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 276 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 277 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 278 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 279 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 280 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 282 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 283 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 285 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 286 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 287 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 288 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 289 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 290 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 291 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 292 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 293 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 294 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 295 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 296 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 297 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 298 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 299 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 300 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 301 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 302 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 303 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 304 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 305 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 306 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 307 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 308 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 309 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 310 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 311 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 312 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 313 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 314 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 315 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 316 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 317 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 318 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 360 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 361 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 362 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 363 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 364 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 365 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 368 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 369 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 370 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 371 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 372 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 373 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 374 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 375 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 376 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 377 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 378 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 379 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 380 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 381 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 382 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 383 | 3300048986 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E | Metagenome | Unclassified |
| 384 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 386 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 407 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 408 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 409 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 410 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 411 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 412 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 415 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 418 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 419 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 430 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 431 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 432 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 433 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 434 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 435 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 436 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 2523533628 | Maridesulfovibrio zosterae DSM 11974 | Isolate | Rhizosphere |
| 441 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 442 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 443 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 444 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 445 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 446 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 447 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 448 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 449 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 450 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 451 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 452 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 453 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 454 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 455 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.51 |
| Metatranscriptomes | 0.38 |
| Isolates | 2.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.15 |
| Nodule | 0.38 |
| Rhizoplane | 5.83 |
| Rhizosphere | 82.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436362_0788498 | 3300039453 | Unclassified | 2025 |
| 2 | SwRhRL2b_contig_1751191 | 2162886007 | Bacteria | 1303 |
| 3 | SwRhRL2b_contig_2759932 | 2162886007 | Bacteria | 1363 |
| 4 | MRS1b_contig_7804166 | 2162886011 | Bacteria | 1605 |
| 5 | MRS1b_contig_8693482 | 2162886011 | Unclassified | 1332 |
| 6 | ARcpr5yngRDRAFT_c005277 | 3300000043 | Bacteria | 1196 |
| 7 | CNXas_1003063 | 3300000545 | Bacteria | 1174 |
| 8 | JGI24747J21853_1005066 | 3300001978 | Bacteria | 1205 |
| 9 | JGI24740J21852_10030229 | 3300001979 | Bacteria | 1767 |
| 10 | JGI24740J21852_10037783 | 3300001979 | Bacteria | 1487 |
| 11 | JGI24740J21852_10045239 | 3300001979 | Bacteria | 1300 |
| 12 | JGI24740J21852_10053293 | 3300001979 | Bacteria | 1148 |
| 13 | JGI24739J22299_10000880 | 3300001989 | Bacteria | 11098 |
| 14 | JGI24739J22299_10008242 | 3300001989 | Bacteria | 3889 |
| 15 | JGI24739J22299_10012147 | 3300001989 | Bacteria | 3162 |
| 16 | JGI24737J22298_10035182 | 3300001990 | Bacteria | 1550 |
| 17 | JGI24735J21928_10020041 | 3300002067 | Bacteria | 2051 |
| 18 | JGI24735J21928_10026311 | 3300002067 | Bacteria | 1749 |
| 19 | JGI24738J21930_10019697 | 3300002075 | Bacteria | 1406 |
| 20 | JGI24738J21930_10023032 | 3300002075 | Bacteria | 1286 |
| 21 | JGI24749J21850_1012207 | 3300002076 | Bacteria | 1206 |
| 22 | JGI24744J21845_10011122 | 3300002077 | Bacteria | 1842 |
| 23 | JGI24033J26618_1007563 | 3300002155 | Bacteria | 1237 |
| 24 | JGI24742J22300_10018067 | 3300002244 | Bacteria | 1195 |
| 25 | JGI24751J29686_10019929 | 3300002459 | Unclassified | 1388 |
| 26 | JGI25156J39149_1000072 | 3300002705 | Bacteria | 79210 |
| 27 | JGI25150J39212_1011789 | 3300002774 | Bacteria | 1570 |
| 28 | JGI25406J46586_10053286 | 3300003203 | Bacteria | 1344 |
| 29 | JGI25406J46586_10056148 | 3300003203 | Bacteria | 1293 |
| 30 | JGI25153J46596_10001013 | 3300003215 | Bacteria | 17106 |
| 31 | rootH1_10015982 | 3300003316 | Bacteria | 13474 |
| 32 | rootH2_10079745 | 3300003320 | Bacteria | 4798 |
| 33 | rootH2_10129418 | 3300003320 | Bacteria | 1298 |
| 34 | rootH2_10268060 | 3300003320 | Bacteria | 1243 |
| 35 | rootL2_10021147 | 3300003322 | Bacteria | 1315 |
| 36 | rootL2_10083669 | 3300003322 | Bacteria | 1852 |
| 37 | rootL2_10091978 | 3300003322 | Bacteria | 2235 |
| 38 | rootL2_10118054 | 3300003322 | Bacteria | 5571 |
| 39 | rootL2_10231333 | 3300003322 | Bacteria | 3625 |
| 40 | rootL2_10270586 | 3300003322 | Unclassified | 2246 |
| 41 | rootL2_10316240 | 3300003322 | Bacteria | 1440 |
| 42 | rootL2_10329729 | 3300003322 | Bacteria | 2121 |
| 43 | rootH1_10023272 | 3300003323 | Bacteria | 4582 |
| 44 | rootH1_10036171 | 3300003323 | Bacteria | 1891 |
| 45 | JGI25160J50197_1026103 | 3300003354 | Bacteria | 1617 |
| 46 | JGI25160J50197_1030153 | 3300003354 | Bacteria | 1419 |
| 47 | JGI25404J52841_10027187 | 3300003659 | Bacteria | 1231 |
| 48 | Ga0055530_10037148 | 3300003791 | Bacteria | 1221 |
| 49 | Ga0065165_1016483 | 3300005262 | Bacteria | 2765 |
| 50 | Ga0065714_10002184 | 3300005288 | Bacteria | 284511 |
| 51 | Ga0065714_10111464 | 3300005288 | Bacteria | 1470 |
| 52 | Ga0065704_10125692 | 3300005289 | Bacteria | 1699 |
| 53 | Ga0065704_10142658 | 3300005289 | Bacteria | 1503 |
| 54 | Ga0065704_10146725 | 3300005289 | Bacteria | 1465 |
| 55 | Ga0065712_10000112 | 3300005290 | Bacteria | 340011 |
| 56 | Ga0065712_10110510 | 3300005290 | Bacteria | 1835 |
| 57 | Ga0065712_10114686 | 3300005290 | Bacteria | 1763 |
| 58 | Ga0065712_10136104 | 3300005290 | Unclassified | 1496 |
| 59 | Ga0065712_10136603 | 3300005290 | Unclassified | 1491 |
| 60 | Ga0065715_10189204 | 3300005293 | Unclassified | 1419 |
| 61 | Ga0065715_10194612 | 3300005293 | Bacteria | 1395 |
| 62 | Ga0065715_10216115 | 3300005293 | Unclassified | 1292 |
| 63 | Ga0065707_10173926 | 3300005295 | Bacteria | 1465 |
| 64 | Ga0065707_10201606 | 3300005295 | Bacteria | 1290 |
| 65 | Ga0070658_10196131 | 3300005327 | Bacteria | 1703 |
| 66 | Ga0070658_10214301 | 3300005327 | Bacteria | 1627 |
| 67 | Ga0070676_10127760 | 3300005328 | Bacteria | 1604 |
| 68 | Ga0070683_100130758 | 3300005329 | Bacteria | 2376 |
| 69 | Ga0070683_100207939 | 3300005329 | Bacteria | 1859 |
| 70 | Ga0070683_100292711 | 3300005329 | Bacteria | 1548 |
| 71 | Ga0070690_100107499 | 3300005330 | Bacteria | 1857 |
| 72 | Ga0070670_100038326 | 3300005331 | Bacteria | 4122 |
| 73 | Ga0070670_100226186 | 3300005331 | Bacteria | 1628 |
| 74 | Ga0068869_100225967 | 3300005334 | Bacteria | 1486 |
| 75 | Ga0068869_100299049 | 3300005334 | Bacteria | 1299 |
| 76 | Ga0070666_10037706 | 3300005335 | Bacteria | 3215 |
| 77 | Ga0070666_10149598 | 3300005335 | Unclassified | 1628 |
| 78 | Ga0070666_10176099 | 3300005335 | Bacteria | 1499 |
| 79 | Ga0070666_10180232 | 3300005335 | Unclassified | 1481 |
| 80 | Ga0070666_10215402 | 3300005335 | Bacteria | 1353 |
| 81 | Ga0070666_10227392 | 3300005335 | Bacteria | 1317 |
| 82 | Ga0070666_10275353 | 3300005335 | Bacteria | 1195 |
| 83 | Ga0070680_100167489 | 3300005336 | Bacteria | 1848 |
| 84 | Ga0070680_100192541 | 3300005336 | Bacteria | 1718 |
| 85 | Ga0070680_100220622 | 3300005336 | Bacteria | 1600 |
| 86 | Ga0070680_100321359 | 3300005336 | Bacteria | 1314 |
| 87 | Ga0070682_100238749 | 3300005337 | Bacteria | 1304 |
| 88 | Ga0070682_100267784 | 3300005337 | Bacteria | 1240 |
| 89 | Ga0068868_100246542 | 3300005338 | Bacteria | 1502 |
| 90 | Ga0068868_100316141 | 3300005338 | Bacteria | 1329 |
| 91 | Ga0068868_100344189 | 3300005338 | Bacteria | 1275 |
| 92 | Ga0068868_100364328 | 3300005338 | Bacteria | 1241 |
| 93 | Ga0070660_100114902 | 3300005339 | Bacteria | 2145 |
| 94 | Ga0070660_100121968 | 3300005339 | Bacteria | 2080 |
| 95 | Ga0070689_100238418 | 3300005340 | Unclassified | 1497 |
| 96 | Ga0070689_100360753 | 3300005340 | Bacteria | 1221 |
| 97 | Ga0070661_100194641 | 3300005344 | Bacteria | 1547 |
| 98 | Ga0070661_100249135 | 3300005344 | Bacteria | 1370 |
| 99 | Ga0070661_100276747 | 3300005344 | Bacteria | 1301 |
| 100 | Ga0070661_100283012 | 3300005344 | Bacteria | 1287 |
| 101 | Ga0070661_100364757 | 3300005344 | Bacteria | 1136 |
| 102 | Ga0070668_100165173 | 3300005347 | Bacteria | 1798 |
| 103 | Ga0070668_100257723 | 3300005347 | Bacteria | 1450 |
| 104 | Ga0070668_100273064 | 3300005347 | Bacteria | 1410 |
| 105 | Ga0070669_100121039 | 3300005353 | Bacteria | 1997 |
| 106 | Ga0070669_100225913 | 3300005353 | Unclassified | 1482 |
| 107 | Ga0070669_100235559 | 3300005353 | Bacteria | 1453 |
| 108 | Ga0070669_100245334 | 3300005353 | Bacteria | 1424 |
| 109 | Ga0070669_100348610 | 3300005353 | Bacteria | 1201 |
| 110 | Ga0070675_100185200 | 3300005354 | Unclassified | 1802 |
| 111 | Ga0070671_100185825 | 3300005355 | Bacteria | 1761 |
| 112 | Ga0070671_100311866 | 3300005355 | Bacteria | 1340 |
| 113 | Ga0070671_100354412 | 3300005355 | Bacteria | 1253 |
| 114 | Ga0070671_100366121 | 3300005355 | Bacteria | 1231 |
| 115 | Ga0070674_100241111 | 3300005356 | Bacteria | 1415 |
| 116 | Ga0070673_100143065 | 3300005364 | Bacteria | 2019 |
| 117 | Ga0070688_100196159 | 3300005365 | Unclassified | 1410 |
| 118 | Ga0070659_100167055 | 3300005366 | Bacteria | 1801 |
| 119 | Ga0070659_100243124 | 3300005366 | Bacteria | 1490 |
| 120 | Ga0070659_100244919 | 3300005366 | Bacteria | 1484 |
| 121 | Ga0070659_100304429 | 3300005366 | Bacteria | 1330 |
| 122 | Ga0070667_100113396 | 3300005367 | Bacteria | 2353 |
| 123 | Ga0070667_100213817 | 3300005367 | Unclassified | 1714 |
| 124 | Ga0070667_100239448 | 3300005367 | Bacteria | 1620 |
| 125 | Ga0070667_100252670 | 3300005367 | Bacteria | 1576 |
| 126 | Ga0070667_100315663 | 3300005367 | Bacteria | 1409 |
| 127 | Ga0070667_100333154 | 3300005367 | Bacteria | 1371 |
| 128 | Ga0070667_100392859 | 3300005367 | Unclassified | 1261 |
| 129 | Ga0070667_100449014 | 3300005367 | Bacteria | 1178 |
| 130 | Ga0070709_10120979 | 3300005434 | Bacteria | 1774 |
| 131 | Ga0070709_10142765 | 3300005434 | Bacteria | 1647 |
| 132 | Ga0070709_10235933 | 3300005434 | Bacteria | 1311 |
| 133 | Ga0070714_100225646 | 3300005435 | Unclassified | 1724 |
| 134 | Ga0070714_100327254 | 3300005435 | Bacteria | 1434 |
| 135 | Ga0070714_100403247 | 3300005435 | Bacteria | 1293 |
| 136 | Ga0070713_100255292 | 3300005436 | Bacteria | 1600 |
| 137 | Ga0070713_100320426 | 3300005436 | Bacteria | 1431 |
| 138 | Ga0070713_100328732 | 3300005436 | Bacteria | 1413 |
| 139 | Ga0070713_100341621 | 3300005436 | Bacteria | 1387 |
| 140 | Ga0070713_100462638 | 3300005436 | Unclassified | 1193 |
| 141 | Ga0070710_10113484 | 3300005437 | Bacteria | 1631 |
| 142 | Ga0070710_10160094 | 3300005437 | Bacteria | 1395 |
| 143 | Ga0070711_100135544 | 3300005439 | Bacteria | 1840 |
| 144 | Ga0070711_100149477 | 3300005439 | Bacteria | 1760 |
| 145 | Ga0070711_100163215 | 3300005439 | Bacteria | 1691 |
| 146 | Ga0070711_100176914 | 3300005439 | Bacteria | 1631 |
| 147 | Ga0070711_100201850 | 3300005439 | Bacteria | 1535 |
| 148 | Ga0070711_100282079 | 3300005439 | Bacteria | 1315 |
| 149 | Ga0070711_100284880 | 3300005439 | Bacteria | 1309 |
| 150 | Ga0070705_100117079 | 3300005440 | Bacteria | 1714 |
| 151 | Ga0070705_100183197 | 3300005440 | Bacteria | 1420 |
| 152 | Ga0070700_100021585 | 3300005441 | Bacteria | 3745 |
| 153 | Ga0070700_100065840 | 3300005441 | Bacteria | 2299 |
| 154 | Ga0070700_100217222 | 3300005441 | Bacteria | 1352 |
| 155 | Ga0070708_100422128 | 3300005445 | Bacteria | 1258 |
| 156 | Ga0070663_100249709 | 3300005455 | Bacteria | 1404 |
| 157 | Ga0070663_100298032 | 3300005455 | Bacteria | 1290 |
| 158 | Ga0070663_100339659 | 3300005455 | Bacteria | 1213 |
| 159 | Ga0070678_100047435 | 3300005456 | Bacteria | 3086 |
| 160 | Ga0070678_100150791 | 3300005456 | Bacteria | 1872 |
| 161 | Ga0070678_100292864 | 3300005456 | Bacteria | 1381 |
| 162 | Ga0070678_100300025 | 3300005456 | Bacteria | 1365 |
| 163 | Ga0070662_100238908 | 3300005457 | Bacteria | 1456 |
| 164 | Ga0070662_100277478 | 3300005457 | Bacteria | 1355 |
| 165 | Ga0070662_100309674 | 3300005457 | Bacteria | 1285 |
| 166 | Ga0070681_10257832 | 3300005458 | Bacteria | 1656 |
| 167 | Ga0070681_10278246 | 3300005458 | Bacteria | 1584 |
| 168 | Ga0070681_10278619 | 3300005458 | Bacteria | 1583 |
| 169 | Ga0070681_10376978 | 3300005458 | Bacteria | 1329 |
| 170 | Ga0070681_10380610 | 3300005458 | Bacteria | 1322 |
| 171 | Ga0070681_10434686 | 3300005458 | Bacteria | 1224 |
| 172 | Ga0068867_100277789 | 3300005459 | Bacteria | 1372 |
| 173 | Ga0068867_100283059 | 3300005459 | Bacteria | 1360 |
| 174 | Ga0070706_100118890 | 3300005467 | Bacteria | 2462 |
| 175 | Ga0070707_100278246 | 3300005468 | Bacteria | 1627 |
| 176 | Ga0070699_100243008 | 3300005518 | Bacteria | 1607 |
| 177 | Ga0070679_100218847 | 3300005530 | Bacteria | 1866 |
| 178 | Ga0070679_100405494 | 3300005530 | Bacteria | 1309 |
| 179 | Ga0070679_100434497 | 3300005530 | Bacteria | 1258 |
| 180 | Ga0070679_100457151 | 3300005530 | Bacteria | 1221 |
| 181 | Ga0070684_100375295 | 3300005535 | Bacteria | 1309 |
| 182 | Ga0070684_100425422 | 3300005535 | Bacteria | 1226 |
| 183 | Ga0070697_100187554 | 3300005536 | Bacteria | 1754 |
| 184 | Ga0068853_100340089 | 3300005539 | Bacteria | 1394 |
| 185 | Ga0068853_100428845 | 3300005539 | Bacteria | 1241 |
| 186 | Ga0068853_100438554 | 3300005539 | Bacteria | 1227 |
| 187 | Ga0068853_100439683 | 3300005539 | Bacteria | 1225 |
| 188 | Ga0070672_100271022 | 3300005543 | Bacteria | 1433 |
| 189 | Ga0070686_100382778 | 3300005544 | Bacteria | 1065 |
| 190 | Ga0070695_100140429 | 3300005545 | Bacteria | 1674 |
| 191 | Ga0070695_100183561 | 3300005545 | Bacteria | 1484 |
| 192 | Ga0070693_100127550 | 3300005547 | Bacteria | 1586 |
| 193 | Ga0070693_100265854 | 3300005547 | Bacteria | 1143 |
| 194 | Ga0070665_100271380 | 3300005548 | Bacteria | 1698 |
| 195 | Ga0070704_100245028 | 3300005549 | Bacteria | 1469 |
| 196 | Ga0068855_100073546 | 3300005563 | Bacteria | 3970 |
| 197 | Ga0068855_100187740 | 3300005563 | Bacteria | 2333 |
| 198 | Ga0068855_100348742 | 3300005563 | Bacteria | 1631 |
| 199 | Ga0068855_100492493 | 3300005563 | Bacteria | 1333 |
| 200 | Ga0070664_100037517 | 3300005564 | Bacteria | 4075 |
| 201 | Ga0070664_100371456 | 3300005564 | Unclassified | 1304 |
| 202 | Ga0068857_100105016 | 3300005577 | Bacteria | 2536 |
| 203 | Ga0068857_100339858 | 3300005577 | Unclassified | 1389 |
| 204 | Ga0068857_100363753 | 3300005577 | Bacteria | 1341 |
| 205 | Ga0068857_100387866 | 3300005577 | Bacteria | 1298 |
| 206 | Ga0068854_100206797 | 3300005578 | Bacteria | 1546 |
| 207 | Ga0068854_100318555 | 3300005578 | Bacteria | 1263 |
| 208 | Ga0068854_100344103 | 3300005578 | Bacteria | 1219 |
| 209 | Ga0068854_100360568 | 3300005578 | Bacteria | 1192 |
| 210 | Ga0068856_100284703 | 3300005614 | Bacteria | 1670 |
| 211 | Ga0068856_100318534 | 3300005614 | Bacteria | 1572 |
| 212 | Ga0068856_100379977 | 3300005614 | Bacteria | 1432 |
| 213 | Ga0068856_100408556 | 3300005614 | Bacteria | 1377 |
| 214 | Ga0068856_100439033 | 3300005614 | Bacteria | 1326 |
| 215 | Ga0068856_100450627 | 3300005614 | Unclassified | 1308 |
| 216 | Ga0068852_100121472 | 3300005616 | Bacteria | 2392 |
| 217 | Ga0068852_100126942 | 3300005616 | Bacteria | 2344 |
| 218 | Ga0068852_100150639 | 3300005616 | Bacteria | 2163 |
| 219 | Ga0068852_100286978 | 3300005616 | Bacteria | 1588 |
| 220 | Ga0068859_100367725 | 3300005617 | Unclassified | 1533 |
| 221 | Ga0068859_100389174 | 3300005617 | Bacteria | 1490 |
| 222 | Ga0068859_100402645 | 3300005617 | Unclassified | 1465 |
| 223 | Ga0068859_100412123 | 3300005617 | Bacteria | 1447 |
| 224 | Ga0068859_100517741 | 3300005617 | Bacteria | 1288 |
| 225 | Ga0068859_100574391 | 3300005617 | Bacteria | 1221 |
| 226 | Ga0068864_100163707 | 3300005618 | Bacteria | 2023 |
| 227 | Ga0068864_100352202 | 3300005618 | Bacteria | 1389 |
| 228 | Ga0068864_100407178 | 3300005618 | Unclassified | 1294 |
| 229 | Ga0068861_100008537 | 3300005719 | Bacteria | 7052 |
| 230 | Ga0068861_100153694 | 3300005719 | Bacteria | 1891 |
| 231 | Ga0068861_100255940 | 3300005719 | Bacteria | 1496 |
| 232 | Ga0068861_100257333 | 3300005719 | Unclassified | 1493 |
| 233 | Ga0068861_100272331 | 3300005719 | Bacteria | 1454 |
| 234 | Ga0068861_100281725 | 3300005719 | Bacteria | 1432 |
| 235 | Ga0068861_100374958 | 3300005719 | Bacteria | 1255 |
| 236 | Ga0068851_10044524 | 3300005834 | Bacteria | 2240 |
| 237 | Ga0068851_10133861 | 3300005834 | Bacteria | 1342 |
| 238 | Ga0068870_10027354 | 3300005840 | Bacteria | 2851 |
| 239 | Ga0068863_100196772 | 3300005841 | Bacteria | 1938 |
| 240 | Ga0068863_100203402 | 3300005841 | Bacteria | 1905 |
| 241 | Ga0068863_100390730 | 3300005841 | Bacteria | 1359 |
| 242 | Ga0068858_100307071 | 3300005842 | Bacteria | 1514 |
| 243 | Ga0068858_100326743 | 3300005842 | Bacteria | 1467 |
| 244 | Ga0068858_100388059 | 3300005842 | Bacteria | 1340 |
| 245 | Ga0068860_100095530 | 3300005843 | Bacteria | 2833 |
| 246 | Ga0068860_100276476 | 3300005843 | Bacteria | 1640 |
| 247 | Ga0068860_100515362 | 3300005843 | Bacteria | 1195 |
| 248 | Ga0068862_100238185 | 3300005844 | Bacteria | 1653 |
| 249 | Ga0068862_100320844 | 3300005844 | Unclassified | 1430 |
| 250 | Ga0068862_100445819 | 3300005844 | Bacteria | 1219 |
| 251 | Ga0081455_10038716 | 3300005937 | Bacteria | 4221 |
| 252 | Ga0081455_10063427 | 3300005937 | Bacteria | 3101 |
| 253 | Ga0081538_10124517 | 3300005981 | Bacteria | 1229 |
| 254 | Ga0081540_1027524 | 3300005983 | Bacteria | 3218 |
| 255 | Ga0081540_1075911 | 3300005983 | Bacteria | 1534 |
| 256 | Ga0081539_10041030 | 3300005985 | Bacteria | 2711 |
| 257 | Ga0081539_10052693 | 3300005985 | Bacteria | 2283 |
| 258 | Ga0081539_10082293 | 3300005985 | Bacteria | 1688 |
| 259 | Ga0070717_10150552 | 3300006028 | Bacteria | 2012 |
| 260 | Ga0070717_10314808 | 3300006028 | Unclassified | 1394 |
| 261 | Ga0070717_10405063 | 3300006028 | Unclassified | 1226 |
| 262 | Ga0075432_10068277 | 3300006058 | Bacteria | 1274 |
| 263 | Ga0075432_10073966 | 3300006058 | Unclassified | 1227 |
| 264 | Ga0070715_10064786 | 3300006163 | Bacteria | 1615 |
| 265 | Ga0070716_100058906 | 3300006173 | Bacteria | 2212 |
| 266 | Ga0070716_100087378 | 3300006173 | Bacteria | 1878 |
| 267 | Ga0070716_100127146 | 3300006173 | Bacteria | 1605 |
| 268 | Ga0070716_100135624 | 3300006173 | Bacteria | 1562 |
| 269 | Ga0070716_100220272 | 3300006173 | Bacteria | 1274 |
| 270 | Ga0070716_100242419 | 3300006173 | Unclassified | 1223 |
| 271 | Ga0070712_100112897 | 3300006175 | Bacteria | 2031 |
| 272 | Ga0070712_100191456 | 3300006175 | Unclassified | 1601 |
| 273 | Ga0075366_10043468 | 3300006195 | Bacteria | 2662 |
| 274 | Ga0075366_10130935 | 3300006195 | Bacteria | 1514 |
| 275 | Ga0075366_10206668 | 3300006195 | Bacteria | 1195 |
| 276 | Ga0097621_100286425 | 3300006237 | Bacteria | 1451 |
| 277 | Ga0097621_100308876 | 3300006237 | Bacteria | 1398 |
| 278 | Ga0097621_100347668 | 3300006237 | Bacteria | 1318 |
| 279 | Ga0097621_100365822 | 3300006237 | Bacteria | 1286 |
| 280 | Ga0097621_100376364 | 3300006237 | Bacteria | 1268 |
| 281 | Ga0075370_10137687 | 3300006353 | Bacteria | 1427 |
| 282 | Ga0068871_100059984 | 3300006358 | Bacteria | 3102 |
| 283 | Ga0068871_100230968 | 3300006358 | Bacteria | 1606 |
| 284 | Ga0068871_100250827 | 3300006358 | Bacteria | 1541 |
| 285 | Ga0068871_100332795 | 3300006358 | Bacteria | 1339 |
| 286 | Ga0075428_100135626 | 3300006844 | Bacteria | 2676 |
| 287 | Ga0075428_100348764 | 3300006844 | Bacteria | 1589 |
| 288 | Ga0075430_100141152 | 3300006846 | Unclassified | 2006 |
| 289 | Ga0075431_100372619 | 3300006847 | Bacteria | 1433 |
| 290 | Ga0075433_10281946 | 3300006852 | Unclassified | 1472 |
| 291 | Ga0075433_10331119 | 3300006852 | Bacteria | 1346 |
| 292 | Ga0075434_100038577 | 3300006871 | Bacteria | 4731 |
| 293 | Ga0075434_100220205 | 3300006871 | Bacteria | 1918 |
| 294 | Ga0075434_100289602 | 3300006871 | Unclassified | 1657 |
| 295 | Ga0075434_100535251 | 3300006871 | Bacteria | 1191 |
| 296 | Ga0075429_100105244 | 3300006880 | Bacteria | 2464 |
| 297 | Ga0075429_100325292 | 3300006880 | Bacteria | 1346 |
| 298 | Ga0068865_100299911 | 3300006881 | Bacteria | 1286 |
| 299 | Ga0075436_100085936 | 3300006914 | Bacteria | 2184 |
| 300 | Ga0075436_100102620 | 3300006914 | Bacteria | 1992 |
| 301 | Ga0075436_100170730 | 3300006914 | Bacteria | 1536 |
| 302 | Ga0075436_100266903 | 3300006914 | Bacteria | 1221 |
| 303 | Ga0097620_100367722 | 3300006931 | Unclassified | 1533 |
| 304 | Ga0097620_100389150 | 3300006931 | Bacteria | 1490 |
| 305 | Ga0097620_100402608 | 3300006931 | Unclassified | 1465 |
| 306 | Ga0097620_100517738 | 3300006931 | Bacteria | 1288 |
| 307 | Ga0097620_100574343 | 3300006931 | Bacteria | 1221 |
| 308 | Ga0075435_100166747 | 3300007076 | Bacteria | 1857 |
| 309 | Ga0075435_100207925 | 3300007076 | Bacteria | 1659 |
| 310 | Ga0075435_100241780 | 3300007076 | Bacteria | 1536 |
| 311 | Ga0075435_100387494 | 3300007076 | Bacteria | 1201 |
| 312 | Ga0105251_10039644 | 3300009011 | Bacteria | 2300 |
| 313 | Ga0105244_10065461 | 3300009036 | Bacteria | 1821 |
| 314 | Ga0105250_10000030 | 3300009092 | Bacteria | 177339 |
| 315 | Ga0105250_10041386 | 3300009092 | Bacteria | 1847 |
| 316 | Ga0105240_10119457 | 3300009093 | Bacteria | 3175 |
| 317 | Ga0105240_10235312 | 3300009093 | Bacteria | 2126 |
| 318 | Ga0105240_10606345 | 3300009093 | Bacteria | 1205 |
| 319 | Ga0105240_10614675 | 3300009093 | Unclassified | 1195 |
| 320 | Ga0111539_10242297 | 3300009094 | Bacteria | 2099 |
| 321 | Ga0111539_10462582 | 3300009094 | Bacteria | 1477 |
| 322 | Ga0114129_10098629 | 3300009147 | Bacteria | 4044 |
| 323 | Ga0105243_10155731 | 3300009148 | Unclassified | 1965 |
| 324 | Ga0105243_10211334 | 3300009148 | Bacteria | 1709 |
| 325 | Ga0105243_10452685 | 3300009148 | Bacteria | 1205 |
| 326 | Ga0105241_10091528 | 3300009174 | Bacteria | 2400 |
| 327 | Ga0105241_10119370 | 3300009174 | Bacteria | 2121 |
| 328 | Ga0105241_10122428 | 3300009174 | Bacteria | 2097 |
| 329 | Ga0105242_10217231 | 3300009176 | Bacteria | 1707 |
| 330 | Ga0105248_10281134 | 3300009177 | Bacteria | 1874 |
| 331 | Ga0105237_10002098 | 3300009545 | Bacteria | 25171 |
| 332 | Ga0105237_10151043 | 3300009545 | Bacteria | 2319 |
| 333 | Ga0105237_10254388 | 3300009545 | Bacteria | 1759 |
| 334 | Ga0105237_10362464 | 3300009545 | Bacteria | 1454 |
| 335 | Ga0105237_10411204 | 3300009545 | Bacteria | 1358 |
| 336 | Ga0105237_10430490 | 3300009545 | Unclassified | 1325 |
| 337 | Ga0105238_10133811 | 3300009551 | Bacteria | 2457 |
| 338 | Ga0105238_10154825 | 3300009551 | Bacteria | 2267 |
| 339 | Ga0105238_10284506 | 3300009551 | Bacteria | 1635 |
| 340 | Ga0105249_10125421 | 3300009553 | Bacteria | 2444 |
| 341 | Ga0105249_10171216 | 3300009553 | Bacteria | 2106 |
| 342 | Ga0105249_10339928 | 3300009553 | Bacteria | 1517 |
| 343 | Ga0105239_10045842 | 3300010375 | Bacteria | 4791 |
| 344 | Ga0105239_10381177 | 3300010375 | Bacteria | 1594 |
| 345 | Ga0105239_10554353 | 3300010375 | Bacteria | 1309 |
| 346 | Ga0105239_10647678 | 3300010375 | Bacteria | 1207 |
| 347 | Ga0105246_10015396 | 3300011119 | Bacteria | 4831 |
| 348 | Ga0157315_1002207 | 3300012508 | Bacteria | 1190 |
| 349 | Ga0157373_10097031 | 3300013100 | Bacteria | 2075 |
| 350 | Ga0157373_10100885 | 3300013100 | Bacteria | 2031 |
| 351 | Ga0157371_10080254 | 3300013102 | Bacteria | 2310 |
| 352 | Ga0157371_10162601 | 3300013102 | Bacteria | 1594 |
| 353 | Ga0157370_10059593 | 3300013104 | Bacteria | 3627 |
| 354 | Ga0157370_10080069 | 3300013104 | Bacteria | 3076 |
| 355 | Ga0157370_10156301 | 3300013104 | Unclassified | 2121 |
| 356 | Ga0157370_10191416 | 3300013104 | Bacteria | 1899 |
| 357 | Ga0157370_10266124 | 3300013104 | Bacteria | 1584 |
| 358 | Ga0157370_10268695 | 3300013104 | Bacteria | 1576 |
| 359 | Ga0157370_10326439 | 3300013104 | Bacteria | 1415 |
| 360 | Ga0157370_10337965 | 3300013104 | Bacteria | 1388 |
| 361 | Ga0157369_10048234 | 3300013105 | Bacteria | 4621 |
| 362 | Ga0157369_10240453 | 3300013105 | Bacteria | 1891 |
| 363 | Ga0157369_10254173 | 3300013105 | Bacteria | 1834 |
| 364 | Ga0157369_10306325 | 3300013105 | Bacteria | 1652 |
| 365 | Ga0157369_10403239 | 3300013105 | Unclassified | 1418 |
| 366 | Ga0157369_10471696 | 3300013105 | Bacteria | 1299 |
| 367 | Ga0157374_10252189 | 3300013296 | Bacteria | 1737 |
| 368 | Ga0157374_10303574 | 3300013296 | Bacteria | 1579 |
| 369 | Ga0157374_10367858 | 3300013296 | Bacteria | 1431 |
| 370 | Ga0157374_10417958 | 3300013296 | Unclassified | 1339 |
| 371 | Ga0157378_10116008 | 3300013297 | Bacteria | 2462 |
| 372 | Ga0157378_10280131 | 3300013297 | Bacteria | 1607 |
| 373 | Ga0157378_10394670 | 3300013297 | Bacteria | 1362 |
| 374 | Ga0157378_10450986 | 3300013297 | Bacteria | 1277 |
| 375 | Ga0163162_10483901 | 3300013306 | Bacteria | 1369 |
| 376 | Ga0163162_10507567 | 3300013306 | Bacteria | 1336 |
| 377 | Ga0163162_10536980 | 3300013306 | Bacteria | 1298 |
| 378 | Ga0157372_10232696 | 3300013307 | Bacteria | 2136 |
| 379 | Ga0157372_10245517 | 3300013307 | Bacteria | 2078 |
| 380 | Ga0157372_10286552 | 3300013307 | Bacteria | 1915 |
| 381 | Ga0157372_10337274 | 3300013307 | Bacteria | 1756 |
| 382 | Ga0157372_10348607 | 3300013307 | Bacteria | 1725 |
| 383 | Ga0157372_10362830 | 3300013307 | Bacteria | 1688 |
| 384 | Ga0157372_10417807 | 3300013307 | Bacteria | 1563 |
| 385 | Ga0157372_10485341 | 3300013307 | Bacteria | 1441 |
| 386 | Ga0157372_10504108 | 3300013307 | Bacteria | 1411 |
| 387 | Ga0157372_10523868 | 3300013307 | Bacteria | 1382 |
| 388 | Ga0157372_10769211 | 3300013307 | Bacteria | 1119 |
| 389 | Ga0157375_10093057 | 3300013308 | Unclassified | 3080 |
| 390 | Ga0157375_10250154 | 3300013308 | Bacteria | 1933 |
| 391 | Ga0157375_10467330 | 3300013308 | Bacteria | 1427 |
| 392 | Ga0157375_10547100 | 3300013308 | Bacteria | 1319 |
| 393 | Ga0163163_10123993 | 3300014325 | Bacteria | 2620 |
| 394 | Ga0163163_10194330 | 3300014325 | Bacteria | 2077 |
| 395 | Ga0163163_10330175 | 3300014325 | Bacteria | 1579 |
| 396 | Ga0157380_10038290 | 3300014326 | Bacteria | 3722 |
| 397 | Ga0157380_10179376 | 3300014326 | Bacteria | 1859 |
| 398 | Ga0157380_10302079 | 3300014326 | Unclassified | 1475 |
| 399 | Ga0182008_10000872 | 3300014497 | Bacteria | 20967 |
| 400 | Ga0182008_10026729 | 3300014497 | Bacteria | 2926 |
| 401 | Ga0182008_10056333 | 3300014497 | Bacteria | 1943 |
| 402 | Ga0182008_10072913 | 3300014497 | Bacteria | 1689 |
| 403 | Ga0182008_10105032 | 3300014497 | Unclassified | 1397 |
| 404 | Ga0182008_10121568 | 3300014497 | Bacteria | 1298 |
| 405 | Ga0182008_10122197 | 3300014497 | Bacteria | 1295 |
| 406 | Ga0157377_10075252 | 3300014745 | Bacteria | 1961 |
| 407 | Ga0157377_10129520 | 3300014745 | Unclassified | 1539 |
| 408 | Ga0157379_10221337 | 3300014968 | Bacteria | 1715 |
| 409 | Ga0157379_10278999 | 3300014968 | Bacteria | 1520 |
| 410 | Ga0157379_10434236 | 3300014968 | Bacteria | 1210 |
| 411 | Ga0157376_10004700 | 3300014969 | Bacteria | 9517 |
| 412 | Ga0157376_10206049 | 3300014969 | Bacteria | 1812 |
| 413 | Ga0157376_10318090 | 3300014969 | Bacteria | 1479 |
| 414 | Ga0182006_1028537 | 3300015261 | Unclassified | 2269 |
| 415 | Ga0182007_10012773 | 3300015262 | Bacteria | 3224 |
| 416 | Ga0182007_10052038 | 3300015262 | Bacteria | 1350 |
| 417 | Ga0182007_10054682 | 3300015262 | Bacteria | 1313 |
| 418 | Ga0182005_1017650 | 3300015265 | Bacteria | 1974 |
| 419 | Ga0182005_1039165 | 3300015265 | Bacteria | 1289 |
| 420 | Ga0163161_10137945 | 3300017792 | Bacteria | 1845 |
| 421 | Ga0163161_10218975 | 3300017792 | Bacteria | 1473 |
| 422 | Ga0163161_10308987 | 3300017792 | Bacteria | 1247 |
| 423 | Ga0213873_10032012 | 3300021358 | Bacteria | 1311 |
| 424 | Ga0213873_10039976 | 3300021358 | Bacteria | 1204 |
| 425 | Ga0213872_10101256 | 3300021361 | Bacteria | 1284 |
| 426 | Ga0213876_10017673 | 3300021384 | Bacteria | 3762 |
| 427 | Ga0213875_10046300 | 3300021388 | Bacteria | 2041 |
| 428 | Ga0213875_10054143 | 3300021388 | Unclassified | 1879 |
| 429 | Ga0213875_10101793 | 3300021388 | Bacteria | 1341 |
| 430 | Ga0213871_10036629 | 3300021441 | Bacteria | 1302 |
| 431 | Ga0224569_102037 | 3300022732 | Bacteria | 1668 |
| 432 | Ga0224572_1020652 | 3300024225 | Bacteria | 1264 |
| 433 | Ga0228598_1004896 | 3300024227 | Bacteria | 2818 |
| 434 | Ga0207425_1015872 | 3300025245 | Bacteria | 1682 |
| 435 | Ga0207425_1022494 | 3300025245 | Bacteria | 1328 |
| 436 | Ga0209759_1000002 | 3300025256 | Bacteria | 1027596 |
| 437 | Ga0209129_1004696 | 3300025258 | Bacteria | 5200 |
| 438 | Ga0209129_1008170 | 3300025258 | Bacteria | 2961 |
| 439 | Ga0209673_1019038 | 3300025273 | Bacteria | 2477 |
| 440 | Ga0209564_1002265 | 3300025295 | Bacteria | 15780 |
| 441 | Ga0209758_1064597 | 3300025297 | Bacteria | 1185 |
| 442 | Ga0209758_1065548 | 3300025297 | Bacteria | 1172 |
| 443 | Ga0207426_1035959 | 3300025302 | Bacteria | 1577 |
| 444 | Ga0207426_1052284 | 3300025302 | Bacteria | 1210 |
| 445 | Ga0207426_1053960 | 3300025302 | Bacteria | 1184 |
| 446 | Ga0207697_10031574 | 3300025315 | Bacteria | 2167 |
| 447 | Ga0207697_10103057 | 3300025315 | Bacteria | 1217 |
| 448 | Ga0207656_10096578 | 3300025321 | Bacteria | 1349 |
| 449 | Ga0207696_1046441 | 3300025711 | Bacteria | 1253 |
| 450 | Ga0207713_1074733 | 3300025735 | Bacteria | 1239 |
| 451 | Ga0207682_10048511 | 3300025893 | Bacteria | 1750 |
| 452 | Ga0207682_10062668 | 3300025893 | Bacteria | 1559 |
| 453 | Ga0207682_10105682 | 3300025893 | Bacteria | 1235 |
| 454 | Ga0207692_10091003 | 3300025898 | Bacteria | 1654 |
| 455 | Ga0207692_10122768 | 3300025898 | Bacteria | 1456 |
| 456 | Ga0207692_10135572 | 3300025898 | Bacteria | 1395 |
| 457 | Ga0207688_10031963 | 3300025901 | Bacteria | 2908 |
| 458 | Ga0207688_10078433 | 3300025901 | Bacteria | 1882 |
| 459 | Ga0207688_10087632 | 3300025901 | Bacteria | 1785 |
| 460 | Ga0207680_10003295 | 3300025903 | Bacteria | 7610 |
| 461 | Ga0207680_10200565 | 3300025903 | Bacteria | 1359 |
| 462 | Ga0207680_10240713 | 3300025903 | Bacteria | 1247 |
| 463 | Ga0207680_10246452 | 3300025903 | Unclassified | 1233 |
| 464 | Ga0207647_10062299 | 3300025904 | Bacteria | 2273 |
| 465 | Ga0207647_10111456 | 3300025904 | Bacteria | 1617 |
| 466 | Ga0207685_10072977 | 3300025905 | Bacteria | 1397 |
| 467 | Ga0207685_10085400 | 3300025905 | Bacteria | 1316 |
| 468 | Ga0207699_10050794 | 3300025906 | Unclassified | 2447 |
| 469 | Ga0207699_10226327 | 3300025906 | Bacteria | 1279 |
| 470 | Ga0207645_10095315 | 3300025907 | Bacteria | 1916 |
| 471 | Ga0207645_10168306 | 3300025907 | Bacteria | 1435 |
| 472 | Ga0207645_10170066 | 3300025907 | Bacteria | 1428 |
| 473 | Ga0207645_10172363 | 3300025907 | Bacteria | 1418 |
| 474 | Ga0207643_10153523 | 3300025908 | Bacteria | 1382 |
| 475 | Ga0207643_10166108 | 3300025908 | Bacteria | 1330 |
| 476 | Ga0207705_10079852 | 3300025909 | Bacteria | 2383 |
| 477 | Ga0207705_10257230 | 3300025909 | Bacteria | 1332 |
| 478 | Ga0207705_10333064 | 3300025909 | Bacteria | 1168 |
| 479 | Ga0207684_10248194 | 3300025910 | Bacteria | 1536 |
| 480 | Ga0207654_10081807 | 3300025911 | Bacteria | 1946 |
| 481 | Ga0207654_10101529 | 3300025911 | Bacteria | 1773 |
| 482 | Ga0207654_10143555 | 3300025911 | Bacteria | 1525 |
| 483 | Ga0207654_10236281 | 3300025911 | Bacteria | 1219 |
| 484 | Ga0207707_10045153 | 3300025912 | Bacteria | 3840 |
| 485 | Ga0207707_10110799 | 3300025912 | Bacteria | 2399 |
| 486 | Ga0207707_10152653 | 3300025912 | Bacteria | 2019 |
| 487 | Ga0207707_10300041 | 3300025912 | Bacteria | 1389 |
| 488 | Ga0207707_10360993 | 3300025912 | Bacteria | 1251 |
| 489 | Ga0207695_10001751 | 3300025913 | Bacteria | 34449 |
| 490 | Ga0207695_10063328 | 3300025913 | Bacteria | 3814 |
| 491 | Ga0207695_10077082 | 3300025913 | Bacteria | 3387 |
| 492 | Ga0207695_10165375 | 3300025913 | Bacteria | 2141 |
| 493 | Ga0207695_10275154 | 3300025913 | Bacteria | 1578 |
| 494 | Ga0207695_10429718 | 3300025913 | Bacteria | 1205 |
| 495 | Ga0207671_10004948 | 3300025914 | Bacteria | 12498 |
| 496 | Ga0207671_10162587 | 3300025914 | Bacteria | 1730 |
| 497 | Ga0207693_10178790 | 3300025915 | Bacteria | 1669 |
| 498 | Ga0207693_10222657 | 3300025915 | Bacteria | 1482 |
| 499 | Ga0207693_10248745 | 3300025915 | Bacteria | 1395 |
| 500 | Ga0207693_10306628 | 3300025915 | Bacteria | 1243 |
| 501 | Ga0207663_10213762 | 3300025916 | Bacteria | 1399 |
| 502 | Ga0207663_10221338 | 3300025916 | Bacteria | 1377 |
| 503 | Ga0207663_10247171 | 3300025916 | Bacteria | 1311 |
| 504 | Ga0207663_10271398 | 3300025916 | Bacteria | 1257 |
| 505 | Ga0207660_10154207 | 3300025917 | Bacteria | 1767 |
| 506 | Ga0207660_10236907 | 3300025917 | Bacteria | 1437 |
| 507 | Ga0207660_10256365 | 3300025917 | Bacteria | 1382 |
| 508 | Ga0207660_10264646 | 3300025917 | Bacteria | 1361 |
| 509 | Ga0207657_10123311 | 3300025919 | Bacteria | 2130 |
| 510 | Ga0207657_10151291 | 3300025919 | Bacteria | 1890 |
| 511 | Ga0207657_10291313 | 3300025919 | Bacteria | 1294 |
| 512 | Ga0207657_10315908 | 3300025919 | Bacteria | 1236 |
| 513 | Ga0207649_10257271 | 3300025920 | Bacteria | 1260 |
| 514 | Ga0207649_10291614 | 3300025920 | Bacteria | 1190 |
| 515 | Ga0207649_10301701 | 3300025920 | Bacteria | 1171 |
| 516 | Ga0207652_10054640 | 3300025921 | Bacteria | 3433 |
| 517 | Ga0207652_10089855 | 3300025921 | Bacteria | 2698 |
| 518 | Ga0207652_10185191 | 3300025921 | Bacteria | 1872 |
| 519 | Ga0207652_10318260 | 3300025921 | Bacteria | 1405 |
| 520 | Ga0207652_10324320 | 3300025921 | Bacteria | 1390 |
| 521 | Ga0207646_10232621 | 3300025922 | Bacteria | 1665 |
| 522 | Ga0207681_10147460 | 3300025923 | Bacteria | 1759 |
| 523 | Ga0207681_10152464 | 3300025923 | Unclassified | 1733 |
| 524 | Ga0207681_10215663 | 3300025923 | Bacteria | 1482 |
| 525 | Ga0207681_10231761 | 3300025923 | Bacteria | 1433 |
| 526 | Ga0207694_10333605 | 3300025924 | Bacteria | 1253 |
| 527 | Ga0207650_10001931 | 3300025925 | Bacteria | 14600 |
| 528 | Ga0207650_10034561 | 3300025925 | Bacteria | 3667 |
| 529 | Ga0207650_10046818 | 3300025925 | Bacteria | 3185 |
| 530 | Ga0207650_10200170 | 3300025925 | Bacteria | 1599 |
| 531 | Ga0207650_10334098 | 3300025925 | Bacteria | 1243 |
| 532 | Ga0207659_10160500 | 3300025926 | Bacteria | 1764 |
| 533 | Ga0207659_10204875 | 3300025926 | Unclassified | 1578 |
| 534 | Ga0207659_10252663 | 3300025926 | Bacteria | 1431 |
| 535 | Ga0207700_10160126 | 3300025928 | Bacteria | 1868 |
| 536 | Ga0207700_10276115 | 3300025928 | Bacteria | 1444 |
| 537 | Ga0207700_10307572 | 3300025928 | Bacteria | 1370 |
| 538 | Ga0207700_10308997 | 3300025928 | Bacteria | 1367 |
| 539 | Ga0207700_10442620 | 3300025928 | Bacteria | 1144 |
| 540 | Ga0207664_10097800 | 3300025929 | Bacteria | 2419 |
| 541 | Ga0207664_10204190 | 3300025929 | Bacteria | 1707 |
| 542 | Ga0207644_10298275 | 3300025931 | Bacteria | 1298 |
| 543 | Ga0207644_10340327 | 3300025931 | Bacteria | 1216 |
| 544 | Ga0207690_10322411 | 3300025932 | Bacteria | 1215 |
| 545 | Ga0207690_10329531 | 3300025932 | Bacteria | 1202 |
| 546 | Ga0207706_10177266 | 3300025933 | Bacteria | 1872 |
| 547 | Ga0207706_10195172 | 3300025933 | Bacteria | 1776 |
| 548 | Ga0207706_10288969 | 3300025933 | Bacteria | 1429 |
| 549 | Ga0207709_10233427 | 3300025935 | Unclassified | 1334 |
| 550 | Ga0207709_10237186 | 3300025935 | Bacteria | 1325 |
| 551 | Ga0207670_10192396 | 3300025936 | Bacteria | 1544 |
| 552 | Ga0207669_10128238 | 3300025937 | Bacteria | 1737 |
| 553 | Ga0207704_10236256 | 3300025938 | Bacteria | 1362 |
| 554 | Ga0207704_10248464 | 3300025938 | Bacteria | 1334 |
| 555 | Ga0207704_10288146 | 3300025938 | Bacteria | 1252 |
| 556 | Ga0207665_10008229 | 3300025939 | Bacteria | 6885 |
| 557 | Ga0207665_10075123 | 3300025939 | Bacteria | 2314 |
| 558 | Ga0207665_10082452 | 3300025939 | Bacteria | 2216 |
| 559 | Ga0207665_10100605 | 3300025939 | Bacteria | 2017 |
| 560 | Ga0207665_10115630 | 3300025939 | Bacteria | 1890 |
| 561 | Ga0207665_10136539 | 3300025939 | Bacteria | 1745 |
| 562 | Ga0207665_10191279 | 3300025939 | Bacteria | 1487 |
| 563 | Ga0207665_10233357 | 3300025939 | Bacteria | 1353 |
| 564 | Ga0207665_10240373 | 3300025939 | Bacteria | 1334 |
| 565 | Ga0207665_10246259 | 3300025939 | Bacteria | 1319 |
| 566 | Ga0207689_10104485 | 3300025942 | Bacteria | 2327 |
| 567 | Ga0207661_10067607 | 3300025944 | Bacteria | 2907 |
| 568 | Ga0207661_10402593 | 3300025944 | Bacteria | 1241 |
| 569 | Ga0207661_10434019 | 3300025944 | Bacteria | 1194 |
| 570 | Ga0207679_10348514 | 3300025945 | Bacteria | 1290 |
| 571 | Ga0207679_10417457 | 3300025945 | Bacteria | 1183 |
| 572 | Ga0207667_10072114 | 3300025949 | Bacteria | 3590 |
| 573 | Ga0207667_10383837 | 3300025949 | Bacteria | 1431 |
| 574 | Ga0207667_10387404 | 3300025949 | Bacteria | 1424 |
| 575 | Ga0207667_10435574 | 3300025949 | Bacteria | 1333 |
| 576 | Ga0207667_10465978 | 3300025949 | Bacteria | 1283 |
| 577 | Ga0207651_10075403 | 3300025960 | Bacteria | 2406 |
| 578 | Ga0207651_10157771 | 3300025960 | Unclassified | 1775 |
| 579 | Ga0207651_10246780 | 3300025960 | Bacteria | 1458 |
| 580 | Ga0207712_10066855 | 3300025961 | Unclassified | 2571 |
| 581 | Ga0207712_10144136 | 3300025961 | Bacteria | 1832 |
| 582 | Ga0207712_10231088 | 3300025961 | Bacteria | 1485 |
| 583 | Ga0207668_10120543 | 3300025972 | Bacteria | 1985 |
| 584 | Ga0207668_10370573 | 3300025972 | Bacteria | 1202 |
| 585 | Ga0207640_10131315 | 3300025981 | Bacteria | 1811 |
| 586 | Ga0207640_10273469 | 3300025981 | Bacteria | 1323 |
| 587 | Ga0207640_10294303 | 3300025981 | Bacteria | 1281 |
| 588 | Ga0207640_10391301 | 3300025981 | Bacteria | 1129 |
| 589 | Ga0207658_10168765 | 3300025986 | Unclassified | 1801 |
| 590 | Ga0207658_10171342 | 3300025986 | Bacteria | 1788 |
| 591 | Ga0207658_10302907 | 3300025986 | Bacteria | 1377 |
| 592 | Ga0207658_10365310 | 3300025986 | Bacteria | 1260 |
| 593 | Ga0207658_10411237 | 3300025986 | Bacteria | 1191 |
| 594 | Ga0207658_10414951 | 3300025986 | Bacteria | 1186 |
| 595 | Ga0207677_10197779 | 3300026023 | Bacteria | 1595 |
| 596 | Ga0207677_10291364 | 3300026023 | Bacteria | 1344 |
| 597 | Ga0207677_10359977 | 3300026023 | Bacteria | 1222 |
| 598 | Ga0207703_10317041 | 3300026035 | Unclassified | 1427 |
| 599 | Ga0207703_10361199 | 3300026035 | Bacteria | 1339 |
| 600 | Ga0207703_10371315 | 3300026035 | Bacteria | 1321 |
| 601 | Ga0207639_10125837 | 3300026041 | Bacteria | 2114 |
| 602 | Ga0207639_10298018 | 3300026041 | Bacteria | 1424 |
| 603 | Ga0207639_10309846 | 3300026041 | Bacteria | 1398 |
| 604 | Ga0207639_10350065 | 3300026041 | Bacteria | 1319 |
| 605 | Ga0207639_10416130 | 3300026041 | Bacteria | 1214 |
| 606 | Ga0207678_10093380 | 3300026067 | Bacteria | 2571 |
| 607 | Ga0207678_10102241 | 3300026067 | Unclassified | 2446 |
| 608 | Ga0207678_10214407 | 3300026067 | Bacteria | 1647 |
| 609 | Ga0207678_10251757 | 3300026067 | Bacteria | 1513 |
| 610 | Ga0207678_10324796 | 3300026067 | Bacteria | 1324 |
| 611 | Ga0207678_10386651 | 3300026067 | Bacteria | 1210 |
| 612 | Ga0207708_10040908 | 3300026075 | Bacteria | 3535 |
| 613 | Ga0207708_10070812 | 3300026075 | Bacteria | 2670 |
| 614 | Ga0207708_10280776 | 3300026075 | Bacteria | 1349 |
| 615 | Ga0207708_10305953 | 3300026075 | Bacteria | 1294 |
| 616 | Ga0207702_10272771 | 3300026078 | Bacteria | 1596 |
| 617 | Ga0207702_10340200 | 3300026078 | Unclassified | 1433 |
| 618 | Ga0207702_10411103 | 3300026078 | Bacteria | 1307 |
| 619 | Ga0207702_10425830 | 3300026078 | Bacteria | 1284 |
| 620 | Ga0207702_10429196 | 3300026078 | Bacteria | 1279 |
| 621 | Ga0207641_10206213 | 3300026088 | Bacteria | 1815 |
| 622 | Ga0207648_10154760 | 3300026089 | Bacteria | 2023 |
| 623 | Ga0207676_10305056 | 3300026095 | Unclassified | 1455 |
| 624 | Ga0207674_10063619 | 3300026116 | Bacteria | 3724 |
| 625 | Ga0207674_10330378 | 3300026116 | Bacteria | 1474 |
| 626 | Ga0207675_100178505 | 3300026118 | Bacteria | 2033 |
| 627 | Ga0207675_100182188 | 3300026118 | Bacteria | 2011 |
| 628 | Ga0207675_100215411 | 3300026118 | Bacteria | 1849 |
| 629 | Ga0207675_100253696 | 3300026118 | Unclassified | 1703 |
| 630 | Ga0207675_100262233 | 3300026118 | Bacteria | 1675 |
| 631 | Ga0207675_100288600 | 3300026118 | Bacteria | 1596 |
| 632 | Ga0207683_10043507 | 3300026121 | Bacteria | 3925 |
| 633 | Ga0207683_10116612 | 3300026121 | Bacteria | 2394 |
| 634 | Ga0207683_10235151 | 3300026121 | Bacteria | 1671 |
| 635 | Ga0207683_10296288 | 3300026121 | Bacteria | 1480 |
| 636 | Ga0207683_10327059 | 3300026121 | Bacteria | 1405 |
| 637 | Ga0207698_10077952 | 3300026142 | Bacteria | 2658 |
| 638 | Ga0207698_10146605 | 3300026142 | Bacteria | 2042 |
| 639 | Ga0207698_10237065 | 3300026142 | Unclassified | 1660 |
| 640 | Ga0207698_10308701 | 3300026142 | Bacteria | 1476 |
| 641 | Ga0207698_10407498 | 3300026142 | Bacteria | 1301 |
| 642 | Ga0207698_10484620 | 3300026142 | Bacteria | 1200 |
| 643 | Ga0207698_10525426 | 3300026142 | Bacteria | 1156 |
| 644 | Ga0209969_1011881 | 3300027360 | Bacteria | 1253 |
| 645 | Ga0210000_1012778 | 3300027462 | Bacteria | 1249 |
| 646 | Ga0210000_1017361 | 3300027462 | Bacteria | 1091 |
| 647 | Ga0209968_1014508 | 3300027526 | Bacteria | 1241 |
| 648 | Ga0210002_1008947 | 3300027617 | Bacteria | 1528 |
| 649 | Ga0209971_1031996 | 3300027682 | Bacteria | 1262 |
| 650 | Ga0209998_10018230 | 3300027717 | Bacteria | 1489 |
| 651 | Ga0209974_10063676 | 3300027876 | Bacteria | 1250 |
| 652 | Ga0207428_10301964 | 3300027907 | Bacteria | 1185 |
| 653 | Ga0268266_10200733 | 3300028379 | Bacteria | 1825 |
| 654 | Ga0268265_10132275 | 3300028380 | Bacteria | 2075 |
| 655 | Ga0268265_10229553 | 3300028380 | Unclassified | 1630 |
| 656 | Ga0268265_10307237 | 3300028380 | Bacteria | 1430 |
| 657 | Ga0268265_10444662 | 3300028380 | Bacteria | 1209 |
| 658 | Ga0268264_10201915 | 3300028381 | Bacteria | 1819 |
| 659 | Ga0268264_10334015 | 3300028381 | Bacteria | 1437 |
| 660 | Ga0265326_10034941 | 3300028558 | Bacteria | 1429 |
| 661 | Ga0307517_10174989 | 3300028786 | Bacteria | 1400 |
| 662 | Ga0265765_1002940 | 3300030879 | Bacteria | 1685 |
| 663 | Ga0265760_10008115 | 3300031090 | Bacteria | 3000 |
| 664 | Ga0265328_10053062 | 3300031239 | Bacteria | 1487 |
| 665 | Ga0265327_10015234 | 3300031251 | Bacteria | 4978 |
| 666 | Ga0265316_10058534 | 3300031344 | Bacteria | 3000 |
| 667 | Ga0307513_10066003 | 3300031456 | Bacteria | 3805 |
| 668 | Ga0307513_10229264 | 3300031456 | Bacteria | 1671 |
| 669 | Ga0307408_100284624 | 3300031548 | Bacteria | 1378 |
| 670 | Ga0265314_10196673 | 3300031711 | Bacteria | 1195 |
| 671 | Ga0316576_10131100 | 3300031727 | Unclassified | 1886 |
| 672 | Ga0316576_10242280 | 3300031727 | Bacteria | 1354 |
| 673 | Ga0307405_10057636 | 3300031731 | Bacteria | 2441 |
| 674 | Ga0307406_10196057 | 3300031901 | Bacteria | 1483 |
| 675 | Ga0307412_10156090 | 3300031911 | Bacteria | 1689 |
| 676 | Ga0307412_10201382 | 3300031911 | Bacteria | 1512 |
| 677 | Ga0307412_10251480 | 3300031911 | Bacteria | 1372 |
| 678 | Ga0307416_100225435 | 3300032002 | Bacteria | 1802 |
| 679 | Ga0307414_10002594 | 3300032004 | Bacteria | 9506 |
| 680 | Ga0307414_10272576 | 3300032004 | Bacteria | 1418 |
| 681 | Ga0316583_10061230 | 3300032133 | Bacteria | 1319 |
| 682 | Ga0316580_10055087 | 3300032139 | Bacteria | 1223 |
| 683 | Ga0307507_10073697 | 3300033179 | Bacteria | 3067 |
| 684 | Ga0373950_0018071 | 3300034818 | Bacteria | 1221 |
| 685 | Ga0373938_0009909 | 3300034957 | Bacteria | 1737 |
| 686 | Ga0373926_0077849 | 3300035083 | Bacteria | 1223 |
| 687 | Ga0373929_0022104 | 3300035085 | Bacteria | 1296 |
| 688 | Ga0373929_0023846 | 3300035085 | Bacteria | 1260 |
| 689 | Ga0373940_0016404 | 3300035088 | Bacteria | 1834 |
| 690 | Ga0373944_0042146 | 3300035089 | Bacteria | 1415 |
| 691 | Ga0373949_0028770 | 3300035090 | Bacteria | 1313 |
| 692 | Ga0373951_0021740 | 3300035091 | Bacteria | 1474 |
| 693 | Ga0373923_0097515 | 3300035111 | Bacteria | 1293 |
| 694 | Ga0373932_0049290 | 3300035112 | Bacteria | 1244 |
| 695 | Ga0373936_0050374 | 3300035113 | Bacteria | 1684 |
| 696 | Ga0373943_0020871 | 3300035170 | Bacteria | 3023 |
| 697 | Ga0373946_0089871 | 3300035171 | Bacteria | 1359 |
| 698 | Ga0373946_0094306 | 3300035171 | Bacteria | 1331 |
| 699 | Ga0373961_0030240 | 3300035241 | Bacteria | 1505 |
| 700 | Ga0373931_0142060 | 3300035691 | Bacteria | 1391 |
| 701 | Ga0373931_0171287 | 3300035691 | Bacteria | 1279 |
| 702 | Ga0373935_0026283 | 3300035692 | Bacteria | 3591 |
| 703 | Ga0373935_0256796 | 3300035692 | Bacteria | 1224 |
| 704 | Ga0373927_0154193 | 3300035695 | Bacteria | 1504 |
| 705 | Ga0373947_0093386 | 3300035725 | Bacteria | 1880 |
| 706 | Ga0373947_0153376 | 3300035725 | Bacteria | 1485 |
| 707 | Ga0373937_0411750 | 3300036401 | Bacteria | 1283 |
| 708 | Ga0373937_0476499 | 3300036401 | Bacteria | 1185 |
| 709 | Ga0316582_0200759 | 3300036647 | Bacteria | 1360 |
| 710 | Ga0316584_0232673 | 3300036712 | Bacteria | 1350 |
| 711 | Ga0373925_0049221 | 3300037068 | Bacteria | 3141 |
| 712 | Ga0373925_0242906 | 3300037068 | Bacteria | 1442 |
| 713 | Ga0395899_0238342 | 3300037312 | Bacteria | 1253 |
| 714 | Ga0395900_0291929 | 3300037418 | Bacteria | 1619 |
| 715 | Ga0395900_0422689 | 3300037418 | Bacteria | 1293 |
| 716 | Ga0395900_0446867 | 3300037418 | Unclassified | 1249 |
| 717 | Ga0395900_0459297 | 3300037418 | Bacteria | 1228 |
| 718 | Ga0395898_0376736 | 3300037466 | Bacteria | 1353 |
| 719 | Ga0395905_0240037 | 3300037471 | Unclassified | 1693 |
| 720 | Ga0395905_0241791 | 3300037471 | Bacteria | 1687 |
| 721 | Ga0395905_0276446 | 3300037471 | Bacteria | 1565 |
| 722 | Ga0395905_0422874 | 3300037471 | Bacteria | 1228 |
| 723 | Ga0316581_0044812 | 3300037588 | Unclassified | 1351 |
| 724 | Ga0436364_0053155 | 3300037853 | Bacteria | 1390 |
| 725 | Ga0436364_0086624 | 3300037853 | Bacteria | 1385 |
| 726 | Ga0436364_0204912 | 3300037853 | Bacteria | 2131 |
| 727 | Ga0436364_0286621 | 3300037853 | Bacteria | 2492 |
| 728 | Ga0436364_0724866 | 3300037853 | Bacteria | 1277 |
| 729 | Ga0436364_0951973 | 3300037853 | Bacteria | 1475 |
| 730 | Ga0436364_1004052 | 3300037853 | Bacteria | 2612 |
| 731 | Ga0395901_0051753 | 3300038443 | Bacteria | 4269 |
| 732 | Ga0395901_0333247 | 3300038443 | Unclassified | 1568 |
| 733 | Ga0400490_07533 | 3300038726 | Bacteria | 26292 |
| 734 | Ga0400490_42319 | 3300038726 | Bacteria | 43071 |
| 735 | Ga0400490_58764 | 3300038726 | Bacteria | 1626 |
| 736 | Ga0242420_010783 | 3300038996 | Bacteria | 1524 |
| 737 | Ga0400483_011185 | 3300039062 | Bacteria | 1691 |
| 738 | Ga0400483_026323 | 3300039062 | Bacteria | 1812 |
| 739 | Ga0400483_046209 | 3300039062 | Bacteria | 1454 |
| 740 | Ga0400483_071440 | 3300039062 | Bacteria | 1354 |
| 741 | Ga0400483_075005 | 3300039062 | Bacteria | 1595 |
| 742 | Ga0400483_099974 | 3300039062 | Bacteria | 1184 |
| 743 | Ga0400483_128661 | 3300039062 | Bacteria | 1224 |
| 744 | Ga0400483_164724 | 3300039062 | Bacteria | 1605 |
| 745 | Ga0400483_226079 | 3300039062 | Bacteria | 1931 |
| 746 | Ga0400483_254865 | 3300039062 | Bacteria | 2339 |
| 747 | Ga0400483_270116 | 3300039062 | Bacteria | 1625 |
| 748 | Ga0400489_02500 | 3300039093 | Bacteria | 1324 |
| 749 | Ga0400489_40234 | 3300039093 | Bacteria | 1661 |
| 750 | Ga0436365_0568097 | 3300039437 | Bacteria | 1733 |
| 751 | Ga0436365_0659278 | 3300039437 | Bacteria | 1373 |
| 752 | Ga0436365_0893926 | 3300039437 | Bacteria | 4028 |
| 753 | Ga0436365_1425058 | 3300039437 | Bacteria | 1465 |
| 754 | Ga0436365_1522570 | 3300039437 | Bacteria | 1399 |
| 755 | Ga0436360_0336636 | 3300039438 | Bacteria | 1679 |
| 756 | Ga0436360_0414532 | 3300039438 | Bacteria | 1465 |
| 757 | Ga0436360_0489642 | 3300039438 | Bacteria | 1667 |
| 758 | Ga0436360_0850160 | 3300039438 | Unclassified | 1531 |
| 759 | Ga0436360_0927702 | 3300039438 | Bacteria | 1520 |
| 760 | Ga0436361_0364438 | 3300039447 | Bacteria | 10071 |
| 761 | Ga0436361_0875690 | 3300039447 | Unclassified | 1859 |
| 762 | Ga0436361_1052794 | 3300039447 | Bacteria | 1377 |
| 763 | Ga0436361_1125479 | 3300039447 | Bacteria | 1482 |
| 764 | Ga0436363_0152949 | 3300039450 | Bacteria | 1207 |
| 765 | Ga0436363_0922990 | 3300039450 | Bacteria | 1861 |
| 766 | Ga0436363_1223014 | 3300039450 | Unclassified | 1381 |
| 767 | Ga0436363_1362346 | 3300039450 | Bacteria | 1500 |
| 768 | Ga0436363_1636152 | 3300039450 | Bacteria | 1558 |
| 769 | Ga0436362_0244038 | 3300039453 | Bacteria | 1706 |
| 770 | Ga0436362_0754209 | 3300039453 | Unclassified | 1606 |
| 771 | Ga0451789_0703507 | 3300041443 | Bacteria | 1383 |
| 772 | Ga0451806_812352 | 3300041462 | Bacteria | 1892 |
| 773 | Ga0451807_0295069 | 3300041486 | Bacteria | 1445 |
| 774 | Ga0451845_0629088 | 3300041501 | Bacteria | 1751 |
| 775 | Ga0451853_1726360 | 3300041512 | Bacteria | 1771 |
| 776 | Ga0450914_002861 | 3300042118 | Bacteria | 1275 |
| 777 | Ga0450902_013600 | 3300042137 | Bacteria | 1311 |
| 778 | Ga0439435_0045533 | 3300042436 | Bacteria | 1241 |
| 779 | Ga0439464_0021927 | 3300042439 | Bacteria | 1755 |
| 780 | Ga0451577_0281545 | 3300042876 | Bacteria | 1506 |
| 781 | Ga0466972_0040530 | 3300044658 | Bacteria | 2268 |
| 782 | Ga0466972_0069208 | 3300044658 | Bacteria | 1686 |
| 783 | Ga0466961_0156343 | 3300044693 | Bacteria | 1422 |
| 784 | Ga0466963_0184726 | 3300044694 | Bacteria | 1456 |
| 785 | Ga0466964_0006040 | 3300044706 | Bacteria | 4512 |
| 786 | Ga0453684_0297187 | 3300044712 | Bacteria | 1836 |
| 787 | Ga0453684_0361880 | 3300044712 | Bacteria | 1633 |
| 788 | Ga0466970_0108314 | 3300044765 | Bacteria | 1516 |
| 789 | Ga0466970_0108804 | 3300044765 | Unclassified | 1513 |
| 790 | Ga0466959_0110234 | 3300045049 | Bacteria | 1965 |
| 791 | Ga0466959_0265214 | 3300045049 | Unclassified | 1182 |
| 792 | Ga0451576_0393164 | 3300045051 | Bacteria | 1453 |
| 793 | Ga0466967_0222238 | 3300045976 | Bacteria | 1795 |
| 794 | Ga0466967_0225109 | 3300045976 | Bacteria | 1784 |
| 795 | Ga0466967_0362109 | 3300045976 | Bacteria | 1405 |
| 796 | Ga0466967_0459958 | 3300045976 | Bacteria | 1244 |
| 797 | Ga0495592_0157334 | 3300046454 | Bacteria | 1566 |
| 798 | Ga0495590_0002805 | 3300046457 | Bacteria | 7198 |
| 799 | Ga0495629_0260359 | 3300046459 | Bacteria | 1192 |
| 800 | Ga0495638_0028650 | 3300046460 | Bacteria | 3593 |
| 801 | Ga0495638_0154877 | 3300046460 | Bacteria | 1326 |
| 802 | Ga0495651_0111962 | 3300046462 | Bacteria | 2017 |
| 803 | Ga0495651_0245276 | 3300046462 | Bacteria | 1226 |
| 804 | Ga0495653_0070369 | 3300046463 | Bacteria | 2619 |
| 805 | Ga0495580_0153150 | 3300046472 | Bacteria | 1597 |
| 806 | Ga0495580_0195300 | 3300046472 | Bacteria | 1395 |
| 807 | Ga0495605_0040747 | 3300046474 | Bacteria | 2317 |
| 808 | Ga0495620_0086658 | 3300046515 | Bacteria | 1260 |
| 809 | Ga0495620_0088965 | 3300046515 | Bacteria | 1240 |
| 810 | Ga0495628_0041687 | 3300046516 | Bacteria | 3664 |
| 811 | Ga0495628_0221348 | 3300046516 | Bacteria | 1421 |
| 812 | Ga0495632_0053500 | 3300046519 | Unclassified | 1982 |
| 813 | Ga0495648_0048062 | 3300046524 | Bacteria | 2630 |
| 814 | Ga0495642_0062446 | 3300046528 | Bacteria | 1547 |
| 815 | Ga0495652_0064638 | 3300046529 | Bacteria | 3076 |
| 816 | Ga0495665_0023895 | 3300046531 | Bacteria | 3284 |
| 817 | Ga0495665_0135126 | 3300046531 | Bacteria | 1290 |
| 818 | Ga0495587_0157257 | 3300046536 | Bacteria | 1294 |
| 819 | Ga0495598_0052896 | 3300046537 | Bacteria | 1228 |
| 820 | Ga0495598_0059533 | 3300046537 | Bacteria | 1174 |
| 821 | Ga0495645_0209624 | 3300046543 | Bacteria | 1317 |
| 822 | Ga0495668_0146925 | 3300046616 | Bacteria | 1291 |
| 823 | Ga0495634_0002312 | 3300046642 | Bacteria | 15945 |
| 824 | Ga0495635_0216009 | 3300046663 | Bacteria | 1298 |
| 825 | Ga0495623_0148699 | 3300046679 | Bacteria | 1386 |
| 826 | Ga0495646_0058631 | 3300046680 | Bacteria | 2301 |
| 827 | Ga0495646_0154210 | 3300046680 | Bacteria | 1275 |
| 828 | Ga0495658_0122042 | 3300046683 | Bacteria | 1577 |
| 829 | Ga0495669_0019991 | 3300046684 | Bacteria | 2893 |
| 830 | Ga0495669_0087880 | 3300046684 | Bacteria | 1432 |
| 831 | Ga0495669_0124056 | 3300046684 | Unclassified | 1212 |
| 832 | Ga0495624_0233362 | 3300046690 | Bacteria | 1114 |
| 833 | Ga0495649_0124737 | 3300046694 | Bacteria | 1360 |
| 834 | Ga0495589_0016864 | 3300046794 | Bacteria | 3750 |
| 835 | Ga0495581_0148538 | 3300047315 | Bacteria | 1368 |
| 836 | Ga0495604_0154018 | 3300047317 | Bacteria | 1630 |
| 837 | Ga0495604_0184776 | 3300047317 | Bacteria | 1456 |
| 838 | Ga0495604_0218467 | 3300047317 | Bacteria | 1313 |
| 839 | Ga0495674_0022247 | 3300047319 | Bacteria | 5846 |
| 840 | Ga0495674_0100447 | 3300047319 | Bacteria | 2462 |
| 841 | Ga0495674_0261322 | 3300047319 | Bacteria | 1422 |
| 842 | Ga0495672_0059410 | 3300047320 | Bacteria | 2212 |
| 843 | Ga0495672_0087803 | 3300047320 | Bacteria | 1716 |
| 844 | Ga0495680_0201423 | 3300047322 | Bacteria | 1427 |
| 845 | Ga0495680_0214516 | 3300047322 | Bacteria | 1376 |
| 846 | Ga0495683_0046404 | 3300047323 | Bacteria | 2180 |
| 847 | Ga0495687_059783 | 3300047443 | Bacteria | 1574 |
| 848 | Ga0495675_0033688 | 3300047444 | Bacteria | 3269 |
| 849 | Ga0495675_0068391 | 3300047444 | Bacteria | 2243 |
| 850 | Ga0495675_0194613 | 3300047444 | Bacteria | 1236 |
| 851 | Ga0495673_0093484 | 3300047469 | Bacteria | 1225 |
| 852 | Ga0495686_0020690 | 3300047472 | Unclassified | 4385 |
| 853 | Ga0495602_0034333 | 3300048088 | Bacteria | 4746 |
| 854 | Ga0495602_0089387 | 3300048088 | Bacteria | 2561 |
| 855 | Ga0495602_0182237 | 3300048088 | Bacteria | 1618 |
| 856 | Ga0495602_0201467 | 3300048088 | Bacteria | 1518 |
| 857 | Ga0496100_0128325 | 3300048903 | Bacteria | 1783 |
| 858 | Ga0496100_0293452 | 3300048903 | Unclassified | 1215 |
| 859 | Ga0496100_0296341 | 3300048903 | Bacteria | 1209 |
| 860 | Ga0496101_0251690 | 3300048904 | Unclassified | 1376 |
| 861 | Ga0496101_0281705 | 3300048904 | Bacteria | 1299 |
| 862 | Ga0496101_0323763 | 3300048904 | Bacteria | 1209 |
| 863 | Ga0496102_0214414 | 3300048905 | Bacteria | 1815 |
| 864 | Ga0496102_0283287 | 3300048905 | Bacteria | 1562 |
| 865 | Ga0496102_0449107 | 3300048905 | Bacteria | 1209 |
| 866 | Ga0496103_0223949 | 3300048906 | Bacteria | 1209 |
| 867 | Ga0496104_0118609 | 3300048907 | Bacteria | 2540 |
| 868 | Ga0496104_0179210 | 3300048907 | Bacteria | 2029 |
| 869 | Ga0496104_0367246 | 3300048907 | Bacteria | 1351 |
| 870 | Ga0496104_0483548 | 3300048907 | Bacteria | 1149 |
| 871 | Ga0496105_0110849 | 3300048908 | Bacteria | 2265 |
| 872 | Ga0496105_0325303 | 3300048908 | Bacteria | 1231 |
| 873 | Ga0496106_0163399 | 3300048909 | Bacteria | 1762 |
| 874 | Ga0496106_0225096 | 3300048909 | Unclassified | 1496 |
| 875 | Ga0496106_0304832 | 3300048909 | Bacteria | 1277 |
| 876 | Ga0496106_0343756 | 3300048909 | Bacteria | 1198 |
| 877 | Ga0496106_0358517 | 3300048909 | Bacteria | 1171 |
| 878 | Ga0496107_0104212 | 3300048910 | Bacteria | 2081 |
| 879 | Ga0496107_0156905 | 3300048910 | Bacteria | 1685 |
| 880 | Ga0496107_0162478 | 3300048910 | Unclassified | 1655 |
| 881 | Ga0496108_0264262 | 3300048911 | Bacteria | 1497 |
| 882 | Ga0496108_0306138 | 3300048911 | Bacteria | 1384 |
| 883 | Ga0496108_0309874 | 3300048911 | Bacteria | 1375 |
| 884 | Ga0496108_0344742 | 3300048911 | Unclassified | 1300 |
| 885 | Ga0496108_0367229 | 3300048911 | Bacteria | 1256 |
| 886 | Ga0496109_0223622 | 3300048912 | Bacteria | 1770 |
| 887 | Ga0496109_0258980 | 3300048912 | Bacteria | 1638 |
| 888 | Ga0496109_0320985 | 3300048912 | Bacteria | 1461 |
| 889 | Ga0496109_0386071 | 3300048912 | Bacteria | 1323 |
| 890 | Ga0496110_0138988 | 3300048913 | Bacteria | 2196 |
| 891 | Ga0496110_0193792 | 3300048913 | Bacteria | 1845 |
| 892 | Ga0496110_0352983 | 3300048913 | Bacteria | 1339 |
| 893 | Ga0496110_0387090 | 3300048913 | Bacteria | 1274 |
| 894 | Ga0496110_0443567 | 3300048913 | Bacteria | 1183 |
| 895 | Ga0496111_0105798 | 3300048914 | Unclassified | 2071 |
| 896 | Ga0496111_0153666 | 3300048914 | Bacteria | 1707 |
| 897 | Ga0496112_0295115 | 3300048915 | Bacteria | 1567 |
| 898 | Ga0496112_0358494 | 3300048915 | Unclassified | 1400 |
| 899 | Ga0496112_0437742 | 3300048915 | Bacteria | 1245 |
| 900 | Ga0496112_0519557 | 3300048915 | Bacteria | 1125 |
| 901 | Ga0496113_0052442 | 3300048916 | Bacteria | 3046 |
| 902 | Ga0496113_0121239 | 3300048916 | Bacteria | 2045 |
| 903 | Ga0496113_0172817 | 3300048916 | Bacteria | 1711 |
| 904 | Ga0496113_0233797 | 3300048916 | Bacteria | 1466 |
| 905 | Ga0496114_0347175 | 3300048917 | Bacteria | 1312 |
| 906 | Ga0496114_0443765 | 3300048917 | Bacteria | 1149 |
| 907 | Ga0496115_0014177 | 3300048918 | Bacteria | 6032 |
| 908 | Ga0496115_0175154 | 3300048918 | Bacteria | 1774 |
| 909 | Ga0496115_0403362 | 3300048918 | Bacteria | 1109 |
| 910 | Ga0496116_0090148 | 3300048919 | Bacteria | 1867 |
| 911 | Ga0496117_0141054 | 3300048920 | Bacteria | 1443 |
| 912 | Ga0496118_0194351 | 3300048921 | Bacteria | 1209 |
| 913 | Ga0496119_0114393 | 3300048922 | Bacteria | 1492 |
| 914 | Ga0496120_0136741 | 3300048923 | Bacteria | 1248 |
| 915 | Ga0496122_0004728 | 3300048925 | Bacteria | 16707 |
| 916 | Ga0496122_0007495 | 3300048925 | Bacteria | 12107 |
| 917 | Ga0496122_0185465 | 3300048925 | Bacteria | 1234 |
| 918 | Ga0496123_0023137 | 3300048926 | Bacteria | 4765 |
| 919 | Ga0496123_0033563 | 3300048926 | Bacteria | 3691 |
| 920 | Ga0496123_0070687 | 3300048926 | Bacteria | 2182 |
| 921 | Ga0496124_0110209 | 3300048927 | Bacteria | 2216 |
| 922 | Ga0496124_0128291 | 3300048927 | Bacteria | 2018 |
| 923 | Ga0496125_0007596 | 3300048928 | Bacteria | 11515 |
| 924 | Ga0496125_0145184 | 3300048928 | Bacteria | 1641 |
| 925 | Ga0496126_0212372 | 3300048929 | Bacteria | 1628 |
| 926 | Ga0466983_0226267 | 3300048986 | Bacteria | 1473 |
| 927 | Ga0495682_0057187 | 3300049460 | Bacteria | 1412 |
| 928 | Ga0501294_002584 | 3300049517 | Unclassified | 1712 |
| 929 | Ga0501032_0242207 | 3300049569 | Bacteria | 1171 |
| 930 | Ga0501033_0001675 | 3300049570 | Bacteria | 19372 |
| 931 | Ga0501033_0247634 | 3300049570 | Bacteria | 1264 |
| 932 | Ga0501034_0208259 | 3300049571 | Bacteria | 1911 |
| 933 | Ga0501034_0264834 | 3300049571 | Bacteria | 1661 |
| 934 | Ga0501034_0298735 | 3300049571 | Unclassified | 1547 |
| 935 | Ga0501034_0307562 | 3300049571 | Bacteria | 1520 |
| 936 | Ga0501036_0138625 | 3300049572 | Bacteria | 2053 |
| 937 | Ga0501036_0227206 | 3300049572 | Unclassified | 1566 |
| 938 | Ga0501036_0291771 | 3300049572 | Bacteria | 1364 |
| 939 | Ga0501036_0380817 | 3300049572 | Bacteria | 1177 |
| 940 | Ga0501037_0153873 | 3300049573 | Unclassified | 1642 |
| 941 | Ga0501038_0188328 | 3300049574 | Bacteria | 1661 |
| 942 | Ga0501039_0281397 | 3300049575 | Bacteria | 1307 |
| 943 | Ga0501039_0314249 | 3300049575 | Bacteria | 1232 |
| 944 | Ga0501040_0279023 | 3300049576 | Bacteria | 1193 |
| 945 | Ga0501040_0310022 | 3300049576 | Bacteria | 1128 |
| 946 | Ga0501041_0167562 | 3300049577 | Bacteria | 1374 |
| 947 | Ga0501041_0199380 | 3300049577 | Bacteria | 1254 |
| 948 | Ga0501041_0209329 | 3300049577 | Bacteria | 1223 |
| 949 | Ga0501042_0227839 | 3300049578 | Bacteria | 1344 |
| 950 | Ga0501042_0234403 | 3300049578 | Bacteria | 1324 |
| 951 | Ga0501046_0233653 | 3300049580 | Bacteria | 1357 |
| 952 | Ga0501046_0239289 | 3300049580 | Bacteria | 1339 |
| 953 | Ga0501046_0269359 | 3300049580 | Bacteria | 1249 |
| 954 | Ga0501047_0262539 | 3300049581 | Bacteria | 1574 |
| 955 | Ga0501048_0025867 | 3300049582 | Bacteria | 4275 |
| 956 | Ga0501048_0227785 | 3300049582 | Bacteria | 1322 |
| 957 | Ga0501048_0231740 | 3300049582 | Bacteria | 1310 |
| 958 | Ga0501048_0247402 | 3300049582 | Bacteria | 1265 |
| 959 | Ga0501069_0021032 | 3300049585 | Bacteria | 3539 |
| 960 | Ga0501069_0139700 | 3300049585 | Unclassified | 1389 |
| 961 | Ga0501070_0009953 | 3300049586 | Bacteria | 8039 |
| 962 | Ga0501070_0416774 | 3300049586 | Bacteria | 1085 |
| 963 | Ga0501071_0282842 | 3300049587 | Bacteria | 1255 |
| 964 | Ga0501072_0227700 | 3300049588 | Bacteria | 1485 |
| 965 | Ga0501072_0395039 | 3300049588 | Bacteria | 1097 |
| 966 | Ga0501073_0218936 | 3300049589 | Bacteria | 1315 |
| 967 | Ga0501075_0277387 | 3300049591 | Bacteria | 1277 |
| 968 | Ga0501077_0203911 | 3300049593 | Bacteria | 1256 |
| 969 | Ga0501201_004341 | 3300049651 | Unclassified | 1314 |
| 970 | Ga0501202_009168 | 3300049652 | Unclassified | 1814 |
| 971 | Ga0501207_005154 | 3300049654 | Unclassified | 1802 |
| 972 | Ga0501223_007098 | 3300049663 | Unclassified | 2301 |
| 973 | Ga0501257_001308 | 3300049686 | Bacteria | 5131 |
| 974 | Ga0501225_0002406 | 3300049705 | Bacteria | 5775 |
| 975 | Ga0501079_0256968 | 3300049741 | Bacteria | 1365 |
| 976 | Ga0501081_0055398 | 3300049743 | Bacteria | 2740 |
| 977 | Ga0501271_003649 | 3300049768 | Unclassified | 1429 |
| 978 | Ga0501035_0026016 | 3300049822 | Bacteria | 5359 |
| 979 | Ga0501035_0082459 | 3300049822 | Bacteria | 2837 |
| 980 | Ga0501044_0372052 | 3300049823 | Unclassified | 1345 |
| 981 | Ga0501044_0385142 | 3300049823 | Bacteria | 1317 |
| 982 | nmdc:mga0k408_113259_c1 | 3300050493 | Bacteria | 1604 |
| 983 | nmdc:mga0k408_116415_c1 | 3300050493 | Bacteria | 1581 |
| 984 | nmdc:mga0k408_47532_c1 | 3300050493 | Bacteria | 2480 |
| 985 | nmdc:mga07m45_167367_c1 | 3300050496 | Bacteria | 1277 |
| 986 | nmdc:mga05p37_58293_c1 | 3300050507 | Bacteria | 4756 |
| 987 | nmdc:mga09592_100757_c1 | 3300050508 | Bacteria | 2474 |
| 988 | nmdc:mga09592_390542_c1 | 3300050508 | Bacteria | 1203 |
| 989 | nmdc:mga0qj67_136977_c1 | 3300050509 | Bacteria | 1984 |
| 990 | nmdc:mga06r32_231264_c1 | 3300050510 | Unclassified | 1837 |
| 991 | nmdc:mga06r32_9455_c1 | 3300050510 | Bacteria | 8798 |
| 992 | nmdc:mga08y16_299811_c1 | 3300050511 | Bacteria | 1657 |
| 993 | nmdc:mga08y16_532705_c1 | 3300050511 | Bacteria | 1190 |
| 994 | nmdc:mga0n895_220501_c1 | 3300050512 | Bacteria | 1926 |
| 995 | nmdc:mga0n895_241898_c1 | 3300050512 | Bacteria | 1832 |
| 996 | nmdc:mga0n895_319440_c1 | 3300050512 | Bacteria | 1574 |
| 997 | nmdc:mga0n895_357256_c1 | 3300050512 | Unclassified | 1480 |
| 998 | nmdc:mga0n895_464201_c1 | 3300050512 | Bacteria | 1278 |
| 999 | nmdc:mga0n895_494567_c1 | 3300050512 | Bacteria | 1233 |
| 1000 | nmdc:mga0rr50_137051_c1 | 3300050513 | Bacteria | 1966 |
| 1001 | nmdc:mga0rr50_260809_c1 | 3300050513 | Bacteria | 1442 |
| 1002 | nmdc:mga0rr50_44497_c1 | 3300050513 | Bacteria | 3257 |
| 1003 | nmdc:mga0rr50_58168_c1 | 3300050513 | Bacteria | 2896 |
| 1004 | nmdc:mga08x19_159244_c1 | 3300050514 | Bacteria | 1533 |
| 1005 | nmdc:mga08x19_214796_c1 | 3300050514 | Bacteria | 1321 |
| 1006 | nmdc:mga08x19_240853_c1 | 3300050514 | Bacteria | 1247 |
| 1007 | nmdc:mga08x19_284_c1 | 3300050514 | Bacteria | 37998 |
| 1008 | nmdc:mga0a205_194440_c1 | 3300050515 | Bacteria | 1920 |
| 1009 | nmdc:mga0a205_339353_c1 | 3300050515 | Unclassified | 1371 |
| 1010 | Ga0495619_0182665 | 3300053085 | Bacteria | 1451 |
| 1011 | Ga0500641_0105220 | 3300053096 | Bacteria | 1212 |
| 1012 | Ga0500594_0033776 | 3300053118 | Bacteria | 1362 |
| 1013 | Ga0500652_000713 | 3300053131 | Bacteria | 11288 |
| 1014 | Ga0500658_0088344 | 3300053134 | Bacteria | 1336 |
| 1015 | Ga0500588_0035536 | 3300053146 | Unclassified | 1467 |
| 1016 | Ga0500588_0052263 | 3300053146 | Bacteria | 1278 |
| 1017 | Ga0500604_0015626 | 3300053151 | Bacteria | 2082 |
| 1018 | Ga0500637_0052489 | 3300053178 | Bacteria | 2325 |
| 1019 | Ga0501084_0333780 | 3300054114 | Bacteria | 1280 |
| 1020 | Ga0587068_011021 | 3300059641 | Bacteria | 1357 |
| 1021 | Ga0587072_004443 | 3300059643 | Bacteria | 2038 |
| 1022 | Ga0501082_0334017 | 3300060353 | Bacteria | 1320 |
| 1023 | Ga0501082_0339773 | 3300060353 | Bacteria | 1308 |
| 1024 | Ga0501082_0398858 | 3300060353 | Bacteria | 1200 |
| 1025 | 2524000573 | 2523533628 | Bacteria | 4098242 |
| 1026 | 2524001544 | 2523533628 | Bacteria | 4098242 |
| 1027 | 2524003653 | 2523533628 | Bacteria | 4098242 |
| 1028 | 2599744234 | 2599185240 | Bacteria | 7968121 |
| 1029 | 2600206271 | 2599185355 | Bacteria | 7968906 |
| 1030 | 2676743414 | 2675903129 | Bacteria | 7964495 |
| 1031 | 2738760017 | 2738541283 | Bacteria | 7222293 |
| 1032 | 2753571776 | 2751185846 | Bacteria | 7242164 |
| 1033 | 2835316416 | 2835312727 | Bacteria | 7413381 |
| 1034 | 2842332692 | 2842324504 | Bacteria | 9364110 |
| 1035 | 2842355861 | 2842348783 | Bacteria | 9002918 |
| 1036 | 2906001616 | 2905999023 | Bacteria | 4591259 |
| 1037 | 2913852153 | 2913844669 | Bacteria | 8381711 |
| 1038 | 2929925216 | 2929921140 | Bacteria | 8649150 |
| 1039 | 2977233163 | 2977232053 | Bacteria | 5485925 |
| 1040 | 2977233206 | 2977232053 | Bacteria | 5485925 |
| 1041 | 2977236334 | 2977232053 | Bacteria | 5485925 |
| 1042 | 2977236604 | 2977232053 | Bacteria | 5485925 |
| 1043 | 642425669 | 641736151 | Bacteria | 7477263 |
| 1044 | 642425690 | 641736151 | Bacteria | 7477263 |
| 1045 | 642617469 | 642555113 | Bacteria | 8214658 |
| 1046 | 643602653 | 643348564 | Bacteria | 8839022 |
| 1047 | Ga0436362_0788498 | |||
| 1048 | SwRhRL2b_contig_1751191 | |||
| 1049 | SwRhRL2b_contig_2759932 | |||
| 1050 | MRS1b_contig_7804166 | |||
| 1051 | MRS1b_contig_8693482 | |||
| 1052 | ARcpr5yngRDRAFT_c005277 | |||
| 1053 | CNXas_1003063 | |||
| 1054 | JGI24747J21853_1005066 | |||
| 1055 | JGI24740J21852_10030229 | |||
| 1056 | JGI24740J21852_10037783 | |||
| 1057 | JGI24740J21852_10045239 | |||
| 1058 | JGI24740J21852_10053293 | |||
| 1059 | JGI24739J22299_10000880 | |||
| 1060 | JGI24739J22299_10008242 | |||
| 1061 | JGI24739J22299_10012147 | |||
| 1062 | JGI24737J22298_10035182 | |||
| 1063 | JGI24735J21928_10020041 | |||
| 1064 | JGI24735J21928_10026311 | |||
| 1065 | JGI24738J21930_10019697 | |||
| 1066 | JGI24738J21930_10023032 | |||
| 1067 | JGI24749J21850_1012207 | |||
| 1068 | JGI24744J21845_10011122 | |||
| 1069 | JGI24033J26618_1007563 | |||
| 1070 | JGI24742J22300_10018067 | |||
| 1071 | JGI24751J29686_10019929 | |||
| 1072 | JGI25156J39149_1000072 | |||
| 1073 | JGI25150J39212_1011789 | |||
| 1074 | JGI25406J46586_10053286 | |||
| 1075 | JGI25406J46586_10056148 | |||
| 1076 | JGI25153J46596_10001013 | |||
| 1077 | rootH1_10015982 | |||
| 1078 | rootH2_10079745 | |||
| 1079 | rootH2_10129418 | |||
| 1080 | rootH2_10268060 | |||
| 1081 | rootL2_10021147 | |||
| 1082 | rootL2_10083669 | |||
| 1083 | rootL2_10091978 | |||
| 1084 | rootL2_10118054 | |||
| 1085 | rootL2_10231333 | |||
| 1086 | rootL2_10270586 | |||
| 1087 | rootL2_10316240 | |||
| 1088 | rootL2_10329729 | |||
| 1089 | rootH1_10023272 | |||
| 1090 | rootH1_10036171 | |||
| 1091 | JGI25160J50197_1026103 | |||
| 1092 | JGI25160J50197_1030153 | |||
| 1093 | JGI25404J52841_10027187 | |||
| 1094 | Ga0055530_10037148 | |||
| 1095 | Ga0065165_1016483 | |||
| 1096 | Ga0065714_10002184 | |||
| 1097 | Ga0065714_10111464 | |||
| 1098 | Ga0065704_10125692 | |||
| 1099 | Ga0065704_10142658 | |||
| 1100 | Ga0065704_10146725 | |||
| 1101 | Ga0065712_10000112 | |||
| 1102 | Ga0065712_10110510 | |||
| 1103 | Ga0065712_10114686 | |||
| 1104 | Ga0065712_10136104 | |||
| 1105 | Ga0065712_10136603 | |||
| 1106 | Ga0065715_10189204 | |||
| 1107 | Ga0065715_10194612 | |||
| 1108 | Ga0065715_10216115 | |||
| 1109 | Ga0065707_10173926 | |||
| 1110 | Ga0065707_10201606 | |||
| 1111 | Ga0070658_10196131 | |||
| 1112 | Ga0070658_10214301 | |||
| 1113 | Ga0070676_10127760 | |||
| 1114 | Ga0070683_100130758 | |||
| 1115 | Ga0070683_100207939 | |||
| 1116 | Ga0070683_100292711 | |||
| 1117 | Ga0070690_100107499 | |||
| 1118 | Ga0070670_100038326 | |||
| 1119 | Ga0070670_100226186 | |||
| 1120 | Ga0068869_100225967 | |||
| 1121 | Ga0068869_100299049 | |||
| 1122 | Ga0070666_10037706 | |||
| 1123 | Ga0070666_10149598 | |||
| 1124 | Ga0070666_10176099 | |||
| 1125 | Ga0070666_10180232 | |||
| 1126 | Ga0070666_10215402 | |||
| 1127 | Ga0070666_10227392 | |||
| 1128 | Ga0070666_10275353 | |||
| 1129 | Ga0070680_100167489 | |||
| 1130 | Ga0070680_100192541 | |||
| 1131 | Ga0070680_100220622 | |||
| 1132 | Ga0070680_100321359 | |||
| 1133 | Ga0070682_100238749 | |||
| 1134 | Ga0070682_100267784 | |||
| 1135 | Ga0068868_100246542 | |||
| 1136 | Ga0068868_100316141 | |||
| 1137 | Ga0068868_100344189 | |||
| 1138 | Ga0068868_100364328 | |||
| 1139 | Ga0070660_100114902 | |||
| 1140 | Ga0070660_100121968 | |||
| 1141 | Ga0070689_100238418 | |||
| 1142 | Ga0070689_100360753 | |||
| 1143 | Ga0070661_100194641 | |||
| 1144 | Ga0070661_100249135 | |||
| 1145 | Ga0070661_100276747 | |||
| 1146 | Ga0070661_100283012 | |||
| 1147 | Ga0070661_100364757 | |||
| 1148 | Ga0070668_100165173 | |||
| 1149 | Ga0070668_100257723 | |||
| 1150 | Ga0070668_100273064 | |||
| 1151 | Ga0070669_100121039 | |||
| 1152 | Ga0070669_100225913 | |||
| 1153 | Ga0070669_100235559 | |||
| 1154 | Ga0070669_100245334 | |||
| 1155 | Ga0070669_100348610 | |||
| 1156 | Ga0070675_100185200 | |||
| 1157 | Ga0070671_100185825 | |||
| 1158 | Ga0070671_100311866 | |||
| 1159 | Ga0070671_100354412 | |||
| 1160 | Ga0070671_100366121 | |||
| 1161 | Ga0070674_100241111 | |||
| 1162 | Ga0070673_100143065 | |||
| 1163 | Ga0070688_100196159 | |||
| 1164 | Ga0070659_100167055 | |||
| 1165 | Ga0070659_100243124 | |||
| 1166 | Ga0070659_100244919 | |||
| 1167 | Ga0070659_100304429 | |||
| 1168 | Ga0070667_100113396 | |||
| 1169 | Ga0070667_100213817 | |||
| 1170 | Ga0070667_100239448 | |||
| 1171 | Ga0070667_100252670 | |||
| 1172 | Ga0070667_100315663 | |||
| 1173 | Ga0070667_100333154 | |||
| 1174 | Ga0070667_100392859 | |||
| 1175 | Ga0070667_100449014 | |||
| 1176 | Ga0070709_10120979 | |||
| 1177 | Ga0070709_10142765 | |||
| 1178 | Ga0070709_10235933 | |||
| 1179 | Ga0070714_100225646 | |||
| 1180 | Ga0070714_100327254 | |||
| 1181 | Ga0070714_100403247 | |||
| 1182 | Ga0070713_100255292 | |||
| 1183 | Ga0070713_100320426 | |||
| 1184 | Ga0070713_100328732 | |||
| 1185 | Ga0070713_100341621 | |||
| 1186 | Ga0070713_100462638 | |||
| 1187 | Ga0070710_10113484 | |||
| 1188 | Ga0070710_10160094 | |||
| 1189 | Ga0070711_100135544 | |||
| 1190 | Ga0070711_100149477 | |||
| 1191 | Ga0070711_100163215 | |||
| 1192 | Ga0070711_100176914 | |||
| 1193 | Ga0070711_100201850 | |||
| 1194 | Ga0070711_100282079 | |||
| 1195 | Ga0070711_100284880 | |||
| 1196 | Ga0070705_100117079 | |||
| 1197 | Ga0070705_100183197 | |||
| 1198 | Ga0070700_100021585 | |||
| 1199 | Ga0070700_100065840 | |||
| 1200 | Ga0070700_100217222 | |||
| 1201 | Ga0070708_100422128 | |||
| 1202 | Ga0070663_100249709 | |||
| 1203 | Ga0070663_100298032 | |||
| 1204 | Ga0070663_100339659 | |||
| 1205 | Ga0070678_100047435 | |||
| 1206 | Ga0070678_100150791 | |||
| 1207 | Ga0070678_100292864 | |||
| 1208 | Ga0070678_100300025 | |||
| 1209 | Ga0070662_100238908 | |||
| 1210 | Ga0070662_100277478 | |||
| 1211 | Ga0070662_100309674 | |||
| 1212 | Ga0070681_10257832 | |||
| 1213 | Ga0070681_10278246 | |||
| 1214 | Ga0070681_10278619 | |||
| 1215 | Ga0070681_10376978 | |||
| 1216 | Ga0070681_10380610 | |||
| 1217 | Ga0070681_10434686 | |||
| 1218 | Ga0068867_100277789 | |||
| 1219 | Ga0068867_100283059 | |||
| 1220 | Ga0070706_100118890 | |||
| 1221 | Ga0070707_100278246 | |||
| 1222 | Ga0070699_100243008 | |||
| 1223 | Ga0070679_100218847 | |||
| 1224 | Ga0070679_100405494 | |||
| 1225 | Ga0070679_100434497 | |||
| 1226 | Ga0070679_100457151 | |||
| 1227 | Ga0070684_100375295 | |||
| 1228 | Ga0070684_100425422 | |||
| 1229 | Ga0070697_100187554 | |||
| 1230 | Ga0068853_100340089 | |||
| 1231 | Ga0068853_100428845 | |||
| 1232 | Ga0068853_100438554 | |||
| 1233 | Ga0068853_100439683 | |||
| 1234 | Ga0070672_100271022 | |||
| 1235 | Ga0070686_100382778 | |||
| 1236 | Ga0070695_100140429 | |||
| 1237 | Ga0070695_100183561 | |||
| 1238 | Ga0070693_100127550 | |||
| 1239 | Ga0070693_100265854 | |||
| 1240 | Ga0070665_100271380 | |||
| 1241 | Ga0070704_100245028 | |||
| 1242 | Ga0068855_100073546 | |||
| 1243 | Ga0068855_100187740 | |||
| 1244 | Ga0068855_100348742 | |||
| 1245 | Ga0068855_100492493 | |||
| 1246 | Ga0070664_100037517 | |||
| 1247 | Ga0070664_100371456 | |||
| 1248 | Ga0068857_100105016 | |||
| 1249 | Ga0068857_100339858 | |||
| 1250 | Ga0068857_100363753 | |||
| 1251 | Ga0068857_100387866 | |||
| 1252 | Ga0068854_100206797 | |||
| 1253 | Ga0068854_100318555 | |||
| 1254 | Ga0068854_100344103 | |||
| 1255 | Ga0068854_100360568 | |||
| 1256 | Ga0068856_100284703 | |||
| 1257 | Ga0068856_100318534 | |||
| 1258 | Ga0068856_100379977 | |||
| 1259 | Ga0068856_100408556 | |||
| 1260 | Ga0068856_100439033 | |||
| 1261 | Ga0068856_100450627 | |||
| 1262 | Ga0068852_100121472 | |||
| 1263 | Ga0068852_100126942 | |||
| 1264 | Ga0068852_100150639 | |||
| 1265 | Ga0068852_100286978 | |||
| 1266 | Ga0068859_100367725 | |||
| 1267 | Ga0068859_100389174 | |||
| 1268 | Ga0068859_100402645 | |||
| 1269 | Ga0068859_100412123 | |||
| 1270 | Ga0068859_100517741 | |||
| 1271 | Ga0068859_100574391 | |||
| 1272 | Ga0068864_100163707 | |||
| 1273 | Ga0068864_100352202 | |||
| 1274 | Ga0068864_100407178 | |||
| 1275 | Ga0068861_100008537 | |||
| 1276 | Ga0068861_100153694 | |||
| 1277 | Ga0068861_100255940 | |||
| 1278 | Ga0068861_100257333 | |||
| 1279 | Ga0068861_100272331 | |||
| 1280 | Ga0068861_100281725 | |||
| 1281 | Ga0068861_100374958 | |||
| 1282 | Ga0068851_10044524 | |||
| 1283 | Ga0068851_10133861 | |||
| 1284 | Ga0068870_10027354 | |||
| 1285 | Ga0068863_100196772 | |||
| 1286 | Ga0068863_100203402 | |||
| 1287 | Ga0068863_100390730 | |||
| 1288 | Ga0068858_100307071 | |||
| 1289 | Ga0068858_100326743 | |||
| 1290 | Ga0068858_100388059 | |||
| 1291 | Ga0068860_100095530 | |||
| 1292 | Ga0068860_100276476 | |||
| 1293 | Ga0068860_100515362 | |||
| 1294 | Ga0068862_100238185 | |||
| 1295 | Ga0068862_100320844 | |||
| 1296 | Ga0068862_100445819 | |||
| 1297 | Ga0081455_10038716 | |||
| 1298 | Ga0081455_10063427 | |||
| 1299 | Ga0081538_10124517 | |||
| 1300 | Ga0081540_1027524 | |||
| 1301 | Ga0081540_1075911 | |||
| 1302 | Ga0081539_10041030 | |||
| 1303 | Ga0081539_10052693 | |||
| 1304 | Ga0081539_10082293 | |||
| 1305 | Ga0070717_10150552 | |||
| 1306 | Ga0070717_10314808 | |||
| 1307 | Ga0070717_10405063 | |||
| 1308 | Ga0075432_10068277 | |||
| 1309 | Ga0075432_10073966 | |||
| 1310 | Ga0070715_10064786 | |||
| 1311 | Ga0070716_100058906 | |||
| 1312 | Ga0070716_100087378 | |||
| 1313 | Ga0070716_100127146 | |||
| 1314 | Ga0070716_100135624 | |||
| 1315 | Ga0070716_100220272 | |||
| 1316 | Ga0070716_100242419 | |||
| 1317 | Ga0070712_100112897 | |||
| 1318 | Ga0070712_100191456 | |||
| 1319 | Ga0075366_10043468 | |||
| 1320 | Ga0075366_10130935 | |||
| 1321 | Ga0075366_10206668 | |||
| 1322 | Ga0097621_100286425 | |||
| 1323 | Ga0097621_100308876 | |||
| 1324 | Ga0097621_100347668 | |||
| 1325 | Ga0097621_100365822 | |||
| 1326 | Ga0097621_100376364 | |||
| 1327 | Ga0075370_10137687 | |||
| 1328 | Ga0068871_100059984 | |||
| 1329 | Ga0068871_100230968 | |||
| 1330 | Ga0068871_100250827 | |||
| 1331 | Ga0068871_100332795 | |||
| 1332 | Ga0075428_100135626 | |||
| 1333 | Ga0075428_100348764 | |||
| 1334 | Ga0075430_100141152 | |||
| 1335 | Ga0075431_100372619 | |||
| 1336 | Ga0075433_10281946 | |||
| 1337 | Ga0075433_10331119 | |||
| 1338 | Ga0075434_100038577 | |||
| 1339 | Ga0075434_100220205 | |||
| 1340 | Ga0075434_100289602 | |||
| 1341 | Ga0075434_100535251 | |||
| 1342 | Ga0075429_100105244 | |||
| 1343 | Ga0075429_100325292 | |||
| 1344 | Ga0068865_100299911 | |||
| 1345 | Ga0075436_100085936 | |||
| 1346 | Ga0075436_100102620 | |||
| 1347 | Ga0075436_100170730 | |||
| 1348 | Ga0075436_100266903 | |||
| 1349 | Ga0097620_100367722 | |||
| 1350 | Ga0097620_100389150 | |||
| 1351 | Ga0097620_100402608 | |||
| 1352 | Ga0097620_100517738 | |||
| 1353 | Ga0097620_100574343 | |||
| 1354 | Ga0075435_100166747 | |||
| 1355 | Ga0075435_100207925 | |||
| 1356 | Ga0075435_100241780 | |||
| 1357 | Ga0075435_100387494 | |||
| 1358 | Ga0105251_10039644 | |||
| 1359 | Ga0105244_10065461 | |||
| 1360 | Ga0105250_10000030 | |||
| 1361 | Ga0105250_10041386 | |||
| 1362 | Ga0105240_10119457 | |||
| 1363 | Ga0105240_10235312 | |||
| 1364 | Ga0105240_10606345 | |||
| 1365 | Ga0105240_10614675 | |||
| 1366 | Ga0111539_10242297 | |||
| 1367 | Ga0111539_10462582 | |||
| 1368 | Ga0114129_10098629 | |||
| 1369 | Ga0105243_10155731 | |||
| 1370 | Ga0105243_10211334 | |||
| 1371 | Ga0105243_10452685 | |||
| 1372 | Ga0105241_10091528 | |||
| 1373 | Ga0105241_10119370 | |||
| 1374 | Ga0105241_10122428 | |||
| 1375 | Ga0105242_10217231 | |||
| 1376 | Ga0105248_10281134 | |||
| 1377 | Ga0105237_10002098 | |||
| 1378 | Ga0105237_10151043 | |||
| 1379 | Ga0105237_10254388 | |||
| 1380 | Ga0105237_10362464 | |||
| 1381 | Ga0105237_10411204 | |||
| 1382 | Ga0105237_10430490 | |||
| 1383 | Ga0105238_10133811 | |||
| 1384 | Ga0105238_10154825 | |||
| 1385 | Ga0105238_10284506 | |||
| 1386 | Ga0105249_10125421 | |||
| 1387 | Ga0105249_10171216 | |||
| 1388 | Ga0105249_10339928 | |||
| 1389 | Ga0105239_10045842 | |||
| 1390 | Ga0105239_10381177 | |||
| 1391 | Ga0105239_10554353 | |||
| 1392 | Ga0105239_10647678 | |||
| 1393 | Ga0105246_10015396 | |||
| 1394 | Ga0157315_1002207 | |||
| 1395 | Ga0157373_10097031 | |||
| 1396 | Ga0157373_10100885 | |||
| 1397 | Ga0157371_10080254 | |||
| 1398 | Ga0157371_10162601 | |||
| 1399 | Ga0157370_10059593 | |||
| 1400 | Ga0157370_10080069 | |||
| 1401 | Ga0157370_10156301 | |||
| 1402 | Ga0157370_10191416 | |||
| 1403 | Ga0157370_10266124 | |||
| 1404 | Ga0157370_10268695 | |||
| 1405 | Ga0157370_10326439 | |||
| 1406 | Ga0157370_10337965 | |||
| 1407 | Ga0157369_10048234 | |||
| 1408 | Ga0157369_10240453 | |||
| 1409 | Ga0157369_10254173 | |||
| 1410 | Ga0157369_10306325 | |||
| 1411 | Ga0157369_10403239 | |||
| 1412 | Ga0157369_10471696 | |||
| 1413 | Ga0157374_10252189 | |||
| 1414 | Ga0157374_10303574 | |||
| 1415 | Ga0157374_10367858 | |||
| 1416 | Ga0157374_10417958 | |||
| 1417 | Ga0157378_10116008 | |||
| 1418 | Ga0157378_10280131 | |||
| 1419 | Ga0157378_10394670 | |||
| 1420 | Ga0157378_10450986 | |||
| 1421 | Ga0163162_10483901 | |||
| 1422 | Ga0163162_10507567 | |||
| 1423 | Ga0163162_10536980 | |||
| 1424 | Ga0157372_10232696 | |||
| 1425 | Ga0157372_10245517 | |||
| 1426 | Ga0157372_10286552 | |||
| 1427 | Ga0157372_10337274 | |||
| 1428 | Ga0157372_10348607 | |||
| 1429 | Ga0157372_10362830 | |||
| 1430 | Ga0157372_10417807 | |||
| 1431 | Ga0157372_10485341 | |||
| 1432 | Ga0157372_10504108 | |||
| 1433 | Ga0157372_10523868 | |||
| 1434 | Ga0157372_10769211 | |||
| 1435 | Ga0157375_10093057 | |||
| 1436 | Ga0157375_10250154 | |||
| 1437 | Ga0157375_10467330 | |||
| 1438 | Ga0157375_10547100 | |||
| 1439 | Ga0163163_10123993 | |||
| 1440 | Ga0163163_10194330 | |||
| 1441 | Ga0163163_10330175 | |||
| 1442 | Ga0157380_10038290 | |||
| 1443 | Ga0157380_10179376 | |||
| 1444 | Ga0157380_10302079 | |||
| 1445 | Ga0182008_10000872 | |||
| 1446 | Ga0182008_10026729 | |||
| 1447 | Ga0182008_10056333 | |||
| 1448 | Ga0182008_10072913 | |||
| 1449 | Ga0182008_10105032 | |||
| 1450 | Ga0182008_10121568 | |||
| 1451 | Ga0182008_10122197 | |||
| 1452 | Ga0157377_10075252 | |||
| 1453 | Ga0157377_10129520 | |||
| 1454 | Ga0157379_10221337 | |||
| 1455 | Ga0157379_10278999 | |||
| 1456 | Ga0157379_10434236 | |||
| 1457 | Ga0157376_10004700 | |||
| 1458 | Ga0157376_10206049 | |||
| 1459 | Ga0157376_10318090 | |||
| 1460 | Ga0182006_1028537 | |||
| 1461 | Ga0182007_10012773 | |||
| 1462 | Ga0182007_10052038 | |||
| 1463 | Ga0182007_10054682 | |||
| 1464 | Ga0182005_1017650 | |||
| 1465 | Ga0182005_1039165 | |||
| 1466 | Ga0163161_10137945 | |||
| 1467 | Ga0163161_10218975 | |||
| 1468 | Ga0163161_10308987 | |||
| 1469 | Ga0213873_10032012 | |||
| 1470 | Ga0213873_10039976 | |||
| 1471 | Ga0213872_10101256 | |||
| 1472 | Ga0213876_10017673 | |||
| 1473 | Ga0213875_10046300 | |||
| 1474 | Ga0213875_10054143 | |||
| 1475 | Ga0213875_10101793 | |||
| 1476 | Ga0213871_10036629 | |||
| 1477 | Ga0224569_102037 | |||
| 1478 | Ga0224572_1020652 | |||
| 1479 | Ga0228598_1004896 | |||
| 1480 | Ga0207425_1015872 | |||
| 1481 | Ga0207425_1022494 | |||
| 1482 | Ga0209759_1000002 | |||
| 1483 | Ga0209129_1004696 | |||
| 1484 | Ga0209129_1008170 | |||
| 1485 | Ga0209673_1019038 | |||
| 1486 | Ga0209564_1002265 | |||
| 1487 | Ga0209758_1064597 | |||
| 1488 | Ga0209758_1065548 | |||
| 1489 | Ga0207426_1035959 | |||
| 1490 | Ga0207426_1052284 | |||
| 1491 | Ga0207426_1053960 | |||
| 1492 | Ga0207697_10031574 | |||
| 1493 | Ga0207697_10103057 | |||
| 1494 | Ga0207656_10096578 | |||
| 1495 | Ga0207696_1046441 | |||
| 1496 | Ga0207713_1074733 | |||
| 1497 | Ga0207682_10048511 | |||
| 1498 | Ga0207682_10062668 | |||
| 1499 | Ga0207682_10105682 | |||
| 1500 | Ga0207692_10091003 | |||
| 1501 | Ga0207692_10122768 | |||
| 1502 | Ga0207692_10135572 | |||
| 1503 | Ga0207688_10031963 | |||
| 1504 | Ga0207688_10078433 | |||
| 1505 | Ga0207688_10087632 | |||
| 1506 | Ga0207680_10003295 | |||
| 1507 | Ga0207680_10200565 | |||
| 1508 | Ga0207680_10240713 | |||
| 1509 | Ga0207680_10246452 | |||
| 1510 | Ga0207647_10062299 | |||
| 1511 | Ga0207647_10111456 | |||
| 1512 | Ga0207685_10072977 | |||
| 1513 | Ga0207685_10085400 | |||
| 1514 | Ga0207699_10050794 | |||
| 1515 | Ga0207699_10226327 | |||
| 1516 | Ga0207645_10095315 | |||
| 1517 | Ga0207645_10168306 | |||
| 1518 | Ga0207645_10170066 | |||
| 1519 | Ga0207645_10172363 | |||
| 1520 | Ga0207643_10153523 | |||
| 1521 | Ga0207643_10166108 | |||
| 1522 | Ga0207705_10079852 | |||
| 1523 | Ga0207705_10257230 | |||
| 1524 | Ga0207705_10333064 | |||
| 1525 | Ga0207684_10248194 | |||
| 1526 | Ga0207654_10081807 | |||
| 1527 | Ga0207654_10101529 | |||
| 1528 | Ga0207654_10143555 | |||
| 1529 | Ga0207654_10236281 | |||
| 1530 | Ga0207707_10045153 | |||
| 1531 | Ga0207707_10110799 | |||
| 1532 | Ga0207707_10152653 | |||
| 1533 | Ga0207707_10300041 | |||
| 1534 | Ga0207707_10360993 | |||
| 1535 | Ga0207695_10001751 | |||
| 1536 | Ga0207695_10063328 | |||
| 1537 | Ga0207695_10077082 | |||
| 1538 | Ga0207695_10165375 | |||
| 1539 | Ga0207695_10275154 | |||
| 1540 | Ga0207695_10429718 | |||
| 1541 | Ga0207671_10004948 | |||
| 1542 | Ga0207671_10162587 | |||
| 1543 | Ga0207693_10178790 | |||
| 1544 | Ga0207693_10222657 | |||
| 1545 | Ga0207693_10248745 | |||
| 1546 | Ga0207693_10306628 | |||
| 1547 | Ga0207663_10213762 | |||
| 1548 | Ga0207663_10221338 | |||
| 1549 | Ga0207663_10247171 | |||
| 1550 | Ga0207663_10271398 | |||
| 1551 | Ga0207660_10154207 | |||
| 1552 | Ga0207660_10236907 | |||
| 1553 | Ga0207660_10256365 | |||
| 1554 | Ga0207660_10264646 | |||
| 1555 | Ga0207657_10123311 | |||
| 1556 | Ga0207657_10151291 | |||
| 1557 | Ga0207657_10291313 | |||
| 1558 | Ga0207657_10315908 | |||
| 1559 | Ga0207649_10257271 | |||
| 1560 | Ga0207649_10291614 | |||
| 1561 | Ga0207649_10301701 | |||
| 1562 | Ga0207652_10054640 | |||
| 1563 | Ga0207652_10089855 | |||
| 1564 | Ga0207652_10185191 | |||
| 1565 | Ga0207652_10318260 | |||
| 1566 | Ga0207652_10324320 | |||
| 1567 | Ga0207646_10232621 | |||
| 1568 | Ga0207681_10147460 | |||
| 1569 | Ga0207681_10152464 | |||
| 1570 | Ga0207681_10215663 | |||
| 1571 | Ga0207681_10231761 | |||
| 1572 | Ga0207694_10333605 | |||
| 1573 | Ga0207650_10001931 | |||
| 1574 | Ga0207650_10034561 | |||
| 1575 | Ga0207650_10046818 | |||
| 1576 | Ga0207650_10200170 | |||
| 1577 | Ga0207650_10334098 | |||
| 1578 | Ga0207659_10160500 | |||
| 1579 | Ga0207659_10204875 | |||
| 1580 | Ga0207659_10252663 | |||
| 1581 | Ga0207700_10160126 | |||
| 1582 | Ga0207700_10276115 | |||
| 1583 | Ga0207700_10307572 | |||
| 1584 | Ga0207700_10308997 | |||
| 1585 | Ga0207700_10442620 | |||
| 1586 | Ga0207664_10097800 | |||
| 1587 | Ga0207664_10204190 | |||
| 1588 | Ga0207644_10298275 | |||
| 1589 | Ga0207644_10340327 | |||
| 1590 | Ga0207690_10322411 | |||
| 1591 | Ga0207690_10329531 | |||
| 1592 | Ga0207706_10177266 | |||
| 1593 | Ga0207706_10195172 | |||
| 1594 | Ga0207706_10288969 | |||
| 1595 | Ga0207709_10233427 | |||
| 1596 | Ga0207709_10237186 | |||
| 1597 | Ga0207670_10192396 | |||
| 1598 | Ga0207669_10128238 | |||
| 1599 | Ga0207704_10236256 | |||
| 1600 | Ga0207704_10248464 | |||
| 1601 | Ga0207704_10288146 | |||
| 1602 | Ga0207665_10008229 | |||
| 1603 | Ga0207665_10075123 | |||
| 1604 | Ga0207665_10082452 | |||
| 1605 | Ga0207665_10100605 | |||
| 1606 | Ga0207665_10115630 | |||
| 1607 | Ga0207665_10136539 | |||
| 1608 | Ga0207665_10191279 | |||
| 1609 | Ga0207665_10233357 | |||
| 1610 | Ga0207665_10240373 | |||
| 1611 | Ga0207665_10246259 | |||
| 1612 | Ga0207689_10104485 | |||
| 1613 | Ga0207661_10067607 | |||
| 1614 | Ga0207661_10402593 | |||
| 1615 | Ga0207661_10434019 | |||
| 1616 | Ga0207679_10348514 | |||
| 1617 | Ga0207679_10417457 | |||
| 1618 | Ga0207667_10072114 | |||
| 1619 | Ga0207667_10383837 | |||
| 1620 | Ga0207667_10387404 | |||
| 1621 | Ga0207667_10435574 | |||
| 1622 | Ga0207667_10465978 | |||
| 1623 | Ga0207651_10075403 | |||
| 1624 | Ga0207651_10157771 | |||
| 1625 | Ga0207651_10246780 | |||
| 1626 | Ga0207712_10066855 | |||
| 1627 | Ga0207712_10144136 | |||
| 1628 | Ga0207712_10231088 | |||
| 1629 | Ga0207668_10120543 | |||
| 1630 | Ga0207668_10370573 | |||
| 1631 | Ga0207640_10131315 | |||
| 1632 | Ga0207640_10273469 | |||
| 1633 | Ga0207640_10294303 | |||
| 1634 | Ga0207640_10391301 | |||
| 1635 | Ga0207658_10168765 | |||
| 1636 | Ga0207658_10171342 | |||
| 1637 | Ga0207658_10302907 | |||
| 1638 | Ga0207658_10365310 | |||
| 1639 | Ga0207658_10411237 | |||
| 1640 | Ga0207658_10414951 | |||
| 1641 | Ga0207677_10197779 | |||
| 1642 | Ga0207677_10291364 | |||
| 1643 | Ga0207677_10359977 | |||
| 1644 | Ga0207703_10317041 | |||
| 1645 | Ga0207703_10361199 | |||
| 1646 | Ga0207703_10371315 | |||
| 1647 | Ga0207639_10125837 | |||
| 1648 | Ga0207639_10298018 | |||
| 1649 | Ga0207639_10309846 | |||
| 1650 | Ga0207639_10350065 | |||
| 1651 | Ga0207639_10416130 | |||
| 1652 | Ga0207678_10093380 | |||
| 1653 | Ga0207678_10102241 | |||
| 1654 | Ga0207678_10214407 | |||
| 1655 | Ga0207678_10251757 | |||
| 1656 | Ga0207678_10324796 | |||
| 1657 | Ga0207678_10386651 | |||
| 1658 | Ga0207708_10040908 | |||
| 1659 | Ga0207708_10070812 | |||
| 1660 | Ga0207708_10280776 | |||
| 1661 | Ga0207708_10305953 | |||
| 1662 | Ga0207702_10272771 | |||
| 1663 | Ga0207702_10340200 | |||
| 1664 | Ga0207702_10411103 | |||
| 1665 | Ga0207702_10425830 | |||
| 1666 | Ga0207702_10429196 | |||
| 1667 | Ga0207641_10206213 | |||
| 1668 | Ga0207648_10154760 | |||
| 1669 | Ga0207676_10305056 | |||
| 1670 | Ga0207674_10063619 | |||
| 1671 | Ga0207674_10330378 | |||
| 1672 | Ga0207675_100178505 | |||
| 1673 | Ga0207675_100182188 | |||
| 1674 | Ga0207675_100215411 | |||
| 1675 | Ga0207675_100253696 | |||
| 1676 | Ga0207675_100262233 | |||
| 1677 | Ga0207675_100288600 | |||
| 1678 | Ga0207683_10043507 | |||
| 1679 | Ga0207683_10116612 | |||
| 1680 | Ga0207683_10235151 | |||
| 1681 | Ga0207683_10296288 | |||
| 1682 | Ga0207683_10327059 | |||
| 1683 | Ga0207698_10077952 | |||
| 1684 | Ga0207698_10146605 | |||
| 1685 | Ga0207698_10237065 | |||
| 1686 | Ga0207698_10308701 | |||
| 1687 | Ga0207698_10407498 | |||
| 1688 | Ga0207698_10484620 | |||
| 1689 | Ga0207698_10525426 | |||
| 1690 | Ga0209969_1011881 | |||
| 1691 | Ga0210000_1012778 | |||
| 1692 | Ga0210000_1017361 | |||
| 1693 | Ga0209968_1014508 | |||
| 1694 | Ga0210002_1008947 | |||
| 1695 | Ga0209971_1031996 | |||
| 1696 | Ga0209998_10018230 | |||
| 1697 | Ga0209974_10063676 | |||
| 1698 | Ga0207428_10301964 | |||
| 1699 | Ga0268266_10200733 | |||
| 1700 | Ga0268265_10132275 | |||
| 1701 | Ga0268265_10229553 | |||
| 1702 | Ga0268265_10307237 | |||
| 1703 | Ga0268265_10444662 | |||
| 1704 | Ga0268264_10201915 | |||
| 1705 | Ga0268264_10334015 | |||
| 1706 | Ga0265326_10034941 | |||
| 1707 | Ga0307517_10174989 | |||
| 1708 | Ga0265765_1002940 | |||
| 1709 | Ga0265760_10008115 | |||
| 1710 | Ga0265328_10053062 | |||
| 1711 | Ga0265327_10015234 | |||
| 1712 | Ga0265316_10058534 | |||
| 1713 | Ga0307513_10066003 | |||
| 1714 | Ga0307513_10229264 | |||
| 1715 | Ga0307408_100284624 | |||
| 1716 | Ga0265314_10196673 | |||
| 1717 | Ga0316576_10131100 | |||
| 1718 | Ga0316576_10242280 | |||
| 1719 | Ga0307405_10057636 | |||
| 1720 | Ga0307406_10196057 | |||
| 1721 | Ga0307412_10156090 | |||
| 1722 | Ga0307412_10201382 | |||
| 1723 | Ga0307412_10251480 | |||
| 1724 | Ga0307416_100225435 | |||
| 1725 | Ga0307414_10002594 | |||
| 1726 | Ga0307414_10272576 | |||
| 1727 | Ga0316583_10061230 | |||
| 1728 | Ga0316580_10055087 | |||
| 1729 | Ga0307507_10073697 | |||
| 1730 | Ga0373950_0018071 | |||
| 1731 | Ga0373938_0009909 | |||
| 1732 | Ga0373926_0077849 | |||
| 1733 | Ga0373929_0022104 | |||
| 1734 | Ga0373929_0023846 | |||
| 1735 | Ga0373940_0016404 | |||
| 1736 | Ga0373944_0042146 | |||
| 1737 | Ga0373949_0028770 | |||
| 1738 | Ga0373951_0021740 | |||
| 1739 | Ga0373923_0097515 | |||
| 1740 | Ga0373932_0049290 | |||
| 1741 | Ga0373936_0050374 | |||
| 1742 | Ga0373943_0020871 | |||
| 1743 | Ga0373946_0089871 | |||
| 1744 | Ga0373946_0094306 | |||
| 1745 | Ga0373961_0030240 | |||
| 1746 | Ga0373931_0142060 | |||
| 1747 | Ga0373931_0171287 | |||
| 1748 | Ga0373935_0026283 | |||
| 1749 | Ga0373935_0256796 | |||
| 1750 | Ga0373927_0154193 | |||
| 1751 | Ga0373947_0093386 | |||
| 1752 | Ga0373947_0153376 | |||
| 1753 | Ga0373937_0411750 | |||
| 1754 | Ga0373937_0476499 | |||
| 1755 | Ga0316582_0200759 | |||
| 1756 | Ga0316584_0232673 | |||
| 1757 | Ga0373925_0049221 | |||
| 1758 | Ga0373925_0242906 | |||
| 1759 | Ga0395899_0238342 | |||
| 1760 | Ga0395900_0291929 | |||
| 1761 | Ga0395900_0422689 | |||
| 1762 | Ga0395900_0446867 | |||
| 1763 | Ga0395900_0459297 | |||
| 1764 | Ga0395898_0376736 | |||
| 1765 | Ga0395905_0240037 | |||
| 1766 | Ga0395905_0241791 | |||
| 1767 | Ga0395905_0276446 | |||
| 1768 | Ga0395905_0422874 | |||
| 1769 | Ga0316581_0044812 | |||
| 1770 | Ga0436364_0053155 | |||
| 1771 | Ga0436364_0086624 | |||
| 1772 | Ga0436364_0204912 | |||
| 1773 | Ga0436364_0286621 | |||
| 1774 | Ga0436364_0724866 | |||
| 1775 | Ga0436364_0951973 | |||
| 1776 | Ga0436364_1004052 | |||
| 1777 | Ga0395901_0051753 | |||
| 1778 | Ga0395901_0333247 | |||
| 1779 | Ga0400490_07533 | |||
| 1780 | Ga0400490_42319 | |||
| 1781 | Ga0400490_58764 | |||
| 1782 | Ga0242420_010783 | |||
| 1783 | Ga0400483_011185 | |||
| 1784 | Ga0400483_026323 | |||
| 1785 | Ga0400483_046209 | |||
| 1786 | Ga0400483_071440 | |||
| 1787 | Ga0400483_075005 | |||
| 1788 | Ga0400483_099974 | |||
| 1789 | Ga0400483_128661 | |||
| 1790 | Ga0400483_164724 | |||
| 1791 | Ga0400483_226079 | |||
| 1792 | Ga0400483_254865 | |||
| 1793 | Ga0400483_270116 | |||
| 1794 | Ga0400489_02500 | |||
| 1795 | Ga0400489_40234 | |||
| 1796 | Ga0436365_0568097 | |||
| 1797 | Ga0436365_0659278 | |||
| 1798 | Ga0436365_0893926 | |||
| 1799 | Ga0436365_1425058 | |||
| 1800 | Ga0436365_1522570 | |||
| 1801 | Ga0436360_0336636 | |||
| 1802 | Ga0436360_0414532 | |||
| 1803 | Ga0436360_0489642 | |||
| 1804 | Ga0436360_0850160 | |||
| 1805 | Ga0436360_0927702 | |||
| 1806 | Ga0436361_0364438 | |||
| 1807 | Ga0436361_0875690 | |||
| 1808 | Ga0436361_1052794 | |||
| 1809 | Ga0436361_1125479 | |||
| 1810 | Ga0436363_0152949 | |||
| 1811 | Ga0436363_0922990 | |||
| 1812 | Ga0436363_1223014 | |||
| 1813 | Ga0436363_1362346 | |||
| 1814 | Ga0436363_1636152 | |||
| 1815 | Ga0436362_0244038 | |||
| 1816 | Ga0436362_0754209 | |||
| 1817 | Ga0451789_0703507 | |||
| 1818 | Ga0451806_812352 | |||
| 1819 | Ga0451807_0295069 | |||
| 1820 | Ga0451845_0629088 | |||
| 1821 | Ga0451853_1726360 | |||
| 1822 | Ga0450914_002861 | |||
| 1823 | Ga0450902_013600 | |||
| 1824 | Ga0439435_0045533 | |||
| 1825 | Ga0439464_0021927 | |||
| 1826 | Ga0451577_0281545 | |||
| 1827 | Ga0466972_0040530 | |||
| 1828 | Ga0466972_0069208 | |||
| 1829 | Ga0466961_0156343 | |||
| 1830 | Ga0466963_0184726 | |||
| 1831 | Ga0466964_0006040 | |||
| 1832 | Ga0453684_0297187 | |||
| 1833 | Ga0453684_0361880 | |||
| 1834 | Ga0466970_0108314 | |||
| 1835 | Ga0466970_0108804 | |||
| 1836 | Ga0466959_0110234 | |||
| 1837 | Ga0466959_0265214 | |||
| 1838 | Ga0451576_0393164 | |||
| 1839 | Ga0466967_0222238 | |||
| 1840 | Ga0466967_0225109 | |||
| 1841 | Ga0466967_0362109 | |||
| 1842 | Ga0466967_0459958 | |||
| 1843 | Ga0495592_0157334 | |||
| 1844 | Ga0495590_0002805 | |||
| 1845 | Ga0495629_0260359 | |||
| 1846 | Ga0495638_0028650 | |||
| 1847 | Ga0495638_0154877 | |||
| 1848 | Ga0495651_0111962 | |||
| 1849 | Ga0495651_0245276 | |||
| 1850 | Ga0495653_0070369 | |||
| 1851 | Ga0495580_0153150 | |||
| 1852 | Ga0495580_0195300 | |||
| 1853 | Ga0495605_0040747 | |||
| 1854 | Ga0495620_0086658 | |||
| 1855 | Ga0495620_0088965 | |||
| 1856 | Ga0495628_0041687 | |||
| 1857 | Ga0495628_0221348 | |||
| 1858 | Ga0495632_0053500 | |||
| 1859 | Ga0495648_0048062 | |||
| 1860 | Ga0495642_0062446 | |||
| 1861 | Ga0495652_0064638 | |||
| 1862 | Ga0495665_0023895 | |||
| 1863 | Ga0495665_0135126 | |||
| 1864 | Ga0495587_0157257 | |||
| 1865 | Ga0495598_0052896 | |||
| 1866 | Ga0495598_0059533 | |||
| 1867 | Ga0495645_0209624 | |||
| 1868 | Ga0495668_0146925 | |||
| 1869 | Ga0495634_0002312 | |||
| 1870 | Ga0495635_0216009 | |||
| 1871 | Ga0495623_0148699 | |||
| 1872 | Ga0495646_0058631 | |||
| 1873 | Ga0495646_0154210 | |||
| 1874 | Ga0495658_0122042 | |||
| 1875 | Ga0495669_0019991 | |||
| 1876 | Ga0495669_0087880 | |||
| 1877 | Ga0495669_0124056 | |||
| 1878 | Ga0495624_0233362 | |||
| 1879 | Ga0495649_0124737 | |||
| 1880 | Ga0495589_0016864 | |||
| 1881 | Ga0495581_0148538 | |||
| 1882 | Ga0495604_0154018 | |||
| 1883 | Ga0495604_0184776 | |||
| 1884 | Ga0495604_0218467 | |||
| 1885 | Ga0495674_0022247 | |||
| 1886 | Ga0495674_0100447 | |||
| 1887 | Ga0495674_0261322 | |||
| 1888 | Ga0495672_0059410 | |||
| 1889 | Ga0495672_0087803 | |||
| 1890 | Ga0495680_0201423 | |||
| 1891 | Ga0495680_0214516 | |||
| 1892 | Ga0495683_0046404 | |||
| 1893 | Ga0495687_059783 | |||
| 1894 | Ga0495675_0033688 | |||
| 1895 | Ga0495675_0068391 | |||
| 1896 | Ga0495675_0194613 | |||
| 1897 | Ga0495673_0093484 | |||
| 1898 | Ga0495686_0020690 | |||
| 1899 | Ga0495602_0034333 | |||
| 1900 | Ga0495602_0089387 | |||
| 1901 | Ga0495602_0182237 | |||
| 1902 | Ga0495602_0201467 | |||
| 1903 | Ga0496100_0128325 | |||
| 1904 | Ga0496100_0293452 | |||
| 1905 | Ga0496100_0296341 | |||
| 1906 | Ga0496101_0251690 | |||
| 1907 | Ga0496101_0281705 | |||
| 1908 | Ga0496101_0323763 | |||
| 1909 | Ga0496102_0214414 | |||
| 1910 | Ga0496102_0283287 | |||
| 1911 | Ga0496102_0449107 | |||
| 1912 | Ga0496103_0223949 | |||
| 1913 | Ga0496104_0118609 | |||
| 1914 | Ga0496104_0179210 | |||
| 1915 | Ga0496104_0367246 | |||
| 1916 | Ga0496104_0483548 | |||
| 1917 | Ga0496105_0110849 | |||
| 1918 | Ga0496105_0325303 | |||
| 1919 | Ga0496106_0163399 | |||
| 1920 | Ga0496106_0225096 | |||
| 1921 | Ga0496106_0304832 | |||
| 1922 | Ga0496106_0343756 | |||
| 1923 | Ga0496106_0358517 | |||
| 1924 | Ga0496107_0104212 | |||
| 1925 | Ga0496107_0156905 | |||
| 1926 | Ga0496107_0162478 | |||
| 1927 | Ga0496108_0264262 | |||
| 1928 | Ga0496108_0306138 | |||
| 1929 | Ga0496108_0309874 | |||
| 1930 | Ga0496108_0344742 | |||
| 1931 | Ga0496108_0367229 | |||
| 1932 | Ga0496109_0223622 | |||
| 1933 | Ga0496109_0258980 | |||
| 1934 | Ga0496109_0320985 | |||
| 1935 | Ga0496109_0386071 | |||
| 1936 | Ga0496110_0138988 | |||
| 1937 | Ga0496110_0193792 | |||
| 1938 | Ga0496110_0352983 | |||
| 1939 | Ga0496110_0387090 | |||
| 1940 | Ga0496110_0443567 | |||
| 1941 | Ga0496111_0105798 | |||
| 1942 | Ga0496111_0153666 | |||
| 1943 | Ga0496112_0295115 | |||
| 1944 | Ga0496112_0358494 | |||
| 1945 | Ga0496112_0437742 | |||
| 1946 | Ga0496112_0519557 | |||
| 1947 | Ga0496113_0052442 | |||
| 1948 | Ga0496113_0121239 | |||
| 1949 | Ga0496113_0172817 | |||
| 1950 | Ga0496113_0233797 | |||
| 1951 | Ga0496114_0347175 | |||
| 1952 | Ga0496114_0443765 | |||
| 1953 | Ga0496115_0014177 | |||
| 1954 | Ga0496115_0175154 | |||
| 1955 | Ga0496115_0403362 | |||
| 1956 | Ga0496116_0090148 | |||
| 1957 | Ga0496117_0141054 | |||
| 1958 | Ga0496118_0194351 | |||
| 1959 | Ga0496119_0114393 | |||
| 1960 | Ga0496120_0136741 | |||
| 1961 | Ga0496122_0004728 | |||
| 1962 | Ga0496122_0007495 | |||
| 1963 | Ga0496122_0185465 | |||
| 1964 | Ga0496123_0023137 | |||
| 1965 | Ga0496123_0033563 | |||
| 1966 | Ga0496123_0070687 | |||
| 1967 | Ga0496124_0110209 | |||
| 1968 | Ga0496124_0128291 | |||
| 1969 | Ga0496125_0007596 | |||
| 1970 | Ga0496125_0145184 | |||
| 1971 | Ga0496126_0212372 | |||
| 1972 | Ga0466983_0226267 | |||
| 1973 | Ga0495682_0057187 | |||
| 1974 | Ga0501294_002584 | |||
| 1975 | Ga0501032_0242207 | |||
| 1976 | Ga0501033_0001675 | |||
| 1977 | Ga0501033_0247634 | |||
| 1978 | Ga0501034_0208259 | |||
| 1979 | Ga0501034_0264834 | |||
| 1980 | Ga0501034_0298735 | |||
| 1981 | Ga0501034_0307562 | |||
| 1982 | Ga0501036_0138625 | |||
| 1983 | Ga0501036_0227206 | |||
| 1984 | Ga0501036_0291771 | |||
| 1985 | Ga0501036_0380817 | |||
| 1986 | Ga0501037_0153873 | |||
| 1987 | Ga0501038_0188328 | |||
| 1988 | Ga0501039_0281397 | |||
| 1989 | Ga0501039_0314249 | |||
| 1990 | Ga0501040_0279023 | |||
| 1991 | Ga0501040_0310022 | |||
| 1992 | Ga0501041_0167562 | |||
| 1993 | Ga0501041_0199380 | |||
| 1994 | Ga0501041_0209329 | |||
| 1995 | Ga0501042_0227839 | |||
| 1996 | Ga0501042_0234403 | |||
| 1997 | Ga0501046_0233653 | |||
| 1998 | Ga0501046_0239289 | |||
| 1999 | Ga0501046_0269359 | |||
| 2000 | Ga0501047_0262539 | |||
| 2001 | Ga0501048_0025867 | |||
| 2002 | Ga0501048_0227785 | |||
| 2003 | Ga0501048_0231740 | |||
| 2004 | Ga0501048_0247402 | |||
| 2005 | Ga0501069_0021032 | |||
| 2006 | Ga0501069_0139700 | |||
| 2007 | Ga0501070_0009953 | |||
| 2008 | Ga0501070_0416774 | |||
| 2009 | Ga0501071_0282842 | |||
| 2010 | Ga0501072_0227700 | |||
| 2011 | Ga0501072_0395039 | |||
| 2012 | Ga0501073_0218936 | |||
| 2013 | Ga0501075_0277387 | |||
| 2014 | Ga0501077_0203911 | |||
| 2015 | Ga0501201_004341 | |||
| 2016 | Ga0501202_009168 | |||
| 2017 | Ga0501207_005154 | |||
| 2018 | Ga0501223_007098 | |||
| 2019 | Ga0501257_001308 | |||
| 2020 | Ga0501225_0002406 | |||
| 2021 | Ga0501079_0256968 | |||
| 2022 | Ga0501081_0055398 | |||
| 2023 | Ga0501271_003649 | |||
| 2024 | Ga0501035_0026016 | |||
| 2025 | Ga0501035_0082459 | |||
| 2026 | Ga0501044_0372052 | |||
| 2027 | Ga0501044_0385142 | |||
| 2028 | nmdc:mga0k408_113259_c1 | |||
| 2029 | nmdc:mga0k408_116415_c1 | |||
| 2030 | nmdc:mga0k408_47532_c1 | |||
| 2031 | nmdc:mga07m45_167367_c1 | |||
| 2032 | nmdc:mga05p37_58293_c1 | |||
| 2033 | nmdc:mga09592_100757_c1 | |||
| 2034 | nmdc:mga09592_390542_c1 | |||
| 2035 | nmdc:mga0qj67_136977_c1 | |||
| 2036 | nmdc:mga06r32_231264_c1 | |||
| 2037 | nmdc:mga06r32_9455_c1 | |||
| 2038 | nmdc:mga08y16_299811_c1 | |||
| 2039 | nmdc:mga08y16_532705_c1 | |||
| 2040 | nmdc:mga0n895_220501_c1 | |||
| 2041 | nmdc:mga0n895_241898_c1 | |||
| 2042 | nmdc:mga0n895_319440_c1 | |||
| 2043 | nmdc:mga0n895_357256_c1 | |||
| 2044 | nmdc:mga0n895_464201_c1 | |||
| 2045 | nmdc:mga0n895_494567_c1 | |||
| 2046 | nmdc:mga0rr50_137051_c1 | |||
| 2047 | nmdc:mga0rr50_260809_c1 | |||
| 2048 | nmdc:mga0rr50_44497_c1 | |||
| 2049 | nmdc:mga0rr50_58168_c1 | |||
| 2050 | nmdc:mga08x19_159244_c1 | |||
| 2051 | nmdc:mga08x19_214796_c1 | |||
| 2052 | nmdc:mga08x19_240853_c1 | |||
| 2053 | nmdc:mga08x19_284_c1 | |||
| 2054 | nmdc:mga0a205_194440_c1 | |||
| 2055 | nmdc:mga0a205_339353_c1 | |||
| 2056 | Ga0495619_0182665 | |||
| 2057 | Ga0500641_0105220 | |||
| 2058 | Ga0500594_0033776 | |||
| 2059 | Ga0500652_000713 | |||
| 2060 | Ga0500658_0088344 | |||
| 2061 | Ga0500588_0035536 | |||
| 2062 | Ga0500588_0052263 | |||
| 2063 | Ga0500604_0015626 | |||
| 2064 | Ga0500637_0052489 | |||
| 2065 | Ga0501084_0333780 | |||
| 2066 | Ga0587068_011021 | |||
| 2067 | Ga0587072_004443 | |||
| 2068 | Ga0501082_0334017 | |||
| 2069 | Ga0501082_0339773 | |||
| 2070 | Ga0501082_0398858 | |||
| 2071 | 2524000573 | |||
| 2072 | 2524001544 | |||
| 2073 | 2524003653 | |||
| 2074 | 2599744234 | |||
| 2075 | 2600206271 | |||
| 2076 | 2676743414 | |||
| 2077 | 2738760017 | |||
| 2078 | 2753571776 | |||
| 2079 | 2835316416 | |||
| 2080 | 2842332692 | |||
| 2081 | 2842355861 | |||
| 2082 | 2906001616 | |||
| 2083 | 2913852153 | |||
| 2084 | 2929925216 | |||
| 2085 | 2977233163 | |||
| 2086 | 2977233206 | |||
| 2087 | 2977236334 | |||
| 2088 | 2977236604 | |||
| 2089 | 642425669 | |||
| 2090 | 642425690 | |||
| 2091 | 642617469 | |||
| 2092 | 643602653 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6qbv-assembly2.cif.gz_D | structure of the htlv-2 integrase catalytic core domain in complex with magnesium (dimeric form) | 0.8523 | 158 | 330 |
| 6qbv-assembly1.cif.gz_B | structure of the htlv-2 integrase catalytic core domain in complex with magnesium (dimeric form) | 0.8511 | 158 | 330 |
| 3wng-assembly1.cif.gz_B | cyclic hexapeptide pkidnp in complex with hiv-1 integrase | 0.8442 | 163 | 336 |
| 6u8q-assembly1.cif.gz_L | cryoem structure of hiv-1 cleaved synaptic complex (csc) intasome | 0.8416 | 163 | 336 |
| 6qbv-assembly1.cif.gz_B | structure of the htlv-2 integrase catalytic core domain in complex with magnesium (dimeric form) | 0.8403 | 158 | 330 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WKH9_102_261_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8533 | 162 | 326 | 3.30.420.10 |
| af_P0CF80_124_283_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.848 | 158 | 329 | 3.30.420.10 |
| af_P0CF80_124_283_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8383 | 158 | 329 | 3.30.420.10 |
| af_P0CF56_119_291_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8337 | 156 | 335 | 3.30.420.10 |
| af_P9WKH9_102_261_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8337 | 162 | 326 | 3.30.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5S3YP03-F1-model_v4 | IS481 family transposase | 0.983 | 155 | 230 |
|
| AF-M3J805-F1-model_v4 | Putative transposase | 0.9719 | 157 | 252 |
|
| AF-A0A4V3STL3-F1-model_v4 | Transposase | 0.9716 | 161 | 343 |
GO:0003676
GO:0015074 |
| AF-A0A0F3RHX5-F1-model_v4 | Integrase core domain protein | 0.9715 | 164 | 343 |
GO:0003676
GO:0015074 |
| AF-A0A1I2SKE6-F1-model_v4 | Integrase core domain-containing protein | 0.9706 | 176 | 343 |
GO:0003676
GO:0015074 |