F488917
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1044 | 477 | 989 | 302 |
Family's Representative Sequence
| Representative Sequence | 3300049742|Ga0501080_0012126|Ga0501080_0012126_1570_2646 |
| Length | 358 |
| Sequence | MKARVSPVNVADAWSAIGASPFDARSIAEKPARARARRYHRGLRCDPSRERFPKETRMQLGMIGLGKMGNFMAQRLMKAGHDVVGFDPNGDARKALTDAGGKAVDSLDKLIEALQPPRAVWVMVPAGKIVDQTVAALNDKLAKGDVVIDGGNSNYKDDQRHAAELAPKGINYVDCGTSGGVWGLKEGYSMMVGGDDKVVDRLRPIFEALAPGKDQGWGHVGPVGSGHFVKMVHNGIEYGMMQAYAEGFAIFQHKDEFKLDLAQIAEIWRYGSVVRSWLLDLTADALKRNPDMQGIAPYVVDSGEGRWTVAEAIDLDVPAPIITASLIERLRSRDSDSFTDKLLSAMRNEFGGHAMKKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 3 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 4 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 5 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 6 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 7 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 8 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 9 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 10 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 11 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 12 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 13 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 14 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 15 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 16 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 17 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 18 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 19 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 20 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 21 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 22 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 23 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 24 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 25 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 26 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 27 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 28 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 29 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 30 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 31 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 32 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 33 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 34 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 35 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 36 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 37 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 38 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 39 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 40 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 41 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 42 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 43 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 44 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 45 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 46 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 47 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 48 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 49 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 50 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 51 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 52 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 53 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 54 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 55 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 56 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 57 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 58 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 59 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 60 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 61 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 62 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 64 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 65 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 66 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 67 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 68 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 69 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 70 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 71 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 72 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 73 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 74 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 75 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 76 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 77 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 78 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 79 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 80 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 81 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 82 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 83 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 84 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 89 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 92 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 94 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 96 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 104 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 116 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 117 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 118 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 119 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 121 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 122 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 124 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 126 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 130 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 131 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 132 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 133 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 134 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 135 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 136 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 137 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 138 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 139 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 140 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 141 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 142 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 143 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 144 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 145 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 147 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 148 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 149 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 150 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 151 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 152 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 153 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 154 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 155 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 167 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 168 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 181 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 185 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 186 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 187 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 188 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 189 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 191 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 192 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 193 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 194 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 195 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 196 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 197 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 199 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 200 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 201 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 202 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 210 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 211 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 212 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 215 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 216 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 218 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 220 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 221 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 224 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 227 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 287 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 288 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 289 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 290 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 291 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 292 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 293 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 294 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 295 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 296 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 297 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 298 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 299 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 300 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 301 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 302 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 303 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 304 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 305 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 306 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 307 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 308 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 309 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 310 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 311 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 312 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 313 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 314 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 315 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 316 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 317 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 318 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 319 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 320 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 321 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 322 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 323 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 324 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 325 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 326 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 327 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 328 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 329 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 330 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 331 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 332 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 333 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 334 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 335 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 336 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 337 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 338 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 339 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 340 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 341 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 342 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 343 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 344 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 345 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 346 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 347 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 403 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 404 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 405 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 406 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 407 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 408 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 409 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 410 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 411 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 412 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 413 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 414 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 415 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 416 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 417 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 418 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 419 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 420 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 421 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 422 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 423 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 424 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 425 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 465 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 466 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 467 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 468 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 469 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 470 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 473 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 474 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 475 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 476 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 477 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.39 |
| Metatranscriptomes | 1.34 |
| Isolates | 5.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 6.7 |
| Nodule | 0.1 |
| Rhizoplane | 2.68 |
| Rhizosphere | 80.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000230 | 3300001979 | Bacteria | 23717 |
| 2 | JGI24739J22299_10055207 | 3300001989 | Bacteria | 1270 |
| 3 | JGI24737J22298_10002869 | 3300001990 | Bacteria | 6109 |
| 4 | JGI24737J22298_10016551 | 3300001990 | Bacteria | 2380 |
| 5 | JGI24735J21928_10000213 | 3300002067 | Bacteria | 20363 |
| 6 | JGI25156J39149_1006824 | 3300002705 | Bacteria | 3075 |
| 7 | JGI25162J39368_1000653 | 3300002737 | Bacteria | 24475 |
| 8 | JGI25162J39368_1001259 | 3300002737 | Bacteria | 14479 |
| 9 | JGI25162J39368_1001943 | 3300002737 | Bacteria | 9331 |
| 10 | JGI25162J39368_1005494 | 3300002737 | Bacteria | 2460 |
| 11 | JGI25157J39369_1002739 | 3300002741 | Bacteria | 4056 |
| 12 | JGI25157J39369_1003624 | 3300002741 | Bacteria | 3074 |
| 13 | JGI25164J39214_1000473 | 3300002772 | Bacteria | 19954 |
| 14 | JGI25164J39214_1000490 | 3300002772 | Bacteria | 19438 |
| 15 | JGI25152J39213_1000103 | 3300002773 | Bacteria | 59472 |
| 16 | JGI25150J39212_1000183 | 3300002774 | Bacteria | 35389 |
| 17 | JGI25151J46595_10000187 | 3300003187 | Bacteria | 76949 |
| 18 | JGI25151J46595_10000271 | 3300003187 | Bacteria | 59472 |
| 19 | JGI25406J46586_10015012 | 3300003203 | Bacteria | 3277 |
| 20 | JGI25165J46597_1000625 | 3300003214 | Bacteria | 29618 |
| 21 | JGI25153J46596_10000190 | 3300003215 | Bacteria | 59472 |
| 22 | Ga0006562J51391_1007922 | 3300003578 | Bacteria | 9000 |
| 23 | Ga0006562J51391_1007923 | 3300003578 | Bacteria | 4170 |
| 24 | Ga0055539_1000014 | 3300003752 | Bacteria | 381086 |
| 25 | Ga0055533_1000002 | 3300003756 | Bacteria | 1196393 |
| 26 | Ga0055533_1000962 | 3300003756 | Bacteria | 8475 |
| 27 | Ga0055525_1005588 | 3300003759 | Bacteria | 1068 |
| 28 | Ga0055542_1000010 | 3300003762 | Bacteria | 414813 |
| 29 | Ga0055529_1001798 | 3300003763 | Bacteria | 5209 |
| 30 | Ga0055526_1000005 | 3300003771 | Bacteria | 344542 |
| 31 | Ga0055537_1000042 | 3300003773 | Bacteria | 91406 |
| 32 | Ga0055537_1001615 | 3300003773 | Bacteria | 8475 |
| 33 | Ga0055524_1000005 | 3300003775 | Bacteria | 344542 |
| 34 | Ga0055536_1000773 | 3300003781 | Bacteria | 21299 |
| 35 | Ga0055534_1000002 | 3300003784 | Bacteria | 390762 |
| 36 | Ga0055528_1000002 | 3300003790 | Bacteria | 368879 |
| 37 | Ga0055530_10002647 | 3300003791 | Bacteria | 11202 |
| 38 | Ga0055541_1000497 | 3300003841 | Bacteria | 11039 |
| 39 | Ga0058692_1000053 | 3300003856 | Bacteria | 107166 |
| 40 | Ga0058692_1000065 | 3300003856 | Bacteria | 89723 |
| 41 | Ga0058862_12823758 | 3300004803 | Bacteria | 1790 |
| 42 | Ga0065714_10088992 | 3300005288 | Bacteria | 1996 |
| 43 | Ga0065715_10005079 | 3300005293 | Bacteria | 4935 |
| 44 | Ga0065707_10092011 | 3300005295 | Bacteria | 3842 |
| 45 | Ga0070658_10000065 | 3300005327 | Bacteria | 104621 |
| 46 | Ga0070658_10016063 | 3300005327 | Bacteria | 5986 |
| 47 | Ga0070658_10122941 | 3300005327 | Bacteria | 2158 |
| 48 | Ga0070658_10136650 | 3300005327 | Bacteria | 2046 |
| 49 | Ga0070676_10002175 | 3300005328 | Bacteria | 9989 |
| 50 | Ga0070676_10004260 | 3300005328 | Bacteria | 7516 |
| 51 | Ga0070683_100058119 | 3300005329 | Bacteria | 3594 |
| 52 | Ga0070683_100102372 | 3300005329 | Bacteria | 2697 |
| 53 | Ga0070670_100086016 | 3300005331 | Bacteria | 2702 |
| 54 | Ga0070670_100120801 | 3300005331 | Bacteria | 2260 |
| 55 | Ga0070670_100295628 | 3300005331 | Bacteria | 1416 |
| 56 | Ga0068869_100000848 | 3300005334 | Bacteria | 17540 |
| 57 | Ga0068869_100005518 | 3300005334 | Bacteria | 7962 |
| 58 | Ga0068869_100178597 | 3300005334 | Bacteria | 1663 |
| 59 | Ga0070680_100000138 | 3300005336 | Bacteria | 44481 |
| 60 | Ga0070680_100019130 | 3300005336 | Bacteria | 5423 |
| 61 | Ga0070680_100026845 | 3300005336 | Bacteria | 4607 |
| 62 | Ga0070680_100065060 | 3300005336 | Bacteria | 2988 |
| 63 | Ga0070680_100249030 | 3300005336 | Bacteria | 1502 |
| 64 | Ga0070682_100004912 | 3300005337 | Bacteria | 7422 |
| 65 | Ga0070682_100013413 | 3300005337 | Bacteria | 4713 |
| 66 | Ga0070682_100183929 | 3300005337 | Bacteria | 1462 |
| 67 | Ga0068868_100000154 | 3300005338 | Bacteria | 44616 |
| 68 | Ga0068868_100169688 | 3300005338 | Bacteria | 1806 |
| 69 | Ga0070660_100355517 | 3300005339 | Bacteria | 1207 |
| 70 | Ga0070689_100006130 | 3300005340 | Bacteria | 8285 |
| 71 | Ga0070691_10000204 | 3300005341 | Bacteria | 19856 |
| 72 | Ga0070691_10047295 | 3300005341 | Bacteria | 2045 |
| 73 | Ga0070687_100001734 | 3300005343 | Bacteria | 7848 |
| 74 | Ga0070687_100100108 | 3300005343 | Bacteria | 1621 |
| 75 | Ga0070661_100014313 | 3300005344 | Bacteria | 5589 |
| 76 | Ga0070661_100019362 | 3300005344 | Bacteria | 4851 |
| 77 | Ga0070661_100022768 | 3300005344 | Bacteria | 4486 |
| 78 | Ga0070661_100137945 | 3300005344 | Bacteria | 1836 |
| 79 | Ga0070661_100221607 | 3300005344 | Bacteria | 1451 |
| 80 | Ga0070661_100505846 | 3300005344 | Bacteria | 967 |
| 81 | Ga0070692_10000826 | 3300005345 | Bacteria | 10346 |
| 82 | Ga0070692_10001376 | 3300005345 | Bacteria | 8785 |
| 83 | Ga0070692_10024606 | 3300005345 | Bacteria | 2960 |
| 84 | Ga0070668_100002627 | 3300005347 | Bacteria | 13198 |
| 85 | Ga0070668_100005675 | 3300005347 | Bacteria | 9250 |
| 86 | Ga0070668_100297144 | 3300005347 | Bacteria | 1353 |
| 87 | Ga0070669_100016734 | 3300005353 | Bacteria | 5233 |
| 88 | Ga0070669_100021816 | 3300005353 | Bacteria | 4579 |
| 89 | Ga0070675_100025078 | 3300005354 | Bacteria | 4779 |
| 90 | Ga0070675_100051402 | 3300005354 | Bacteria | 3386 |
| 91 | Ga0070671_100020254 | 3300005355 | Bacteria | 5423 |
| 92 | Ga0070673_100000023 | 3300005364 | Bacteria | 91936 |
| 93 | Ga0070688_100015057 | 3300005365 | Bacteria | 4391 |
| 94 | Ga0070688_100213269 | 3300005365 | Bacteria | 1357 |
| 95 | Ga0070659_100004369 | 3300005366 | Bacteria | 10091 |
| 96 | Ga0070659_100005005 | 3300005366 | Bacteria | 9495 |
| 97 | Ga0070659_100014512 | 3300005366 | Bacteria | 5888 |
| 98 | Ga0070667_100023098 | 3300005367 | Bacteria | 5158 |
| 99 | Ga0070667_100059611 | 3300005367 | Bacteria | 3229 |
| 100 | Ga0070667_100273171 | 3300005367 | Bacteria | 1516 |
| 101 | Ga0070714_100000007 | 3300005435 | Bacteria | 285654 |
| 102 | Ga0070714_100000025 | 3300005435 | Bacteria | 147717 |
| 103 | Ga0070714_100002188 | 3300005435 | Bacteria | 14379 |
| 104 | Ga0070714_100179606 | 3300005435 | Bacteria | 1925 |
| 105 | Ga0070714_100234025 | 3300005435 | Bacteria | 1693 |
| 106 | Ga0070713_100003658 | 3300005436 | Bacteria | 10176 |
| 107 | Ga0070711_100203553 | 3300005439 | Bacteria | 1529 |
| 108 | Ga0070705_100176800 | 3300005440 | Bacteria | 1442 |
| 109 | Ga0070700_100000015 | 3300005441 | Bacteria | 149873 |
| 110 | Ga0070700_100022316 | 3300005441 | Bacteria | 3689 |
| 111 | Ga0070708_100005216 | 3300005445 | Bacteria | 10289 |
| 112 | Ga0070708_100382634 | 3300005445 | Bacteria | 1327 |
| 113 | Ga0070663_100001998 | 3300005455 | Bacteria | 11388 |
| 114 | Ga0070663_100003552 | 3300005455 | Bacteria | 9006 |
| 115 | Ga0070663_100011137 | 3300005455 | Bacteria | 5632 |
| 116 | Ga0070663_100030594 | 3300005455 | Bacteria | 3691 |
| 117 | Ga0070663_100174476 | 3300005455 | Bacteria | 1664 |
| 118 | Ga0070663_100181951 | 3300005455 | Bacteria | 1631 |
| 119 | Ga0070678_100015225 | 3300005456 | Bacteria | 4881 |
| 120 | Ga0070678_100040799 | 3300005456 | Bacteria | 3286 |
| 121 | Ga0070662_100007688 | 3300005457 | Bacteria | 6993 |
| 122 | Ga0070662_100055165 | 3300005457 | Bacteria | 2882 |
| 123 | Ga0070662_100095797 | 3300005457 | Bacteria | 2238 |
| 124 | Ga0070662_100105335 | 3300005457 | Bacteria | 2141 |
| 125 | Ga0070662_100356393 | 3300005457 | Bacteria | 1199 |
| 126 | Ga0070681_10000076 | 3300005458 | Bacteria | 73378 |
| 127 | Ga0070681_10001058 | 3300005458 | Bacteria | 23417 |
| 128 | Ga0070681_10005260 | 3300005458 | Bacteria | 12496 |
| 129 | Ga0070681_10012818 | 3300005458 | Bacteria | 8322 |
| 130 | Ga0070681_10051976 | 3300005458 | Bacteria | 4086 |
| 131 | Ga0070681_10097017 | 3300005458 | Bacteria | 2895 |
| 132 | Ga0070681_10231243 | 3300005458 | Bacteria | 1763 |
| 133 | Ga0068867_100000007 | 3300005459 | Bacteria | 148726 |
| 134 | Ga0068867_100299750 | 3300005459 | Bacteria | 1325 |
| 135 | Ga0070685_10053205 | 3300005466 | Bacteria | 2345 |
| 136 | Ga0070706_100017183 | 3300005467 | Bacteria | 6682 |
| 137 | Ga0070706_100075262 | 3300005467 | Bacteria | 3124 |
| 138 | Ga0070698_100025964 | 3300005471 | Bacteria | 6102 |
| 139 | Ga0070679_100000504 | 3300005530 | Bacteria | 33271 |
| 140 | Ga0070679_100005669 | 3300005530 | Bacteria | 11575 |
| 141 | Ga0070679_100094827 | 3300005530 | Bacteria | 2972 |
| 142 | Ga0070679_100229808 | 3300005530 | Bacteria | 1815 |
| 143 | Ga0070679_100245203 | 3300005530 | Bacteria | 1748 |
| 144 | Ga0070684_100142709 | 3300005535 | Bacteria | 2166 |
| 145 | Ga0070684_100431134 | 3300005535 | Bacteria | 1217 |
| 146 | Ga0070684_100608218 | 3300005535 | Bacteria | 1016 |
| 147 | Ga0070697_100053485 | 3300005536 | Bacteria | 3281 |
| 148 | Ga0070697_100147487 | 3300005536 | Bacteria | 1982 |
| 149 | Ga0068853_100025947 | 3300005539 | Bacteria | 4918 |
| 150 | Ga0068853_100026580 | 3300005539 | Bacteria | 4860 |
| 151 | Ga0068853_100087550 | 3300005539 | Bacteria | 2733 |
| 152 | Ga0068853_100195851 | 3300005539 | Bacteria | 1838 |
| 153 | Ga0068853_100241865 | 3300005539 | Bacteria | 1654 |
| 154 | Ga0068853_100295727 | 3300005539 | Bacteria | 1495 |
| 155 | Ga0070672_100003161 | 3300005543 | Bacteria | 10646 |
| 156 | Ga0070672_100021437 | 3300005543 | Bacteria | 4728 |
| 157 | Ga0070686_100193262 | 3300005544 | Bacteria | 1454 |
| 158 | Ga0070696_100003079 | 3300005546 | Bacteria | 11084 |
| 159 | Ga0070696_100015403 | 3300005546 | Bacteria | 5134 |
| 160 | Ga0070696_100027962 | 3300005546 | Bacteria | 3846 |
| 161 | Ga0070693_100014051 | 3300005547 | Bacteria | 4091 |
| 162 | Ga0070665_100000465 | 3300005548 | Bacteria | 58821 |
| 163 | Ga0070665_100237824 | 3300005548 | Bacteria | 1822 |
| 164 | Ga0070665_100503266 | 3300005548 | Bacteria | 1223 |
| 165 | Ga0070704_100071046 | 3300005549 | Bacteria | 2528 |
| 166 | Ga0068855_100000897 | 3300005563 | Bacteria | 36900 |
| 167 | Ga0068855_100034494 | 3300005563 | Bacteria | 6035 |
| 168 | Ga0068855_100059757 | 3300005563 | Bacteria | 4459 |
| 169 | Ga0068855_100167742 | 3300005563 | Bacteria | 2488 |
| 170 | Ga0068855_100192031 | 3300005563 | Bacteria | 2303 |
| 171 | Ga0068855_100593199 | 3300005563 | Bacteria | 1195 |
| 172 | Ga0068857_100014249 | 3300005577 | Bacteria | 6927 |
| 173 | Ga0068857_100019539 | 3300005577 | Bacteria | 5950 |
| 174 | Ga0068857_100082251 | 3300005577 | Bacteria | 2876 |
| 175 | Ga0068857_100120614 | 3300005577 | Bacteria | 2360 |
| 176 | Ga0068857_100150476 | 3300005577 | Bacteria | 2108 |
| 177 | Ga0068854_100000027 | 3300005578 | Bacteria | 117836 |
| 178 | Ga0068854_100000142 | 3300005578 | Bacteria | 49834 |
| 179 | Ga0068854_100063019 | 3300005578 | Bacteria | 2690 |
| 180 | Ga0068854_100368849 | 3300005578 | Bacteria | 1180 |
| 181 | Ga0068856_100000462 | 3300005614 | Bacteria | 44787 |
| 182 | Ga0068856_100004819 | 3300005614 | Bacteria | 13371 |
| 183 | Ga0068856_100025070 | 3300005614 | Bacteria | 5811 |
| 184 | Ga0068856_100336574 | 3300005614 | Bacteria | 1527 |
| 185 | Ga0068852_100112354 | 3300005616 | Bacteria | 2479 |
| 186 | Ga0068866_10036810 | 3300005718 | Bacteria | 2399 |
| 187 | Ga0068861_100004360 | 3300005719 | Bacteria | 9490 |
| 188 | Ga0068851_10026102 | 3300005834 | Bacteria | 2868 |
| 189 | Ga0068863_100038707 | 3300005841 | Bacteria | 4536 |
| 190 | Ga0068858_100013390 | 3300005842 | Bacteria | 7741 |
| 191 | Ga0068858_100098118 | 3300005842 | Bacteria | 2732 |
| 192 | Ga0068858_100128673 | 3300005842 | Bacteria | 2373 |
| 193 | Ga0068860_100041224 | 3300005843 | Bacteria | 4410 |
| 194 | Ga0068860_100061738 | 3300005843 | Bacteria | 3561 |
| 195 | Ga0068860_100101230 | 3300005843 | Bacteria | 2749 |
| 196 | Ga0068862_100070914 | 3300005844 | Bacteria | 3009 |
| 197 | Ga0081539_10000105 | 3300005985 | Bacteria | 197356 |
| 198 | Ga0081539_10083936 | 3300005985 | Bacteria | 1666 |
| 199 | Ga0075364_10061999 | 3300006051 | Bacteria | 2454 |
| 200 | Ga0070712_100056201 | 3300006175 | Bacteria | 2760 |
| 201 | Ga0070712_100218002 | 3300006175 | Bacteria | 1509 |
| 202 | Ga0097621_100002061 | 3300006237 | Bacteria | 13748 |
| 203 | Ga0068871_100002074 | 3300006358 | Bacteria | 13555 |
| 204 | Ga0068871_100137854 | 3300006358 | Bacteria | 2073 |
| 205 | Ga0075428_100002309 | 3300006844 | Bacteria | 20651 |
| 206 | Ga0075428_100008733 | 3300006844 | Bacteria | 11238 |
| 207 | Ga0075428_100415922 | 3300006844 | Bacteria | 1440 |
| 208 | Ga0075428_100713931 | 3300006844 | Bacteria | 1068 |
| 209 | Ga0075430_100065318 | 3300006846 | Bacteria | 3057 |
| 210 | Ga0075431_100013904 | 3300006847 | Bacteria | 8127 |
| 211 | Ga0075433_10039496 | 3300006852 | Bacteria | 4082 |
| 212 | Ga0075434_100007756 | 3300006871 | Bacteria | 9939 |
| 213 | Ga0075434_100048328 | 3300006871 | Bacteria | 4221 |
| 214 | Ga0075429_100055515 | 3300006880 | Bacteria | 3446 |
| 215 | Ga0068865_100000010 | 3300006881 | Bacteria | 159548 |
| 216 | Ga0068865_100007765 | 3300006881 | Bacteria | 6613 |
| 217 | Ga0068865_100122851 | 3300006881 | Bacteria | 1934 |
| 218 | Ga0099795_10004112 | 3300007788 | Bacteria | 3711 |
| 219 | Ga0105240_10000049 | 3300009093 | Bacteria | 236718 |
| 220 | Ga0105240_10000113 | 3300009093 | Bacteria | 168192 |
| 221 | Ga0105240_10002816 | 3300009093 | Bacteria | 27486 |
| 222 | Ga0105240_10069114 | 3300009093 | Bacteria | 4372 |
| 223 | Ga0105240_10081693 | 3300009093 | Bacteria | 3970 |
| 224 | Ga0105240_10228162 | 3300009093 | Bacteria | 2166 |
| 225 | Ga0105240_10680974 | 3300009093 | Bacteria | 1124 |
| 226 | Ga0111539_10043138 | 3300009094 | Bacteria | 5409 |
| 227 | Ga0111539_10049401 | 3300009094 | Bacteria | 5017 |
| 228 | Ga0111539_10063244 | 3300009094 | Bacteria | 4379 |
| 229 | Ga0111539_10565172 | 3300009094 | Bacteria | 1325 |
| 230 | Ga0105245_10001804 | 3300009098 | Bacteria | 19521 |
| 231 | Ga0105245_10056362 | 3300009098 | Bacteria | 3532 |
| 232 | Ga0105245_10062002 | 3300009098 | Bacteria | 3373 |
| 233 | Ga0114129_10001539 | 3300009147 | Bacteria | 31268 |
| 234 | Ga0114129_10014853 | 3300009147 | Bacteria | 11095 |
| 235 | Ga0114129_10148798 | 3300009147 | Bacteria | 3205 |
| 236 | Ga0105243_10000950 | 3300009148 | Bacteria | 27049 |
| 237 | Ga0105243_10004757 | 3300009148 | Bacteria | 10671 |
| 238 | Ga0105243_10008647 | 3300009148 | Bacteria | 7810 |
| 239 | Ga0105243_10011470 | 3300009148 | Bacteria | 6704 |
| 240 | Ga0105243_10014541 | 3300009148 | Bacteria | 5954 |
| 241 | Ga0105241_10011546 | 3300009174 | Bacteria | 6475 |
| 242 | Ga0105241_10012868 | 3300009174 | Bacteria | 6140 |
| 243 | Ga0105241_10013711 | 3300009174 | Bacteria | 5938 |
| 244 | Ga0105241_10282502 | 3300009174 | Bacteria | 1418 |
| 245 | Ga0105242_10000210 | 3300009176 | Bacteria | 45627 |
| 246 | Ga0105242_10007241 | 3300009176 | Bacteria | 8552 |
| 247 | Ga0105248_10057736 | 3300009177 | Bacteria | 4356 |
| 248 | Ga0105248_10262904 | 3300009177 | Bacteria | 1942 |
| 249 | Ga0105237_10000230 | 3300009545 | Bacteria | 79441 |
| 250 | Ga0105237_10284515 | 3300009545 | Bacteria | 1656 |
| 251 | Ga0105237_10362694 | 3300009545 | Bacteria | 1453 |
| 252 | Ga0105238_10002948 | 3300009551 | Bacteria | 16980 |
| 253 | Ga0105238_10041071 | 3300009551 | Bacteria | 4686 |
| 254 | Ga0105238_10073696 | 3300009551 | Bacteria | 3408 |
| 255 | Ga0105238_10143947 | 3300009551 | Bacteria | 2360 |
| 256 | Ga0105238_10543702 | 3300009551 | Bacteria | 1165 |
| 257 | Ga0105249_10000195 | 3300009553 | Bacteria | 69709 |
| 258 | Ga0105249_10007619 | 3300009553 | Bacteria | 9444 |
| 259 | Ga0105249_10017303 | 3300009553 | Bacteria | 6400 |
| 260 | Ga0105249_10030480 | 3300009553 | Bacteria | 4876 |
| 261 | Ga0105249_10135624 | 3300009553 | Bacteria | 2355 |
| 262 | Ga0105249_10294373 | 3300009553 | Bacteria | 1626 |
| 263 | Ga0105032_101587 | 3300009979 | Bacteria | 2065 |
| 264 | Ga0105028_101804 | 3300009993 | Bacteria | 2244 |
| 265 | Ga0105239_10000034 | 3300010375 | Bacteria | 219430 |
| 266 | Ga0105239_10004123 | 3300010375 | Bacteria | 17464 |
| 267 | Ga0105239_10095696 | 3300010375 | Bacteria | 3280 |
| 268 | Ga0105239_10299995 | 3300010375 | Bacteria | 1809 |
| 269 | Ga0105239_10319165 | 3300010375 | Bacteria | 1751 |
| 270 | Ga0105239_10485188 | 3300010375 | Bacteria | 1404 |
| 271 | Ga0157373_10098054 | 3300013100 | Bacteria | 2063 |
| 272 | Ga0157371_10000397 | 3300013102 | Bacteria | 54547 |
| 273 | Ga0157371_10019340 | 3300013102 | Bacteria | 5024 |
| 274 | Ga0157371_10070140 | 3300013102 | Bacteria | 2481 |
| 275 | Ga0157371_10080697 | 3300013102 | Bacteria | 2304 |
| 276 | Ga0157371_10182732 | 3300013102 | Bacteria | 1500 |
| 277 | Ga0157371_10236816 | 3300013102 | Bacteria | 1312 |
| 278 | Ga0157370_10010248 | 3300013104 | Bacteria | 9897 |
| 279 | Ga0157370_10024020 | 3300013104 | Bacteria | 6044 |
| 280 | Ga0157370_10025407 | 3300013104 | Bacteria | 5862 |
| 281 | Ga0157370_10035718 | 3300013104 | Bacteria | 4828 |
| 282 | Ga0157370_10065485 | 3300013104 | Bacteria | 3438 |
| 283 | Ga0157370_10082723 | 3300013104 | Bacteria | 3019 |
| 284 | Ga0157370_10189137 | 3300013104 | Bacteria | 1911 |
| 285 | Ga0157369_10030897 | 3300013105 | Bacteria | 5904 |
| 286 | Ga0157369_10045576 | 3300013105 | Bacteria | 4768 |
| 287 | Ga0157369_10054676 | 3300013105 | Bacteria | 4310 |
| 288 | Ga0157369_10196583 | 3300013105 | Bacteria | 2118 |
| 289 | Ga0157369_10219655 | 3300013105 | Bacteria | 1990 |
| 290 | Ga0157369_10248017 | 3300013105 | Bacteria | 1859 |
| 291 | Ga0157369_10301602 | 3300013105 | Bacteria | 1666 |
| 292 | Ga0157374_10000830 | 3300013296 | Bacteria | 27049 |
| 293 | Ga0157374_10002660 | 3300013296 | Bacteria | 15048 |
| 294 | Ga0157374_10079124 | 3300013296 | Bacteria | 3114 |
| 295 | Ga0157374_10265052 | 3300013296 | Bacteria | 1693 |
| 296 | Ga0157378_10001477 | 3300013297 | Bacteria | 21228 |
| 297 | Ga0157378_10013933 | 3300013297 | Bacteria | 7034 |
| 298 | Ga0157378_10144915 | 3300013297 | Bacteria | 2208 |
| 299 | Ga0157378_10562746 | 3300013297 | Bacteria | 1147 |
| 300 | Ga0163162_10000015 | 3300013306 | Bacteria | 261996 |
| 301 | Ga0163162_10009246 | 3300013306 | Bacteria | 9588 |
| 302 | Ga0163162_10033700 | 3300013306 | Bacteria | 5090 |
| 303 | Ga0163162_10072625 | 3300013306 | Bacteria | 3496 |
| 304 | Ga0163162_10670611 | 3300013306 | Bacteria | 1160 |
| 305 | Ga0157372_10000004 | 3300013307 | Bacteria | 435659 |
| 306 | Ga0157372_10008269 | 3300013307 | Bacteria | 11061 |
| 307 | Ga0157372_10022871 | 3300013307 | Bacteria | 6769 |
| 308 | Ga0157372_10047515 | 3300013307 | Bacteria | 4770 |
| 309 | Ga0157372_10070446 | 3300013307 | Bacteria | 3934 |
| 310 | Ga0157372_10118468 | 3300013307 | Bacteria | 3038 |
| 311 | Ga0157372_10122484 | 3300013307 | Bacteria | 2988 |
| 312 | Ga0157375_10002120 | 3300013308 | Bacteria | 17145 |
| 313 | Ga0157375_10156411 | 3300013308 | Bacteria | 2418 |
| 314 | Ga0157375_10234511 | 3300013308 | Bacteria | 1994 |
| 315 | Ga0157375_10389508 | 3300013308 | Bacteria | 1560 |
| 316 | Ga0157375_10663712 | 3300013308 | Bacteria | 1198 |
| 317 | Ga0163163_10000205 | 3300014325 | Bacteria | 61330 |
| 318 | Ga0163163_10091541 | 3300014325 | Bacteria | 3056 |
| 319 | Ga0157380_10033964 | 3300014326 | Bacteria | 3931 |
| 320 | Ga0157380_10299929 | 3300014326 | Bacteria | 1480 |
| 321 | Ga0182008_10048966 | 3300014497 | Bacteria | 2098 |
| 322 | Ga0182008_10069164 | 3300014497 | Bacteria | 1737 |
| 323 | Ga0157377_10014848 | 3300014745 | Bacteria | 3972 |
| 324 | Ga0157379_10367839 | 3300014968 | Bacteria | 1318 |
| 325 | Ga0157376_10000047 | 3300014969 | Bacteria | 107974 |
| 326 | Ga0157376_10112995 | 3300014969 | Bacteria | 2394 |
| 327 | Ga0157376_10261459 | 3300014969 | Bacteria | 1622 |
| 328 | Ga0182006_1012948 | 3300015261 | Bacteria | 3637 |
| 329 | Ga0182006_1030792 | 3300015261 | Bacteria | 2166 |
| 330 | Ga0182006_1032508 | 3300015261 | Bacteria | 2097 |
| 331 | Ga0182006_1033197 | 3300015261 | Bacteria | 2070 |
| 332 | Ga0182007_10000079 | 3300015262 | Bacteria | 73543 |
| 333 | Ga0182007_10003052 | 3300015262 | Bacteria | 8072 |
| 334 | Ga0182005_1000166 | 3300015265 | Bacteria | 45594 |
| 335 | Ga0182005_1048792 | 3300015265 | Bacteria | 1150 |
| 336 | Ga0183368_1004 | 3300015687 | Bacteria | 1211761 |
| 337 | Ga0183360_10002 | 3300015689 | Bacteria | 953821 |
| 338 | Ga0163161_10018593 | 3300017792 | Bacteria | 4869 |
| 339 | Ga0163161_10039512 | 3300017792 | Bacteria | 3388 |
| 340 | Ga0163161_10184246 | 3300017792 | Bacteria | 1602 |
| 341 | Ga0197907_10031041 | 3300020069 | Bacteria | 1831 |
| 342 | Ga0206356_11162436 | 3300020070 | Bacteria | 2371 |
| 343 | Ga0206351_10270042 | 3300020077 | Bacteria | 1049 |
| 344 | Ga0206352_10784584 | 3300020078 | Bacteria | 1230 |
| 345 | Ga0206350_10514329 | 3300020080 | Bacteria | 2379 |
| 346 | Ga0206354_10512197 | 3300020081 | Bacteria | 2443 |
| 347 | Ga0206353_11363697 | 3300020082 | Bacteria | 1420 |
| 348 | Ga0154015_1208151 | 3300020610 | Bacteria | 1257 |
| 349 | Ga0154015_1499885 | 3300020610 | Bacteria | 1311 |
| 350 | Ga0213876_10001632 | 3300021384 | Bacteria | 13683 |
| 351 | Ga0213875_10049732 | 3300021388 | Bacteria | 1965 |
| 352 | Ga0224712_10020806 | 3300022467 | Bacteria | 2235 |
| 353 | Ga0224712_10028061 | 3300022467 | Bacteria | 2008 |
| 354 | Ga0228598_1013405 | 3300024227 | Bacteria | 1623 |
| 355 | Ga0209566_100056 | 3300025225 | Bacteria | 209595 |
| 356 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 357 | Ga0209674_100063 | 3300025226 | Bacteria | 275507 |
| 358 | Ga0209674_100836 | 3300025226 | Bacteria | 10196 |
| 359 | Ga0209672_100509 | 3300025228 | Bacteria | 21444 |
| 360 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 361 | Ga0207427_100132 | 3300025231 | Bacteria | 92962 |
| 362 | Ga0207427_100322 | 3300025231 | Bacteria | 32298 |
| 363 | Ga0207427_103057 | 3300025231 | Bacteria | 3807 |
| 364 | Ga0209437_100005 | 3300025233 | Bacteria | 1071596 |
| 365 | Ga0209437_100118 | 3300025233 | Bacteria | 207534 |
| 366 | Ga0209437_100233 | 3300025233 | Bacteria | 93858 |
| 367 | Ga0209258_100935 | 3300025242 | Bacteria | 14221 |
| 368 | Ga0209258_101545 | 3300025242 | Bacteria | 7709 |
| 369 | Ga0207425_1000148 | 3300025245 | Bacteria | 59862 |
| 370 | Ga0207425_1001805 | 3300025245 | Bacteria | 8297 |
| 371 | Ga0209646_1004787 | 3300025246 | Bacteria | 2432 |
| 372 | Ga0209026_1000010 | 3300025250 | Bacteria | 511986 |
| 373 | Ga0209026_1000061 | 3300025250 | Bacteria | 219572 |
| 374 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 375 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 376 | Ga0209759_1003743 | 3300025256 | Bacteria | 5945 |
| 377 | Ga0209129_1000239 | 3300025258 | Bacteria | 59863 |
| 378 | Ga0209233_1000011 | 3300025261 | Bacteria | 1071611 |
| 379 | Ga0209233_1000046 | 3300025261 | Bacteria | 470971 |
| 380 | Ga0209233_1011210 | 3300025261 | Bacteria | 2649 |
| 381 | Ga0209233_1015398 | 3300025261 | Bacteria | 2130 |
| 382 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 383 | Ga0209455_1000111 | 3300025272 | Bacteria | 188820 |
| 384 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 385 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 386 | Ga0209676_1000411 | 3300025292 | Bacteria | 77084 |
| 387 | Ga0209025_1000006 | 3300025294 | Bacteria | 1153444 |
| 388 | Ga0209025_1000048 | 3300025294 | Bacteria | 335574 |
| 389 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 390 | Ga0209758_1000056 | 3300025297 | Bacteria | 335574 |
| 391 | Ga0209758_1008030 | 3300025297 | Bacteria | 6973 |
| 392 | Ga0209050_1000146 | 3300025298 | Bacteria | 166930 |
| 393 | Ga0209256_1000006 | 3300025299 | Bacteria | 1250310 |
| 394 | Ga0209256_1003699 | 3300025299 | Bacteria | 10388 |
| 395 | Ga0207656_10008749 | 3300025321 | Bacteria | 3741 |
| 396 | Ga0207642_10161387 | 3300025899 | Bacteria | 1204 |
| 397 | Ga0207688_10112355 | 3300025901 | Bacteria | 1583 |
| 398 | Ga0207680_10047257 | 3300025903 | Bacteria | 2549 |
| 399 | Ga0207680_10061889 | 3300025903 | Bacteria | 2284 |
| 400 | Ga0207647_10001386 | 3300025904 | Bacteria | 18622 |
| 401 | Ga0207647_10002100 | 3300025904 | Bacteria | 15252 |
| 402 | Ga0207647_10003612 | 3300025904 | Bacteria | 11579 |
| 403 | Ga0207647_10010284 | 3300025904 | Bacteria | 6610 |
| 404 | Ga0207647_10026222 | 3300025904 | Bacteria | 3816 |
| 405 | Ga0207647_10051240 | 3300025904 | Bacteria | 2552 |
| 406 | Ga0207647_10054217 | 3300025904 | Bacteria | 2467 |
| 407 | Ga0207645_10000737 | 3300025907 | Bacteria | 27273 |
| 408 | Ga0207645_10009242 | 3300025907 | Bacteria | 6828 |
| 409 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 410 | Ga0207705_10000146 | 3300025909 | Bacteria | 75353 |
| 411 | Ga0207705_10000373 | 3300025909 | Bacteria | 40446 |
| 412 | Ga0207705_10000788 | 3300025909 | Bacteria | 26019 |
| 413 | Ga0207705_10009432 | 3300025909 | Bacteria | 7097 |
| 414 | Ga0207705_10059428 | 3300025909 | Bacteria | 2759 |
| 415 | Ga0207705_10081047 | 3300025909 | Bacteria | 2365 |
| 416 | Ga0207705_10257657 | 3300025909 | Bacteria | 1331 |
| 417 | Ga0207684_10076825 | 3300025910 | Bacteria | 2838 |
| 418 | Ga0207684_10321899 | 3300025910 | Bacteria | 1333 |
| 419 | Ga0207654_10024425 | 3300025911 | Bacteria | 3249 |
| 420 | Ga0207707_10000018 | 3300025912 | Bacteria | 215518 |
| 421 | Ga0207707_10000036 | 3300025912 | Bacteria | 146159 |
| 422 | Ga0207707_10000868 | 3300025912 | Bacteria | 29545 |
| 423 | Ga0207707_10000944 | 3300025912 | Bacteria | 28014 |
| 424 | Ga0207707_10009741 | 3300025912 | Bacteria | 8335 |
| 425 | Ga0207707_10015309 | 3300025912 | Bacteria | 6677 |
| 426 | Ga0207707_10017108 | 3300025912 | Bacteria | 6317 |
| 427 | Ga0207707_10023133 | 3300025912 | Bacteria | 5438 |
| 428 | Ga0207707_10027620 | 3300025912 | Bacteria | 4961 |
| 429 | Ga0207707_10050186 | 3300025912 | Bacteria | 3635 |
| 430 | Ga0207707_10127412 | 3300025912 | Bacteria | 2226 |
| 431 | Ga0207695_10000007 | 3300025913 | Bacteria | 1092551 |
| 432 | Ga0207695_10000114 | 3300025913 | Bacteria | 242465 |
| 433 | Ga0207695_10000816 | 3300025913 | Bacteria | 57734 |
| 434 | Ga0207695_10001086 | 3300025913 | Bacteria | 47444 |
| 435 | Ga0207695_10002626 | 3300025913 | Bacteria | 26298 |
| 436 | Ga0207695_10027868 | 3300025913 | Bacteria | 6280 |
| 437 | Ga0207695_10050538 | 3300025913 | Bacteria | 4372 |
| 438 | Ga0207695_10053798 | 3300025913 | Bacteria | 4208 |
| 439 | Ga0207695_10073182 | 3300025913 | Bacteria | 3493 |
| 440 | Ga0207695_10115114 | 3300025913 | Bacteria | 2664 |
| 441 | Ga0207695_10182106 | 3300025913 | Bacteria | 2022 |
| 442 | Ga0207671_10000639 | 3300025914 | Bacteria | 45851 |
| 443 | Ga0207671_10082200 | 3300025914 | Bacteria | 2417 |
| 444 | Ga0207671_10321677 | 3300025914 | Bacteria | 1224 |
| 445 | Ga0207660_10000389 | 3300025917 | Bacteria | 28880 |
| 446 | Ga0207660_10009240 | 3300025917 | Bacteria | 6379 |
| 447 | Ga0207660_10009433 | 3300025917 | Bacteria | 6317 |
| 448 | Ga0207660_10009884 | 3300025917 | Bacteria | 6180 |
| 449 | Ga0207660_10010720 | 3300025917 | Bacteria | 5957 |
| 450 | Ga0207660_10015984 | 3300025917 | Bacteria | 4961 |
| 451 | Ga0207660_10028000 | 3300025917 | Bacteria | 3851 |
| 452 | Ga0207660_10048875 | 3300025917 | Bacteria | 2995 |
| 453 | Ga0207660_10145550 | 3300025917 | Bacteria | 1816 |
| 454 | Ga0207660_10237378 | 3300025917 | Bacteria | 1435 |
| 455 | Ga0207662_10001726 | 3300025918 | Bacteria | 10708 |
| 456 | Ga0207657_10022248 | 3300025919 | Bacteria | 5940 |
| 457 | Ga0207649_10001271 | 3300025920 | Bacteria | 15070 |
| 458 | Ga0207649_10019583 | 3300025920 | Bacteria | 3869 |
| 459 | Ga0207649_10065234 | 3300025920 | Bacteria | 2304 |
| 460 | Ga0207649_10150937 | 3300025920 | Bacteria | 1600 |
| 461 | Ga0207652_10000409 | 3300025921 | Bacteria | 44486 |
| 462 | Ga0207652_10004945 | 3300025921 | Bacteria | 10791 |
| 463 | Ga0207652_10007521 | 3300025921 | Bacteria | 8769 |
| 464 | Ga0207652_10038403 | 3300025921 | Bacteria | 4059 |
| 465 | Ga0207652_10076977 | 3300025921 | Bacteria | 2910 |
| 466 | Ga0207652_10212731 | 3300025921 | Bacteria | 1741 |
| 467 | Ga0207646_10192292 | 3300025922 | Bacteria | 1843 |
| 468 | Ga0207681_10027150 | 3300025923 | Bacteria | 3699 |
| 469 | Ga0207694_10000930 | 3300025924 | Bacteria | 25962 |
| 470 | Ga0207694_10002010 | 3300025924 | Bacteria | 16833 |
| 471 | Ga0207694_10013293 | 3300025924 | Bacteria | 6199 |
| 472 | Ga0207694_10085369 | 3300025924 | Bacteria | 2484 |
| 473 | Ga0207694_10132693 | 3300025924 | Bacteria | 1997 |
| 474 | Ga0207650_10059382 | 3300025925 | Bacteria | 2850 |
| 475 | Ga0207650_10165686 | 3300025925 | Bacteria | 1754 |
| 476 | Ga0207650_10244319 | 3300025925 | Bacteria | 1451 |
| 477 | Ga0207659_10042135 | 3300025926 | Bacteria | 3199 |
| 478 | Ga0207659_10136197 | 3300025926 | Bacteria | 1901 |
| 479 | Ga0207687_10008258 | 3300025927 | Bacteria | 6810 |
| 480 | Ga0207687_10062794 | 3300025927 | Bacteria | 2628 |
| 481 | Ga0207700_10001535 | 3300025928 | Bacteria | 13085 |
| 482 | Ga0207700_10296846 | 3300025928 | Bacteria | 1394 |
| 483 | Ga0207664_10000014 | 3300025929 | Bacteria | 249865 |
| 484 | Ga0207664_10000071 | 3300025929 | Bacteria | 105708 |
| 485 | Ga0207664_10000601 | 3300025929 | Bacteria | 24933 |
| 486 | Ga0207644_10042775 | 3300025931 | Bacteria | 3212 |
| 487 | Ga0207690_10000532 | 3300025932 | Bacteria | 24801 |
| 488 | Ga0207690_10001860 | 3300025932 | Bacteria | 12965 |
| 489 | Ga0207690_10108815 | 3300025932 | Bacteria | 1993 |
| 490 | Ga0207690_10109772 | 3300025932 | Bacteria | 1985 |
| 491 | Ga0207690_10137975 | 3300025932 | Bacteria | 1793 |
| 492 | Ga0207706_10008698 | 3300025933 | Bacteria | 9352 |
| 493 | Ga0207706_10011915 | 3300025933 | Bacteria | 7916 |
| 494 | Ga0207706_10013100 | 3300025933 | Bacteria | 7546 |
| 495 | Ga0207706_10042110 | 3300025933 | Bacteria | 4047 |
| 496 | Ga0207706_10049448 | 3300025933 | Bacteria | 3715 |
| 497 | Ga0207706_10470496 | 3300025933 | Bacteria | 1086 |
| 498 | Ga0207686_10000598 | 3300025934 | Bacteria | 22543 |
| 499 | Ga0207709_10000050 | 3300025935 | Bacteria | 234391 |
| 500 | Ga0207709_10000527 | 3300025935 | Bacteria | 33281 |
| 501 | Ga0207709_10009913 | 3300025935 | Bacteria | 5247 |
| 502 | Ga0207704_10000020 | 3300025938 | Bacteria | 148847 |
| 503 | Ga0207704_10013639 | 3300025938 | Bacteria | 4076 |
| 504 | Ga0207691_10003625 | 3300025940 | Bacteria | 14989 |
| 505 | Ga0207691_10014108 | 3300025940 | Bacteria | 7622 |
| 506 | Ga0207691_10046652 | 3300025940 | Bacteria | 3980 |
| 507 | Ga0207711_10014427 | 3300025941 | Bacteria | 6563 |
| 508 | Ga0207711_10023261 | 3300025941 | Bacteria | 5186 |
| 509 | Ga0207689_10001541 | 3300025942 | Bacteria | 21894 |
| 510 | Ga0207689_10001783 | 3300025942 | Bacteria | 20340 |
| 511 | Ga0207661_10001897 | 3300025944 | Bacteria | 14342 |
| 512 | Ga0207661_10045981 | 3300025944 | Bacteria | 3459 |
| 513 | Ga0207661_10209699 | 3300025944 | Bacteria | 1716 |
| 514 | Ga0207661_10248469 | 3300025944 | Bacteria | 1580 |
| 515 | Ga0207679_10004674 | 3300025945 | Bacteria | 8528 |
| 516 | Ga0207667_10000040 | 3300025949 | Bacteria | 275827 |
| 517 | Ga0207667_10000947 | 3300025949 | Bacteria | 37022 |
| 518 | Ga0207667_10007762 | 3300025949 | Bacteria | 12828 |
| 519 | Ga0207667_10072474 | 3300025949 | Bacteria | 3580 |
| 520 | Ga0207667_10103191 | 3300025949 | Bacteria | 2941 |
| 521 | Ga0207667_10149101 | 3300025949 | Bacteria | 2408 |
| 522 | Ga0207667_10205878 | 3300025949 | Bacteria | 2017 |
| 523 | Ga0207667_10238588 | 3300025949 | Bacteria | 1861 |
| 524 | Ga0207651_10000005 | 3300025960 | Bacteria | 246132 |
| 525 | Ga0207712_10000277 | 3300025961 | Bacteria | 48990 |
| 526 | Ga0207712_10001146 | 3300025961 | Bacteria | 18465 |
| 527 | Ga0207712_10014077 | 3300025961 | Bacteria | 5135 |
| 528 | Ga0207712_10021212 | 3300025961 | Bacteria | 4262 |
| 529 | Ga0207668_10005154 | 3300025972 | Bacteria | 7689 |
| 530 | Ga0207668_10018373 | 3300025972 | Bacteria | 4398 |
| 531 | Ga0207640_10000009 | 3300025981 | Bacteria | 283101 |
| 532 | Ga0207640_10000145 | 3300025981 | Bacteria | 51603 |
| 533 | Ga0207640_10005290 | 3300025981 | Bacteria | 7031 |
| 534 | Ga0207640_10014194 | 3300025981 | Bacteria | 4579 |
| 535 | Ga0207640_10098268 | 3300025981 | Bacteria | 2046 |
| 536 | Ga0207640_10133355 | 3300025981 | Bacteria | 1799 |
| 537 | Ga0207658_10149525 | 3300025986 | Bacteria | 1901 |
| 538 | Ga0207677_10000373 | 3300026023 | Bacteria | 31103 |
| 539 | Ga0207677_10471654 | 3300026023 | Bacteria | 1080 |
| 540 | Ga0207703_10004934 | 3300026035 | Bacteria | 10830 |
| 541 | Ga0207639_10001840 | 3300026041 | Bacteria | 14285 |
| 542 | Ga0207639_10004652 | 3300026041 | Bacteria | 9240 |
| 543 | Ga0207639_10007809 | 3300026041 | Bacteria | 7304 |
| 544 | Ga0207639_10014224 | 3300026041 | Bacteria | 5589 |
| 545 | Ga0207639_10020933 | 3300026041 | Bacteria | 4692 |
| 546 | Ga0207639_10293628 | 3300026041 | Bacteria | 1434 |
| 547 | Ga0207639_10693695 | 3300026041 | Bacteria | 944 |
| 548 | Ga0207678_10004979 | 3300026067 | Bacteria | 11914 |
| 549 | Ga0207678_10005889 | 3300026067 | Bacteria | 10929 |
| 550 | Ga0207678_10006369 | 3300026067 | Bacteria | 10480 |
| 551 | Ga0207678_10020914 | 3300026067 | Bacteria | 5736 |
| 552 | Ga0207678_10043979 | 3300026067 | Bacteria | 3865 |
| 553 | Ga0207708_10000004 | 3300026075 | Bacteria | 293087 |
| 554 | Ga0207708_10009224 | 3300026075 | Bacteria | 7302 |
| 555 | Ga0207702_10000172 | 3300026078 | Bacteria | 77484 |
| 556 | Ga0207702_10008380 | 3300026078 | Bacteria | 8721 |
| 557 | Ga0207702_10015708 | 3300026078 | Bacteria | 6269 |
| 558 | Ga0207702_10036014 | 3300026078 | Bacteria | 4138 |
| 559 | Ga0207641_10025775 | 3300026088 | Bacteria | 4849 |
| 560 | Ga0207641_10043596 | 3300026088 | Bacteria | 3768 |
| 561 | Ga0207648_10000017 | 3300026089 | Bacteria | 148699 |
| 562 | Ga0207648_10027096 | 3300026089 | Bacteria | 5090 |
| 563 | Ga0207648_10030744 | 3300026089 | Bacteria | 4752 |
| 564 | Ga0207648_10136587 | 3300026089 | Bacteria | 2160 |
| 565 | Ga0207674_10001921 | 3300026116 | Bacteria | 26378 |
| 566 | Ga0207674_10004423 | 3300026116 | Bacteria | 16915 |
| 567 | Ga0207674_10012476 | 3300026116 | Bacteria | 9496 |
| 568 | Ga0207674_10021680 | 3300026116 | Bacteria | 6916 |
| 569 | Ga0207674_10050289 | 3300026116 | Bacteria | 4259 |
| 570 | Ga0207674_10227566 | 3300026116 | Bacteria | 1813 |
| 571 | Ga0207674_10258908 | 3300026116 | Bacteria | 1687 |
| 572 | Ga0207674_10341215 | 3300026116 | Bacteria | 1448 |
| 573 | Ga0207675_100001976 | 3300026118 | Bacteria | 20447 |
| 574 | Ga0207675_100031644 | 3300026118 | Bacteria | 4929 |
| 575 | Ga0207683_10232436 | 3300026121 | Bacteria | 1682 |
| 576 | Ga0207698_10000931 | 3300026142 | Bacteria | 17023 |
| 577 | Ga0207698_10054723 | 3300026142 | Bacteria | 3072 |
| 578 | Ga0207698_10083396 | 3300026142 | Bacteria | 2587 |
| 579 | Ga0207698_10332722 | 3300026142 | Bacteria | 1427 |
| 580 | Ga0209371_1000018 | 3300027312 | Bacteria | 614700 |
| 581 | Ga0209371_1000025 | 3300027312 | Bacteria | 450640 |
| 582 | Ga0209974_10004171 | 3300027876 | Bacteria | 5169 |
| 583 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 584 | Ga0268266_10026003 | 3300028379 | Bacteria | 4979 |
| 585 | Ga0268266_10027010 | 3300028379 | Bacteria | 4884 |
| 586 | Ga0268266_10031407 | 3300028379 | Bacteria | 4510 |
| 587 | Ga0268266_10305737 | 3300028379 | Bacteria | 1485 |
| 588 | Ga0268265_10061048 | 3300028380 | Bacteria | 2891 |
| 589 | Ga0268265_10566371 | 3300028380 | Bacteria | 1081 |
| 590 | Ga0268264_10148368 | 3300028381 | Bacteria | 2100 |
| 591 | Ga0268264_10298648 | 3300028381 | Bacteria | 1515 |
| 592 | Ga0265319_1000240 | 3300028563 | Bacteria | 41199 |
| 593 | Ga0265318_10002424 | 3300028577 | Bacteria | 9972 |
| 594 | Ga0265338_10212940 | 3300028800 | Bacteria | 1449 |
| 595 | Ga0268256_1000016 | 3300030500 | Bacteria | 614700 |
| 596 | Ga0268256_1000027 | 3300030500 | Bacteria | 450640 |
| 597 | Ga0316181_1114053 | 3300030744 | Bacteria | 1726 |
| 598 | Ga0316181_1268996 | 3300030744 | Bacteria | 2554 |
| 599 | Ga0265332_10014777 | 3300031238 | Bacteria | 3451 |
| 600 | Ga0265320_10000136 | 3300031240 | Bacteria | 63022 |
| 601 | Ga0265325_10001525 | 3300031241 | Bacteria | 16241 |
| 602 | Ga0265325_10042548 | 3300031241 | Bacteria | 2374 |
| 603 | Ga0265329_10000171 | 3300031242 | Bacteria | 32652 |
| 604 | Ga0265340_10003989 | 3300031247 | Bacteria | 8293 |
| 605 | Ga0265339_10065646 | 3300031249 | Bacteria | 1945 |
| 606 | Ga0265331_10000021 | 3300031250 | Bacteria | 242632 |
| 607 | Ga0265331_10016315 | 3300031250 | Bacteria | 3902 |
| 608 | Ga0265316_10001078 | 3300031344 | Bacteria | 29506 |
| 609 | Ga0265316_10012682 | 3300031344 | Bacteria | 7544 |
| 610 | Ga0307513_10158437 | 3300031456 | Bacteria | 2160 |
| 611 | Ga0307408_100005909 | 3300031548 | Bacteria | 8152 |
| 612 | Ga0307408_100073444 | 3300031548 | Bacteria | 2535 |
| 613 | Ga0265313_10001348 | 3300031595 | Bacteria | 23135 |
| 614 | Ga0307508_10065258 | 3300031616 | Bacteria | 3208 |
| 615 | Ga0307508_10284242 | 3300031616 | Bacteria | 1248 |
| 616 | Ga0265314_10007149 | 3300031711 | Bacteria | 9723 |
| 617 | Ga0265342_10000555 | 3300031712 | Bacteria | 39457 |
| 618 | Ga0265342_10104745 | 3300031712 | Bacteria | 1607 |
| 619 | Ga0307413_10022756 | 3300031824 | Bacteria | 3384 |
| 620 | Ga0307413_10085739 | 3300031824 | Bacteria | 2034 |
| 621 | Ga0307413_10088902 | 3300031824 | Bacteria | 2005 |
| 622 | Ga0307413_10126983 | 3300031824 | Bacteria | 1739 |
| 623 | Ga0307410_10002430 | 3300031852 | Bacteria | 9007 |
| 624 | Ga0307410_10029439 | 3300031852 | Bacteria | 3496 |
| 625 | Ga0307410_10040470 | 3300031852 | Bacteria | 3067 |
| 626 | Ga0307406_10002083 | 3300031901 | Bacteria | 10912 |
| 627 | Ga0307406_10005253 | 3300031901 | Bacteria | 7079 |
| 628 | Ga0307406_10186025 | 3300031901 | Bacteria | 1517 |
| 629 | Ga0307407_10043860 | 3300031903 | Bacteria | 2517 |
| 630 | Ga0307412_10093954 | 3300031911 | Bacteria | 2105 |
| 631 | Ga0307412_10217952 | 3300031911 | Bacteria | 1461 |
| 632 | Ga0307409_100049477 | 3300031995 | Bacteria | 3205 |
| 633 | Ga0307409_100063613 | 3300031995 | Bacteria | 2894 |
| 634 | Ga0307416_100110189 | 3300032002 | Bacteria | 2423 |
| 635 | Ga0307414_10000303 | 3300032004 | Bacteria | 28561 |
| 636 | Ga0307414_10002908 | 3300032004 | Bacteria | 9058 |
| 637 | Ga0307414_10380382 | 3300032004 | Bacteria | 1220 |
| 638 | Ga0307411_10076113 | 3300032005 | Bacteria | 2293 |
| 639 | Ga0307411_10076436 | 3300032005 | Bacteria | 2289 |
| 640 | Ga0307411_10084639 | 3300032005 | Bacteria | 2194 |
| 641 | Ga0307415_100140021 | 3300032126 | Bacteria | 1846 |
| 642 | Ga0307415_100354786 | 3300032126 | Bacteria | 1236 |
| 643 | Ga0307507_10093349 | 3300033179 | Bacteria | 2564 |
| 644 | Ga0373926_0027212 | 3300035083 | Bacteria | 2002 |
| 645 | Ga0373952_0035064 | 3300035092 | Bacteria | 1134 |
| 646 | Ga0373945_0006636 | 3300035116 | Bacteria | 3739 |
| 647 | Ga0373956_0063225 | 3300035119 | Bacteria | 1678 |
| 648 | Ga0373943_0002619 | 3300035170 | Bacteria | 8184 |
| 649 | Ga0373935_0014070 | 3300035692 | Bacteria | 4832 |
| 650 | Ga0373927_0031176 | 3300035695 | Bacteria | 3477 |
| 651 | Ga0373933_0018862 | 3300035724 | Bacteria | 3886 |
| 652 | Ga0373933_0093035 | 3300035724 | Bacteria | 1863 |
| 653 | Ga0373947_0004896 | 3300035725 | Bacteria | 7838 |
| 654 | Ga0373947_0036575 | 3300035725 | Bacteria | 2912 |
| 655 | Ga0373937_0049907 | 3300036401 | Bacteria | 3832 |
| 656 | Ga0373937_0366843 | 3300036401 | Bacteria | 1365 |
| 657 | Ga0373925_0000649 | 3300037068 | Bacteria | 32703 |
| 658 | Ga0395899_0036394 | 3300037312 | Bacteria | 3692 |
| 659 | Ga0395900_0000033 | 3300037418 | Bacteria | 260271 |
| 660 | Ga0395900_0000888 | 3300037418 | Bacteria | 39271 |
| 661 | Ga0395900_0009693 | 3300037418 | Bacteria | 9869 |
| 662 | Ga0395900_0010009 | 3300037418 | Bacteria | 9702 |
| 663 | Ga0395900_0054926 | 3300037418 | Bacteria | 4100 |
| 664 | Ga0395898_0000355 | 3300037466 | Bacteria | 101003 |
| 665 | Ga0395898_0040116 | 3300037466 | Bacteria | 4632 |
| 666 | Ga0395898_0425028 | 3300037466 | Bacteria | 1266 |
| 667 | Ga0395905_0006600 | 3300037471 | Bacteria | 11643 |
| 668 | Ga0395905_0041832 | 3300037471 | Bacteria | 4300 |
| 669 | Ga0395905_0109833 | 3300037471 | Bacteria | 2589 |
| 670 | Ga0395905_0111481 | 3300037471 | Bacteria | 2569 |
| 671 | Ga0395905_0116462 | 3300037471 | Bacteria | 2512 |
| 672 | Ga0436364_0570527 | 3300037853 | Bacteria | 21688 |
| 673 | Ga0436364_0714734 | 3300037853 | Bacteria | 2049 |
| 674 | Ga0436364_1332114 | 3300037853 | Bacteria | 1998 |
| 675 | Ga0395901_0008861 | 3300038443 | Bacteria | 10186 |
| 676 | Ga0395901_0015001 | 3300038443 | Bacteria | 7876 |
| 677 | Ga0237819_00212 | 3300038705 | Bacteria | 21141 |
| 678 | Ga0237819_06260 | 3300038705 | Bacteria | 1798 |
| 679 | Ga0436365_0457258 | 3300039437 | Bacteria | 12071 |
| 680 | Ga0436365_1712708 | 3300039437 | Bacteria | 68148 |
| 681 | Ga0439436_0012161 | 3300041404 | Bacteria | 2612 |
| 682 | Ga0439441_007876 | 3300042001 | Bacteria | 1729 |
| 683 | Ga0439449_0079876 | 3300042007 | Bacteria | 1206 |
| 684 | Ga0466972_0014295 | 3300044658 | Bacteria | 3977 |
| 685 | Ga0466972_0020438 | 3300044658 | Bacteria | 3308 |
| 686 | Ga0466965_0055600 | 3300044683 | Bacteria | 1969 |
| 687 | Ga0466961_0097013 | 3300044693 | Bacteria | 1859 |
| 688 | Ga0466961_0099769 | 3300044693 | Bacteria | 1830 |
| 689 | Ga0453684_0121349 | 3300044712 | Bacteria | 3155 |
| 690 | Ga0453684_0671748 | 3300044712 | Bacteria | 1128 |
| 691 | Ga0466970_0021001 | 3300044765 | Bacteria | 3399 |
| 692 | Ga0466970_0086454 | 3300044765 | Bacteria | 1699 |
| 693 | Ga0466960_0007515 | 3300044901 | Bacteria | 4430 |
| 694 | Ga0466959_0049070 | 3300045049 | Bacteria | 3101 |
| 695 | Ga0466959_0201346 | 3300045049 | Bacteria | 1386 |
| 696 | Ga0466959_0267173 | 3300045049 | Bacteria | 1177 |
| 697 | Ga0451576_0049273 | 3300045051 | Bacteria | 4420 |
| 698 | Ga0451576_0386162 | 3300045051 | Bacteria | 1468 |
| 699 | Ga0466967_0520577 | 3300045976 | Bacteria | 1169 |
| 700 | Ga0495627_003294 | 3300046453 | Bacteria | 7220 |
| 701 | Ga0495627_010445 | 3300046453 | Bacteria | 3374 |
| 702 | Ga0495592_0001829 | 3300046454 | Bacteria | 14953 |
| 703 | Ga0495591_013499 | 3300046458 | Bacteria | 2983 |
| 704 | Ga0495638_0000087 | 3300046460 | Bacteria | 152531 |
| 705 | Ga0495638_0000095 | 3300046460 | Bacteria | 141825 |
| 706 | Ga0495638_0000526 | 3300046460 | Bacteria | 44654 |
| 707 | Ga0495651_0000112 | 3300046462 | Bacteria | 59789 |
| 708 | Ga0495651_0004909 | 3300046462 | Bacteria | 10229 |
| 709 | Ga0495651_0037275 | 3300046462 | Bacteria | 3785 |
| 710 | Ga0495653_0008702 | 3300046463 | Bacteria | 8315 |
| 711 | Ga0495653_0057144 | 3300046463 | Bacteria | 2972 |
| 712 | Ga0495650_0000122 | 3300046471 | Bacteria | 182888 |
| 713 | Ga0495580_0004583 | 3300046472 | Bacteria | 11600 |
| 714 | Ga0495582_0000213 | 3300046473 | Bacteria | 32186 |
| 715 | Ga0495639_0003220 | 3300046475 | Bacteria | 7093 |
| 716 | Ga0495662_0021763 | 3300046476 | Bacteria | 3098 |
| 717 | Ga0495664_0027212 | 3300046477 | Bacteria | 3333 |
| 718 | Ga0495664_0029489 | 3300046477 | Bacteria | 3209 |
| 719 | Ga0495664_0103014 | 3300046477 | Bacteria | 1720 |
| 720 | Ga0495606_0000154 | 3300046507 | Bacteria | 119458 |
| 721 | Ga0495608_0005013 | 3300046511 | Bacteria | 9472 |
| 722 | Ga0495608_0015212 | 3300046511 | Bacteria | 5339 |
| 723 | Ga0495628_0010075 | 3300046516 | Bacteria | 8042 |
| 724 | Ga0495630_0046901 | 3300046517 | Bacteria | 3230 |
| 725 | Ga0495630_0111043 | 3300046517 | Bacteria | 2077 |
| 726 | Ga0495630_0172293 | 3300046517 | Bacteria | 1649 |
| 727 | Ga0495632_0035825 | 3300046519 | Bacteria | 2528 |
| 728 | Ga0495643_0001815 | 3300046522 | Bacteria | 18211 |
| 729 | Ga0495663_0003358 | 3300046525 | Bacteria | 4627 |
| 730 | Ga0495663_0004265 | 3300046525 | Bacteria | 4031 |
| 731 | Ga0495642_0008250 | 3300046528 | Bacteria | 3984 |
| 732 | Ga0495652_0001460 | 3300046529 | Bacteria | 26134 |
| 733 | Ga0495652_0039539 | 3300046529 | Bacteria | 4078 |
| 734 | Ga0495665_0000168 | 3300046531 | Bacteria | 33008 |
| 735 | Ga0495665_0002975 | 3300046531 | Bacteria | 9159 |
| 736 | Ga0495640_0089957 | 3300046533 | Unclassified | 2027 |
| 737 | Ga0495640_0137767 | 3300046533 | Bacteria | 1575 |
| 738 | Ga0495586_0007098 | 3300046535 | Bacteria | 5970 |
| 739 | Ga0495586_0044609 | 3300046535 | Bacteria | 2389 |
| 740 | Ga0495586_0127954 | 3300046535 | Bacteria | 1421 |
| 741 | Ga0495587_0008194 | 3300046536 | Bacteria | 6734 |
| 742 | Ga0495645_0018582 | 3300046543 | Bacteria | 4995 |
| 743 | Ga0495622_0069635 | 3300046557 | Bacteria | 1624 |
| 744 | Ga0495633_0005215 | 3300046558 | Bacteria | 8016 |
| 745 | Ga0495633_0006398 | 3300046558 | Bacteria | 6986 |
| 746 | Ga0495667_0002346 | 3300046559 | Bacteria | 12657 |
| 747 | Ga0495667_0021853 | 3300046559 | Bacteria | 4314 |
| 748 | Ga0495656_0001607 | 3300046615 | Bacteria | 7396 |
| 749 | Ga0495668_0000364 | 3300046616 | Bacteria | 59836 |
| 750 | Ga0495625_0010997 | 3300046660 | Bacteria | 7425 |
| 751 | Ga0495625_0025870 | 3300046660 | Bacteria | 4442 |
| 752 | Ga0495625_0078789 | 3300046660 | Bacteria | 2299 |
| 753 | Ga0495635_0005328 | 3300046663 | Bacteria | 8955 |
| 754 | Ga0495635_0181855 | 3300046663 | Unclassified | 1429 |
| 755 | Ga0495657_0004093 | 3300046675 | Bacteria | 11695 |
| 756 | Ga0495657_0155154 | 3300046675 | Bacteria | 1419 |
| 757 | Ga0495623_0199603 | 3300046679 | Unclassified | 1151 |
| 758 | Ga0495646_0004052 | 3300046680 | Bacteria | 9190 |
| 759 | Ga0495647_0000124 | 3300046681 | Bacteria | 19840 |
| 760 | Ga0495647_0087280 | 3300046681 | Bacteria | 1274 |
| 761 | Ga0495658_0001608 | 3300046683 | Bacteria | 11762 |
| 762 | Ga0495613_0002933 | 3300046689 | Bacteria | 12776 |
| 763 | Ga0495613_0068659 | 3300046689 | Bacteria | 2585 |
| 764 | Ga0495624_0023365 | 3300046690 | Bacteria | 4077 |
| 765 | Ga0495670_0025528 | 3300046691 | Bacteria | 2923 |
| 766 | Ga0495671_0033896 | 3300046692 | Bacteria | 2599 |
| 767 | Ga0495649_0010401 | 3300046694 | Bacteria | 5489 |
| 768 | Ga0495600_0001620 | 3300046809 | Bacteria | 12555 |
| 769 | Ga0495600_0003112 | 3300046809 | Bacteria | 9714 |
| 770 | Ga0495581_0000059 | 3300047315 | Bacteria | 42676 |
| 771 | Ga0495581_0153730 | 3300047315 | Bacteria | 1344 |
| 772 | Ga0495604_0004415 | 3300047317 | Bacteria | 11133 |
| 773 | Ga0495674_0008146 | 3300047319 | Bacteria | 9996 |
| 774 | Ga0495674_0142410 | 3300047319 | Bacteria | 2015 |
| 775 | Ga0495672_0000087 | 3300047320 | Bacteria | 154275 |
| 776 | Ga0495680_0001270 | 3300047322 | Bacteria | 27523 |
| 777 | Ga0495680_0004117 | 3300047322 | Bacteria | 13982 |
| 778 | Ga0495680_0014929 | 3300047322 | Bacteria | 6713 |
| 779 | Ga0495675_0000121 | 3300047444 | Bacteria | 56852 |
| 780 | Ga0495675_0010587 | 3300047444 | Bacteria | 5764 |
| 781 | Ga0495675_0068687 | 3300047444 | Bacteria | 2238 |
| 782 | Ga0495684_0002904 | 3300047471 | Bacteria | 13490 |
| 783 | Ga0495684_0004922 | 3300047471 | Bacteria | 10428 |
| 784 | Ga0495684_0005046 | 3300047471 | Bacteria | 10306 |
| 785 | Ga0495684_0007540 | 3300047471 | Bacteria | 8420 |
| 786 | Ga0495684_0036199 | 3300047471 | Bacteria | 3785 |
| 787 | Ga0495686_0004003 | 3300047472 | Bacteria | 12335 |
| 788 | Ga0495686_0021929 | 3300047472 | Bacteria | 4231 |
| 789 | Ga0495593_0020029 | 3300047673 | Bacteria | 3746 |
| 790 | Ga0495602_0002431 | 3300048088 | Bacteria | 18968 |
| 791 | Ga0496100_0034593 | 3300048903 | Bacteria | 3172 |
| 792 | Ga0496101_0022322 | 3300048904 | Bacteria | 4355 |
| 793 | Ga0496101_0061834 | 3300048904 | Bacteria | 2721 |
| 794 | Ga0496104_0013018 | 3300048907 | Bacteria | 7491 |
| 795 | Ga0496104_0013159 | 3300048907 | Bacteria | 7459 |
| 796 | Ga0496105_0058392 | 3300048908 | Bacteria | 3185 |
| 797 | Ga0496106_0265147 | 3300048909 | Bacteria | 1375 |
| 798 | Ga0496107_0196288 | 3300048910 | Bacteria | 1500 |
| 799 | Ga0496108_0119623 | 3300048911 | Bacteria | 2258 |
| 800 | Ga0496108_0703611 | 3300048911 | Bacteria | 876 |
| 801 | Ga0496109_0083637 | 3300048912 | Bacteria | 2943 |
| 802 | Ga0496109_0193734 | 3300048912 | Bacteria | 1910 |
| 803 | Ga0496110_0144262 | 3300048913 | Bacteria | 2153 |
| 804 | Ga0496112_0046779 | 3300048915 | Bacteria | 4245 |
| 805 | Ga0496112_0204691 | 3300048915 | Bacteria | 1932 |
| 806 | Ga0496112_0224091 | 3300048915 | Bacteria | 1836 |
| 807 | Ga0496113_0013073 | 3300048916 | Bacteria | 5605 |
| 808 | Ga0496113_0046259 | 3300048916 | Bacteria | 3230 |
| 809 | Ga0496114_0011751 | 3300048917 | Bacteria | 7004 |
| 810 | Ga0496114_0075849 | 3300048917 | Bacteria | 2832 |
| 811 | Ga0496114_0132116 | 3300048917 | Bacteria | 2156 |
| 812 | Ga0496114_0203032 | 3300048917 | Bacteria | 1736 |
| 813 | Ga0496115_0000116 | 3300048918 | Bacteria | 73024 |
| 814 | Ga0496115_0000233 | 3300048918 | Bacteria | 50408 |
| 815 | Ga0496115_0000293 | 3300048918 | Bacteria | 43225 |
| 816 | Ga0496115_0007196 | 3300048918 | Bacteria | 8175 |
| 817 | Ga0496115_0231491 | 3300048918 | Bacteria | 1523 |
| 818 | Ga0496115_0351060 | 3300048918 | Bacteria | 1203 |
| 819 | Ga0496116_0002572 | 3300048919 | Bacteria | 18929 |
| 820 | Ga0496116_0013614 | 3300048919 | Bacteria | 6541 |
| 821 | Ga0496116_0014949 | 3300048919 | Bacteria | 6160 |
| 822 | Ga0496116_0041201 | 3300048919 | Bacteria | 3171 |
| 823 | Ga0496117_0003980 | 3300048920 | Bacteria | 16691 |
| 824 | Ga0496117_0008136 | 3300048920 | Bacteria | 10024 |
| 825 | Ga0496117_0013164 | 3300048920 | Bacteria | 7236 |
| 826 | Ga0496117_0069791 | 3300048920 | Bacteria | 2364 |
| 827 | Ga0496118_0000260 | 3300048921 | Bacteria | 92249 |
| 828 | Ga0496118_0000953 | 3300048921 | Bacteria | 45266 |
| 829 | Ga0496118_0006046 | 3300048921 | Bacteria | 13482 |
| 830 | Ga0496118_0007889 | 3300048921 | Bacteria | 11154 |
| 831 | Ga0496118_0008964 | 3300048921 | Bacteria | 10208 |
| 832 | Ga0496118_0015832 | 3300048921 | Bacteria | 6955 |
| 833 | Ga0496118_0023738 | 3300048921 | Bacteria | 5315 |
| 834 | Ga0496118_0058708 | 3300048921 | Bacteria | 2872 |
| 835 | Ga0496118_0088913 | 3300048921 | Bacteria | 2134 |
| 836 | Ga0496118_0110485 | 3300048921 | Bacteria | 1826 |
| 837 | Ga0496118_0239116 | 3300048921 | Bacteria | 1041 |
| 838 | Ga0496119_0000048 | 3300048922 | Bacteria | 185846 |
| 839 | Ga0496119_0000711 | 3300048922 | Bacteria | 44692 |
| 840 | Ga0496119_0004893 | 3300048922 | Bacteria | 13104 |
| 841 | Ga0496119_0023171 | 3300048922 | Bacteria | 4416 |
| 842 | Ga0496119_0034191 | 3300048922 | Bacteria | 3354 |
| 843 | Ga0496119_0046818 | 3300048922 | Bacteria | 2696 |
| 844 | Ga0496120_0000113 | 3300048923 | Bacteria | 136672 |
| 845 | Ga0496120_0000519 | 3300048923 | Bacteria | 59691 |
| 846 | Ga0496120_0000727 | 3300048923 | Bacteria | 48259 |
| 847 | Ga0496121_0000013 | 3300048924 | Bacteria | 614976 |
| 848 | Ga0496121_0004863 | 3300048924 | Bacteria | 17653 |
| 849 | Ga0496121_0005121 | 3300048924 | Bacteria | 17074 |
| 850 | Ga0496121_0042740 | 3300048924 | Bacteria | 3937 |
| 851 | Ga0496121_0043735 | 3300048924 | Bacteria | 3874 |
| 852 | Ga0496122_0001140 | 3300048925 | Bacteria | 45568 |
| 853 | Ga0496122_0014529 | 3300048925 | Bacteria | 7601 |
| 854 | Ga0496122_0126649 | 3300048925 | Bacteria | 1633 |
| 855 | Ga0496122_0192224 | 3300048925 | Bacteria | 1203 |
| 856 | Ga0496123_0000942 | 3300048926 | Bacteria | 45419 |
| 857 | Ga0496123_0056542 | 3300048926 | Bacteria | 2563 |
| 858 | Ga0496124_0001552 | 3300048927 | Bacteria | 33193 |
| 859 | Ga0496124_0003834 | 3300048927 | Bacteria | 18012 |
| 860 | Ga0496124_0027671 | 3300048927 | Bacteria | 5083 |
| 861 | Ga0496124_0089185 | 3300048927 | Bacteria | 2518 |
| 862 | Ga0496124_0106341 | 3300048927 | Bacteria | 2265 |
| 863 | Ga0496125_0000722 | 3300048928 | Bacteria | 54697 |
| 864 | Ga0496125_0013105 | 3300048928 | Bacteria | 8174 |
| 865 | Ga0496125_0018451 | 3300048928 | Bacteria | 6625 |
| 866 | Ga0496125_0035604 | 3300048928 | Bacteria | 4362 |
| 867 | Ga0496126_0000057 | 3300048929 | Bacteria | 276781 |
| 868 | Ga0496126_0000320 | 3300048929 | Bacteria | 102586 |
| 869 | Ga0496126_0003861 | 3300048929 | Bacteria | 18507 |
| 870 | Ga0496126_0015014 | 3300048929 | Bacteria | 7808 |
| 871 | Ga0496126_0016096 | 3300048929 | Bacteria | 7495 |
| 872 | Ga0496126_0023194 | 3300048929 | Bacteria | 6016 |
| 873 | Ga0496126_0023341 | 3300048929 | Bacteria | 5995 |
| 874 | Ga0501031_0001796 | 3300049568 | Bacteria | 13467 |
| 875 | Ga0501031_0014464 | 3300049568 | Bacteria | 5128 |
| 876 | Ga0501032_0007207 | 3300049569 | Bacteria | 8134 |
| 877 | Ga0501032_0010231 | 3300049569 | Bacteria | 6768 |
| 878 | Ga0501032_0044695 | 3300049569 | Bacteria | 2997 |
| 879 | Ga0501033_0000086 | 3300049570 | Bacteria | 88255 |
| 880 | Ga0501033_0006023 | 3300049570 | Bacteria | 9512 |
| 881 | Ga0501033_0024833 | 3300049570 | Bacteria | 4520 |
| 882 | Ga0501033_0030820 | 3300049570 | Bacteria | 4031 |
| 883 | Ga0501033_0036085 | 3300049570 | Bacteria | 3705 |
| 884 | Ga0501033_0060447 | 3300049570 | Bacteria | 2795 |
| 885 | Ga0501033_0063173 | 3300049570 | Bacteria | 2726 |
| 886 | Ga0501034_0093322 | 3300049571 | Bacteria | 3006 |
| 887 | Ga0501034_0200942 | 3300049571 | Bacteria | 1951 |
| 888 | Ga0501036_0003611 | 3300049572 | Bacteria | 12365 |
| 889 | Ga0501036_0011588 | 3300049572 | Bacteria | 7304 |
| 890 | Ga0501036_0018586 | 3300049572 | Bacteria | 5827 |
| 891 | Ga0501036_0025725 | 3300049572 | Bacteria | 4967 |
| 892 | Ga0501036_0152836 | 3300049572 | Bacteria | 1947 |
| 893 | Ga0501036_0350644 | 3300049572 | Bacteria | 1232 |
| 894 | Ga0501037_0041500 | 3300049573 | Bacteria | 3384 |
| 895 | Ga0501037_0086830 | 3300049573 | Bacteria | 2264 |
| 896 | Ga0501038_0011732 | 3300049574 | Bacteria | 7993 |
| 897 | Ga0501038_0016254 | 3300049574 | Bacteria | 6748 |
| 898 | Ga0501038_0022471 | 3300049574 | Bacteria | 5651 |
| 899 | Ga0501038_0061319 | 3300049574 | Bacteria | 3216 |
| 900 | Ga0501038_0109817 | 3300049574 | Bacteria | 2285 |
| 901 | Ga0501038_0172902 | 3300049574 | Bacteria | 1747 |
| 902 | Ga0501039_0007126 | 3300049575 | Bacteria | 8519 |
| 903 | Ga0501039_0010959 | 3300049575 | Bacteria | 6909 |
| 904 | Ga0501039_0013495 | 3300049575 | Bacteria | 6247 |
| 905 | Ga0501039_0045023 | 3300049575 | Bacteria | 3408 |
| 906 | Ga0501040_0004213 | 3300049576 | Bacteria | 9362 |
| 907 | Ga0501040_0017688 | 3300049576 | Bacteria | 4731 |
| 908 | Ga0501041_0003615 | 3300049577 | Bacteria | 8891 |
| 909 | Ga0501042_0001952 | 3300049578 | Bacteria | 12421 |
| 910 | Ga0501042_0002596 | 3300049578 | Bacteria | 11110 |
| 911 | Ga0501042_0364241 | 3300049578 | Bacteria | 1046 |
| 912 | Ga0501043_0005825 | 3300049579 | Bacteria | 9912 |
| 913 | Ga0501043_0045918 | 3300049579 | Bacteria | 3434 |
| 914 | Ga0501043_0111954 | 3300049579 | Bacteria | 2143 |
| 915 | Ga0501046_0001919 | 3300049580 | Bacteria | 19740 |
| 916 | Ga0501046_0007819 | 3300049580 | Bacteria | 9381 |
| 917 | Ga0501047_0011238 | 3300049581 | Bacteria | 8473 |
| 918 | Ga0501047_0011692 | 3300049581 | Bacteria | 8299 |
| 919 | Ga0501047_0466423 | 3300049581 | Bacteria | 1091 |
| 920 | Ga0501048_0137342 | 3300049582 | Bacteria | 1728 |
| 921 | Ga0501048_0209232 | 3300049582 | Bacteria | 1383 |
| 922 | Ga0501068_0001687 | 3300049584 | Bacteria | 11780 |
| 923 | Ga0501068_0019942 | 3300049584 | Bacteria | 3901 |
| 924 | Ga0501069_0004963 | 3300049585 | Bacteria | 6903 |
| 925 | Ga0501070_0000269 | 3300049586 | Bacteria | 49060 |
| 926 | Ga0501070_0170031 | 3300049586 | Bacteria | 1795 |
| 927 | Ga0501070_0267493 | 3300049586 | Bacteria | 1397 |
| 928 | Ga0501070_0397768 | 3300049586 | Bacteria | 1114 |
| 929 | Ga0501072_0019466 | 3300049588 | Bacteria | 5248 |
| 930 | Ga0501072_0223635 | 3300049588 | Bacteria | 1500 |
| 931 | Ga0501073_0000408 | 3300049589 | Bacteria | 29377 |
| 932 | Ga0501073_0080842 | 3300049589 | Bacteria | 2261 |
| 933 | Ga0501074_0011170 | 3300049590 | Bacteria | 6523 |
| 934 | Ga0501074_0056693 | 3300049590 | Bacteria | 2824 |
| 935 | Ga0501075_0158630 | 3300049591 | Bacteria | 1726 |
| 936 | Ga0501076_0001011 | 3300049592 | Bacteria | 18469 |
| 937 | Ga0501076_0007819 | 3300049592 | Bacteria | 7792 |
| 938 | Ga0501076_0122416 | 3300049592 | Bacteria | 2106 |
| 939 | Ga0501077_0004162 | 3300049593 | Bacteria | 8740 |
| 940 | Ga0501077_0011204 | 3300049593 | Bacteria | 5594 |
| 941 | Ga0501077_0020571 | 3300049593 | Bacteria | 4178 |
| 942 | Ga0501079_0012719 | 3300049741 | Bacteria | 6429 |
| 943 | Ga0501079_0234515 | 3300049741 | Bacteria | 1434 |
| 944 | Ga0501079_0251816 | 3300049741 | Bacteria | 1380 |
| 945 | Ga0501080_0012126 | 3300049742 | Bacteria | 7896 |
| 946 | Ga0501080_0030603 | 3300049742 | Bacteria | 5016 |
| 947 | Ga0501080_0533340 | 3300049742 | Bacteria | 1046 |
| 948 | Ga0501081_0002043 | 3300049743 | Bacteria | 12580 |
| 949 | Ga0501081_0128766 | 3300049743 | Bacteria | 1807 |
| 950 | Ga0501083_0000990 | 3300049744 | Bacteria | 18870 |
| 951 | Ga0501035_0008776 | 3300049822 | Bacteria | 9410 |
| 952 | Ga0501035_0020150 | 3300049822 | Bacteria | 6124 |
| 953 | Ga0501035_0029675 | 3300049822 | Bacteria | 4987 |
| 954 | Ga0501035_0072308 | 3300049822 | Bacteria | 3052 |
| 955 | Ga0501035_0277633 | 3300049822 | Bacteria | 1417 |
| 956 | Ga0501044_0000749 | 3300049823 | Bacteria | 39273 |
| 957 | Ga0501044_0002590 | 3300049823 | Bacteria | 20558 |
| 958 | Ga0501044_0013084 | 3300049823 | Bacteria | 8981 |
| 959 | Ga0501044_0039363 | 3300049823 | Bacteria | 4933 |
| 960 | Ga0501044_0358588 | 3300049823 | Bacteria | 1376 |
| 961 | Ga0501044_0432093 | 3300049823 | Bacteria | 1226 |
| 962 | Ga0501044_0481197 | 3300049823 | Bacteria | 1144 |
| 963 | Ga0501044_0622771 | 3300049823 | Bacteria | 970 |
| 964 | Ga0501045_0005098 | 3300049824 | Bacteria | 9093 |
| 965 | Ga0501045_0010906 | 3300049824 | Bacteria | 6364 |
| 966 | nmdc:mga05p37_22411_c1 | 3300050507 | Bacteria | 7662 |
| 967 | nmdc:mga05p37_470558_c1 | 3300050507 | Bacteria | 1450 |
| 968 | nmdc:mga09592_1422_c1 | 3300050508 | Bacteria | 19206 |
| 969 | nmdc:mga09592_170495_c1 | 3300050508 | Bacteria | 1882 |
| 970 | nmdc:mga0qj67_25287_c1 | 3300050509 | Bacteria | 4586 |
| 971 | nmdc:mga0qj67_338480_c1 | 3300050509 | Bacteria | 1217 |
| 972 | nmdc:mga06r32_20879_c1 | 3300050510 | Bacteria | 6037 |
| 973 | nmdc:mga06r32_247156_c1 | 3300050510 | Bacteria | 1771 |
| 974 | nmdc:mga08y16_123927_c1 | 3300050511 | Bacteria | 2689 |
| 975 | nmdc:mga08y16_1627_c1 | 3300050511 | Bacteria | 22743 |
| 976 | nmdc:mga0n895_30080_c1 | 3300050512 | Bacteria | 5186 |
| 977 | nmdc:mga0a205_113774_c1 | 3300050515 | Bacteria | 2605 |
| 978 | Ga0495619_0040301 | 3300053085 | Bacteria | 3053 |
| 979 | Ga0500651_0047289 | 3300053093 | Bacteria | 2705 |
| 980 | Ga0500595_000162 | 3300053119 | Bacteria | 44030 |
| 981 | Ga0500568_0000316 | 3300053139 | Bacteria | 38483 |
| 982 | Ga0500573_0000049 | 3300053140 | Bacteria | 96218 |
| 983 | Ga0500590_000735 | 3300053148 | Bacteria | 11952 |
| 984 | Ga0500634_0000377 | 3300053161 | Bacteria | 14223 |
| 985 | Ga0501084_0020970 | 3300054114 | Bacteria | 5449 |
| 986 | Ga0501082_0027265 | 3300060353 | Bacteria | 4919 |
| 987 | Ga0501082_0334484 | 3300060353 | Bacteria | 1319 |
| 988 | Ga0530510_0002588 | 3300061734 | Bacteria | 12423 |
| 989 | Ga0530510_0004408 | 3300061734 | Bacteria | 9747 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045049 | Ga0466959_0201346 | Ga0466959_0201346_625_1374 | 235 |
| 2 | 3300048911 | Ga0496108_0703611 | Ga0496108_0703611_86_823 | 238 |
| 3 | 3300049588 | Ga0501072_0223635 | Ga0501072_0223635_21_755 | 244 |
| 4 | 3300049824 | Ga0501045_0010906 | Ga0501045_0010906_22_801 | 248 |
| 5 | 3300005455 | Ga0070663_100181951 | Ga0070663_1001819511 | 279 |
| 6 | 3300031824 | Ga0307413_10022756 | Ga0307413_100227564 | 279 |
| 7 | 3300005353 | Ga0070669_100021816 | Ga0070669_1000218164 | 281 |
| 8 | 3300005543 | Ga0070672_100021437 | Ga0070672_1000214372 | 281 |
| 9 | 3300025940 | Ga0207691_10014108 | Ga0207691_100141084 | 281 |
| 10 | 3300044765 | Ga0466970_0086454 | Ga0466970_0086454_796_1683 | 281 |
| 11 | 3300007788 | Ga0099795_10004112 | Ga0099795_100041122 | 282 |
| 12 | 3300035119 | Ga0373956_0063225 | Ga0373956_0063225_25_927 | 287 |
| 13 | 3300048910 | Ga0496107_0196288 | Ga0496107_0196288_274_1137 | 287 |
| 14 | 3300050512 | nmdc:mga0n895_30080_c1 | nmdc:mga0n895_30080_c1_1390_2253 | 287 |
| 15 | iso_pu_bacteria | 3002998708 | 3003003577 | 287 |
| 16 | iso_pu_bacteria | 8053945823 | 8053951975 | 287 |
| 17 | 3300009094 | Ga0111539_10049401 | Ga0111539_100494012 | 288 |
| 18 | 3300030744 | Ga0316181_1114053 | Ga0316181_11140532 | 288 |
| 19 | 3300036401 | Ga0373937_0366843 | Ga0373937_0366843_24_896 | 288 |
| 20 | 3300042007 | Ga0439449_0079876 | Ga0439449_0079876_62_979 | 288 |
| 21 | 3300050507 | nmdc:mga05p37_470558_c1 | nmdc:mga05p37_470558_c1_44_910 | 288 |
| 22 | iso_pu_bacteria | 2643221632 | 2644181827 | 288 |
| 23 | iso_pu_bacteria | 2844841374 | 2844844335 | 288 |
| 24 | iso_pu_bacteria | 2844852863 | 2844853635 | 288 |
| 25 | iso_pu_bacteria | 2919055335 | 2919056285 | 288 |
| 26 | iso_pu_bacteria | 2919523602 | 2919526287 | 288 |
| 27 | iso_pu_bacteria | 2928153084 | 2928154418 | 288 |
| 28 | 3300005445 | Ga0070708_100005216 | Ga0070708_1000052164 | 290 |
| 29 | 3300048921 | Ga0496118_0239116 | Ga0496118_0239116_17_889 | 290 |
| 30 | 3300005367 | Ga0070667_100273171 | Ga0070667_1002731713 | 291 |
| 31 | 3300005445 | Ga0070708_100382634 | Ga0070708_1003826342 | 291 |
| 32 | 3300005467 | Ga0070706_100017183 | Ga0070706_1000171833 | 291 |
| 33 | 3300005471 | Ga0070698_100025964 | Ga0070698_1000259642 | 291 |
| 34 | 3300009148 | Ga0105243_10014541 | Ga0105243_100145415 | 291 |
| 35 | 3300015261 | Ga0182006_1030792 | Ga0182006_10307922 | 291 |
| 36 | 3300015265 | Ga0182005_1048792 | Ga0182005_10487921 | 291 |
| 37 | 3300025910 | Ga0207684_10076825 | Ga0207684_100768252 | 291 |
| 38 | 3300025986 | Ga0207658_10149525 | Ga0207658_101495252 | 291 |
| 39 | 3300035092 | Ga0373952_0035064 | Ga0373952_0035064_244_1119 | 291 |
| 40 | 3300044693 | Ga0466961_0097013 | Ga0466961_0097013_432_1352 | 291 |
| 41 | 3300044693 | Ga0466961_0099769 | Ga0466961_0099769_396_1316 | 291 |
| 42 | 3300044765 | Ga0466970_0021001 | Ga0466970_0021001_2131_3051 | 291 |
| 43 | 3300046453 | Ga0495627_010445 | Ga0495627_010445_2418_3305 | 291 |
| 44 | 3300046519 | Ga0495632_0035825 | Ga0495632_0035825_30_917 | 291 |
| 45 | 3300046522 | Ga0495643_0001815 | Ga0495643_0001815_2964_3839 | 291 |
| 46 | 3300046558 | Ga0495633_0006398 | Ga0495633_0006398_64_951 | 291 |
| 47 | 3300046660 | Ga0495625_0078789 | Ga0495625_0078789_303_1178 | 291 |
| 48 | 3300047320 | Ga0495672_0000087 | Ga0495672_0000087_17451_18326 | 291 |
| 49 | 3300048919 | Ga0496116_0041201 | Ga0496116_0041201_2105_2980 | 291 |
| 50 | 3300048921 | Ga0496118_0008964 | Ga0496118_0008964_5343_6254 | 291 |
| 51 | 3300048922 | Ga0496119_0023171 | Ga0496119_0023171_23_898 | 291 |
| 52 | 3300048925 | Ga0496122_0192224 | Ga0496122_0192224_313_1188 | 291 |
| 53 | 3300048929 | Ga0496126_0015014 | Ga0496126_0015014_2507_3418 | 291 |
| 54 | 3300049568 | Ga0501031_0014464 | Ga0501031_0014464_852_1772 | 291 |
| 55 | 3300049570 | Ga0501033_0030820 | Ga0501033_0030820_458_1378 | 291 |
| 56 | 3300049572 | Ga0501036_0003611 | Ga0501036_0003611_7830_8750 | 291 |
| 57 | 3300049574 | Ga0501038_0011732 | Ga0501038_0011732_6357_7277 | 291 |
| 58 | 3300049574 | Ga0501038_0172902 | Ga0501038_0172902_740_1660 | 291 |
| 59 | 3300049575 | Ga0501039_0007126 | Ga0501039_0007126_7109_8029 | 291 |
| 60 | 3300049576 | Ga0501040_0004213 | Ga0501040_0004213_5245_6165 | 291 |
| 61 | 3300049577 | Ga0501041_0003615 | Ga0501041_0003615_5218_6138 | 291 |
| 62 | 3300049582 | Ga0501048_0137342 | Ga0501048_0137342_756_1670 | 291 |
| 63 | 3300049584 | Ga0501068_0019942 | Ga0501068_0019942_2950_3858 | 291 |
| 64 | 3300049592 | Ga0501076_0007819 | Ga0501076_0007819_5244_6164 | 291 |
| 65 | 3300049593 | Ga0501077_0011204 | Ga0501077_0011204_3635_4555 | 291 |
| 66 | 3300049741 | Ga0501079_0012719 | Ga0501079_0012719_3504_4424 | 291 |
| 67 | 3300049741 | Ga0501079_0234515 | Ga0501079_0234515_481_1395 | 291 |
| 68 | 3300049742 | Ga0501080_0533340 | Ga0501080_0533340_71_991 | 291 |
| 69 | 3300049743 | Ga0501081_0128766 | Ga0501081_0128766_492_1412 | 291 |
| 70 | 3300053161 | Ga0500634_0000377 | Ga0500634_0000377_13270_14157 | 291 |
| 71 | 3300054114 | Ga0501084_0020970 | Ga0501084_0020970_3919_4839 | 291 |
| 72 | 3300060353 | Ga0501082_0027265 | Ga0501082_0027265_3671_4591 | 291 |
| 73 | 3300061734 | Ga0530510_0004408 | Ga0530510_0004408_540_1460 | 291 |
| 74 | 3300001989 | JGI24739J22299_10055207 | JGI24739J22299_100552072 | 292 |
| 75 | 3300001990 | JGI24737J22298_10002869 | JGI24737J22298_100028692 | 292 |
| 76 | 3300002067 | JGI24735J21928_10000213 | JGI24735J21928_1000021313 | 292 |
| 77 | 3300003578 | Ga0006562J51391_1007922 | Ga0006562J51391_10079222 | 292 |
| 78 | 3300003578 | Ga0006562J51391_1007923 | Ga0006562J51391_10079234 | 292 |
| 79 | 3300003752 | Ga0055539_1000014 | Ga0055539_10000145 | 292 |
| 80 | 3300003756 | Ga0055533_1000002 | Ga0055533_1000002792 | 292 |
| 81 | 3300003759 | Ga0055525_1005588 | Ga0055525_10055882 | 292 |
| 82 | 3300003841 | Ga0055541_1000497 | Ga0055541_10004979 | 292 |
| 83 | 3300005327 | Ga0070658_10000065 | Ga0070658_1000006535 | 292 |
| 84 | 3300005327 | Ga0070658_10016063 | Ga0070658_100160633 | 292 |
| 85 | 3300005435 | Ga0070714_100000007 | Ga0070714_10000000781 | 292 |
| 86 | 3300005435 | Ga0070714_100179606 | Ga0070714_1001796062 | 292 |
| 87 | 3300005441 | Ga0070700_100000015 | Ga0070700_10000001564 | 292 |
| 88 | 3300005455 | Ga0070663_100174476 | Ga0070663_1001744762 | 292 |
| 89 | 3300005539 | Ga0068853_100195851 | Ga0068853_1001958512 | 292 |
| 90 | 3300009551 | Ga0105238_10073696 | Ga0105238_100736962 | 292 |
| 91 | 3300009551 | Ga0105238_10543702 | Ga0105238_105437022 | 292 |
| 92 | 3300013102 | Ga0157371_10080697 | Ga0157371_100806972 | 292 |
| 93 | 3300013104 | Ga0157370_10065485 | Ga0157370_100654853 | 292 |
| 94 | 3300013105 | Ga0157369_10301602 | Ga0157369_103016022 | 292 |
| 95 | 3300013296 | Ga0157374_10265052 | Ga0157374_102650522 | 292 |
| 96 | 3300013306 | Ga0163162_10670611 | Ga0163162_106706112 | 292 |
| 97 | 3300013307 | Ga0157372_10000004 | Ga0157372_10000004180 | 292 |
| 98 | 3300013307 | Ga0157372_10118468 | Ga0157372_101184682 | 292 |
| 99 | 3300013308 | Ga0157375_10234511 | Ga0157375_102345112 | 292 |
| 100 | 3300025225 | Ga0209566_100056 | Ga0209566_100056218 | 292 |
| 101 | 3300025226 | Ga0209674_100001 | Ga0209674_1000012772 | 292 |
| 102 | 3300025230 | Ga0209563_100001 | Ga0209563_1000012772 | 292 |
| 103 | 3300025253 | Ga0209677_100001 | Ga0209677_1000012772 | 292 |
| 104 | 3300025904 | Ga0207647_10010284 | Ga0207647_100102845 | 292 |
| 105 | 3300025904 | Ga0207647_10026222 | Ga0207647_100262223 | 292 |
| 106 | 3300025904 | Ga0207647_10051240 | Ga0207647_100512402 | 292 |
| 107 | 3300025909 | Ga0207705_10000001 | Ga0207705_100000011030 | 292 |
| 108 | 3300025929 | Ga0207664_10000014 | Ga0207664_10000014150 | 292 |
| 109 | 3300026067 | Ga0207678_10043979 | Ga0207678_100439791 | 292 |
| 110 | 3300026075 | Ga0207708_10000004 | Ga0207708_10000004231 | 292 |
| 111 | 3300037418 | Ga0395900_0000888 | Ga0395900_0000888_17404_18291 | 292 |
| 112 | 3300037466 | Ga0395898_0000355 | Ga0395898_0000355_61411_62298 | 292 |
| 113 | 3300044658 | Ga0466972_0014295 | Ga0466972_0014295_1447_2334 | 292 |
| 114 | 3300044658 | Ga0466972_0020438 | Ga0466972_0020438_300_1187 | 292 |
| 115 | 3300044683 | Ga0466965_0055600 | Ga0466965_0055600_447_1334 | 292 |
| 116 | 3300044901 | Ga0466960_0007515 | Ga0466960_0007515_821_1708 | 292 |
| 117 | 3300046535 | Ga0495586_0127954 | Ga0495586_0127954_146_1039 | 292 |
| 118 | 3300048904 | Ga0496101_0022322 | Ga0496101_0022322_3167_4054 | 292 |
| 119 | 3300048907 | Ga0496104_0013018 | Ga0496104_0013018_6248_7135 | 292 |
| 120 | 3300048909 | Ga0496106_0265147 | Ga0496106_0265147_402_1289 | 292 |
| 121 | 3300048912 | Ga0496109_0193734 | Ga0496109_0193734_125_1051 | 292 |
| 122 | 3300048915 | Ga0496112_0046779 | Ga0496112_0046779_332_1264 | 292 |
| 123 | 3300048916 | Ga0496113_0046259 | Ga0496113_0046259_563_1495 | 292 |
| 124 | 3300048917 | Ga0496114_0203032 | Ga0496114_0203032_381_1268 | 292 |
| 125 | 3300048918 | Ga0496115_0231491 | Ga0496115_0231491_551_1438 | 292 |
| 126 | 3300048922 | Ga0496119_0034191 | Ga0496119_0034191_1677_2564 | 292 |
| 127 | 3300048926 | Ga0496123_0056542 | Ga0496123_0056542_695_1582 | 292 |
| 128 | 3300049570 | Ga0501033_0036085 | Ga0501033_0036085_377_1264 | 292 |
| 129 | 3300049578 | Ga0501042_0001952 | Ga0501042_0001952_214_1101 | 292 |
| 130 | 3300049586 | Ga0501070_0000269 | Ga0501070_0000269_27673_28560 | 292 |
| 131 | 3300049744 | Ga0501083_0000990 | Ga0501083_0000990_6618_7505 | 292 |
| 132 | 3300049822 | Ga0501035_0277633 | Ga0501035_0277633_14_901 | 292 |
| 133 | 3300049823 | Ga0501044_0432093 | Ga0501044_0432093_92_979 | 292 |
| 134 | iso_pu_bacteria | 2852649853 | 2852652124 | 292 |
| 135 | iso_pu_bacteria | 8056037122 | 8056040431 | 292 |
| 136 | 3300035116 | Ga0373945_0006636 | Ga0373945_0006636_1517_2422 | 293 |
| 137 | 3300035170 | Ga0373943_0002619 | Ga0373943_0002619_4813_5718 | 293 |
| 138 | 3300035692 | Ga0373935_0014070 | Ga0373935_0014070_139_1044 | 293 |
| 139 | 3300035695 | Ga0373927_0031176 | Ga0373927_0031176_1651_2556 | 293 |
| 140 | 3300035724 | Ga0373933_0018862 | Ga0373933_0018862_2210_3115 | 293 |
| 141 | 3300035725 | Ga0373947_0004896 | Ga0373947_0004896_4411_5316 | 293 |
| 142 | 3300035725 | Ga0373947_0036575 | Ga0373947_0036575_1423_2304 | 293 |
| 143 | 3300036401 | Ga0373937_0049907 | Ga0373937_0049907_1117_2022 | 293 |
| 144 | 3300037068 | Ga0373925_0000649 | Ga0373925_0000649_9040_9945 | 293 |
| 145 | 3300046472 | Ga0495580_0004583 | Ga0495580_0004583_10020_10925 | 293 |
| 146 | 3300046473 | Ga0495582_0000213 | Ga0495582_0000213_23675_24580 | 293 |
| 147 | 3300046475 | Ga0495639_0003220 | Ga0495639_0003220_4523_5428 | 293 |
| 148 | 3300046476 | Ga0495662_0021763 | Ga0495662_0021763_599_1504 | 293 |
| 149 | 3300046531 | Ga0495665_0000168 | Ga0495665_0000168_20514_21419 | 293 |
| 150 | 3300046663 | Ga0495635_0005328 | Ga0495635_0005328_7607_8512 | 293 |
| 151 | 3300046681 | Ga0495647_0000124 | Ga0495647_0000124_11955_12860 | 293 |
| 152 | 3300046683 | Ga0495658_0001608 | Ga0495658_0001608_1701_2606 | 293 |
| 153 | 3300046689 | Ga0495613_0002933 | Ga0495613_0002933_8948_9853 | 293 |
| 154 | 3300046809 | Ga0495600_0003112 | Ga0495600_0003112_8495_9400 | 293 |
| 155 | 3300047315 | Ga0495581_0000059 | Ga0495581_0000059_28131_29036 | 293 |
| 156 | 3300047471 | Ga0495684_0004922 | Ga0495684_0004922_7736_8641 | 293 |
| 157 | 3300005331 | Ga0070670_100086016 | Ga0070670_1000860162 | 294 |
| 158 | 3300005354 | Ga0070675_100025078 | Ga0070675_1000250784 | 294 |
| 159 | 3300005577 | Ga0068857_100014249 | Ga0068857_1000142494 | 294 |
| 160 | 3300009094 | Ga0111539_10043138 | Ga0111539_100431382 | 294 |
| 161 | 3300009098 | Ga0105245_10001804 | Ga0105245_1000180411 | 294 |
| 162 | 3300009174 | Ga0105241_10012868 | Ga0105241_100128684 | 294 |
| 163 | 3300013104 | Ga0157370_10082723 | Ga0157370_100827233 | 294 |
| 164 | 3300025926 | Ga0207659_10136197 | Ga0207659_101361973 | 294 |
| 165 | 3300026089 | Ga0207648_10030744 | Ga0207648_100307444 | 294 |
| 166 | 3300026116 | Ga0207674_10021680 | Ga0207674_100216806 | 294 |
| 167 | 3300031852 | Ga0307410_10002430 | Ga0307410_100024305 | 294 |
| 168 | 3300031901 | Ga0307406_10186025 | Ga0307406_101860252 | 294 |
| 169 | 3300031995 | Ga0307409_100063613 | Ga0307409_1000636133 | 294 |
| 170 | 3300032005 | Ga0307411_10084639 | Ga0307411_100846393 | 294 |
| 171 | 3300037853 | Ga0436364_1332114 | Ga0436364_1332114_974_1894 | 294 |
| 172 | 3300047315 | Ga0495581_0153730 | Ga0495581_0153730_169_1125 | 294 |
| 173 | 3300047471 | Ga0495684_0036199 | Ga0495684_0036199_2778_3734 | 294 |
| 174 | 3300005459 | Ga0068867_100299750 | Ga0068867_1002997502 | 296 |
| 175 | 3300005843 | Ga0068860_100061738 | Ga0068860_1000617383 | 296 |
| 176 | 3300006844 | Ga0075428_100008733 | Ga0075428_10000873311 | 296 |
| 177 | 3300006881 | Ga0068865_100122851 | Ga0068865_1001228512 | 296 |
| 178 | 3300009148 | Ga0105243_10008647 | Ga0105243_100086472 | 296 |
| 179 | 3300009174 | Ga0105241_10282502 | Ga0105241_102825022 | 296 |
| 180 | 3300013297 | Ga0157378_10144915 | Ga0157378_101449152 | 296 |
| 181 | 3300025933 | Ga0207706_10049448 | Ga0207706_100494483 | 296 |
| 182 | 3300025940 | Ga0207691_10046652 | Ga0207691_100466523 | 296 |
| 183 | 3300026089 | Ga0207648_10136587 | Ga0207648_101365872 | 296 |
| 184 | 3300028381 | Ga0268264_10298648 | Ga0268264_102986481 | 296 |
| 185 | 3300046460 | Ga0495638_0000526 | Ga0495638_0000526_9292_10182 | 296 |
| 186 | 3300046528 | Ga0495642_0008250 | Ga0495642_0008250_1772_2662 | 296 |
| 187 | 3300048921 | Ga0496118_0110485 | Ga0496118_0110485_766_1656 | 296 |
| 188 | iso_pu_bacteria | 2576861471 | 2578456972 | 296 |
| 189 | iso_pu_bacteria | 2941475908 | 2941478747 | 296 |
| 190 | iso_pu_bacteria | 2941489479 | 2941492614 | 296 |
| 191 | iso_pu_bacteria | 2987605356 | 2987608822 | 296 |
| 192 | iso_pu_bacteria | 2995948881 | 2995949724 | 296 |
| 193 | 3300003203 | JGI25406J46586_10015012 | JGI25406J46586_100150123 | 297 |
| 194 | 3300003773 | Ga0055537_1001615 | Ga0055537_10016159 | 297 |
| 195 | 3300005435 | Ga0070714_100000025 | Ga0070714_10000002541 | 297 |
| 196 | 3300005536 | Ga0070697_100053485 | Ga0070697_1000534852 | 297 |
| 197 | 3300006051 | Ga0075364_10061999 | Ga0075364_100619992 | 297 |
| 198 | 3300006844 | Ga0075428_100002309 | Ga0075428_10000230923 | 297 |
| 199 | 3300006846 | Ga0075430_100065318 | Ga0075430_1000653183 | 297 |
| 200 | 3300006847 | Ga0075431_100013904 | Ga0075431_1000139046 | 297 |
| 201 | 3300009094 | Ga0111539_10063244 | Ga0111539_100632442 | 297 |
| 202 | 3300009147 | Ga0114129_10001539 | Ga0114129_1000153914 | 297 |
| 203 | 3300009147 | Ga0114129_10014853 | Ga0114129_100148539 | 297 |
| 204 | 3300009177 | Ga0105248_10262904 | Ga0105248_102629042 | 297 |
| 205 | 3300009551 | Ga0105238_10002948 | Ga0105238_100029487 | 297 |
| 206 | 3300009553 | Ga0105249_10030480 | Ga0105249_100304805 | 297 |
| 207 | 3300010375 | Ga0105239_10319165 | Ga0105239_103191651 | 297 |
| 208 | 3300013102 | Ga0157371_10182732 | Ga0157371_101827321 | 297 |
| 209 | 3300013105 | Ga0157369_10030897 | Ga0157369_100308973 | 297 |
| 210 | 3300013105 | Ga0157369_10196583 | Ga0157369_101965832 | 297 |
| 211 | 3300013306 | Ga0163162_10009246 | Ga0163162_100092465 | 297 |
| 212 | 3300013308 | Ga0157375_10389508 | Ga0157375_103895082 | 297 |
| 213 | 3300014325 | Ga0163163_10091541 | Ga0163163_100915413 | 297 |
| 214 | 3300014326 | Ga0157380_10033964 | Ga0157380_100339642 | 297 |
| 215 | 3300025929 | Ga0207664_10000071 | Ga0207664_1000007198 | 297 |
| 216 | 3300025972 | Ga0207668_10018373 | Ga0207668_100183732 | 297 |
| 217 | 3300026121 | Ga0207683_10232436 | Ga0207683_102324362 | 297 |
| 218 | 3300032126 | Ga0307415_100354786 | Ga0307415_1003547862 | 297 |
| 219 | 3300045051 | Ga0451576_0049273 | Ga0451576_0049273_28_921 | 297 |
| 220 | 3300046458 | Ga0495591_013499 | Ga0495591_013499_1823_2716 | 297 |
| 221 | 3300046681 | Ga0495647_0087280 | Ga0495647_0087280_365_1258 | 297 |
| 222 | 3300048915 | Ga0496112_0204691 | Ga0496112_0204691_164_1057 | 297 |
| 223 | 3300048921 | Ga0496118_0007889 | Ga0496118_0007889_2881_3774 | 297 |
| 224 | 3300048921 | Ga0496118_0088913 | Ga0496118_0088913_1227_2120 | 297 |
| 225 | 3300048925 | Ga0496122_0126649 | Ga0496122_0126649_463_1356 | 297 |
| 226 | 3300049570 | Ga0501033_0024833 | Ga0501033_0024833_3031_3924 | 297 |
| 227 | 3300049570 | Ga0501033_0063173 | Ga0501033_0063173_587_1480 | 297 |
| 228 | 3300049572 | Ga0501036_0350644 | Ga0501036_0350644_221_1114 | 297 |
| 229 | 3300049575 | Ga0501039_0045023 | Ga0501039_0045023_812_1705 | 297 |
| 230 | 3300049578 | Ga0501042_0364241 | Ga0501042_0364241_80_973 | 297 |
| 231 | 3300049585 | Ga0501069_0004963 | Ga0501069_0004963_1762_2655 | 297 |
| 232 | 3300049586 | Ga0501070_0397768 | Ga0501070_0397768_50_943 | 297 |
| 233 | 3300049588 | Ga0501072_0019466 | Ga0501072_0019466_1512_2405 | 297 |
| 234 | 3300049589 | Ga0501073_0080842 | Ga0501073_0080842_1060_1953 | 297 |
| 235 | 3300049590 | Ga0501074_0011170 | Ga0501074_0011170_4273_5166 | 297 |
| 236 | 3300049590 | Ga0501074_0056693 | Ga0501074_0056693_1434_2327 | 297 |
| 237 | 3300049592 | Ga0501076_0001011 | Ga0501076_0001011_3904_4797 | 297 |
| 238 | 3300049593 | Ga0501077_0004162 | Ga0501077_0004162_38_931 | 297 |
| 239 | 3300049741 | Ga0501079_0251816 | Ga0501079_0251816_113_1006 | 297 |
| 240 | 3300049742 | Ga0501080_0030603 | Ga0501080_0030603_2934_3827 | 297 |
| 241 | 3300049743 | Ga0501081_0002043 | Ga0501081_0002043_4565_5458 | 297 |
| 242 | 3300049822 | Ga0501035_0020150 | Ga0501035_0020150_2032_2925 | 297 |
| 243 | 3300049823 | Ga0501044_0481197 | Ga0501044_0481197_182_1075 | 297 |
| 244 | 3300050507 | nmdc:mga05p37_22411_c1 | nmdc:mga05p37_22411_c1_3626_4519 | 297 |
| 245 | 3300050508 | nmdc:mga09592_1422_c1 | nmdc:mga09592_1422_c1_5298_6191 | 297 |
| 246 | 3300050508 | nmdc:mga09592_170495_c1 | nmdc:mga09592_170495_c1_226_1119 | 297 |
| 247 | 3300050509 | nmdc:mga0qj67_25287_c1 | nmdc:mga0qj67_25287_c1_2681_3574 | 297 |
| 248 | 3300050510 | nmdc:mga06r32_20879_c1 | nmdc:mga06r32_20879_c1_2001_2894 | 297 |
| 249 | 3300050510 | nmdc:mga06r32_247156_c1 | nmdc:mga06r32_247156_c1_47_940 | 297 |
| 250 | 3300050511 | nmdc:mga08y16_123927_c1 | nmdc:mga08y16_123927_c1_1274_2167 | 297 |
| 251 | 3300050515 | nmdc:mga0a205_113774_c1 | nmdc:mga0a205_113774_c1_1014_1907 | 297 |
| 252 | 3300060353 | Ga0501082_0334484 | Ga0501082_0334484_381_1274 | 297 |
| 253 | 3300061734 | Ga0530510_0002588 | Ga0530510_0002588_323_1216 | 297 |
| 254 | iso_pu_bacteria | 2537561836 | 2538835230 | 297 |
| 255 | iso_pu_bacteria | 2547132130 | 2547503584 | 297 |
| 256 | iso_pu_bacteria | 2643221562 | 2643828613 | 297 |
| 257 | iso_pu_bacteria | 2643221577 | 2643896244 | 297 |
| 258 | iso_pu_bacteria | 2643221579 | 2643909325 | 297 |
| 259 | iso_pu_bacteria | 2643221581 | 2643914826 | 297 |
| 260 | iso_pu_bacteria | 2643221593 | 2643973271 | 297 |
| 261 | iso_pu_bacteria | 2643221685 | 2644478458 | 297 |
| 262 | iso_pu_bacteria | 2687453130 | 2687582201 | 297 |
| 263 | iso_pu_bacteria | 2747842428 | 2747949938 | 297 |
| 264 | iso_pu_bacteria | 2747842501 | 2748019670 | 297 |
| 265 | iso_pu_bacteria | 2765235840 | 2765580534 | 297 |
| 266 | iso_pu_bacteria | 2816332141 | 2816518442 | 297 |
| 267 | iso_pu_bacteria | 2842391507 | 2842394449 | 297 |
| 268 | iso_pu_bacteria | 2852684882 | 2852687184 | 297 |
| 269 | iso_pu_bacteria | 2857442823 | 2857446854 | 297 |
| 270 | iso_pu_bacteria | 2874220319 | 2874223197 | 297 |
| 271 | iso_pu_bacteria | 2884411467 | 2884414161 | 297 |
| 272 | iso_pu_bacteria | 2895395659 | 2895397974 | 297 |
| 273 | iso_pu_bacteria | 2919089067 | 2919093232 | 297 |
| 274 | iso_pu_bacteria | 2919130084 | 2919131059 | 297 |
| 275 | iso_pu_bacteria | 2919134579 | 2919138747 | 297 |
| 276 | iso_pu_bacteria | 2923516293 | 2923517265 | 297 |
| 277 | iso_pu_bacteria | 2928496128 | 2928499863 | 297 |
| 278 | iso_pu_bacteria | 2928963466 | 2928963689 | 297 |
| 279 | iso_pu_bacteria | 2929195423 | 2929196299 | 297 |
| 280 | iso_pu_bacteria | 2931380184 | 2931383366 | 297 |
| 281 | iso_pu_bacteria | 2937610967 | 2937614339 | 297 |
| 282 | iso_pu_bacteria | 2939589442 | 2939589835 | 297 |
| 283 | iso_pu_bacteria | 2939611941 | 2939613570 | 297 |
| 284 | iso_pu_bacteria | 2939626828 | 2939630929 | 297 |
| 285 | iso_pu_bacteria | 2952252522 | 2952255999 | 297 |
| 286 | iso_pu_bacteria | 2961047084 | 2961049961 | 297 |
| 287 | iso_pu_bacteria | 2961064222 | 2961064876 | 297 |
| 288 | iso_pu_bacteria | 2974307012 | 2974307620 | 297 |
| 289 | iso_pu_bacteria | 2977247770 | 2977248331 | 297 |
| 290 | iso_pu_bacteria | 2984514374 | 2984517176 | 297 |
| 291 | iso_pu_bacteria | 8021622325 | 8021625567 | 297 |
| 292 | iso_pu_bacteria | 8021626552 | 8021630554 | 297 |
| 293 | iso_pu_bacteria | 8021648035 | 8021649736 | 297 |
| 294 | 3300005338 | Ga0068868_100169688 | Ga0068868_1001696882 | 298 |
| 295 | 3300005343 | Ga0070687_100100108 | Ga0070687_1001001082 | 298 |
| 296 | 3300005347 | Ga0070668_100297144 | Ga0070668_1002971442 | 298 |
| 297 | 3300005365 | Ga0070688_100213269 | Ga0070688_1002132691 | 298 |
| 298 | 3300005544 | Ga0070686_100193262 | Ga0070686_1001932622 | 298 |
| 299 | 3300005549 | Ga0070704_100071046 | Ga0070704_1000710462 | 298 |
| 300 | 3300005842 | Ga0068858_100098118 | Ga0068858_1000981182 | 298 |
| 301 | 3300005985 | Ga0081539_10000105 | Ga0081539_10000105107 | 298 |
| 302 | 3300006844 | Ga0075428_100713931 | Ga0075428_1007139311 | 298 |
| 303 | 3300009147 | Ga0114129_10148798 | Ga0114129_101487982 | 298 |
| 304 | 3300009148 | Ga0105243_10011470 | Ga0105243_100114704 | 298 |
| 305 | 3300009176 | Ga0105242_10007241 | Ga0105242_100072418 | 298 |
| 306 | 3300013297 | Ga0157378_10562746 | Ga0157378_105627461 | 298 |
| 307 | 3300014326 | Ga0157380_10299929 | Ga0157380_102999291 | 298 |
| 308 | 3300017792 | Ga0163161_10184246 | Ga0163161_101842462 | 298 |
| 309 | 3300021388 | Ga0213875_10049732 | Ga0213875_100497322 | 298 |
| 310 | 3300025899 | Ga0207642_10161387 | Ga0207642_101613871 | 298 |
| 311 | 3300026118 | Ga0207675_100031644 | Ga0207675_1000316444 | 298 |
| 312 | 3300028380 | Ga0268265_10566371 | Ga0268265_105663711 | 298 |
| 313 | 3300037853 | Ga0436364_0570527 | Ga0436364_0570527_14962_15897 | 298 |
| 314 | 3300050509 | nmdc:mga0qj67_338480_c1 | nmdc:mga0qj67_338480_c1_54_950 | 298 |
| 315 | 3300053085 | Ga0495619_0040301 | Ga0495619_0040301_149_1051 | 298 |
| 316 | 3300001990 | JGI24737J22298_10016551 | JGI24737J22298_100165512 | 300 |
| 317 | 3300003771 | Ga0055526_1000005 | Ga0055526_1000005239 | 300 |
| 318 | 3300003773 | Ga0055537_1000042 | Ga0055537_100004291 | 300 |
| 319 | 3300003775 | Ga0055524_1000005 | Ga0055524_1000005240 | 300 |
| 320 | 3300003784 | Ga0055534_1000002 | Ga0055534_100000290 | 300 |
| 321 | 3300003790 | Ga0055528_1000002 | Ga0055528_100000290 | 300 |
| 322 | 3300005327 | Ga0070658_10122941 | Ga0070658_101229412 | 300 |
| 323 | 3300005328 | Ga0070676_10002175 | Ga0070676_100021753 | 300 |
| 324 | 3300005334 | Ga0068869_100000848 | Ga0068869_1000008483 | 300 |
| 325 | 3300005338 | Ga0068868_100000154 | Ga0068868_10000015420 | 300 |
| 326 | 3300005364 | Ga0070673_100000023 | Ga0070673_10000002382 | 300 |
| 327 | 3300005435 | Ga0070714_100234025 | Ga0070714_1002340252 | 300 |
| 328 | 3300005455 | Ga0070663_100001998 | Ga0070663_1000019984 | 300 |
| 329 | 3300005459 | Ga0068867_100000007 | Ga0068867_10000000724 | 300 |
| 330 | 3300005539 | Ga0068853_100025947 | Ga0068853_1000259475 | 300 |
| 331 | 3300005578 | Ga0068854_100000027 | Ga0068854_1000000273 | 300 |
| 332 | 3300005578 | Ga0068854_100368849 | Ga0068854_1003688492 | 300 |
| 333 | 3300005718 | Ga0068866_10036810 | Ga0068866_100368102 | 300 |
| 334 | 3300006237 | Ga0097621_100002061 | Ga0097621_1000020618 | 300 |
| 335 | 3300006358 | Ga0068871_100002074 | Ga0068871_1000020748 | 300 |
| 336 | 3300006881 | Ga0068865_100000010 | Ga0068865_100000010156 | 300 |
| 337 | 3300009098 | Ga0105245_10056362 | Ga0105245_100563622 | 300 |
| 338 | 3300009148 | Ga0105243_10000950 | Ga0105243_1000095024 | 300 |
| 339 | 3300009174 | Ga0105241_10011546 | Ga0105241_100115463 | 300 |
| 340 | 3300009176 | Ga0105242_10000210 | Ga0105242_1000021024 | 300 |
| 341 | 3300009553 | Ga0105249_10017303 | Ga0105249_100173036 | 300 |
| 342 | 3300009993 | Ga0105028_101804 | Ga0105028_1018042 | 300 |
| 343 | 3300010375 | Ga0105239_10004123 | Ga0105239_1000412311 | 300 |
| 344 | 3300013102 | Ga0157371_10000397 | Ga0157371_1000039726 | 300 |
| 345 | 3300013296 | Ga0157374_10000830 | Ga0157374_1000083024 | 300 |
| 346 | 3300013297 | Ga0157378_10001477 | Ga0157378_1000147717 | 300 |
| 347 | 3300013308 | Ga0157375_10002120 | Ga0157375_1000212013 | 300 |
| 348 | 3300014745 | Ga0157377_10014848 | Ga0157377_100148484 | 300 |
| 349 | 3300014969 | Ga0157376_10000047 | Ga0157376_1000004724 | 300 |
| 350 | 3300015261 | Ga0182006_1012948 | Ga0182006_10129484 | 300 |
| 351 | 3300015262 | Ga0182007_10000079 | Ga0182007_1000007917 | 300 |
| 352 | 3300015265 | Ga0182005_1000166 | Ga0182005_10001669 | 300 |
| 353 | 3300015689 | Ga0183360_10002 | Ga0183360_10002856 | 300 |
| 354 | 3300024227 | Ga0228598_1013405 | Ga0228598_10134052 | 300 |
| 355 | 3300025263 | Ga0209565_1000001 | Ga0209565_1000001546 | 300 |
| 356 | 3300025273 | Ga0209673_1000001 | Ga0209673_1000001546 | 300 |
| 357 | 3300025291 | Ga0209675_1000001 | Ga0209675_10000011986 | 300 |
| 358 | 3300025295 | Ga0209564_1000001 | Ga0209564_10000012148 | 300 |
| 359 | 3300025299 | Ga0209256_1000006 | Ga0209256_1000006584 | 300 |
| 360 | 3300025907 | Ga0207645_10009242 | Ga0207645_100092423 | 300 |
| 361 | 3300025909 | Ga0207705_10059428 | Ga0207705_100594282 | 300 |
| 362 | 3300025911 | Ga0207654_10024425 | Ga0207654_100244252 | 300 |
| 363 | 3300025927 | Ga0207687_10008258 | Ga0207687_100082582 | 300 |
| 364 | 3300025934 | Ga0207686_10000598 | Ga0207686_100005984 | 300 |
| 365 | 3300025935 | Ga0207709_10000050 | Ga0207709_10000050227 | 300 |
| 366 | 3300025938 | Ga0207704_10000020 | Ga0207704_10000020137 | 300 |
| 367 | 3300025942 | Ga0207689_10001541 | Ga0207689_1000154110 | 300 |
| 368 | 3300025960 | Ga0207651_10000005 | Ga0207651_1000000524 | 300 |
| 369 | 3300025961 | Ga0207712_10021212 | Ga0207712_100212122 | 300 |
| 370 | 3300025981 | Ga0207640_10000145 | Ga0207640_1000014539 | 300 |
| 371 | 3300026023 | Ga0207677_10000373 | Ga0207677_100003734 | 300 |
| 372 | 3300026041 | Ga0207639_10007809 | Ga0207639_100078092 | 300 |
| 373 | 3300026067 | Ga0207678_10005889 | Ga0207678_100058894 | 300 |
| 374 | 3300026089 | Ga0207648_10000017 | Ga0207648_10000017137 | 300 |
| 375 | 3300037853 | Ga0436364_0714734 | Ga0436364_0714734_963_1946 | 300 |
| 376 | 3300044712 | Ga0453684_0671748 | Ga0453684_0671748_63_983 | 300 |
| 377 | 3300045051 | Ga0451576_0386162 | Ga0451576_0386162_231_1151 | 300 |
| 378 | 3300046525 | Ga0495663_0003358 | Ga0495663_0003358_3082_3996 | 300 |
| 379 | 3300046525 | Ga0495663_0004265 | Ga0495663_0004265_2689_3591 | 300 |
| 380 | 3300046558 | Ga0495633_0005215 | Ga0495633_0005215_6559_7461 | 300 |
| 381 | 3300048907 | Ga0496104_0013159 | Ga0496104_0013159_3742_4644 | 300 |
| 382 | 3300048919 | Ga0496116_0013614 | Ga0496116_0013614_2038_2940 | 300 |
| 383 | 3300048919 | Ga0496116_0014949 | Ga0496116_0014949_2038_2940 | 300 |
| 384 | 3300048920 | Ga0496117_0069791 | Ga0496117_0069791_1387_2289 | 300 |
| 385 | 3300048921 | Ga0496118_0058708 | Ga0496118_0058708_1396_2304 | 300 |
| 386 | 3300048922 | Ga0496119_0000711 | Ga0496119_0000711_25212_26114 | 300 |
| 387 | 3300048922 | Ga0496119_0046818 | Ga0496119_0046818_35_937 | 300 |
| 388 | 3300048923 | Ga0496120_0000727 | Ga0496120_0000727_28620_29522 | 300 |
| 389 | 3300048924 | Ga0496121_0005121 | Ga0496121_0005121_4813_5715 | 300 |
| 390 | 3300048924 | Ga0496121_0043735 | Ga0496121_0043735_2016_2918 | 300 |
| 391 | 3300048925 | Ga0496122_0001140 | Ga0496122_0001140_39777_40685 | 300 |
| 392 | 3300048925 | Ga0496122_0014529 | Ga0496122_0014529_4029_4931 | 300 |
| 393 | 3300048926 | Ga0496123_0000942 | Ga0496123_0000942_39619_40527 | 300 |
| 394 | 3300048927 | Ga0496124_0003834 | Ga0496124_0003834_5601_6503 | 300 |
| 395 | 3300048927 | Ga0496124_0089185 | Ga0496124_0089185_1419_2321 | 300 |
| 396 | 3300048928 | Ga0496125_0000722 | Ga0496125_0000722_2657_3559 | 300 |
| 397 | 3300048928 | Ga0496125_0013105 | Ga0496125_0013105_4598_5500 | 300 |
| 398 | 3300048928 | Ga0496125_0018451 | Ga0496125_0018451_4672_5586 | 300 |
| 399 | 3300048928 | Ga0496125_0035604 | Ga0496125_0035604_1369_2271 | 300 |
| 400 | 3300048929 | Ga0496126_0003861 | Ga0496126_0003861_12027_12929 | 300 |
| 401 | 3300053148 | Ga0500590_000735 | Ga0500590_000735_6379_7356 | 300 |
| 402 | 3300001979 | JGI24740J21852_10000230 | JGI24740J21852_1000023010 | 301 |
| 403 | 3300002705 | JGI25156J39149_1006824 | JGI25156J39149_10068244 | 301 |
| 404 | 3300002737 | JGI25162J39368_1000653 | JGI25162J39368_100065318 | 301 |
| 405 | 3300002737 | JGI25162J39368_1001259 | JGI25162J39368_10012597 | 301 |
| 406 | 3300002737 | JGI25162J39368_1001943 | JGI25162J39368_100194310 | 301 |
| 407 | 3300002737 | JGI25162J39368_1005494 | JGI25162J39368_10054942 | 301 |
| 408 | 3300002741 | JGI25157J39369_1002739 | JGI25157J39369_10027391 | 301 |
| 409 | 3300002741 | JGI25157J39369_1003624 | JGI25157J39369_10036244 | 301 |
| 410 | 3300002772 | JGI25164J39214_1000473 | JGI25164J39214_10004733 | 301 |
| 411 | 3300002772 | JGI25164J39214_1000490 | JGI25164J39214_100049017 | 301 |
| 412 | 3300002773 | JGI25152J39213_1000103 | JGI25152J39213_100010315 | 301 |
| 413 | 3300002774 | JGI25150J39212_1000183 | JGI25150J39212_100018317 | 301 |
| 414 | 3300003187 | JGI25151J46595_10000187 | JGI25151J46595_100001876 | 301 |
| 415 | 3300003187 | JGI25151J46595_10000271 | JGI25151J46595_1000027136 | 301 |
| 416 | 3300003214 | JGI25165J46597_1000625 | JGI25165J46597_100062511 | 301 |
| 417 | 3300003215 | JGI25153J46596_10000190 | JGI25153J46596_1000019036 | 301 |
| 418 | 3300003756 | Ga0055533_1000962 | Ga0055533_10009627 | 301 |
| 419 | 3300003762 | Ga0055542_1000010 | Ga0055542_1000010115 | 301 |
| 420 | 3300003763 | Ga0055529_1001798 | Ga0055529_10017982 | 301 |
| 421 | 3300003781 | Ga0055536_1000773 | Ga0055536_10007732 | 301 |
| 422 | 3300003791 | Ga0055530_10002647 | Ga0055530_100026474 | 301 |
| 423 | 3300003856 | Ga0058692_1000053 | Ga0058692_100005377 | 301 |
| 424 | 3300003856 | Ga0058692_1000065 | Ga0058692_100006541 | 301 |
| 425 | 3300004803 | Ga0058862_12823758 | Ga0058862_128237581 | 301 |
| 426 | 3300005288 | Ga0065714_10088992 | Ga0065714_100889922 | 301 |
| 427 | 3300005293 | Ga0065715_10005079 | Ga0065715_100050794 | 301 |
| 428 | 3300005295 | Ga0065707_10092011 | Ga0065707_100920112 | 301 |
| 429 | 3300005327 | Ga0070658_10136650 | Ga0070658_101366502 | 301 |
| 430 | 3300005328 | Ga0070676_10004260 | Ga0070676_100042604 | 301 |
| 431 | 3300005329 | Ga0070683_100058119 | Ga0070683_1000581193 | 301 |
| 432 | 3300005329 | Ga0070683_100102372 | Ga0070683_1001023722 | 301 |
| 433 | 3300005331 | Ga0070670_100120801 | Ga0070670_1001208012 | 301 |
| 434 | 3300005331 | Ga0070670_100295628 | Ga0070670_1002956281 | 301 |
| 435 | 3300005334 | Ga0068869_100005518 | Ga0068869_10000551812 | 301 |
| 436 | 3300005334 | Ga0068869_100178597 | Ga0068869_1001785972 | 301 |
| 437 | 3300005336 | Ga0070680_100000138 | Ga0070680_10000013813 | 301 |
| 438 | 3300005336 | Ga0070680_100019130 | Ga0070680_1000191303 | 301 |
| 439 | 3300005336 | Ga0070680_100026845 | Ga0070680_1000268453 | 301 |
| 440 | 3300005336 | Ga0070680_100065060 | Ga0070680_1000650602 | 301 |
| 441 | 3300005336 | Ga0070680_100249030 | Ga0070680_1002490302 | 301 |
| 442 | 3300005337 | Ga0070682_100004912 | Ga0070682_1000049126 | 301 |
| 443 | 3300005337 | Ga0070682_100013413 | Ga0070682_1000134134 | 301 |
| 444 | 3300005337 | Ga0070682_100183929 | Ga0070682_1001839292 | 301 |
| 445 | 3300005339 | Ga0070660_100355517 | Ga0070660_1003555171 | 301 |
| 446 | 3300005340 | Ga0070689_100006130 | Ga0070689_1000061302 | 301 |
| 447 | 3300005341 | Ga0070691_10000204 | Ga0070691_100002045 | 301 |
| 448 | 3300005341 | Ga0070691_10047295 | Ga0070691_100472952 | 301 |
| 449 | 3300005343 | Ga0070687_100001734 | Ga0070687_1000017344 | 301 |
| 450 | 3300005344 | Ga0070661_100014313 | Ga0070661_1000143133 | 301 |
| 451 | 3300005344 | Ga0070661_100019362 | Ga0070661_1000193622 | 301 |
| 452 | 3300005344 | Ga0070661_100022768 | Ga0070661_1000227682 | 301 |
| 453 | 3300005344 | Ga0070661_100137945 | Ga0070661_1001379451 | 301 |
| 454 | 3300005344 | Ga0070661_100221607 | Ga0070661_1002216072 | 301 |
| 455 | 3300005344 | Ga0070661_100505846 | Ga0070661_1005058461 | 301 |
| 456 | 3300005345 | Ga0070692_10000826 | Ga0070692_100008265 | 301 |
| 457 | 3300005345 | Ga0070692_10001376 | Ga0070692_100013763 | 301 |
| 458 | 3300005345 | Ga0070692_10024606 | Ga0070692_100246062 | 301 |
| 459 | 3300005347 | Ga0070668_100002627 | Ga0070668_1000026274 | 301 |
| 460 | 3300005347 | Ga0070668_100005675 | Ga0070668_1000056753 | 301 |
| 461 | 3300005353 | Ga0070669_100016734 | Ga0070669_1000167345 | 301 |
| 462 | 3300005354 | Ga0070675_100051402 | Ga0070675_1000514023 | 301 |
| 463 | 3300005355 | Ga0070671_100020254 | Ga0070671_1000202544 | 301 |
| 464 | 3300005365 | Ga0070688_100015057 | Ga0070688_1000150571 | 301 |
| 465 | 3300005366 | Ga0070659_100004369 | Ga0070659_10000436911 | 301 |
| 466 | 3300005366 | Ga0070659_100005005 | Ga0070659_1000050054 | 301 |
| 467 | 3300005366 | Ga0070659_100014512 | Ga0070659_1000145122 | 301 |
| 468 | 3300005367 | Ga0070667_100023098 | Ga0070667_1000230983 | 301 |
| 469 | 3300005367 | Ga0070667_100059611 | Ga0070667_1000596113 | 301 |
| 470 | 3300005435 | Ga0070714_100002188 | Ga0070714_1000021888 | 301 |
| 471 | 3300005436 | Ga0070713_100003658 | Ga0070713_1000036585 | 301 |
| 472 | 3300005439 | Ga0070711_100203553 | Ga0070711_1002035532 | 301 |
| 473 | 3300005440 | Ga0070705_100176800 | Ga0070705_1001768002 | 301 |
| 474 | 3300005441 | Ga0070700_100022316 | Ga0070700_1000223162 | 301 |
| 475 | 3300005455 | Ga0070663_100003552 | Ga0070663_1000035522 | 301 |
| 476 | 3300005455 | Ga0070663_100011137 | Ga0070663_1000111372 | 301 |
| 477 | 3300005455 | Ga0070663_100030594 | Ga0070663_1000305943 | 301 |
| 478 | 3300005456 | Ga0070678_100015225 | Ga0070678_1000152251 | 301 |
| 479 | 3300005456 | Ga0070678_100040799 | Ga0070678_1000407992 | 301 |
| 480 | 3300005457 | Ga0070662_100007688 | Ga0070662_1000076883 | 301 |
| 481 | 3300005457 | Ga0070662_100055165 | Ga0070662_1000551652 | 301 |
| 482 | 3300005457 | Ga0070662_100095797 | Ga0070662_1000957972 | 301 |
| 483 | 3300005457 | Ga0070662_100105335 | Ga0070662_1001053351 | 301 |
| 484 | 3300005457 | Ga0070662_100356393 | Ga0070662_1003563931 | 301 |
| 485 | 3300005458 | Ga0070681_10000076 | Ga0070681_1000007623 | 301 |
| 486 | 3300005458 | Ga0070681_10001058 | Ga0070681_100010588 | 301 |
| 487 | 3300005458 | Ga0070681_10005260 | Ga0070681_100052609 | 301 |
| 488 | 3300005458 | Ga0070681_10012818 | Ga0070681_100128183 | 301 |
| 489 | 3300005458 | Ga0070681_10051976 | Ga0070681_100519763 | 301 |
| 490 | 3300005458 | Ga0070681_10097017 | Ga0070681_100970173 | 301 |
| 491 | 3300005458 | Ga0070681_10231243 | Ga0070681_102312432 | 301 |
| 492 | 3300005466 | Ga0070685_10053205 | Ga0070685_100532052 | 301 |
| 493 | 3300005467 | Ga0070706_100075262 | Ga0070706_1000752623 | 301 |
| 494 | 3300005530 | Ga0070679_100000504 | Ga0070679_10000050416 | 301 |
| 495 | 3300005530 | Ga0070679_100005669 | Ga0070679_1000056697 | 301 |
| 496 | 3300005530 | Ga0070679_100094827 | Ga0070679_1000948273 | 301 |
| 497 | 3300005530 | Ga0070679_100229808 | Ga0070679_1002298082 | 301 |
| 498 | 3300005530 | Ga0070679_100245203 | Ga0070679_1002452032 | 301 |
| 499 | 3300005535 | Ga0070684_100142709 | Ga0070684_1001427092 | 301 |
| 500 | 3300005535 | Ga0070684_100431134 | Ga0070684_1004311342 | 301 |
| 501 | 3300005535 | Ga0070684_100608218 | Ga0070684_1006082181 | 301 |
| 502 | 3300005536 | Ga0070697_100147487 | Ga0070697_1001474872 | 301 |
| 503 | 3300005539 | Ga0068853_100026580 | Ga0068853_1000265802 | 301 |
| 504 | 3300005539 | Ga0068853_100087550 | Ga0068853_1000875502 | 301 |
| 505 | 3300005539 | Ga0068853_100241865 | Ga0068853_1002418652 | 301 |
| 506 | 3300005539 | Ga0068853_100295727 | Ga0068853_1002957271 | 301 |
| 507 | 3300005543 | Ga0070672_100003161 | Ga0070672_1000031613 | 301 |
| 508 | 3300005546 | Ga0070696_100003079 | Ga0070696_1000030792 | 301 |
| 509 | 3300005546 | Ga0070696_100015403 | Ga0070696_1000154034 | 301 |
| 510 | 3300005546 | Ga0070696_100027962 | Ga0070696_1000279623 | 301 |
| 511 | 3300005547 | Ga0070693_100014051 | Ga0070693_1000140512 | 301 |
| 512 | 3300005548 | Ga0070665_100000465 | Ga0070665_10000046545 | 301 |
| 513 | 3300005548 | Ga0070665_100237824 | Ga0070665_1002378242 | 301 |
| 514 | 3300005548 | Ga0070665_100503266 | Ga0070665_1005032661 | 301 |
| 515 | 3300005563 | Ga0068855_100000897 | Ga0068855_1000008976 | 301 |
| 516 | 3300005563 | Ga0068855_100034494 | Ga0068855_1000344942 | 301 |
| 517 | 3300005563 | Ga0068855_100059757 | Ga0068855_1000597573 | 301 |
| 518 | 3300005563 | Ga0068855_100167742 | Ga0068855_1001677421 | 301 |
| 519 | 3300005563 | Ga0068855_100192031 | Ga0068855_1001920312 | 301 |
| 520 | 3300005563 | Ga0068855_100593199 | Ga0068855_1005931991 | 301 |
| 521 | 3300005577 | Ga0068857_100019539 | Ga0068857_1000195391 | 301 |
| 522 | 3300005577 | Ga0068857_100082251 | Ga0068857_1000822512 | 301 |
| 523 | 3300005577 | Ga0068857_100120614 | Ga0068857_1001206142 | 301 |
| 524 | 3300005577 | Ga0068857_100150476 | Ga0068857_1001504762 | 301 |
| 525 | 3300005578 | Ga0068854_100000142 | Ga0068854_10000014248 | 301 |
| 526 | 3300005578 | Ga0068854_100063019 | Ga0068854_1000630192 | 301 |
| 527 | 3300005614 | Ga0068856_100000462 | Ga0068856_10000046226 | 301 |
| 528 | 3300005614 | Ga0068856_100004819 | Ga0068856_1000048193 | 301 |
| 529 | 3300005614 | Ga0068856_100025070 | Ga0068856_1000250705 | 301 |
| 530 | 3300005614 | Ga0068856_100336574 | Ga0068856_1003365741 | 301 |
| 531 | 3300005616 | Ga0068852_100112354 | Ga0068852_1001123542 | 301 |
| 532 | 3300005719 | Ga0068861_100004360 | Ga0068861_1000043607 | 301 |
| 533 | 3300005834 | Ga0068851_10026102 | Ga0068851_100261023 | 301 |
| 534 | 3300005841 | Ga0068863_100038707 | Ga0068863_1000387074 | 301 |
| 535 | 3300005842 | Ga0068858_100013390 | Ga0068858_1000133909 | 301 |
| 536 | 3300005842 | Ga0068858_100128673 | Ga0068858_1001286731 | 301 |
| 537 | 3300005843 | Ga0068860_100041224 | Ga0068860_1000412244 | 301 |
| 538 | 3300005843 | Ga0068860_100101230 | Ga0068860_1001012302 | 301 |
| 539 | 3300005844 | Ga0068862_100070914 | Ga0068862_1000709142 | 301 |
| 540 | 3300005985 | Ga0081539_10083936 | Ga0081539_100839362 | 301 |
| 541 | 3300006175 | Ga0070712_100056201 | Ga0070712_1000562012 | 301 |
| 542 | 3300006175 | Ga0070712_100218002 | Ga0070712_1002180022 | 301 |
| 543 | 3300006358 | Ga0068871_100137854 | Ga0068871_1001378542 | 301 |
| 544 | 3300006844 | Ga0075428_100415922 | Ga0075428_1004159222 | 301 |
| 545 | 3300006852 | Ga0075433_10039496 | Ga0075433_100394963 | 301 |
| 546 | 3300006871 | Ga0075434_100007756 | Ga0075434_1000077567 | 301 |
| 547 | 3300006871 | Ga0075434_100048328 | Ga0075434_1000483286 | 301 |
| 548 | 3300006880 | Ga0075429_100055515 | Ga0075429_1000555153 | 301 |
| 549 | 3300006881 | Ga0068865_100007765 | Ga0068865_1000077652 | 301 |
| 550 | 3300009093 | Ga0105240_10000049 | Ga0105240_1000004939 | 301 |
| 551 | 3300009093 | Ga0105240_10000113 | Ga0105240_1000011374 | 301 |
| 552 | 3300009093 | Ga0105240_10002816 | Ga0105240_1000281617 | 301 |
| 553 | 3300009093 | Ga0105240_10069114 | Ga0105240_100691142 | 301 |
| 554 | 3300009093 | Ga0105240_10081693 | Ga0105240_100816934 | 301 |
| 555 | 3300009093 | Ga0105240_10228162 | Ga0105240_102281622 | 301 |
| 556 | 3300009093 | Ga0105240_10680974 | Ga0105240_106809741 | 301 |
| 557 | 3300009094 | Ga0111539_10565172 | Ga0111539_105651722 | 301 |
| 558 | 3300009098 | Ga0105245_10062002 | Ga0105245_100620022 | 301 |
| 559 | 3300009148 | Ga0105243_10004757 | Ga0105243_100047576 | 301 |
| 560 | 3300009174 | Ga0105241_10013711 | Ga0105241_100137114 | 301 |
| 561 | 3300009177 | Ga0105248_10057736 | Ga0105248_100577364 | 301 |
| 562 | 3300009545 | Ga0105237_10000230 | Ga0105237_1000023053 | 301 |
| 563 | 3300009545 | Ga0105237_10284515 | Ga0105237_102845152 | 301 |
| 564 | 3300009545 | Ga0105237_10362694 | Ga0105237_103626941 | 301 |
| 565 | 3300009551 | Ga0105238_10041071 | Ga0105238_100410713 | 301 |
| 566 | 3300009551 | Ga0105238_10143947 | Ga0105238_101439471 | 301 |
| 567 | 3300009553 | Ga0105249_10000195 | Ga0105249_1000019540 | 301 |
| 568 | 3300009553 | Ga0105249_10007619 | Ga0105249_100076194 | 301 |
| 569 | 3300009553 | Ga0105249_10135624 | Ga0105249_101356243 | 301 |
| 570 | 3300009553 | Ga0105249_10294373 | Ga0105249_102943732 | 301 |
| 571 | 3300009979 | Ga0105032_101587 | Ga0105032_1015873 | 301 |
| 572 | 3300010375 | Ga0105239_10000034 | Ga0105239_100000341 | 301 |
| 573 | 3300010375 | Ga0105239_10095696 | Ga0105239_100956963 | 301 |
| 574 | 3300010375 | Ga0105239_10299995 | Ga0105239_102999951 | 301 |
| 575 | 3300010375 | Ga0105239_10485188 | Ga0105239_104851882 | 301 |
| 576 | 3300013100 | Ga0157373_10098054 | Ga0157373_100980542 | 301 |
| 577 | 3300013102 | Ga0157371_10019340 | Ga0157371_100193403 | 301 |
| 578 | 3300013102 | Ga0157371_10070140 | Ga0157371_100701402 | 301 |
| 579 | 3300013102 | Ga0157371_10236816 | Ga0157371_102368161 | 301 |
| 580 | 3300013104 | Ga0157370_10010248 | Ga0157370_100102489 | 301 |
| 581 | 3300013104 | Ga0157370_10024020 | Ga0157370_100240207 | 301 |
| 582 | 3300013104 | Ga0157370_10025407 | Ga0157370_100254071 | 301 |
| 583 | 3300013104 | Ga0157370_10035718 | Ga0157370_100357183 | 301 |
| 584 | 3300013104 | Ga0157370_10189137 | Ga0157370_101891373 | 301 |
| 585 | 3300013105 | Ga0157369_10045576 | Ga0157369_100455762 | 301 |
| 586 | 3300013105 | Ga0157369_10054676 | Ga0157369_100546764 | 301 |
| 587 | 3300013105 | Ga0157369_10219655 | Ga0157369_102196552 | 301 |
| 588 | 3300013105 | Ga0157369_10248017 | Ga0157369_102480171 | 301 |
| 589 | 3300013296 | Ga0157374_10002660 | Ga0157374_1000266011 | 301 |
| 590 | 3300013296 | Ga0157374_10079124 | Ga0157374_100791242 | 301 |
| 591 | 3300013297 | Ga0157378_10013933 | Ga0157378_100139336 | 301 |
| 592 | 3300013306 | Ga0163162_10000015 | Ga0163162_1000001557 | 301 |
| 593 | 3300013306 | Ga0163162_10033700 | Ga0163162_100337004 | 301 |
| 594 | 3300013306 | Ga0163162_10072625 | Ga0163162_100726252 | 301 |
| 595 | 3300013307 | Ga0157372_10008269 | Ga0157372_100082692 | 301 |
| 596 | 3300013307 | Ga0157372_10022871 | Ga0157372_100228713 | 301 |
| 597 | 3300013307 | Ga0157372_10047515 | Ga0157372_100475151 | 301 |
| 598 | 3300013307 | Ga0157372_10070446 | Ga0157372_100704462 | 301 |
| 599 | 3300013307 | Ga0157372_10122484 | Ga0157372_101224842 | 301 |
| 600 | 3300013308 | Ga0157375_10156411 | Ga0157375_101564111 | 301 |
| 601 | 3300013308 | Ga0157375_10663712 | Ga0157375_106637121 | 301 |
| 602 | 3300014325 | Ga0163163_10000205 | Ga0163163_1000020543 | 301 |
| 603 | 3300014497 | Ga0182008_10048966 | Ga0182008_100489662 | 301 |
| 604 | 3300014497 | Ga0182008_10069164 | Ga0182008_100691642 | 301 |
| 605 | 3300014968 | Ga0157379_10367839 | Ga0157379_103678392 | 301 |
| 606 | 3300014969 | Ga0157376_10112995 | Ga0157376_101129952 | 301 |
| 607 | 3300014969 | Ga0157376_10261459 | Ga0157376_102614592 | 301 |
| 608 | 3300015261 | Ga0182006_1032508 | Ga0182006_10325082 | 301 |
| 609 | 3300015261 | Ga0182006_1033197 | Ga0182006_10331972 | 301 |
| 610 | 3300015262 | Ga0182007_10003052 | Ga0182007_100030523 | 301 |
| 611 | 3300015687 | Ga0183368_1004 | Ga0183368_1004710 | 301 |
| 612 | 3300017792 | Ga0163161_10018593 | Ga0163161_100185934 | 301 |
| 613 | 3300017792 | Ga0163161_10039512 | Ga0163161_100395123 | 301 |
| 614 | 3300020069 | Ga0197907_10031041 | Ga0197907_100310412 | 301 |
| 615 | 3300020070 | Ga0206356_11162436 | Ga0206356_111624362 | 301 |
| 616 | 3300020077 | Ga0206351_10270042 | Ga0206351_102700421 | 301 |
| 617 | 3300020078 | Ga0206352_10784584 | Ga0206352_107845842 | 301 |
| 618 | 3300020080 | Ga0206350_10514329 | Ga0206350_105143292 | 301 |
| 619 | 3300020081 | Ga0206354_10512197 | Ga0206354_105121971 | 301 |
| 620 | 3300020082 | Ga0206353_11363697 | Ga0206353_113636971 | 301 |
| 621 | 3300020610 | Ga0154015_1208151 | Ga0154015_12081511 | 301 |
| 622 | 3300020610 | Ga0154015_1499885 | Ga0154015_14998852 | 301 |
| 623 | 3300021384 | Ga0213876_10001632 | Ga0213876_1000163210 | 301 |
| 624 | 3300022467 | Ga0224712_10020806 | Ga0224712_100208062 | 301 |
| 625 | 3300022467 | Ga0224712_10028061 | Ga0224712_100280614 | 301 |
| 626 | 3300025226 | Ga0209674_100063 | Ga0209674_100063135 | 301 |
| 627 | 3300025226 | Ga0209674_100836 | Ga0209674_1008364 | 301 |
| 628 | 3300025228 | Ga0209672_100509 | Ga0209672_10050910 | 301 |
| 629 | 3300025231 | Ga0207427_100132 | Ga0207427_10013218 | 301 |
| 630 | 3300025231 | Ga0207427_100322 | Ga0207427_10032211 | 301 |
| 631 | 3300025231 | Ga0207427_103057 | Ga0207427_1030572 | 301 |
| 632 | 3300025233 | Ga0209437_100005 | Ga0209437_100005166 | 301 |
| 633 | 3300025233 | Ga0209437_100118 | Ga0209437_10011864 | 301 |
| 634 | 3300025233 | Ga0209437_100233 | Ga0209437_10023313 | 301 |
| 635 | 3300025242 | Ga0209258_100935 | Ga0209258_1009352 | 301 |
| 636 | 3300025242 | Ga0209258_101545 | Ga0209258_1015457 | 301 |
| 637 | 3300025245 | Ga0207425_1000148 | Ga0207425_100014815 | 301 |
| 638 | 3300025245 | Ga0207425_1001805 | Ga0207425_10018057 | 301 |
| 639 | 3300025246 | Ga0209646_1004787 | Ga0209646_10047871 | 301 |
| 640 | 3300025250 | Ga0209026_1000010 | Ga0209026_100001037 | 301 |
| 641 | 3300025250 | Ga0209026_1000061 | Ga0209026_1000061130 | 301 |
| 642 | 3300025254 | Ga0209148_1000005 | Ga0209148_1000005230 | 301 |
| 643 | 3300025256 | Ga0209759_1003743 | Ga0209759_10037437 | 301 |
| 644 | 3300025258 | Ga0209129_1000239 | Ga0209129_100023915 | 301 |
| 645 | 3300025261 | Ga0209233_1000011 | Ga0209233_1000011774 | 301 |
| 646 | 3300025261 | Ga0209233_1000046 | Ga0209233_1000046230 | 301 |
| 647 | 3300025261 | Ga0209233_1011210 | Ga0209233_10112102 | 301 |
| 648 | 3300025261 | Ga0209233_1015398 | Ga0209233_10153982 | 301 |
| 649 | 3300025272 | Ga0209455_1000111 | Ga0209455_1000111122 | 301 |
| 650 | 3300025292 | Ga0209676_1000411 | Ga0209676_100041141 | 301 |
| 651 | 3300025294 | Ga0209025_1000006 | Ga0209025_1000006549 | 301 |
| 652 | 3300025294 | Ga0209025_1000048 | Ga0209025_1000048260 | 301 |
| 653 | 3300025297 | Ga0209758_1000056 | Ga0209758_1000056260 | 301 |
| 654 | 3300025297 | Ga0209758_1008030 | Ga0209758_10080306 | 301 |
| 655 | 3300025298 | Ga0209050_1000146 | Ga0209050_100014620 | 301 |
| 656 | 3300025299 | Ga0209256_1003699 | Ga0209256_100369910 | 301 |
| 657 | 3300025321 | Ga0207656_10008749 | Ga0207656_100087492 | 301 |
| 658 | 3300025901 | Ga0207688_10112355 | Ga0207688_101123551 | 301 |
| 659 | 3300025903 | Ga0207680_10047257 | Ga0207680_100472572 | 301 |
| 660 | 3300025903 | Ga0207680_10061889 | Ga0207680_100618892 | 301 |
| 661 | 3300025904 | Ga0207647_10001386 | Ga0207647_100013864 | 301 |
| 662 | 3300025904 | Ga0207647_10002100 | Ga0207647_100021007 | 301 |
| 663 | 3300025904 | Ga0207647_10003612 | Ga0207647_100036126 | 301 |
| 664 | 3300025904 | Ga0207647_10054217 | Ga0207647_100542171 | 301 |
| 665 | 3300025907 | Ga0207645_10000737 | Ga0207645_1000073713 | 301 |
| 666 | 3300025909 | Ga0207705_10000146 | Ga0207705_1000014663 | 301 |
| 667 | 3300025909 | Ga0207705_10000373 | Ga0207705_1000037342 | 301 |
| 668 | 3300025909 | Ga0207705_10000788 | Ga0207705_100007882 | 301 |
| 669 | 3300025909 | Ga0207705_10009432 | Ga0207705_100094324 | 301 |
| 670 | 3300025909 | Ga0207705_10081047 | Ga0207705_100810472 | 301 |
| 671 | 3300025909 | Ga0207705_10257657 | Ga0207705_102576571 | 301 |
| 672 | 3300025910 | Ga0207684_10321899 | Ga0207684_103218992 | 301 |
| 673 | 3300025912 | Ga0207707_10000018 | Ga0207707_1000001837 | 301 |
| 674 | 3300025912 | Ga0207707_10000036 | Ga0207707_1000003649 | 301 |
| 675 | 3300025912 | Ga0207707_10000868 | Ga0207707_1000086813 | 301 |
| 676 | 3300025912 | Ga0207707_10000944 | Ga0207707_1000094422 | 301 |
| 677 | 3300025912 | Ga0207707_10009741 | Ga0207707_100097413 | 301 |
| 678 | 3300025912 | Ga0207707_10015309 | Ga0207707_100153091 | 301 |
| 679 | 3300025912 | Ga0207707_10017108 | Ga0207707_100171083 | 301 |
| 680 | 3300025912 | Ga0207707_10023133 | Ga0207707_100231331 | 301 |
| 681 | 3300025912 | Ga0207707_10027620 | Ga0207707_100276203 | 301 |
| 682 | 3300025912 | Ga0207707_10050186 | Ga0207707_100501863 | 301 |
| 683 | 3300025912 | Ga0207707_10127412 | Ga0207707_101274123 | 301 |
| 684 | 3300025913 | Ga0207695_10000007 | Ga0207695_10000007918 | 301 |
| 685 | 3300025913 | Ga0207695_10000114 | Ga0207695_10000114115 | 301 |
| 686 | 3300025913 | Ga0207695_10000816 | Ga0207695_1000081634 | 301 |
| 687 | 3300025913 | Ga0207695_10001086 | Ga0207695_1000108631 | 301 |
| 688 | 3300025913 | Ga0207695_10002626 | Ga0207695_100026269 | 301 |
| 689 | 3300025913 | Ga0207695_10027868 | Ga0207695_100278682 | 301 |
| 690 | 3300025913 | Ga0207695_10050538 | Ga0207695_100505382 | 301 |
| 691 | 3300025913 | Ga0207695_10053798 | Ga0207695_100537983 | 301 |
| 692 | 3300025913 | Ga0207695_10073182 | Ga0207695_100731824 | 301 |
| 693 | 3300025913 | Ga0207695_10115114 | Ga0207695_101151142 | 301 |
| 694 | 3300025913 | Ga0207695_10182106 | Ga0207695_101821061 | 301 |
| 695 | 3300025914 | Ga0207671_10000639 | Ga0207671_1000063929 | 301 |
| 696 | 3300025914 | Ga0207671_10082200 | Ga0207671_100822002 | 301 |
| 697 | 3300025914 | Ga0207671_10321677 | Ga0207671_103216771 | 301 |
| 698 | 3300025917 | Ga0207660_10000389 | Ga0207660_1000038913 | 301 |
| 699 | 3300025917 | Ga0207660_10009240 | Ga0207660_100092403 | 301 |
| 700 | 3300025917 | Ga0207660_10009433 | Ga0207660_100094333 | 301 |
| 701 | 3300025917 | Ga0207660_10009884 | Ga0207660_100098844 | 301 |
| 702 | 3300025917 | Ga0207660_10010720 | Ga0207660_100107203 | 301 |
| 703 | 3300025917 | Ga0207660_10015984 | Ga0207660_100159843 | 301 |
| 704 | 3300025917 | Ga0207660_10028000 | Ga0207660_100280004 | 301 |
| 705 | 3300025917 | Ga0207660_10048875 | Ga0207660_100488752 | 301 |
| 706 | 3300025917 | Ga0207660_10145550 | Ga0207660_101455502 | 301 |
| 707 | 3300025917 | Ga0207660_10237378 | Ga0207660_102373782 | 301 |
| 708 | 3300025918 | Ga0207662_10001726 | Ga0207662_100017267 | 301 |
| 709 | 3300025919 | Ga0207657_10022248 | Ga0207657_100222482 | 301 |
| 710 | 3300025920 | Ga0207649_10001271 | Ga0207649_100012716 | 301 |
| 711 | 3300025920 | Ga0207649_10019583 | Ga0207649_100195832 | 301 |
| 712 | 3300025920 | Ga0207649_10065234 | Ga0207649_100652342 | 301 |
| 713 | 3300025920 | Ga0207649_10150937 | Ga0207649_101509372 | 301 |
| 714 | 3300025921 | Ga0207652_10000409 | Ga0207652_1000040912 | 301 |
| 715 | 3300025921 | Ga0207652_10004945 | Ga0207652_100049457 | 301 |
| 716 | 3300025921 | Ga0207652_10007521 | Ga0207652_100075215 | 301 |
| 717 | 3300025921 | Ga0207652_10038403 | Ga0207652_100384032 | 301 |
| 718 | 3300025921 | Ga0207652_10076977 | Ga0207652_100769772 | 301 |
| 719 | 3300025921 | Ga0207652_10212731 | Ga0207652_102127312 | 301 |
| 720 | 3300025922 | Ga0207646_10192292 | Ga0207646_101922922 | 301 |
| 721 | 3300025923 | Ga0207681_10027150 | Ga0207681_100271505 | 301 |
| 722 | 3300025924 | Ga0207694_10000930 | Ga0207694_1000093012 | 301 |
| 723 | 3300025924 | Ga0207694_10002010 | Ga0207694_1000201014 | 301 |
| 724 | 3300025924 | Ga0207694_10013293 | Ga0207694_100132932 | 301 |
| 725 | 3300025924 | Ga0207694_10085369 | Ga0207694_100853692 | 301 |
| 726 | 3300025924 | Ga0207694_10132693 | Ga0207694_101326932 | 301 |
| 727 | 3300025925 | Ga0207650_10059382 | Ga0207650_100593824 | 301 |
| 728 | 3300025925 | Ga0207650_10165686 | Ga0207650_101656861 | 301 |
| 729 | 3300025925 | Ga0207650_10244319 | Ga0207650_102443192 | 301 |
| 730 | 3300025926 | Ga0207659_10042135 | Ga0207659_100421352 | 301 |
| 731 | 3300025927 | Ga0207687_10062794 | Ga0207687_100627942 | 301 |
| 732 | 3300025928 | Ga0207700_10001535 | Ga0207700_100015354 | 301 |
| 733 | 3300025928 | Ga0207700_10296846 | Ga0207700_102968462 | 301 |
| 734 | 3300025929 | Ga0207664_10000601 | Ga0207664_100006018 | 301 |
| 735 | 3300025931 | Ga0207644_10042775 | Ga0207644_100427752 | 301 |
| 736 | 3300025932 | Ga0207690_10000532 | Ga0207690_1000053214 | 301 |
| 737 | 3300025932 | Ga0207690_10001860 | Ga0207690_100018606 | 301 |
| 738 | 3300025932 | Ga0207690_10108815 | Ga0207690_101088151 | 301 |
| 739 | 3300025932 | Ga0207690_10109772 | Ga0207690_101097722 | 301 |
| 740 | 3300025932 | Ga0207690_10137975 | Ga0207690_101379752 | 301 |
| 741 | 3300025933 | Ga0207706_10008698 | Ga0207706_100086984 | 301 |
| 742 | 3300025933 | Ga0207706_10011915 | Ga0207706_100119151 | 301 |
| 743 | 3300025933 | Ga0207706_10013100 | Ga0207706_100131004 | 301 |
| 744 | 3300025933 | Ga0207706_10042110 | Ga0207706_100421102 | 301 |
| 745 | 3300025933 | Ga0207706_10470496 | Ga0207706_104704961 | 301 |
| 746 | 3300025935 | Ga0207709_10000527 | Ga0207709_1000052719 | 301 |
| 747 | 3300025935 | Ga0207709_10009913 | Ga0207709_100099135 | 301 |
| 748 | 3300025938 | Ga0207704_10013639 | Ga0207704_100136393 | 301 |
| 749 | 3300025940 | Ga0207691_10003625 | Ga0207691_100036254 | 301 |
| 750 | 3300025941 | Ga0207711_10014427 | Ga0207711_100144273 | 301 |
| 751 | 3300025941 | Ga0207711_10023261 | Ga0207711_100232613 | 301 |
| 752 | 3300025942 | Ga0207689_10001783 | Ga0207689_100017837 | 301 |
| 753 | 3300025944 | Ga0207661_10001897 | Ga0207661_100018976 | 301 |
| 754 | 3300025944 | Ga0207661_10045981 | Ga0207661_100459812 | 301 |
| 755 | 3300025944 | Ga0207661_10209699 | Ga0207661_102096992 | 301 |
| 756 | 3300025944 | Ga0207661_10248469 | Ga0207661_102484691 | 301 |
| 757 | 3300025945 | Ga0207679_10004674 | Ga0207679_100046743 | 301 |
| 758 | 3300025949 | Ga0207667_10000040 | Ga0207667_10000040213 | 301 |
| 759 | 3300025949 | Ga0207667_10000947 | Ga0207667_1000094723 | 301 |
| 760 | 3300025949 | Ga0207667_10007762 | Ga0207667_100077621 | 301 |
| 761 | 3300025949 | Ga0207667_10072474 | Ga0207667_100724742 | 301 |
| 762 | 3300025949 | Ga0207667_10103191 | Ga0207667_101031915 | 301 |
| 763 | 3300025949 | Ga0207667_10149101 | Ga0207667_101491012 | 301 |
| 764 | 3300025949 | Ga0207667_10205878 | Ga0207667_102058782 | 301 |
| 765 | 3300025949 | Ga0207667_10238588 | Ga0207667_102385882 | 301 |
| 766 | 3300025961 | Ga0207712_10000277 | Ga0207712_1000027739 | 301 |
| 767 | 3300025961 | Ga0207712_10001146 | Ga0207712_1000114610 | 301 |
| 768 | 3300025961 | Ga0207712_10014077 | Ga0207712_100140774 | 301 |
| 769 | 3300025972 | Ga0207668_10005154 | Ga0207668_100051541 | 301 |
| 770 | 3300025981 | Ga0207640_10000009 | Ga0207640_10000009214 | 301 |
| 771 | 3300025981 | Ga0207640_10005290 | Ga0207640_100052903 | 301 |
| 772 | 3300025981 | Ga0207640_10014194 | Ga0207640_100141942 | 301 |
| 773 | 3300025981 | Ga0207640_10098268 | Ga0207640_100982682 | 301 |
| 774 | 3300025981 | Ga0207640_10133355 | Ga0207640_101333552 | 301 |
| 775 | 3300026023 | Ga0207677_10471654 | Ga0207677_104716542 | 301 |
| 776 | 3300026035 | Ga0207703_10004934 | Ga0207703_100049346 | 301 |
| 777 | 3300026041 | Ga0207639_10001840 | Ga0207639_100018407 | 301 |
| 778 | 3300026041 | Ga0207639_10004652 | Ga0207639_100046527 | 301 |
| 779 | 3300026041 | Ga0207639_10014224 | Ga0207639_100142242 | 301 |
| 780 | 3300026041 | Ga0207639_10020933 | Ga0207639_100209332 | 301 |
| 781 | 3300026041 | Ga0207639_10293628 | Ga0207639_102936282 | 301 |
| 782 | 3300026041 | Ga0207639_10693695 | Ga0207639_106936951 | 301 |
| 783 | 3300026067 | Ga0207678_10004979 | Ga0207678_1000497914 | 301 |
| 784 | 3300026067 | Ga0207678_10006369 | Ga0207678_100063693 | 301 |
| 785 | 3300026067 | Ga0207678_10020914 | Ga0207678_100209147 | 301 |
| 786 | 3300026075 | Ga0207708_10009224 | Ga0207708_100092243 | 301 |
| 787 | 3300026078 | Ga0207702_10000172 | Ga0207702_1000017221 | 301 |
| 788 | 3300026078 | Ga0207702_10008380 | Ga0207702_100083803 | 301 |
| 789 | 3300026078 | Ga0207702_10015708 | Ga0207702_100157087 | 301 |
| 790 | 3300026078 | Ga0207702_10036014 | Ga0207702_100360143 | 301 |
| 791 | 3300026088 | Ga0207641_10025775 | Ga0207641_100257754 | 301 |
| 792 | 3300026088 | Ga0207641_10043596 | Ga0207641_100435962 | 301 |
| 793 | 3300026089 | Ga0207648_10027096 | Ga0207648_100270964 | 301 |
| 794 | 3300026116 | Ga0207674_10001921 | Ga0207674_1000192110 | 301 |
| 795 | 3300026116 | Ga0207674_10004423 | Ga0207674_100044238 | 301 |
| 796 | 3300026116 | Ga0207674_10012476 | Ga0207674_1001247613 | 301 |
| 797 | 3300026116 | Ga0207674_10050289 | Ga0207674_100502893 | 301 |
| 798 | 3300026116 | Ga0207674_10227566 | Ga0207674_102275661 | 301 |
| 799 | 3300026116 | Ga0207674_10258908 | Ga0207674_102589082 | 301 |
| 800 | 3300026116 | Ga0207674_10341215 | Ga0207674_103412151 | 301 |
| 801 | 3300026118 | Ga0207675_100001976 | Ga0207675_10000197613 | 301 |
| 802 | 3300026142 | Ga0207698_10000931 | Ga0207698_100009319 | 301 |
| 803 | 3300026142 | Ga0207698_10054723 | Ga0207698_100547233 | 301 |
| 804 | 3300026142 | Ga0207698_10083396 | Ga0207698_100833962 | 301 |
| 805 | 3300026142 | Ga0207698_10332722 | Ga0207698_103327222 | 301 |
| 806 | 3300027312 | Ga0209371_1000018 | Ga0209371_1000018539 | 301 |
| 807 | 3300027312 | Ga0209371_1000025 | Ga0209371_100002528 | 301 |
| 808 | 3300027876 | Ga0209974_10004171 | Ga0209974_100041714 | 301 |
| 809 | 3300028379 | Ga0268266_10000006 | Ga0268266_10000006994 | 301 |
| 810 | 3300028379 | Ga0268266_10026003 | Ga0268266_100260036 | 301 |
| 811 | 3300028379 | Ga0268266_10027010 | Ga0268266_100270102 | 301 |
| 812 | 3300028379 | Ga0268266_10031407 | Ga0268266_100314073 | 301 |
| 813 | 3300028379 | Ga0268266_10305737 | Ga0268266_103057372 | 301 |
| 814 | 3300028380 | Ga0268265_10061048 | Ga0268265_100610482 | 301 |
| 815 | 3300028381 | Ga0268264_10148368 | Ga0268264_101483682 | 301 |
| 816 | 3300028563 | Ga0265319_1000240 | Ga0265319_100024012 | 301 |
| 817 | 3300028577 | Ga0265318_10002424 | Ga0265318_100024245 | 301 |
| 818 | 3300028800 | Ga0265338_10212940 | Ga0265338_102129401 | 301 |
| 819 | 3300030500 | Ga0268256_1000016 | Ga0268256_1000016539 | 301 |
| 820 | 3300030500 | Ga0268256_1000027 | Ga0268256_100002728 | 301 |
| 821 | 3300030744 | Ga0316181_1268996 | Ga0316181_12689962 | 301 |
| 822 | 3300031238 | Ga0265332_10014777 | Ga0265332_100147772 | 301 |
| 823 | 3300031240 | Ga0265320_10000136 | Ga0265320_1000013649 | 301 |
| 824 | 3300031241 | Ga0265325_10001525 | Ga0265325_1000152513 | 301 |
| 825 | 3300031241 | Ga0265325_10042548 | Ga0265325_100425482 | 301 |
| 826 | 3300031242 | Ga0265329_10000171 | Ga0265329_1000017110 | 301 |
| 827 | 3300031247 | Ga0265340_10003989 | Ga0265340_100039893 | 301 |
| 828 | 3300031249 | Ga0265339_10065646 | Ga0265339_100656462 | 301 |
| 829 | 3300031250 | Ga0265331_10000021 | Ga0265331_1000002152 | 301 |
| 830 | 3300031250 | Ga0265331_10016315 | Ga0265331_100163155 | 301 |
| 831 | 3300031344 | Ga0265316_10001078 | Ga0265316_100010785 | 301 |
| 832 | 3300031344 | Ga0265316_10012682 | Ga0265316_100126823 | 301 |
| 833 | 3300031456 | Ga0307513_10158437 | Ga0307513_101584372 | 301 |
| 834 | 3300031548 | Ga0307408_100005909 | Ga0307408_1000059092 | 301 |
| 835 | 3300031548 | Ga0307408_100073444 | Ga0307408_1000734442 | 301 |
| 836 | 3300031595 | Ga0265313_10001348 | Ga0265313_100013485 | 301 |
| 837 | 3300031616 | Ga0307508_10065258 | Ga0307508_100652582 | 301 |
| 838 | 3300031616 | Ga0307508_10284242 | Ga0307508_102842422 | 301 |
| 839 | 3300031711 | Ga0265314_10007149 | Ga0265314_100071495 | 301 |
| 840 | 3300031712 | Ga0265342_10000555 | Ga0265342_100005555 | 301 |
| 841 | 3300031712 | Ga0265342_10104745 | Ga0265342_101047452 | 301 |
| 842 | 3300031824 | Ga0307413_10085739 | Ga0307413_100857392 | 301 |
| 843 | 3300031824 | Ga0307413_10088902 | Ga0307413_100889022 | 301 |
| 844 | 3300031824 | Ga0307413_10126983 | Ga0307413_101269832 | 301 |
| 845 | 3300031852 | Ga0307410_10029439 | Ga0307410_100294393 | 301 |
| 846 | 3300031852 | Ga0307410_10040470 | Ga0307410_100404703 | 301 |
| 847 | 3300031901 | Ga0307406_10002083 | Ga0307406_100020832 | 301 |
| 848 | 3300031901 | Ga0307406_10005253 | Ga0307406_100052538 | 301 |
| 849 | 3300031903 | Ga0307407_10043860 | Ga0307407_100438602 | 301 |
| 850 | 3300031911 | Ga0307412_10093954 | Ga0307412_100939542 | 301 |
| 851 | 3300031911 | Ga0307412_10217952 | Ga0307412_102179522 | 301 |
| 852 | 3300031995 | Ga0307409_100049477 | Ga0307409_1000494772 | 301 |
| 853 | 3300032002 | Ga0307416_100110189 | Ga0307416_1001101892 | 301 |
| 854 | 3300032004 | Ga0307414_10000303 | Ga0307414_1000030310 | 301 |
| 855 | 3300032004 | Ga0307414_10002908 | Ga0307414_100029083 | 301 |
| 856 | 3300032004 | Ga0307414_10380382 | Ga0307414_103803822 | 301 |
| 857 | 3300032005 | Ga0307411_10076113 | Ga0307411_100761131 | 301 |
| 858 | 3300032005 | Ga0307411_10076436 | Ga0307411_100764362 | 301 |
| 859 | 3300032126 | Ga0307415_100140021 | Ga0307415_1001400212 | 301 |
| 860 | 3300033179 | Ga0307507_10093349 | Ga0307507_100933493 | 301 |
| 861 | 3300035083 | Ga0373926_0027212 | Ga0373926_0027212_221_1135 | 301 |
| 862 | 3300035724 | Ga0373933_0093035 | Ga0373933_0093035_699_1613 | 301 |
| 863 | 3300037312 | Ga0395899_0036394 | Ga0395899_0036394_1216_2133 | 301 |
| 864 | 3300037418 | Ga0395900_0000033 | Ga0395900_0000033_47429_48361 | 301 |
| 865 | 3300037418 | Ga0395900_0009693 | Ga0395900_0009693_2395_3309 | 301 |
| 866 | 3300037418 | Ga0395900_0010009 | Ga0395900_0010009_2975_3907 | 301 |
| 867 | 3300037418 | Ga0395900_0054926 | Ga0395900_0054926_1542_2513 | 301 |
| 868 | 3300037466 | Ga0395898_0040116 | Ga0395898_0040116_249_1181 | 301 |
| 869 | 3300037466 | Ga0395898_0425028 | Ga0395898_0425028_162_1067 | 301 |
| 870 | 3300037471 | Ga0395905_0006600 | Ga0395905_0006600_2396_3310 | 301 |
| 871 | 3300037471 | Ga0395905_0041832 | Ga0395905_0041832_3046_3951 | 301 |
| 872 | 3300037471 | Ga0395905_0109833 | Ga0395905_0109833_1060_1965 | 301 |
| 873 | 3300037471 | Ga0395905_0111481 | Ga0395905_0111481_1358_2272 | 301 |
| 874 | 3300037471 | Ga0395905_0116462 | Ga0395905_0116462_623_1528 | 301 |
| 875 | 3300038443 | Ga0395901_0008861 | Ga0395901_0008861_7361_8275 | 301 |
| 876 | 3300038443 | Ga0395901_0015001 | Ga0395901_0015001_3580_4485 | 301 |
| 877 | 3300038705 | Ga0237819_00212 | Ga0237819_00212_1152_2081 | 301 |
| 878 | 3300038705 | Ga0237819_06260 | Ga0237819_06260_576_1481 | 301 |
| 879 | 3300039437 | Ga0436365_0457258 | Ga0436365_0457258_8552_9460 | 301 |
| 880 | 3300039437 | Ga0436365_1712708 | Ga0436365_1712708_51151_52167 | 301 |
| 881 | 3300041404 | Ga0439436_0012161 | Ga0439436_0012161_1375_2280 | 301 |
| 882 | 3300042001 | Ga0439441_007876 | Ga0439441_007876_132_1043 | 301 |
| 883 | 3300044712 | Ga0453684_0121349 | Ga0453684_0121349_1459_2367 | 301 |
| 884 | 3300045049 | Ga0466959_0049070 | Ga0466959_0049070_788_1693 | 301 |
| 885 | 3300045049 | Ga0466959_0267173 | Ga0466959_0267173_208_1119 | 301 |
| 886 | 3300045976 | Ga0466967_0520577 | Ga0466967_0520577_140_1045 | 301 |
| 887 | 3300046453 | Ga0495627_003294 | Ga0495627_003294_2534_3439 | 301 |
| 888 | 3300046454 | Ga0495592_0001829 | Ga0495592_0001829_7438_8352 | 301 |
| 889 | 3300046460 | Ga0495638_0000087 | Ga0495638_0000087_46612_47517 | 301 |
| 890 | 3300046460 | Ga0495638_0000095 | Ga0495638_0000095_80074_80979 | 301 |
| 891 | 3300046462 | Ga0495651_0000112 | Ga0495651_0000112_26740_27657 | 301 |
| 892 | 3300046462 | Ga0495651_0004909 | Ga0495651_0004909_5090_6004 | 301 |
| 893 | 3300046462 | Ga0495651_0037275 | Ga0495651_0037275_1737_2651 | 301 |
| 894 | 3300046463 | Ga0495653_0008702 | Ga0495653_0008702_3461_4375 | 301 |
| 895 | 3300046463 | Ga0495653_0057144 | Ga0495653_0057144_1129_2043 | 301 |
| 896 | 3300046471 | Ga0495650_0000122 | Ga0495650_0000122_173987_174892 | 301 |
| 897 | 3300046477 | Ga0495664_0027212 | Ga0495664_0027212_1855_2772 | 301 |
| 898 | 3300046477 | Ga0495664_0029489 | Ga0495664_0029489_1186_2100 | 301 |
| 899 | 3300046477 | Ga0495664_0103014 | Ga0495664_0103014_388_1302 | 301 |
| 900 | 3300046507 | Ga0495606_0000154 | Ga0495606_0000154_90688_91593 | 301 |
| 901 | 3300046511 | Ga0495608_0005013 | Ga0495608_0005013_7576_8490 | 301 |
| 902 | 3300046511 | Ga0495608_0015212 | Ga0495608_0015212_4355_5269 | 301 |
| 903 | 3300046516 | Ga0495628_0010075 | Ga0495628_0010075_4614_5528 | 301 |
| 904 | 3300046517 | Ga0495630_0046901 | Ga0495630_0046901_2197_3111 | 301 |
| 905 | 3300046517 | Ga0495630_0111043 | Ga0495630_0111043_160_1074 | 301 |
| 906 | 3300046517 | Ga0495630_0172293 | Ga0495630_0172293_287_1201 | 301 |
| 907 | 3300046529 | Ga0495652_0001460 | Ga0495652_0001460_12100_13014 | 301 |
| 908 | 3300046529 | Ga0495652_0039539 | Ga0495652_0039539_2811_3725 | 301 |
| 909 | 3300046531 | Ga0495665_0002975 | Ga0495665_0002975_2021_2935 | 301 |
| 910 | 3300046533 | Ga0495640_0089957 | Ga0495640_0089957_405_1319 | 301 |
| 911 | 3300046533 | Ga0495640_0137767 | Ga0495640_0137767_84_998 | 301 |
| 912 | 3300046535 | Ga0495586_0007098 | Ga0495586_0007098_1137_2051 | 301 |
| 913 | 3300046535 | Ga0495586_0044609 | Ga0495586_0044609_713_1627 | 301 |
| 914 | 3300046536 | Ga0495587_0008194 | Ga0495587_0008194_759_1673 | 301 |
| 915 | 3300046543 | Ga0495645_0018582 | Ga0495645_0018582_899_1813 | 301 |
| 916 | 3300046557 | Ga0495622_0069635 | Ga0495622_0069635_322_1227 | 301 |
| 917 | 3300046559 | Ga0495667_0002346 | Ga0495667_0002346_6279_7196 | 301 |
| 918 | 3300046559 | Ga0495667_0021853 | Ga0495667_0021853_531_1445 | 301 |
| 919 | 3300046615 | Ga0495656_0001607 | Ga0495656_0001607_970_1878 | 301 |
| 920 | 3300046616 | Ga0495668_0000364 | Ga0495668_0000364_3012_3917 | 301 |
| 921 | 3300046660 | Ga0495625_0010997 | Ga0495625_0010997_4983_5888 | 301 |
| 922 | 3300046660 | Ga0495625_0025870 | Ga0495625_0025870_879_1784 | 301 |
| 923 | 3300046663 | Ga0495635_0181855 | Ga0495635_0181855_132_1046 | 301 |
| 924 | 3300046675 | Ga0495657_0004093 | Ga0495657_0004093_6277_7191 | 301 |
| 925 | 3300046675 | Ga0495657_0155154 | Ga0495657_0155154_386_1300 | 301 |
| 926 | 3300046679 | Ga0495623_0199603 | Ga0495623_0199603_197_1111 | 301 |
| 927 | 3300046680 | Ga0495646_0004052 | Ga0495646_0004052_3892_4806 | 301 |
| 928 | 3300046689 | Ga0495613_0068659 | Ga0495613_0068659_1461_2375 | 301 |
| 929 | 3300046690 | Ga0495624_0023365 | Ga0495624_0023365_248_1162 | 301 |
| 930 | 3300046691 | Ga0495670_0025528 | Ga0495670_0025528_1425_2333 | 301 |
| 931 | 3300046692 | Ga0495671_0033896 | Ga0495671_0033896_354_1385 | 301 |
| 932 | 3300046694 | Ga0495649_0010401 | Ga0495649_0010401_3238_4143 | 301 |
| 933 | 3300046809 | Ga0495600_0001620 | Ga0495600_0001620_7027_7941 | 301 |
| 934 | 3300047317 | Ga0495604_0004415 | Ga0495604_0004415_6051_6965 | 301 |
| 935 | 3300047319 | Ga0495674_0008146 | Ga0495674_0008146_4535_5449 | 301 |
| 936 | 3300047319 | Ga0495674_0142410 | Ga0495674_0142410_696_1610 | 301 |
| 937 | 3300047322 | Ga0495680_0001270 | Ga0495680_0001270_10674_11591 | 301 |
| 938 | 3300047322 | Ga0495680_0004117 | Ga0495680_0004117_3459_4373 | 301 |
| 939 | 3300047322 | Ga0495680_0014929 | Ga0495680_0014929_5679_6593 | 301 |
| 940 | 3300047444 | Ga0495675_0000121 | Ga0495675_0000121_44679_45593 | 301 |
| 941 | 3300047444 | Ga0495675_0010587 | Ga0495675_0010587_104_1021 | 301 |
| 942 | 3300047444 | Ga0495675_0068687 | Ga0495675_0068687_1205_2119 | 301 |
| 943 | 3300047471 | Ga0495684_0002904 | Ga0495684_0002904_4503_5417 | 301 |
| 944 | 3300047471 | Ga0495684_0005046 | Ga0495684_0005046_6258_7172 | 301 |
| 945 | 3300047471 | Ga0495684_0007540 | Ga0495684_0007540_5845_6759 | 301 |
| 946 | 3300047472 | Ga0495686_0004003 | Ga0495686_0004003_5163_6092 | 301 |
| 947 | 3300047472 | Ga0495686_0021929 | Ga0495686_0021929_22_927 | 301 |
| 948 | 3300047673 | Ga0495593_0020029 | Ga0495593_0020029_2695_3609 | 301 |
| 949 | 3300048088 | Ga0495602_0002431 | Ga0495602_0002431_8030_8944 | 301 |
| 950 | 3300048903 | Ga0496100_0034593 | Ga0496100_0034593_481_1386 | 301 |
| 951 | 3300048904 | Ga0496101_0061834 | Ga0496101_0061834_1290_2195 | 301 |
| 952 | 3300048908 | Ga0496105_0058392 | Ga0496105_0058392_2260_3165 | 301 |
| 953 | 3300048911 | Ga0496108_0119623 | Ga0496108_0119623_327_1232 | 301 |
| 954 | 3300048912 | Ga0496109_0083637 | Ga0496109_0083637_473_1378 | 301 |
| 955 | 3300048913 | Ga0496110_0144262 | Ga0496110_0144262_349_1254 | 301 |
| 956 | 3300048915 | Ga0496112_0224091 | Ga0496112_0224091_215_1129 | 301 |
| 957 | 3300048916 | Ga0496113_0013073 | Ga0496113_0013073_3907_4812 | 301 |
| 958 | 3300048917 | Ga0496114_0011751 | Ga0496114_0011751_4752_5657 | 301 |
| 959 | 3300048917 | Ga0496114_0075849 | Ga0496114_0075849_1703_2608 | 301 |
| 960 | 3300048917 | Ga0496114_0132116 | Ga0496114_0132116_850_1755 | 301 |
| 961 | 3300048918 | Ga0496115_0000116 | Ga0496115_0000116_58694_59599 | 301 |
| 962 | 3300048918 | Ga0496115_0000233 | Ga0496115_0000233_30070_30975 | 301 |
| 963 | 3300048918 | Ga0496115_0000293 | Ga0496115_0000293_28722_29627 | 301 |
| 964 | 3300048918 | Ga0496115_0007196 | Ga0496115_0007196_5203_6108 | 301 |
| 965 | 3300048918 | Ga0496115_0351060 | Ga0496115_0351060_26_931 | 301 |
| 966 | 3300048919 | Ga0496116_0002572 | Ga0496116_0002572_5033_5938 | 301 |
| 967 | 3300048920 | Ga0496117_0003980 | Ga0496117_0003980_10258_11163 | 301 |
| 968 | 3300048920 | Ga0496117_0008136 | Ga0496117_0008136_7020_7925 | 301 |
| 969 | 3300048920 | Ga0496117_0013164 | Ga0496117_0013164_5316_6221 | 301 |
| 970 | 3300048921 | Ga0496118_0000260 | Ga0496118_0000260_50418_51323 | 301 |
| 971 | 3300048921 | Ga0496118_0000953 | Ga0496118_0000953_18455_19360 | 301 |
| 972 | 3300048921 | Ga0496118_0006046 | Ga0496118_0006046_9889_10794 | 301 |
| 973 | 3300048921 | Ga0496118_0015832 | Ga0496118_0015832_37_942 | 301 |
| 974 | 3300048921 | Ga0496118_0023738 | Ga0496118_0023738_1455_2360 | 301 |
| 975 | 3300048922 | Ga0496119_0000048 | Ga0496119_0000048_13537_14442 | 301 |
| 976 | 3300048922 | Ga0496119_0004893 | Ga0496119_0004893_8515_9420 | 301 |
| 977 | 3300048923 | Ga0496120_0000113 | Ga0496120_0000113_73960_74865 | 301 |
| 978 | 3300048923 | Ga0496120_0000519 | Ga0496120_0000519_13480_14385 | 301 |
| 979 | 3300048924 | Ga0496121_0000013 | Ga0496121_0000013_359098_360003 | 301 |
| 980 | 3300048924 | Ga0496121_0004863 | Ga0496121_0004863_12513_13418 | 301 |
| 981 | 3300048924 | Ga0496121_0042740 | Ga0496121_0042740_957_1862 | 301 |
| 982 | 3300048927 | Ga0496124_0001552 | Ga0496124_0001552_17038_17943 | 301 |
| 983 | 3300048927 | Ga0496124_0027671 | Ga0496124_0027671_1986_2891 | 301 |
| 984 | 3300048927 | Ga0496124_0106341 | Ga0496124_0106341_295_1200 | 301 |
| 985 | 3300048929 | Ga0496126_0000057 | Ga0496126_0000057_125662_126567 | 301 |
| 986 | 3300048929 | Ga0496126_0000320 | Ga0496126_0000320_26426_27331 | 301 |
| 987 | 3300048929 | Ga0496126_0016096 | Ga0496126_0016096_5219_6175 | 301 |
| 988 | 3300048929 | Ga0496126_0023194 | Ga0496126_0023194_1923_2828 | 301 |
| 989 | 3300048929 | Ga0496126_0023341 | Ga0496126_0023341_3692_4597 | 301 |
| 990 | 3300049568 | Ga0501031_0001796 | Ga0501031_0001796_6201_7106 | 301 |
| 991 | 3300049569 | Ga0501032_0007207 | Ga0501032_0007207_5489_6394 | 301 |
| 992 | 3300049569 | Ga0501032_0010231 | Ga0501032_0010231_3960_4865 | 301 |
| 993 | 3300049569 | Ga0501032_0044695 | Ga0501032_0044695_2051_2956 | 301 |
| 994 | 3300049570 | Ga0501033_0000086 | Ga0501033_0000086_58097_59008 | 301 |
| 995 | 3300049570 | Ga0501033_0006023 | Ga0501033_0006023_4635_5540 | 301 |
| 996 | 3300049570 | Ga0501033_0060447 | Ga0501033_0060447_1173_2078 | 301 |
| 997 | 3300049571 | Ga0501034_0093322 | Ga0501034_0093322_376_1281 | 301 |
| 998 | 3300049571 | Ga0501034_0200942 | Ga0501034_0200942_126_1031 | 301 |
| 999 | 3300049572 | Ga0501036_0011588 | Ga0501036_0011588_2435_3340 | 301 |
| 1000 | 3300049572 | Ga0501036_0018586 | Ga0501036_0018586_4187_5092 | 301 |
| 1001 | 3300049572 | Ga0501036_0025725 | Ga0501036_0025725_3399_4304 | 301 |
| 1002 | 3300049572 | Ga0501036_0152836 | Ga0501036_0152836_670_1575 | 301 |
| 1003 | 3300049573 | Ga0501037_0041500 | Ga0501037_0041500_2046_2951 | 301 |
| 1004 | 3300049573 | Ga0501037_0086830 | Ga0501037_0086830_353_1339 | 301 |
| 1005 | 3300049574 | Ga0501038_0016254 | Ga0501038_0016254_4577_5482 | 301 |
| 1006 | 3300049574 | Ga0501038_0022471 | Ga0501038_0022471_1136_2041 | 301 |
| 1007 | 3300049574 | Ga0501038_0061319 | Ga0501038_0061319_2282_3187 | 301 |
| 1008 | 3300049574 | Ga0501038_0109817 | Ga0501038_0109817_589_1494 | 301 |
| 1009 | 3300049575 | Ga0501039_0010959 | Ga0501039_0010959_1246_2151 | 301 |
| 1010 | 3300049575 | Ga0501039_0013495 | Ga0501039_0013495_3965_4870 | 301 |
| 1011 | 3300049576 | Ga0501040_0017688 | Ga0501040_0017688_3542_4447 | 301 |
| 1012 | 3300049578 | Ga0501042_0002596 | Ga0501042_0002596_6109_7014 | 301 |
| 1013 | 3300049579 | Ga0501043_0005825 | Ga0501043_0005825_6091_6996 | 301 |
| 1014 | 3300049579 | Ga0501043_0045918 | Ga0501043_0045918_451_1356 | 301 |
| 1015 | 3300049579 | Ga0501043_0111954 | Ga0501043_0111954_1057_1962 | 301 |
| 1016 | 3300049580 | Ga0501046_0001919 | Ga0501046_0001919_14536_15441 | 301 |
| 1017 | 3300049580 | Ga0501046_0007819 | Ga0501046_0007819_5141_6046 | 301 |
| 1018 | 3300049581 | Ga0501047_0011238 | Ga0501047_0011238_2164_3150 | 301 |
| 1019 | 3300049581 | Ga0501047_0011692 | Ga0501047_0011692_3295_4200 | 301 |
| 1020 | 3300049581 | Ga0501047_0466423 | Ga0501047_0466423_122_1033 | 301 |
| 1021 | 3300049582 | Ga0501048_0209232 | Ga0501048_0209232_369_1274 | 301 |
| 1022 | 3300049584 | Ga0501068_0001687 | Ga0501068_0001687_2581_3486 | 301 |
| 1023 | 3300049586 | Ga0501070_0170031 | Ga0501070_0170031_593_1579 | 301 |
| 1024 | 3300049586 | Ga0501070_0267493 | Ga0501070_0267493_16_948 | 301 |
| 1025 | 3300049589 | Ga0501073_0000408 | Ga0501073_0000408_26522_27508 | 301 |
| 1026 | 3300049591 | Ga0501075_0158630 | Ga0501075_0158630_407_1312 | 301 |
| 1027 | 3300049592 | Ga0501076_0122416 | Ga0501076_0122416_351_1256 | 301 |
| 1028 | 3300049593 | Ga0501077_0020571 | Ga0501077_0020571_1704_2609 | 301 |
| 1029 | 3300049742 | Ga0501080_0012126 | Ga0501080_0012126_1570_2646 | 301 |
| 1030 | 3300049822 | Ga0501035_0008776 | Ga0501035_0008776_7257_8162 | 301 |
| 1031 | 3300049822 | Ga0501035_0029675 | Ga0501035_0029675_1603_2514 | 301 |
| 1032 | 3300049822 | Ga0501035_0072308 | Ga0501035_0072308_1081_1986 | 301 |
| 1033 | 3300049823 | Ga0501044_0000749 | Ga0501044_0000749_32037_32942 | 301 |
| 1034 | 3300049823 | Ga0501044_0002590 | Ga0501044_0002590_13881_14792 | 301 |
| 1035 | 3300049823 | Ga0501044_0013084 | Ga0501044_0013084_7646_8557 | 301 |
| 1036 | 3300049823 | Ga0501044_0039363 | Ga0501044_0039363_64_969 | 301 |
| 1037 | 3300049823 | Ga0501044_0358588 | Ga0501044_0358588_195_1181 | 301 |
| 1038 | 3300049823 | Ga0501044_0622771 | Ga0501044_0622771_30_935 | 301 |
| 1039 | 3300049824 | Ga0501045_0005098 | Ga0501045_0005098_4084_4989 | 301 |
| 1040 | 3300050511 | nmdc:mga08y16_1627_c1 | nmdc:mga08y16_1627_c1_1624_2532 | 301 |
| 1041 | 3300053093 | Ga0500651_0047289 | Ga0500651_0047289_231_1136 | 301 |
| 1042 | 3300053119 | Ga0500595_000162 | Ga0500595_000162_32343_33359 | 301 |
| 1043 | 3300053139 | Ga0500568_0000316 | Ga0500568_0000316_6308_7213 | 301 |
| 1044 | 3300053140 | Ga0500573_0000049 | Ga0500573_0000049_15666_16757 | 301 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6j39-assembly1.cif.gz_A | crystal structure of cmis2 with inhibitor | 0.967 | 1 | 32 |
| 6vpb-assembly1.cif.gz_B-2 | a novel membrane-bound 6-phosphogluconate dehydrogenase from the acetic acid bacteria gluconacetobacter diazotrophicus (gd6pgd) | 0.9533 | 1 | 293 |
| 5x6r-assembly2.cif.gz_B | crystal structure of saccharomyces cerevisiae kmo in complex with ro 61-8048 | 0.9514 | 1 | 33 |
| 4e21-assembly1.cif.gz_B-2 | the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens | 0.9496 | 2 | 293 |
| 4e21-assembly1.cif.gz_A-2 | the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens | 0.9485 | 2 | 290 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5VQP1_29_415_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9478 | 3 | 30 | 3.50.50.60 |
| 6fqxH01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9427 | 2 | 169 | 3.40.50.720 |
| af_A4HWA7_1_176_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9405 | 2 | 30 | 3.50.50.60 |
| 4j36B00 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9386 | 2 | 33 | 3.50.50.60 |
| 5y8iB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9356 | 2 | 164 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I5CPF4-F1-model_v4 | 6-phosphogluconate dehydrogenase | 0.9949 | 47 | 154 |
GO:0004616
GO:0050661 |
| AF-T1B9E1-F1-model_v4 | 6-phosphogluconate dehydrogenase, NAD-binding domain protein (EC 1.1.-.-) | 0.9865 | 1 | 67 |
GO:0016491
GO:0050661 |
| AF-A0A328P4C0-F1-model_v4 | 6-phosphogluconate dehydrogenase (Decarboxylating) | 0.9862 | 1 | 301 |
GO:0004616
GO:0006098 GO:0016054 GO:0019521 GO:0050661 |
| AF-A0A2D6IMQ2-F1-model_v4 | 6-phosphogluconate dehydrogenase (Decarboxylating) | 0.9862 | 1 | 301 |
GO:0004616
GO:0006098 GO:0016054 GO:0019521 GO:0050661 |
| AF-A0A6A0JM29-F1-model_v4 | 6-phosphogluconate dehydrogenase | 0.9857 | 1 | 75 |
GO:0016491
GO:0050661 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar