F488917

General Info

Members Datasets Scaffolds Average Seq Length
1044 477 989 302

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0012126|Ga0501080_0012126_1570_2646
Length 358
Sequence MKARVSPVNVADAWSAIGASPFDARSIAEKPARARARRYHRGLRCDPSRERFPKETRMQLGMIGLGKMGNFMAQRLMKAGHDVVGFDPNGDARKALTDAGGKAVDSLDKLIEALQPPRAVWVMVPAGKIVDQTVAALNDKLAKGDVVIDGGNSNYKDDQRHAAELAPKGINYVDCGTSGGVWGLKEGYSMMVGGDDKVVDRLRPIFEALAPGKDQGWGHVGPVGSGHFVKMVHNGIEYGMMQAYAEGFAIFQHKDEFKLDLAQIAEIWRYGSVVRSWLLDLTADALKRNPDMQGIAPYVVDSGEGRWTVAEAIDLDVPAPIITASLIERLRSRDSDSFTDKLLSAMRNEFGGHAMKKE

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
5 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
6 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
7 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
8 2643221593 Lysobacter sp. Root690 Isolate Unclassified
9 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
10 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
11 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
12 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
13 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
14 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
15 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
16 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
17 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
18 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
19 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
20 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
21 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
22 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
23 2884411467 Dyella sp. AD56 Isolate Rhizosphere
24 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
25 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
26 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
27 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
28 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
29 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
30 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
31 2928153084 Leifsonia sp. 563 Isolate Unclassified
32 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
33 2928963466 Dyella japonica 1073 Isolate Unclassified
34 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
35 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
36 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
37 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
38 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
39 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
40 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
41 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
42 2952252522 Salinicola sp. DM10 Isolate Unclassified
43 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
44 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
45 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
46 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
47 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
48 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
49 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
50 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
51 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
52 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
53 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
54 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
55 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
56 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
57 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
58 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
59 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
60 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
61 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
62 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
64 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
65 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
66 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
67 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
68 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
69 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
70 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
71 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
72 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
73 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
74 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
75 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
76 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
77 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
78 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
79 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
80 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
82 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
83 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
84 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
85 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
86 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
87 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
88 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
89 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
90 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
91 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
92 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
93 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
94 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
95 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
96 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
97 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
98 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
99 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
100 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
101 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
102 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
103 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
104 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
105 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
106 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
107 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
108 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
109 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
110 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
111 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
112 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
113 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
114 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
115 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
116 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
117 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
118 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
119 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
120 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
121 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
122 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
123 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
124 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
125 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
126 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
127 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
128 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
129 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
130 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
131 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
132 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
133 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
134 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
135 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
136 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
137 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
138 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
139 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
140 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
141 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
142 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
143 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
144 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
145 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
146 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
147 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
148 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
149 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
150 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
151 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
152 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
153 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
154 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
155 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
156 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
157 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
158 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
159 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
160 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
161 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
162 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
163 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
164 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
165 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
166 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
167 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
168 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
169 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
170 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
171 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
172 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
173 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
174 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
175 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
176 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
177 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
178 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
179 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
180 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
181 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
182 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
183 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
184 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
185 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
186 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
187 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
188 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
189 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
190 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
191 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
192 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
193 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
194 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
195 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
196 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
197 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
199 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
200 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
201 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
202 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
207 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
208 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
210 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
211 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
212 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
215 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
216 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
217 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
218 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
220 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
221 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
223 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
224 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
225 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
227 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
282 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
283 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
287 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
288 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
289 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
290 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
291 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
292 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
293 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
294 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
295 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
296 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
297 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
298 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
299 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
300 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
301 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
302 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
303 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
304 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
305 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
306 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
307 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
308 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
309 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
310 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
311 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
312 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
313 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
314 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
315 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
316 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
317 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
318 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
319 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
320 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
321 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
322 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
323 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
324 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
325 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
326 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
327 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
328 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
329 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
330 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
331 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
332 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
333 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
334 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
335 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
336 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
337 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
338 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
339 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
340 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
341 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
342 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
343 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
344 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
345 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
346 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
347 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
348 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
349 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
350 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
351 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
352 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
353 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
354 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
355 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
356 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
357 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
358 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
359 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
360 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
361 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
362 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
363 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
364 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
365 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
366 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
367 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
368 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
369 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
370 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
371 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
372 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
373 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
374 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
375 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
376 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
377 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
378 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
379 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
380 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
381 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
382 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
383 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
384 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
385 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
386 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
387 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
388 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
389 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
390 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
391 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
392 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
393 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
394 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
395 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
396 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
397 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
398 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
399 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
400 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
401 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
402 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
403 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
404 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
405 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
406 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
407 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
408 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
409 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
410 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
411 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
412 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
413 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
414 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
415 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
416 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
417 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
418 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
419 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
420 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
421 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
422 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
423 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
424 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
425 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
441 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
442 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
443 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
444 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
445 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
446 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
447 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
448 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
449 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
450 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
451 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
452 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
453 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
456 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
457 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
458 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
459 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
460 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
461 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
462 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
463 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
464 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
465 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
466 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
467 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
468 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
469 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
470 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
471 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
472 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
473 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
474 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
475 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
476 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
477 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.39
Metatranscriptomes 1.34
Isolates 5.27

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 6.7
Nodule 0.1
Rhizoplane 2.68
Rhizosphere 80.08
Stem 0
Stem Tuber 0
Unclassified 10.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000230 3300001979 Bacteria 23717
2 JGI24739J22299_10055207 3300001989 Bacteria 1270
3 JGI24737J22298_10002869 3300001990 Bacteria 6109
4 JGI24737J22298_10016551 3300001990 Bacteria 2380
5 JGI24735J21928_10000213 3300002067 Bacteria 20363
6 JGI25156J39149_1006824 3300002705 Bacteria 3075
7 JGI25162J39368_1000653 3300002737 Bacteria 24475
8 JGI25162J39368_1001259 3300002737 Bacteria 14479
9 JGI25162J39368_1001943 3300002737 Bacteria 9331
10 JGI25162J39368_1005494 3300002737 Bacteria 2460
11 JGI25157J39369_1002739 3300002741 Bacteria 4056
12 JGI25157J39369_1003624 3300002741 Bacteria 3074
13 JGI25164J39214_1000473 3300002772 Bacteria 19954
14 JGI25164J39214_1000490 3300002772 Bacteria 19438
15 JGI25152J39213_1000103 3300002773 Bacteria 59472
16 JGI25150J39212_1000183 3300002774 Bacteria 35389
17 JGI25151J46595_10000187 3300003187 Bacteria 76949
18 JGI25151J46595_10000271 3300003187 Bacteria 59472
19 JGI25406J46586_10015012 3300003203 Bacteria 3277
20 JGI25165J46597_1000625 3300003214 Bacteria 29618
21 JGI25153J46596_10000190 3300003215 Bacteria 59472
22 Ga0006562J51391_1007922 3300003578 Bacteria 9000
23 Ga0006562J51391_1007923 3300003578 Bacteria 4170
24 Ga0055539_1000014 3300003752 Bacteria 381086
25 Ga0055533_1000002 3300003756 Bacteria 1196393
26 Ga0055533_1000962 3300003756 Bacteria 8475
27 Ga0055525_1005588 3300003759 Bacteria 1068
28 Ga0055542_1000010 3300003762 Bacteria 414813
29 Ga0055529_1001798 3300003763 Bacteria 5209
30 Ga0055526_1000005 3300003771 Bacteria 344542
31 Ga0055537_1000042 3300003773 Bacteria 91406
32 Ga0055537_1001615 3300003773 Bacteria 8475
33 Ga0055524_1000005 3300003775 Bacteria 344542
34 Ga0055536_1000773 3300003781 Bacteria 21299
35 Ga0055534_1000002 3300003784 Bacteria 390762
36 Ga0055528_1000002 3300003790 Bacteria 368879
37 Ga0055530_10002647 3300003791 Bacteria 11202
38 Ga0055541_1000497 3300003841 Bacteria 11039
39 Ga0058692_1000053 3300003856 Bacteria 107166
40 Ga0058692_1000065 3300003856 Bacteria 89723
41 Ga0058862_12823758 3300004803 Bacteria 1790
42 Ga0065714_10088992 3300005288 Bacteria 1996
43 Ga0065715_10005079 3300005293 Bacteria 4935
44 Ga0065707_10092011 3300005295 Bacteria 3842
45 Ga0070658_10000065 3300005327 Bacteria 104621
46 Ga0070658_10016063 3300005327 Bacteria 5986
47 Ga0070658_10122941 3300005327 Bacteria 2158
48 Ga0070658_10136650 3300005327 Bacteria 2046
49 Ga0070676_10002175 3300005328 Bacteria 9989
50 Ga0070676_10004260 3300005328 Bacteria 7516
51 Ga0070683_100058119 3300005329 Bacteria 3594
52 Ga0070683_100102372 3300005329 Bacteria 2697
53 Ga0070670_100086016 3300005331 Bacteria 2702
54 Ga0070670_100120801 3300005331 Bacteria 2260
55 Ga0070670_100295628 3300005331 Bacteria 1416
56 Ga0068869_100000848 3300005334 Bacteria 17540
57 Ga0068869_100005518 3300005334 Bacteria 7962
58 Ga0068869_100178597 3300005334 Bacteria 1663
59 Ga0070680_100000138 3300005336 Bacteria 44481
60 Ga0070680_100019130 3300005336 Bacteria 5423
61 Ga0070680_100026845 3300005336 Bacteria 4607
62 Ga0070680_100065060 3300005336 Bacteria 2988
63 Ga0070680_100249030 3300005336 Bacteria 1502
64 Ga0070682_100004912 3300005337 Bacteria 7422
65 Ga0070682_100013413 3300005337 Bacteria 4713
66 Ga0070682_100183929 3300005337 Bacteria 1462
67 Ga0068868_100000154 3300005338 Bacteria 44616
68 Ga0068868_100169688 3300005338 Bacteria 1806
69 Ga0070660_100355517 3300005339 Bacteria 1207
70 Ga0070689_100006130 3300005340 Bacteria 8285
71 Ga0070691_10000204 3300005341 Bacteria 19856
72 Ga0070691_10047295 3300005341 Bacteria 2045
73 Ga0070687_100001734 3300005343 Bacteria 7848
74 Ga0070687_100100108 3300005343 Bacteria 1621
75 Ga0070661_100014313 3300005344 Bacteria 5589
76 Ga0070661_100019362 3300005344 Bacteria 4851
77 Ga0070661_100022768 3300005344 Bacteria 4486
78 Ga0070661_100137945 3300005344 Bacteria 1836
79 Ga0070661_100221607 3300005344 Bacteria 1451
80 Ga0070661_100505846 3300005344 Bacteria 967
81 Ga0070692_10000826 3300005345 Bacteria 10346
82 Ga0070692_10001376 3300005345 Bacteria 8785
83 Ga0070692_10024606 3300005345 Bacteria 2960
84 Ga0070668_100002627 3300005347 Bacteria 13198
85 Ga0070668_100005675 3300005347 Bacteria 9250
86 Ga0070668_100297144 3300005347 Bacteria 1353
87 Ga0070669_100016734 3300005353 Bacteria 5233
88 Ga0070669_100021816 3300005353 Bacteria 4579
89 Ga0070675_100025078 3300005354 Bacteria 4779
90 Ga0070675_100051402 3300005354 Bacteria 3386
91 Ga0070671_100020254 3300005355 Bacteria 5423
92 Ga0070673_100000023 3300005364 Bacteria 91936
93 Ga0070688_100015057 3300005365 Bacteria 4391
94 Ga0070688_100213269 3300005365 Bacteria 1357
95 Ga0070659_100004369 3300005366 Bacteria 10091
96 Ga0070659_100005005 3300005366 Bacteria 9495
97 Ga0070659_100014512 3300005366 Bacteria 5888
98 Ga0070667_100023098 3300005367 Bacteria 5158
99 Ga0070667_100059611 3300005367 Bacteria 3229
100 Ga0070667_100273171 3300005367 Bacteria 1516
101 Ga0070714_100000007 3300005435 Bacteria 285654
102 Ga0070714_100000025 3300005435 Bacteria 147717
103 Ga0070714_100002188 3300005435 Bacteria 14379
104 Ga0070714_100179606 3300005435 Bacteria 1925
105 Ga0070714_100234025 3300005435 Bacteria 1693
106 Ga0070713_100003658 3300005436 Bacteria 10176
107 Ga0070711_100203553 3300005439 Bacteria 1529
108 Ga0070705_100176800 3300005440 Bacteria 1442
109 Ga0070700_100000015 3300005441 Bacteria 149873
110 Ga0070700_100022316 3300005441 Bacteria 3689
111 Ga0070708_100005216 3300005445 Bacteria 10289
112 Ga0070708_100382634 3300005445 Bacteria 1327
113 Ga0070663_100001998 3300005455 Bacteria 11388
114 Ga0070663_100003552 3300005455 Bacteria 9006
115 Ga0070663_100011137 3300005455 Bacteria 5632
116 Ga0070663_100030594 3300005455 Bacteria 3691
117 Ga0070663_100174476 3300005455 Bacteria 1664
118 Ga0070663_100181951 3300005455 Bacteria 1631
119 Ga0070678_100015225 3300005456 Bacteria 4881
120 Ga0070678_100040799 3300005456 Bacteria 3286
121 Ga0070662_100007688 3300005457 Bacteria 6993
122 Ga0070662_100055165 3300005457 Bacteria 2882
123 Ga0070662_100095797 3300005457 Bacteria 2238
124 Ga0070662_100105335 3300005457 Bacteria 2141
125 Ga0070662_100356393 3300005457 Bacteria 1199
126 Ga0070681_10000076 3300005458 Bacteria 73378
127 Ga0070681_10001058 3300005458 Bacteria 23417
128 Ga0070681_10005260 3300005458 Bacteria 12496
129 Ga0070681_10012818 3300005458 Bacteria 8322
130 Ga0070681_10051976 3300005458 Bacteria 4086
131 Ga0070681_10097017 3300005458 Bacteria 2895
132 Ga0070681_10231243 3300005458 Bacteria 1763
133 Ga0068867_100000007 3300005459 Bacteria 148726
134 Ga0068867_100299750 3300005459 Bacteria 1325
135 Ga0070685_10053205 3300005466 Bacteria 2345
136 Ga0070706_100017183 3300005467 Bacteria 6682
137 Ga0070706_100075262 3300005467 Bacteria 3124
138 Ga0070698_100025964 3300005471 Bacteria 6102
139 Ga0070679_100000504 3300005530 Bacteria 33271
140 Ga0070679_100005669 3300005530 Bacteria 11575
141 Ga0070679_100094827 3300005530 Bacteria 2972
142 Ga0070679_100229808 3300005530 Bacteria 1815
143 Ga0070679_100245203 3300005530 Bacteria 1748
144 Ga0070684_100142709 3300005535 Bacteria 2166
145 Ga0070684_100431134 3300005535 Bacteria 1217
146 Ga0070684_100608218 3300005535 Bacteria 1016
147 Ga0070697_100053485 3300005536 Bacteria 3281
148 Ga0070697_100147487 3300005536 Bacteria 1982
149 Ga0068853_100025947 3300005539 Bacteria 4918
150 Ga0068853_100026580 3300005539 Bacteria 4860
151 Ga0068853_100087550 3300005539 Bacteria 2733
152 Ga0068853_100195851 3300005539 Bacteria 1838
153 Ga0068853_100241865 3300005539 Bacteria 1654
154 Ga0068853_100295727 3300005539 Bacteria 1495
155 Ga0070672_100003161 3300005543 Bacteria 10646
156 Ga0070672_100021437 3300005543 Bacteria 4728
157 Ga0070686_100193262 3300005544 Bacteria 1454
158 Ga0070696_100003079 3300005546 Bacteria 11084
159 Ga0070696_100015403 3300005546 Bacteria 5134
160 Ga0070696_100027962 3300005546 Bacteria 3846
161 Ga0070693_100014051 3300005547 Bacteria 4091
162 Ga0070665_100000465 3300005548 Bacteria 58821
163 Ga0070665_100237824 3300005548 Bacteria 1822
164 Ga0070665_100503266 3300005548 Bacteria 1223
165 Ga0070704_100071046 3300005549 Bacteria 2528
166 Ga0068855_100000897 3300005563 Bacteria 36900
167 Ga0068855_100034494 3300005563 Bacteria 6035
168 Ga0068855_100059757 3300005563 Bacteria 4459
169 Ga0068855_100167742 3300005563 Bacteria 2488
170 Ga0068855_100192031 3300005563 Bacteria 2303
171 Ga0068855_100593199 3300005563 Bacteria 1195
172 Ga0068857_100014249 3300005577 Bacteria 6927
173 Ga0068857_100019539 3300005577 Bacteria 5950
174 Ga0068857_100082251 3300005577 Bacteria 2876
175 Ga0068857_100120614 3300005577 Bacteria 2360
176 Ga0068857_100150476 3300005577 Bacteria 2108
177 Ga0068854_100000027 3300005578 Bacteria 117836
178 Ga0068854_100000142 3300005578 Bacteria 49834
179 Ga0068854_100063019 3300005578 Bacteria 2690
180 Ga0068854_100368849 3300005578 Bacteria 1180
181 Ga0068856_100000462 3300005614 Bacteria 44787
182 Ga0068856_100004819 3300005614 Bacteria 13371
183 Ga0068856_100025070 3300005614 Bacteria 5811
184 Ga0068856_100336574 3300005614 Bacteria 1527
185 Ga0068852_100112354 3300005616 Bacteria 2479
186 Ga0068866_10036810 3300005718 Bacteria 2399
187 Ga0068861_100004360 3300005719 Bacteria 9490
188 Ga0068851_10026102 3300005834 Bacteria 2868
189 Ga0068863_100038707 3300005841 Bacteria 4536
190 Ga0068858_100013390 3300005842 Bacteria 7741
191 Ga0068858_100098118 3300005842 Bacteria 2732
192 Ga0068858_100128673 3300005842 Bacteria 2373
193 Ga0068860_100041224 3300005843 Bacteria 4410
194 Ga0068860_100061738 3300005843 Bacteria 3561
195 Ga0068860_100101230 3300005843 Bacteria 2749
196 Ga0068862_100070914 3300005844 Bacteria 3009
197 Ga0081539_10000105 3300005985 Bacteria 197356
198 Ga0081539_10083936 3300005985 Bacteria 1666
199 Ga0075364_10061999 3300006051 Bacteria 2454
200 Ga0070712_100056201 3300006175 Bacteria 2760
201 Ga0070712_100218002 3300006175 Bacteria 1509
202 Ga0097621_100002061 3300006237 Bacteria 13748
203 Ga0068871_100002074 3300006358 Bacteria 13555
204 Ga0068871_100137854 3300006358 Bacteria 2073
205 Ga0075428_100002309 3300006844 Bacteria 20651
206 Ga0075428_100008733 3300006844 Bacteria 11238
207 Ga0075428_100415922 3300006844 Bacteria 1440
208 Ga0075428_100713931 3300006844 Bacteria 1068
209 Ga0075430_100065318 3300006846 Bacteria 3057
210 Ga0075431_100013904 3300006847 Bacteria 8127
211 Ga0075433_10039496 3300006852 Bacteria 4082
212 Ga0075434_100007756 3300006871 Bacteria 9939
213 Ga0075434_100048328 3300006871 Bacteria 4221
214 Ga0075429_100055515 3300006880 Bacteria 3446
215 Ga0068865_100000010 3300006881 Bacteria 159548
216 Ga0068865_100007765 3300006881 Bacteria 6613
217 Ga0068865_100122851 3300006881 Bacteria 1934
218 Ga0099795_10004112 3300007788 Bacteria 3711
219 Ga0105240_10000049 3300009093 Bacteria 236718
220 Ga0105240_10000113 3300009093 Bacteria 168192
221 Ga0105240_10002816 3300009093 Bacteria 27486
222 Ga0105240_10069114 3300009093 Bacteria 4372
223 Ga0105240_10081693 3300009093 Bacteria 3970
224 Ga0105240_10228162 3300009093 Bacteria 2166
225 Ga0105240_10680974 3300009093 Bacteria 1124
226 Ga0111539_10043138 3300009094 Bacteria 5409
227 Ga0111539_10049401 3300009094 Bacteria 5017
228 Ga0111539_10063244 3300009094 Bacteria 4379
229 Ga0111539_10565172 3300009094 Bacteria 1325
230 Ga0105245_10001804 3300009098 Bacteria 19521
231 Ga0105245_10056362 3300009098 Bacteria 3532
232 Ga0105245_10062002 3300009098 Bacteria 3373
233 Ga0114129_10001539 3300009147 Bacteria 31268
234 Ga0114129_10014853 3300009147 Bacteria 11095
235 Ga0114129_10148798 3300009147 Bacteria 3205
236 Ga0105243_10000950 3300009148 Bacteria 27049
237 Ga0105243_10004757 3300009148 Bacteria 10671
238 Ga0105243_10008647 3300009148 Bacteria 7810
239 Ga0105243_10011470 3300009148 Bacteria 6704
240 Ga0105243_10014541 3300009148 Bacteria 5954
241 Ga0105241_10011546 3300009174 Bacteria 6475
242 Ga0105241_10012868 3300009174 Bacteria 6140
243 Ga0105241_10013711 3300009174 Bacteria 5938
244 Ga0105241_10282502 3300009174 Bacteria 1418
245 Ga0105242_10000210 3300009176 Bacteria 45627
246 Ga0105242_10007241 3300009176 Bacteria 8552
247 Ga0105248_10057736 3300009177 Bacteria 4356
248 Ga0105248_10262904 3300009177 Bacteria 1942
249 Ga0105237_10000230 3300009545 Bacteria 79441
250 Ga0105237_10284515 3300009545 Bacteria 1656
251 Ga0105237_10362694 3300009545 Bacteria 1453
252 Ga0105238_10002948 3300009551 Bacteria 16980
253 Ga0105238_10041071 3300009551 Bacteria 4686
254 Ga0105238_10073696 3300009551 Bacteria 3408
255 Ga0105238_10143947 3300009551 Bacteria 2360
256 Ga0105238_10543702 3300009551 Bacteria 1165
257 Ga0105249_10000195 3300009553 Bacteria 69709
258 Ga0105249_10007619 3300009553 Bacteria 9444
259 Ga0105249_10017303 3300009553 Bacteria 6400
260 Ga0105249_10030480 3300009553 Bacteria 4876
261 Ga0105249_10135624 3300009553 Bacteria 2355
262 Ga0105249_10294373 3300009553 Bacteria 1626
263 Ga0105032_101587 3300009979 Bacteria 2065
264 Ga0105028_101804 3300009993 Bacteria 2244
265 Ga0105239_10000034 3300010375 Bacteria 219430
266 Ga0105239_10004123 3300010375 Bacteria 17464
267 Ga0105239_10095696 3300010375 Bacteria 3280
268 Ga0105239_10299995 3300010375 Bacteria 1809
269 Ga0105239_10319165 3300010375 Bacteria 1751
270 Ga0105239_10485188 3300010375 Bacteria 1404
271 Ga0157373_10098054 3300013100 Bacteria 2063
272 Ga0157371_10000397 3300013102 Bacteria 54547
273 Ga0157371_10019340 3300013102 Bacteria 5024
274 Ga0157371_10070140 3300013102 Bacteria 2481
275 Ga0157371_10080697 3300013102 Bacteria 2304
276 Ga0157371_10182732 3300013102 Bacteria 1500
277 Ga0157371_10236816 3300013102 Bacteria 1312
278 Ga0157370_10010248 3300013104 Bacteria 9897
279 Ga0157370_10024020 3300013104 Bacteria 6044
280 Ga0157370_10025407 3300013104 Bacteria 5862
281 Ga0157370_10035718 3300013104 Bacteria 4828
282 Ga0157370_10065485 3300013104 Bacteria 3438
283 Ga0157370_10082723 3300013104 Bacteria 3019
284 Ga0157370_10189137 3300013104 Bacteria 1911
285 Ga0157369_10030897 3300013105 Bacteria 5904
286 Ga0157369_10045576 3300013105 Bacteria 4768
287 Ga0157369_10054676 3300013105 Bacteria 4310
288 Ga0157369_10196583 3300013105 Bacteria 2118
289 Ga0157369_10219655 3300013105 Bacteria 1990
290 Ga0157369_10248017 3300013105 Bacteria 1859
291 Ga0157369_10301602 3300013105 Bacteria 1666
292 Ga0157374_10000830 3300013296 Bacteria 27049
293 Ga0157374_10002660 3300013296 Bacteria 15048
294 Ga0157374_10079124 3300013296 Bacteria 3114
295 Ga0157374_10265052 3300013296 Bacteria 1693
296 Ga0157378_10001477 3300013297 Bacteria 21228
297 Ga0157378_10013933 3300013297 Bacteria 7034
298 Ga0157378_10144915 3300013297 Bacteria 2208
299 Ga0157378_10562746 3300013297 Bacteria 1147
300 Ga0163162_10000015 3300013306 Bacteria 261996
301 Ga0163162_10009246 3300013306 Bacteria 9588
302 Ga0163162_10033700 3300013306 Bacteria 5090
303 Ga0163162_10072625 3300013306 Bacteria 3496
304 Ga0163162_10670611 3300013306 Bacteria 1160
305 Ga0157372_10000004 3300013307 Bacteria 435659
306 Ga0157372_10008269 3300013307 Bacteria 11061
307 Ga0157372_10022871 3300013307 Bacteria 6769
308 Ga0157372_10047515 3300013307 Bacteria 4770
309 Ga0157372_10070446 3300013307 Bacteria 3934
310 Ga0157372_10118468 3300013307 Bacteria 3038
311 Ga0157372_10122484 3300013307 Bacteria 2988
312 Ga0157375_10002120 3300013308 Bacteria 17145
313 Ga0157375_10156411 3300013308 Bacteria 2418
314 Ga0157375_10234511 3300013308 Bacteria 1994
315 Ga0157375_10389508 3300013308 Bacteria 1560
316 Ga0157375_10663712 3300013308 Bacteria 1198
317 Ga0163163_10000205 3300014325 Bacteria 61330
318 Ga0163163_10091541 3300014325 Bacteria 3056
319 Ga0157380_10033964 3300014326 Bacteria 3931
320 Ga0157380_10299929 3300014326 Bacteria 1480
321 Ga0182008_10048966 3300014497 Bacteria 2098
322 Ga0182008_10069164 3300014497 Bacteria 1737
323 Ga0157377_10014848 3300014745 Bacteria 3972
324 Ga0157379_10367839 3300014968 Bacteria 1318
325 Ga0157376_10000047 3300014969 Bacteria 107974
326 Ga0157376_10112995 3300014969 Bacteria 2394
327 Ga0157376_10261459 3300014969 Bacteria 1622
328 Ga0182006_1012948 3300015261 Bacteria 3637
329 Ga0182006_1030792 3300015261 Bacteria 2166
330 Ga0182006_1032508 3300015261 Bacteria 2097
331 Ga0182006_1033197 3300015261 Bacteria 2070
332 Ga0182007_10000079 3300015262 Bacteria 73543
333 Ga0182007_10003052 3300015262 Bacteria 8072
334 Ga0182005_1000166 3300015265 Bacteria 45594
335 Ga0182005_1048792 3300015265 Bacteria 1150
336 Ga0183368_1004 3300015687 Bacteria 1211761
337 Ga0183360_10002 3300015689 Bacteria 953821
338 Ga0163161_10018593 3300017792 Bacteria 4869
339 Ga0163161_10039512 3300017792 Bacteria 3388
340 Ga0163161_10184246 3300017792 Bacteria 1602
341 Ga0197907_10031041 3300020069 Bacteria 1831
342 Ga0206356_11162436 3300020070 Bacteria 2371
343 Ga0206351_10270042 3300020077 Bacteria 1049
344 Ga0206352_10784584 3300020078 Bacteria 1230
345 Ga0206350_10514329 3300020080 Bacteria 2379
346 Ga0206354_10512197 3300020081 Bacteria 2443
347 Ga0206353_11363697 3300020082 Bacteria 1420
348 Ga0154015_1208151 3300020610 Bacteria 1257
349 Ga0154015_1499885 3300020610 Bacteria 1311
350 Ga0213876_10001632 3300021384 Bacteria 13683
351 Ga0213875_10049732 3300021388 Bacteria 1965
352 Ga0224712_10020806 3300022467 Bacteria 2235
353 Ga0224712_10028061 3300022467 Bacteria 2008
354 Ga0228598_1013405 3300024227 Bacteria 1623
355 Ga0209566_100056 3300025225 Bacteria 209595
356 Ga0209674_100001 3300025226 Bacteria 4013750
357 Ga0209674_100063 3300025226 Bacteria 275507
358 Ga0209674_100836 3300025226 Bacteria 10196
359 Ga0209672_100509 3300025228 Bacteria 21444
360 Ga0209563_100001 3300025230 Bacteria 4013775
361 Ga0207427_100132 3300025231 Bacteria 92962
362 Ga0207427_100322 3300025231 Bacteria 32298
363 Ga0207427_103057 3300025231 Bacteria 3807
364 Ga0209437_100005 3300025233 Bacteria 1071596
365 Ga0209437_100118 3300025233 Bacteria 207534
366 Ga0209437_100233 3300025233 Bacteria 93858
367 Ga0209258_100935 3300025242 Bacteria 14221
368 Ga0209258_101545 3300025242 Bacteria 7709
369 Ga0207425_1000148 3300025245 Bacteria 59862
370 Ga0207425_1001805 3300025245 Bacteria 8297
371 Ga0209646_1004787 3300025246 Bacteria 2432
372 Ga0209026_1000010 3300025250 Bacteria 511986
373 Ga0209026_1000061 3300025250 Bacteria 219572
374 Ga0209677_100001 3300025253 Bacteria 4013787
375 Ga0209148_1000005 3300025254 Bacteria 1806504
376 Ga0209759_1003743 3300025256 Bacteria 5945
377 Ga0209129_1000239 3300025258 Bacteria 59863
378 Ga0209233_1000011 3300025261 Bacteria 1071611
379 Ga0209233_1000046 3300025261 Bacteria 470971
380 Ga0209233_1011210 3300025261 Bacteria 2649
381 Ga0209233_1015398 3300025261 Bacteria 2130
382 Ga0209565_1000001 3300025263 Bacteria 2950419
383 Ga0209455_1000111 3300025272 Bacteria 188820
384 Ga0209673_1000001 3300025273 Bacteria 3176258
385 Ga0209675_1000001 3300025291 Bacteria 2950293
386 Ga0209676_1000411 3300025292 Bacteria 77084
387 Ga0209025_1000006 3300025294 Bacteria 1153444
388 Ga0209025_1000048 3300025294 Bacteria 335574
389 Ga0209564_1000001 3300025295 Bacteria 3176258
390 Ga0209758_1000056 3300025297 Bacteria 335574
391 Ga0209758_1008030 3300025297 Bacteria 6973
392 Ga0209050_1000146 3300025298 Bacteria 166930
393 Ga0209256_1000006 3300025299 Bacteria 1250310
394 Ga0209256_1003699 3300025299 Bacteria 10388
395 Ga0207656_10008749 3300025321 Bacteria 3741
396 Ga0207642_10161387 3300025899 Bacteria 1204
397 Ga0207688_10112355 3300025901 Bacteria 1583
398 Ga0207680_10047257 3300025903 Bacteria 2549
399 Ga0207680_10061889 3300025903 Bacteria 2284
400 Ga0207647_10001386 3300025904 Bacteria 18622
401 Ga0207647_10002100 3300025904 Bacteria 15252
402 Ga0207647_10003612 3300025904 Bacteria 11579
403 Ga0207647_10010284 3300025904 Bacteria 6610
404 Ga0207647_10026222 3300025904 Bacteria 3816
405 Ga0207647_10051240 3300025904 Bacteria 2552
406 Ga0207647_10054217 3300025904 Bacteria 2467
407 Ga0207645_10000737 3300025907 Bacteria 27273
408 Ga0207645_10009242 3300025907 Bacteria 6828
409 Ga0207705_10000001 3300025909 Bacteria 2061880
410 Ga0207705_10000146 3300025909 Bacteria 75353
411 Ga0207705_10000373 3300025909 Bacteria 40446
412 Ga0207705_10000788 3300025909 Bacteria 26019
413 Ga0207705_10009432 3300025909 Bacteria 7097
414 Ga0207705_10059428 3300025909 Bacteria 2759
415 Ga0207705_10081047 3300025909 Bacteria 2365
416 Ga0207705_10257657 3300025909 Bacteria 1331
417 Ga0207684_10076825 3300025910 Bacteria 2838
418 Ga0207684_10321899 3300025910 Bacteria 1333
419 Ga0207654_10024425 3300025911 Bacteria 3249
420 Ga0207707_10000018 3300025912 Bacteria 215518
421 Ga0207707_10000036 3300025912 Bacteria 146159
422 Ga0207707_10000868 3300025912 Bacteria 29545
423 Ga0207707_10000944 3300025912 Bacteria 28014
424 Ga0207707_10009741 3300025912 Bacteria 8335
425 Ga0207707_10015309 3300025912 Bacteria 6677
426 Ga0207707_10017108 3300025912 Bacteria 6317
427 Ga0207707_10023133 3300025912 Bacteria 5438
428 Ga0207707_10027620 3300025912 Bacteria 4961
429 Ga0207707_10050186 3300025912 Bacteria 3635
430 Ga0207707_10127412 3300025912 Bacteria 2226
431 Ga0207695_10000007 3300025913 Bacteria 1092551
432 Ga0207695_10000114 3300025913 Bacteria 242465
433 Ga0207695_10000816 3300025913 Bacteria 57734
434 Ga0207695_10001086 3300025913 Bacteria 47444
435 Ga0207695_10002626 3300025913 Bacteria 26298
436 Ga0207695_10027868 3300025913 Bacteria 6280
437 Ga0207695_10050538 3300025913 Bacteria 4372
438 Ga0207695_10053798 3300025913 Bacteria 4208
439 Ga0207695_10073182 3300025913 Bacteria 3493
440 Ga0207695_10115114 3300025913 Bacteria 2664
441 Ga0207695_10182106 3300025913 Bacteria 2022
442 Ga0207671_10000639 3300025914 Bacteria 45851
443 Ga0207671_10082200 3300025914 Bacteria 2417
444 Ga0207671_10321677 3300025914 Bacteria 1224
445 Ga0207660_10000389 3300025917 Bacteria 28880
446 Ga0207660_10009240 3300025917 Bacteria 6379
447 Ga0207660_10009433 3300025917 Bacteria 6317
448 Ga0207660_10009884 3300025917 Bacteria 6180
449 Ga0207660_10010720 3300025917 Bacteria 5957
450 Ga0207660_10015984 3300025917 Bacteria 4961
451 Ga0207660_10028000 3300025917 Bacteria 3851
452 Ga0207660_10048875 3300025917 Bacteria 2995
453 Ga0207660_10145550 3300025917 Bacteria 1816
454 Ga0207660_10237378 3300025917 Bacteria 1435
455 Ga0207662_10001726 3300025918 Bacteria 10708
456 Ga0207657_10022248 3300025919 Bacteria 5940
457 Ga0207649_10001271 3300025920 Bacteria 15070
458 Ga0207649_10019583 3300025920 Bacteria 3869
459 Ga0207649_10065234 3300025920 Bacteria 2304
460 Ga0207649_10150937 3300025920 Bacteria 1600
461 Ga0207652_10000409 3300025921 Bacteria 44486
462 Ga0207652_10004945 3300025921 Bacteria 10791
463 Ga0207652_10007521 3300025921 Bacteria 8769
464 Ga0207652_10038403 3300025921 Bacteria 4059
465 Ga0207652_10076977 3300025921 Bacteria 2910
466 Ga0207652_10212731 3300025921 Bacteria 1741
467 Ga0207646_10192292 3300025922 Bacteria 1843
468 Ga0207681_10027150 3300025923 Bacteria 3699
469 Ga0207694_10000930 3300025924 Bacteria 25962
470 Ga0207694_10002010 3300025924 Bacteria 16833
471 Ga0207694_10013293 3300025924 Bacteria 6199
472 Ga0207694_10085369 3300025924 Bacteria 2484
473 Ga0207694_10132693 3300025924 Bacteria 1997
474 Ga0207650_10059382 3300025925 Bacteria 2850
475 Ga0207650_10165686 3300025925 Bacteria 1754
476 Ga0207650_10244319 3300025925 Bacteria 1451
477 Ga0207659_10042135 3300025926 Bacteria 3199
478 Ga0207659_10136197 3300025926 Bacteria 1901
479 Ga0207687_10008258 3300025927 Bacteria 6810
480 Ga0207687_10062794 3300025927 Bacteria 2628
481 Ga0207700_10001535 3300025928 Bacteria 13085
482 Ga0207700_10296846 3300025928 Bacteria 1394
483 Ga0207664_10000014 3300025929 Bacteria 249865
484 Ga0207664_10000071 3300025929 Bacteria 105708
485 Ga0207664_10000601 3300025929 Bacteria 24933
486 Ga0207644_10042775 3300025931 Bacteria 3212
487 Ga0207690_10000532 3300025932 Bacteria 24801
488 Ga0207690_10001860 3300025932 Bacteria 12965
489 Ga0207690_10108815 3300025932 Bacteria 1993
490 Ga0207690_10109772 3300025932 Bacteria 1985
491 Ga0207690_10137975 3300025932 Bacteria 1793
492 Ga0207706_10008698 3300025933 Bacteria 9352
493 Ga0207706_10011915 3300025933 Bacteria 7916
494 Ga0207706_10013100 3300025933 Bacteria 7546
495 Ga0207706_10042110 3300025933 Bacteria 4047
496 Ga0207706_10049448 3300025933 Bacteria 3715
497 Ga0207706_10470496 3300025933 Bacteria 1086
498 Ga0207686_10000598 3300025934 Bacteria 22543
499 Ga0207709_10000050 3300025935 Bacteria 234391
500 Ga0207709_10000527 3300025935 Bacteria 33281
501 Ga0207709_10009913 3300025935 Bacteria 5247
502 Ga0207704_10000020 3300025938 Bacteria 148847
503 Ga0207704_10013639 3300025938 Bacteria 4076
504 Ga0207691_10003625 3300025940 Bacteria 14989
505 Ga0207691_10014108 3300025940 Bacteria 7622
506 Ga0207691_10046652 3300025940 Bacteria 3980
507 Ga0207711_10014427 3300025941 Bacteria 6563
508 Ga0207711_10023261 3300025941 Bacteria 5186
509 Ga0207689_10001541 3300025942 Bacteria 21894
510 Ga0207689_10001783 3300025942 Bacteria 20340
511 Ga0207661_10001897 3300025944 Bacteria 14342
512 Ga0207661_10045981 3300025944 Bacteria 3459
513 Ga0207661_10209699 3300025944 Bacteria 1716
514 Ga0207661_10248469 3300025944 Bacteria 1580
515 Ga0207679_10004674 3300025945 Bacteria 8528
516 Ga0207667_10000040 3300025949 Bacteria 275827
517 Ga0207667_10000947 3300025949 Bacteria 37022
518 Ga0207667_10007762 3300025949 Bacteria 12828
519 Ga0207667_10072474 3300025949 Bacteria 3580
520 Ga0207667_10103191 3300025949 Bacteria 2941
521 Ga0207667_10149101 3300025949 Bacteria 2408
522 Ga0207667_10205878 3300025949 Bacteria 2017
523 Ga0207667_10238588 3300025949 Bacteria 1861
524 Ga0207651_10000005 3300025960 Bacteria 246132
525 Ga0207712_10000277 3300025961 Bacteria 48990
526 Ga0207712_10001146 3300025961 Bacteria 18465
527 Ga0207712_10014077 3300025961 Bacteria 5135
528 Ga0207712_10021212 3300025961 Bacteria 4262
529 Ga0207668_10005154 3300025972 Bacteria 7689
530 Ga0207668_10018373 3300025972 Bacteria 4398
531 Ga0207640_10000009 3300025981 Bacteria 283101
532 Ga0207640_10000145 3300025981 Bacteria 51603
533 Ga0207640_10005290 3300025981 Bacteria 7031
534 Ga0207640_10014194 3300025981 Bacteria 4579
535 Ga0207640_10098268 3300025981 Bacteria 2046
536 Ga0207640_10133355 3300025981 Bacteria 1799
537 Ga0207658_10149525 3300025986 Bacteria 1901
538 Ga0207677_10000373 3300026023 Bacteria 31103
539 Ga0207677_10471654 3300026023 Bacteria 1080
540 Ga0207703_10004934 3300026035 Bacteria 10830
541 Ga0207639_10001840 3300026041 Bacteria 14285
542 Ga0207639_10004652 3300026041 Bacteria 9240
543 Ga0207639_10007809 3300026041 Bacteria 7304
544 Ga0207639_10014224 3300026041 Bacteria 5589
545 Ga0207639_10020933 3300026041 Bacteria 4692
546 Ga0207639_10293628 3300026041 Bacteria 1434
547 Ga0207639_10693695 3300026041 Bacteria 944
548 Ga0207678_10004979 3300026067 Bacteria 11914
549 Ga0207678_10005889 3300026067 Bacteria 10929
550 Ga0207678_10006369 3300026067 Bacteria 10480
551 Ga0207678_10020914 3300026067 Bacteria 5736
552 Ga0207678_10043979 3300026067 Bacteria 3865
553 Ga0207708_10000004 3300026075 Bacteria 293087
554 Ga0207708_10009224 3300026075 Bacteria 7302
555 Ga0207702_10000172 3300026078 Bacteria 77484
556 Ga0207702_10008380 3300026078 Bacteria 8721
557 Ga0207702_10015708 3300026078 Bacteria 6269
558 Ga0207702_10036014 3300026078 Bacteria 4138
559 Ga0207641_10025775 3300026088 Bacteria 4849
560 Ga0207641_10043596 3300026088 Bacteria 3768
561 Ga0207648_10000017 3300026089 Bacteria 148699
562 Ga0207648_10027096 3300026089 Bacteria 5090
563 Ga0207648_10030744 3300026089 Bacteria 4752
564 Ga0207648_10136587 3300026089 Bacteria 2160
565 Ga0207674_10001921 3300026116 Bacteria 26378
566 Ga0207674_10004423 3300026116 Bacteria 16915
567 Ga0207674_10012476 3300026116 Bacteria 9496
568 Ga0207674_10021680 3300026116 Bacteria 6916
569 Ga0207674_10050289 3300026116 Bacteria 4259
570 Ga0207674_10227566 3300026116 Bacteria 1813
571 Ga0207674_10258908 3300026116 Bacteria 1687
572 Ga0207674_10341215 3300026116 Bacteria 1448
573 Ga0207675_100001976 3300026118 Bacteria 20447
574 Ga0207675_100031644 3300026118 Bacteria 4929
575 Ga0207683_10232436 3300026121 Bacteria 1682
576 Ga0207698_10000931 3300026142 Bacteria 17023
577 Ga0207698_10054723 3300026142 Bacteria 3072
578 Ga0207698_10083396 3300026142 Bacteria 2587
579 Ga0207698_10332722 3300026142 Bacteria 1427
580 Ga0209371_1000018 3300027312 Bacteria 614700
581 Ga0209371_1000025 3300027312 Bacteria 450640
582 Ga0209974_10004171 3300027876 Bacteria 5169
583 Ga0268266_10000006 3300028379 Bacteria 1410021
584 Ga0268266_10026003 3300028379 Bacteria 4979
585 Ga0268266_10027010 3300028379 Bacteria 4884
586 Ga0268266_10031407 3300028379 Bacteria 4510
587 Ga0268266_10305737 3300028379 Bacteria 1485
588 Ga0268265_10061048 3300028380 Bacteria 2891
589 Ga0268265_10566371 3300028380 Bacteria 1081
590 Ga0268264_10148368 3300028381 Bacteria 2100
591 Ga0268264_10298648 3300028381 Bacteria 1515
592 Ga0265319_1000240 3300028563 Bacteria 41199
593 Ga0265318_10002424 3300028577 Bacteria 9972
594 Ga0265338_10212940 3300028800 Bacteria 1449
595 Ga0268256_1000016 3300030500 Bacteria 614700
596 Ga0268256_1000027 3300030500 Bacteria 450640
597 Ga0316181_1114053 3300030744 Bacteria 1726
598 Ga0316181_1268996 3300030744 Bacteria 2554
599 Ga0265332_10014777 3300031238 Bacteria 3451
600 Ga0265320_10000136 3300031240 Bacteria 63022
601 Ga0265325_10001525 3300031241 Bacteria 16241
602 Ga0265325_10042548 3300031241 Bacteria 2374
603 Ga0265329_10000171 3300031242 Bacteria 32652
604 Ga0265340_10003989 3300031247 Bacteria 8293
605 Ga0265339_10065646 3300031249 Bacteria 1945
606 Ga0265331_10000021 3300031250 Bacteria 242632
607 Ga0265331_10016315 3300031250 Bacteria 3902
608 Ga0265316_10001078 3300031344 Bacteria 29506
609 Ga0265316_10012682 3300031344 Bacteria 7544
610 Ga0307513_10158437 3300031456 Bacteria 2160
611 Ga0307408_100005909 3300031548 Bacteria 8152
612 Ga0307408_100073444 3300031548 Bacteria 2535
613 Ga0265313_10001348 3300031595 Bacteria 23135
614 Ga0307508_10065258 3300031616 Bacteria 3208
615 Ga0307508_10284242 3300031616 Bacteria 1248
616 Ga0265314_10007149 3300031711 Bacteria 9723
617 Ga0265342_10000555 3300031712 Bacteria 39457
618 Ga0265342_10104745 3300031712 Bacteria 1607
619 Ga0307413_10022756 3300031824 Bacteria 3384
620 Ga0307413_10085739 3300031824 Bacteria 2034
621 Ga0307413_10088902 3300031824 Bacteria 2005
622 Ga0307413_10126983 3300031824 Bacteria 1739
623 Ga0307410_10002430 3300031852 Bacteria 9007
624 Ga0307410_10029439 3300031852 Bacteria 3496
625 Ga0307410_10040470 3300031852 Bacteria 3067
626 Ga0307406_10002083 3300031901 Bacteria 10912
627 Ga0307406_10005253 3300031901 Bacteria 7079
628 Ga0307406_10186025 3300031901 Bacteria 1517
629 Ga0307407_10043860 3300031903 Bacteria 2517
630 Ga0307412_10093954 3300031911 Bacteria 2105
631 Ga0307412_10217952 3300031911 Bacteria 1461
632 Ga0307409_100049477 3300031995 Bacteria 3205
633 Ga0307409_100063613 3300031995 Bacteria 2894
634 Ga0307416_100110189 3300032002 Bacteria 2423
635 Ga0307414_10000303 3300032004 Bacteria 28561
636 Ga0307414_10002908 3300032004 Bacteria 9058
637 Ga0307414_10380382 3300032004 Bacteria 1220
638 Ga0307411_10076113 3300032005 Bacteria 2293
639 Ga0307411_10076436 3300032005 Bacteria 2289
640 Ga0307411_10084639 3300032005 Bacteria 2194
641 Ga0307415_100140021 3300032126 Bacteria 1846
642 Ga0307415_100354786 3300032126 Bacteria 1236
643 Ga0307507_10093349 3300033179 Bacteria 2564
644 Ga0373926_0027212 3300035083 Bacteria 2002
645 Ga0373952_0035064 3300035092 Bacteria 1134
646 Ga0373945_0006636 3300035116 Bacteria 3739
647 Ga0373956_0063225 3300035119 Bacteria 1678
648 Ga0373943_0002619 3300035170 Bacteria 8184
649 Ga0373935_0014070 3300035692 Bacteria 4832
650 Ga0373927_0031176 3300035695 Bacteria 3477
651 Ga0373933_0018862 3300035724 Bacteria 3886
652 Ga0373933_0093035 3300035724 Bacteria 1863
653 Ga0373947_0004896 3300035725 Bacteria 7838
654 Ga0373947_0036575 3300035725 Bacteria 2912
655 Ga0373937_0049907 3300036401 Bacteria 3832
656 Ga0373937_0366843 3300036401 Bacteria 1365
657 Ga0373925_0000649 3300037068 Bacteria 32703
658 Ga0395899_0036394 3300037312 Bacteria 3692
659 Ga0395900_0000033 3300037418 Bacteria 260271
660 Ga0395900_0000888 3300037418 Bacteria 39271
661 Ga0395900_0009693 3300037418 Bacteria 9869
662 Ga0395900_0010009 3300037418 Bacteria 9702
663 Ga0395900_0054926 3300037418 Bacteria 4100
664 Ga0395898_0000355 3300037466 Bacteria 101003
665 Ga0395898_0040116 3300037466 Bacteria 4632
666 Ga0395898_0425028 3300037466 Bacteria 1266
667 Ga0395905_0006600 3300037471 Bacteria 11643
668 Ga0395905_0041832 3300037471 Bacteria 4300
669 Ga0395905_0109833 3300037471 Bacteria 2589
670 Ga0395905_0111481 3300037471 Bacteria 2569
671 Ga0395905_0116462 3300037471 Bacteria 2512
672 Ga0436364_0570527 3300037853 Bacteria 21688
673 Ga0436364_0714734 3300037853 Bacteria 2049
674 Ga0436364_1332114 3300037853 Bacteria 1998
675 Ga0395901_0008861 3300038443 Bacteria 10186
676 Ga0395901_0015001 3300038443 Bacteria 7876
677 Ga0237819_00212 3300038705 Bacteria 21141
678 Ga0237819_06260 3300038705 Bacteria 1798
679 Ga0436365_0457258 3300039437 Bacteria 12071
680 Ga0436365_1712708 3300039437 Bacteria 68148
681 Ga0439436_0012161 3300041404 Bacteria 2612
682 Ga0439441_007876 3300042001 Bacteria 1729
683 Ga0439449_0079876 3300042007 Bacteria 1206
684 Ga0466972_0014295 3300044658 Bacteria 3977
685 Ga0466972_0020438 3300044658 Bacteria 3308
686 Ga0466965_0055600 3300044683 Bacteria 1969
687 Ga0466961_0097013 3300044693 Bacteria 1859
688 Ga0466961_0099769 3300044693 Bacteria 1830
689 Ga0453684_0121349 3300044712 Bacteria 3155
690 Ga0453684_0671748 3300044712 Bacteria 1128
691 Ga0466970_0021001 3300044765 Bacteria 3399
692 Ga0466970_0086454 3300044765 Bacteria 1699
693 Ga0466960_0007515 3300044901 Bacteria 4430
694 Ga0466959_0049070 3300045049 Bacteria 3101
695 Ga0466959_0201346 3300045049 Bacteria 1386
696 Ga0466959_0267173 3300045049 Bacteria 1177
697 Ga0451576_0049273 3300045051 Bacteria 4420
698 Ga0451576_0386162 3300045051 Bacteria 1468
699 Ga0466967_0520577 3300045976 Bacteria 1169
700 Ga0495627_003294 3300046453 Bacteria 7220
701 Ga0495627_010445 3300046453 Bacteria 3374
702 Ga0495592_0001829 3300046454 Bacteria 14953
703 Ga0495591_013499 3300046458 Bacteria 2983
704 Ga0495638_0000087 3300046460 Bacteria 152531
705 Ga0495638_0000095 3300046460 Bacteria 141825
706 Ga0495638_0000526 3300046460 Bacteria 44654
707 Ga0495651_0000112 3300046462 Bacteria 59789
708 Ga0495651_0004909 3300046462 Bacteria 10229
709 Ga0495651_0037275 3300046462 Bacteria 3785
710 Ga0495653_0008702 3300046463 Bacteria 8315
711 Ga0495653_0057144 3300046463 Bacteria 2972
712 Ga0495650_0000122 3300046471 Bacteria 182888
713 Ga0495580_0004583 3300046472 Bacteria 11600
714 Ga0495582_0000213 3300046473 Bacteria 32186
715 Ga0495639_0003220 3300046475 Bacteria 7093
716 Ga0495662_0021763 3300046476 Bacteria 3098
717 Ga0495664_0027212 3300046477 Bacteria 3333
718 Ga0495664_0029489 3300046477 Bacteria 3209
719 Ga0495664_0103014 3300046477 Bacteria 1720
720 Ga0495606_0000154 3300046507 Bacteria 119458
721 Ga0495608_0005013 3300046511 Bacteria 9472
722 Ga0495608_0015212 3300046511 Bacteria 5339
723 Ga0495628_0010075 3300046516 Bacteria 8042
724 Ga0495630_0046901 3300046517 Bacteria 3230
725 Ga0495630_0111043 3300046517 Bacteria 2077
726 Ga0495630_0172293 3300046517 Bacteria 1649
727 Ga0495632_0035825 3300046519 Bacteria 2528
728 Ga0495643_0001815 3300046522 Bacteria 18211
729 Ga0495663_0003358 3300046525 Bacteria 4627
730 Ga0495663_0004265 3300046525 Bacteria 4031
731 Ga0495642_0008250 3300046528 Bacteria 3984
732 Ga0495652_0001460 3300046529 Bacteria 26134
733 Ga0495652_0039539 3300046529 Bacteria 4078
734 Ga0495665_0000168 3300046531 Bacteria 33008
735 Ga0495665_0002975 3300046531 Bacteria 9159
736 Ga0495640_0089957 3300046533 Unclassified 2027
737 Ga0495640_0137767 3300046533 Bacteria 1575
738 Ga0495586_0007098 3300046535 Bacteria 5970
739 Ga0495586_0044609 3300046535 Bacteria 2389
740 Ga0495586_0127954 3300046535 Bacteria 1421
741 Ga0495587_0008194 3300046536 Bacteria 6734
742 Ga0495645_0018582 3300046543 Bacteria 4995
743 Ga0495622_0069635 3300046557 Bacteria 1624
744 Ga0495633_0005215 3300046558 Bacteria 8016
745 Ga0495633_0006398 3300046558 Bacteria 6986
746 Ga0495667_0002346 3300046559 Bacteria 12657
747 Ga0495667_0021853 3300046559 Bacteria 4314
748 Ga0495656_0001607 3300046615 Bacteria 7396
749 Ga0495668_0000364 3300046616 Bacteria 59836
750 Ga0495625_0010997 3300046660 Bacteria 7425
751 Ga0495625_0025870 3300046660 Bacteria 4442
752 Ga0495625_0078789 3300046660 Bacteria 2299
753 Ga0495635_0005328 3300046663 Bacteria 8955
754 Ga0495635_0181855 3300046663 Unclassified 1429
755 Ga0495657_0004093 3300046675 Bacteria 11695
756 Ga0495657_0155154 3300046675 Bacteria 1419
757 Ga0495623_0199603 3300046679 Unclassified 1151
758 Ga0495646_0004052 3300046680 Bacteria 9190
759 Ga0495647_0000124 3300046681 Bacteria 19840
760 Ga0495647_0087280 3300046681 Bacteria 1274
761 Ga0495658_0001608 3300046683 Bacteria 11762
762 Ga0495613_0002933 3300046689 Bacteria 12776
763 Ga0495613_0068659 3300046689 Bacteria 2585
764 Ga0495624_0023365 3300046690 Bacteria 4077
765 Ga0495670_0025528 3300046691 Bacteria 2923
766 Ga0495671_0033896 3300046692 Bacteria 2599
767 Ga0495649_0010401 3300046694 Bacteria 5489
768 Ga0495600_0001620 3300046809 Bacteria 12555
769 Ga0495600_0003112 3300046809 Bacteria 9714
770 Ga0495581_0000059 3300047315 Bacteria 42676
771 Ga0495581_0153730 3300047315 Bacteria 1344
772 Ga0495604_0004415 3300047317 Bacteria 11133
773 Ga0495674_0008146 3300047319 Bacteria 9996
774 Ga0495674_0142410 3300047319 Bacteria 2015
775 Ga0495672_0000087 3300047320 Bacteria 154275
776 Ga0495680_0001270 3300047322 Bacteria 27523
777 Ga0495680_0004117 3300047322 Bacteria 13982
778 Ga0495680_0014929 3300047322 Bacteria 6713
779 Ga0495675_0000121 3300047444 Bacteria 56852
780 Ga0495675_0010587 3300047444 Bacteria 5764
781 Ga0495675_0068687 3300047444 Bacteria 2238
782 Ga0495684_0002904 3300047471 Bacteria 13490
783 Ga0495684_0004922 3300047471 Bacteria 10428
784 Ga0495684_0005046 3300047471 Bacteria 10306
785 Ga0495684_0007540 3300047471 Bacteria 8420
786 Ga0495684_0036199 3300047471 Bacteria 3785
787 Ga0495686_0004003 3300047472 Bacteria 12335
788 Ga0495686_0021929 3300047472 Bacteria 4231
789 Ga0495593_0020029 3300047673 Bacteria 3746
790 Ga0495602_0002431 3300048088 Bacteria 18968
791 Ga0496100_0034593 3300048903 Bacteria 3172
792 Ga0496101_0022322 3300048904 Bacteria 4355
793 Ga0496101_0061834 3300048904 Bacteria 2721
794 Ga0496104_0013018 3300048907 Bacteria 7491
795 Ga0496104_0013159 3300048907 Bacteria 7459
796 Ga0496105_0058392 3300048908 Bacteria 3185
797 Ga0496106_0265147 3300048909 Bacteria 1375
798 Ga0496107_0196288 3300048910 Bacteria 1500
799 Ga0496108_0119623 3300048911 Bacteria 2258
800 Ga0496108_0703611 3300048911 Bacteria 876
801 Ga0496109_0083637 3300048912 Bacteria 2943
802 Ga0496109_0193734 3300048912 Bacteria 1910
803 Ga0496110_0144262 3300048913 Bacteria 2153
804 Ga0496112_0046779 3300048915 Bacteria 4245
805 Ga0496112_0204691 3300048915 Bacteria 1932
806 Ga0496112_0224091 3300048915 Bacteria 1836
807 Ga0496113_0013073 3300048916 Bacteria 5605
808 Ga0496113_0046259 3300048916 Bacteria 3230
809 Ga0496114_0011751 3300048917 Bacteria 7004
810 Ga0496114_0075849 3300048917 Bacteria 2832
811 Ga0496114_0132116 3300048917 Bacteria 2156
812 Ga0496114_0203032 3300048917 Bacteria 1736
813 Ga0496115_0000116 3300048918 Bacteria 73024
814 Ga0496115_0000233 3300048918 Bacteria 50408
815 Ga0496115_0000293 3300048918 Bacteria 43225
816 Ga0496115_0007196 3300048918 Bacteria 8175
817 Ga0496115_0231491 3300048918 Bacteria 1523
818 Ga0496115_0351060 3300048918 Bacteria 1203
819 Ga0496116_0002572 3300048919 Bacteria 18929
820 Ga0496116_0013614 3300048919 Bacteria 6541
821 Ga0496116_0014949 3300048919 Bacteria 6160
822 Ga0496116_0041201 3300048919 Bacteria 3171
823 Ga0496117_0003980 3300048920 Bacteria 16691
824 Ga0496117_0008136 3300048920 Bacteria 10024
825 Ga0496117_0013164 3300048920 Bacteria 7236
826 Ga0496117_0069791 3300048920 Bacteria 2364
827 Ga0496118_0000260 3300048921 Bacteria 92249
828 Ga0496118_0000953 3300048921 Bacteria 45266
829 Ga0496118_0006046 3300048921 Bacteria 13482
830 Ga0496118_0007889 3300048921 Bacteria 11154
831 Ga0496118_0008964 3300048921 Bacteria 10208
832 Ga0496118_0015832 3300048921 Bacteria 6955
833 Ga0496118_0023738 3300048921 Bacteria 5315
834 Ga0496118_0058708 3300048921 Bacteria 2872
835 Ga0496118_0088913 3300048921 Bacteria 2134
836 Ga0496118_0110485 3300048921 Bacteria 1826
837 Ga0496118_0239116 3300048921 Bacteria 1041
838 Ga0496119_0000048 3300048922 Bacteria 185846
839 Ga0496119_0000711 3300048922 Bacteria 44692
840 Ga0496119_0004893 3300048922 Bacteria 13104
841 Ga0496119_0023171 3300048922 Bacteria 4416
842 Ga0496119_0034191 3300048922 Bacteria 3354
843 Ga0496119_0046818 3300048922 Bacteria 2696
844 Ga0496120_0000113 3300048923 Bacteria 136672
845 Ga0496120_0000519 3300048923 Bacteria 59691
846 Ga0496120_0000727 3300048923 Bacteria 48259
847 Ga0496121_0000013 3300048924 Bacteria 614976
848 Ga0496121_0004863 3300048924 Bacteria 17653
849 Ga0496121_0005121 3300048924 Bacteria 17074
850 Ga0496121_0042740 3300048924 Bacteria 3937
851 Ga0496121_0043735 3300048924 Bacteria 3874
852 Ga0496122_0001140 3300048925 Bacteria 45568
853 Ga0496122_0014529 3300048925 Bacteria 7601
854 Ga0496122_0126649 3300048925 Bacteria 1633
855 Ga0496122_0192224 3300048925 Bacteria 1203
856 Ga0496123_0000942 3300048926 Bacteria 45419
857 Ga0496123_0056542 3300048926 Bacteria 2563
858 Ga0496124_0001552 3300048927 Bacteria 33193
859 Ga0496124_0003834 3300048927 Bacteria 18012
860 Ga0496124_0027671 3300048927 Bacteria 5083
861 Ga0496124_0089185 3300048927 Bacteria 2518
862 Ga0496124_0106341 3300048927 Bacteria 2265
863 Ga0496125_0000722 3300048928 Bacteria 54697
864 Ga0496125_0013105 3300048928 Bacteria 8174
865 Ga0496125_0018451 3300048928 Bacteria 6625
866 Ga0496125_0035604 3300048928 Bacteria 4362
867 Ga0496126_0000057 3300048929 Bacteria 276781
868 Ga0496126_0000320 3300048929 Bacteria 102586
869 Ga0496126_0003861 3300048929 Bacteria 18507
870 Ga0496126_0015014 3300048929 Bacteria 7808
871 Ga0496126_0016096 3300048929 Bacteria 7495
872 Ga0496126_0023194 3300048929 Bacteria 6016
873 Ga0496126_0023341 3300048929 Bacteria 5995
874 Ga0501031_0001796 3300049568 Bacteria 13467
875 Ga0501031_0014464 3300049568 Bacteria 5128
876 Ga0501032_0007207 3300049569 Bacteria 8134
877 Ga0501032_0010231 3300049569 Bacteria 6768
878 Ga0501032_0044695 3300049569 Bacteria 2997
879 Ga0501033_0000086 3300049570 Bacteria 88255
880 Ga0501033_0006023 3300049570 Bacteria 9512
881 Ga0501033_0024833 3300049570 Bacteria 4520
882 Ga0501033_0030820 3300049570 Bacteria 4031
883 Ga0501033_0036085 3300049570 Bacteria 3705
884 Ga0501033_0060447 3300049570 Bacteria 2795
885 Ga0501033_0063173 3300049570 Bacteria 2726
886 Ga0501034_0093322 3300049571 Bacteria 3006
887 Ga0501034_0200942 3300049571 Bacteria 1951
888 Ga0501036_0003611 3300049572 Bacteria 12365
889 Ga0501036_0011588 3300049572 Bacteria 7304
890 Ga0501036_0018586 3300049572 Bacteria 5827
891 Ga0501036_0025725 3300049572 Bacteria 4967
892 Ga0501036_0152836 3300049572 Bacteria 1947
893 Ga0501036_0350644 3300049572 Bacteria 1232
894 Ga0501037_0041500 3300049573 Bacteria 3384
895 Ga0501037_0086830 3300049573 Bacteria 2264
896 Ga0501038_0011732 3300049574 Bacteria 7993
897 Ga0501038_0016254 3300049574 Bacteria 6748
898 Ga0501038_0022471 3300049574 Bacteria 5651
899 Ga0501038_0061319 3300049574 Bacteria 3216
900 Ga0501038_0109817 3300049574 Bacteria 2285
901 Ga0501038_0172902 3300049574 Bacteria 1747
902 Ga0501039_0007126 3300049575 Bacteria 8519
903 Ga0501039_0010959 3300049575 Bacteria 6909
904 Ga0501039_0013495 3300049575 Bacteria 6247
905 Ga0501039_0045023 3300049575 Bacteria 3408
906 Ga0501040_0004213 3300049576 Bacteria 9362
907 Ga0501040_0017688 3300049576 Bacteria 4731
908 Ga0501041_0003615 3300049577 Bacteria 8891
909 Ga0501042_0001952 3300049578 Bacteria 12421
910 Ga0501042_0002596 3300049578 Bacteria 11110
911 Ga0501042_0364241 3300049578 Bacteria 1046
912 Ga0501043_0005825 3300049579 Bacteria 9912
913 Ga0501043_0045918 3300049579 Bacteria 3434
914 Ga0501043_0111954 3300049579 Bacteria 2143
915 Ga0501046_0001919 3300049580 Bacteria 19740
916 Ga0501046_0007819 3300049580 Bacteria 9381
917 Ga0501047_0011238 3300049581 Bacteria 8473
918 Ga0501047_0011692 3300049581 Bacteria 8299
919 Ga0501047_0466423 3300049581 Bacteria 1091
920 Ga0501048_0137342 3300049582 Bacteria 1728
921 Ga0501048_0209232 3300049582 Bacteria 1383
922 Ga0501068_0001687 3300049584 Bacteria 11780
923 Ga0501068_0019942 3300049584 Bacteria 3901
924 Ga0501069_0004963 3300049585 Bacteria 6903
925 Ga0501070_0000269 3300049586 Bacteria 49060
926 Ga0501070_0170031 3300049586 Bacteria 1795
927 Ga0501070_0267493 3300049586 Bacteria 1397
928 Ga0501070_0397768 3300049586 Bacteria 1114
929 Ga0501072_0019466 3300049588 Bacteria 5248
930 Ga0501072_0223635 3300049588 Bacteria 1500
931 Ga0501073_0000408 3300049589 Bacteria 29377
932 Ga0501073_0080842 3300049589 Bacteria 2261
933 Ga0501074_0011170 3300049590 Bacteria 6523
934 Ga0501074_0056693 3300049590 Bacteria 2824
935 Ga0501075_0158630 3300049591 Bacteria 1726
936 Ga0501076_0001011 3300049592 Bacteria 18469
937 Ga0501076_0007819 3300049592 Bacteria 7792
938 Ga0501076_0122416 3300049592 Bacteria 2106
939 Ga0501077_0004162 3300049593 Bacteria 8740
940 Ga0501077_0011204 3300049593 Bacteria 5594
941 Ga0501077_0020571 3300049593 Bacteria 4178
942 Ga0501079_0012719 3300049741 Bacteria 6429
943 Ga0501079_0234515 3300049741 Bacteria 1434
944 Ga0501079_0251816 3300049741 Bacteria 1380
945 Ga0501080_0012126 3300049742 Bacteria 7896
946 Ga0501080_0030603 3300049742 Bacteria 5016
947 Ga0501080_0533340 3300049742 Bacteria 1046
948 Ga0501081_0002043 3300049743 Bacteria 12580
949 Ga0501081_0128766 3300049743 Bacteria 1807
950 Ga0501083_0000990 3300049744 Bacteria 18870
951 Ga0501035_0008776 3300049822 Bacteria 9410
952 Ga0501035_0020150 3300049822 Bacteria 6124
953 Ga0501035_0029675 3300049822 Bacteria 4987
954 Ga0501035_0072308 3300049822 Bacteria 3052
955 Ga0501035_0277633 3300049822 Bacteria 1417
956 Ga0501044_0000749 3300049823 Bacteria 39273
957 Ga0501044_0002590 3300049823 Bacteria 20558
958 Ga0501044_0013084 3300049823 Bacteria 8981
959 Ga0501044_0039363 3300049823 Bacteria 4933
960 Ga0501044_0358588 3300049823 Bacteria 1376
961 Ga0501044_0432093 3300049823 Bacteria 1226
962 Ga0501044_0481197 3300049823 Bacteria 1144
963 Ga0501044_0622771 3300049823 Bacteria 970
964 Ga0501045_0005098 3300049824 Bacteria 9093
965 Ga0501045_0010906 3300049824 Bacteria 6364
966 nmdc:mga05p37_22411_c1 3300050507 Bacteria 7662
967 nmdc:mga05p37_470558_c1 3300050507 Bacteria 1450
968 nmdc:mga09592_1422_c1 3300050508 Bacteria 19206
969 nmdc:mga09592_170495_c1 3300050508 Bacteria 1882
970 nmdc:mga0qj67_25287_c1 3300050509 Bacteria 4586
971 nmdc:mga0qj67_338480_c1 3300050509 Bacteria 1217
972 nmdc:mga06r32_20879_c1 3300050510 Bacteria 6037
973 nmdc:mga06r32_247156_c1 3300050510 Bacteria 1771
974 nmdc:mga08y16_123927_c1 3300050511 Bacteria 2689
975 nmdc:mga08y16_1627_c1 3300050511 Bacteria 22743
976 nmdc:mga0n895_30080_c1 3300050512 Bacteria 5186
977 nmdc:mga0a205_113774_c1 3300050515 Bacteria 2605
978 Ga0495619_0040301 3300053085 Bacteria 3053
979 Ga0500651_0047289 3300053093 Bacteria 2705
980 Ga0500595_000162 3300053119 Bacteria 44030
981 Ga0500568_0000316 3300053139 Bacteria 38483
982 Ga0500573_0000049 3300053140 Bacteria 96218
983 Ga0500590_000735 3300053148 Bacteria 11952
984 Ga0500634_0000377 3300053161 Bacteria 14223
985 Ga0501084_0020970 3300054114 Bacteria 5449
986 Ga0501082_0027265 3300060353 Bacteria 4919
987 Ga0501082_0334484 3300060353 Bacteria 1319
988 Ga0530510_0002588 3300061734 Bacteria 12423
989 Ga0530510_0004408 3300061734 Bacteria 9747

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045049 Ga0466959_0201346 Ga0466959_0201346_625_1374 235
2 3300048911 Ga0496108_0703611 Ga0496108_0703611_86_823 238
3 3300049588 Ga0501072_0223635 Ga0501072_0223635_21_755 244
4 3300049824 Ga0501045_0010906 Ga0501045_0010906_22_801 248
5 3300005455 Ga0070663_100181951 Ga0070663_1001819511 279
6 3300031824 Ga0307413_10022756 Ga0307413_100227564 279
7 3300005353 Ga0070669_100021816 Ga0070669_1000218164 281
8 3300005543 Ga0070672_100021437 Ga0070672_1000214372 281
9 3300025940 Ga0207691_10014108 Ga0207691_100141084 281
10 3300044765 Ga0466970_0086454 Ga0466970_0086454_796_1683 281
11 3300007788 Ga0099795_10004112 Ga0099795_100041122 282
12 3300035119 Ga0373956_0063225 Ga0373956_0063225_25_927 287
13 3300048910 Ga0496107_0196288 Ga0496107_0196288_274_1137 287
14 3300050512 nmdc:mga0n895_30080_c1 nmdc:mga0n895_30080_c1_1390_2253 287
15 iso_pu_bacteria 3002998708 3003003577 287
16 iso_pu_bacteria 8053945823 8053951975 287
17 3300009094 Ga0111539_10049401 Ga0111539_100494012 288
18 3300030744 Ga0316181_1114053 Ga0316181_11140532 288
19 3300036401 Ga0373937_0366843 Ga0373937_0366843_24_896 288
20 3300042007 Ga0439449_0079876 Ga0439449_0079876_62_979 288
21 3300050507 nmdc:mga05p37_470558_c1 nmdc:mga05p37_470558_c1_44_910 288
22 iso_pu_bacteria 2643221632 2644181827 288
23 iso_pu_bacteria 2844841374 2844844335 288
24 iso_pu_bacteria 2844852863 2844853635 288
25 iso_pu_bacteria 2919055335 2919056285 288
26 iso_pu_bacteria 2919523602 2919526287 288
27 iso_pu_bacteria 2928153084 2928154418 288
28 3300005445 Ga0070708_100005216 Ga0070708_1000052164 290
29 3300048921 Ga0496118_0239116 Ga0496118_0239116_17_889 290
30 3300005367 Ga0070667_100273171 Ga0070667_1002731713 291
31 3300005445 Ga0070708_100382634 Ga0070708_1003826342 291
32 3300005467 Ga0070706_100017183 Ga0070706_1000171833 291
33 3300005471 Ga0070698_100025964 Ga0070698_1000259642 291
34 3300009148 Ga0105243_10014541 Ga0105243_100145415 291
35 3300015261 Ga0182006_1030792 Ga0182006_10307922 291
36 3300015265 Ga0182005_1048792 Ga0182005_10487921 291
37 3300025910 Ga0207684_10076825 Ga0207684_100768252 291
38 3300025986 Ga0207658_10149525 Ga0207658_101495252 291
39 3300035092 Ga0373952_0035064 Ga0373952_0035064_244_1119 291
40 3300044693 Ga0466961_0097013 Ga0466961_0097013_432_1352 291
41 3300044693 Ga0466961_0099769 Ga0466961_0099769_396_1316 291
42 3300044765 Ga0466970_0021001 Ga0466970_0021001_2131_3051 291
43 3300046453 Ga0495627_010445 Ga0495627_010445_2418_3305 291
44 3300046519 Ga0495632_0035825 Ga0495632_0035825_30_917 291
45 3300046522 Ga0495643_0001815 Ga0495643_0001815_2964_3839 291
46 3300046558 Ga0495633_0006398 Ga0495633_0006398_64_951 291
47 3300046660 Ga0495625_0078789 Ga0495625_0078789_303_1178 291
48 3300047320 Ga0495672_0000087 Ga0495672_0000087_17451_18326 291
49 3300048919 Ga0496116_0041201 Ga0496116_0041201_2105_2980 291
50 3300048921 Ga0496118_0008964 Ga0496118_0008964_5343_6254 291
51 3300048922 Ga0496119_0023171 Ga0496119_0023171_23_898 291
52 3300048925 Ga0496122_0192224 Ga0496122_0192224_313_1188 291
53 3300048929 Ga0496126_0015014 Ga0496126_0015014_2507_3418 291
54 3300049568 Ga0501031_0014464 Ga0501031_0014464_852_1772 291
55 3300049570 Ga0501033_0030820 Ga0501033_0030820_458_1378 291
56 3300049572 Ga0501036_0003611 Ga0501036_0003611_7830_8750 291
57 3300049574 Ga0501038_0011732 Ga0501038_0011732_6357_7277 291
58 3300049574 Ga0501038_0172902 Ga0501038_0172902_740_1660 291
59 3300049575 Ga0501039_0007126 Ga0501039_0007126_7109_8029 291
60 3300049576 Ga0501040_0004213 Ga0501040_0004213_5245_6165 291
61 3300049577 Ga0501041_0003615 Ga0501041_0003615_5218_6138 291
62 3300049582 Ga0501048_0137342 Ga0501048_0137342_756_1670 291
63 3300049584 Ga0501068_0019942 Ga0501068_0019942_2950_3858 291
64 3300049592 Ga0501076_0007819 Ga0501076_0007819_5244_6164 291
65 3300049593 Ga0501077_0011204 Ga0501077_0011204_3635_4555 291
66 3300049741 Ga0501079_0012719 Ga0501079_0012719_3504_4424 291
67 3300049741 Ga0501079_0234515 Ga0501079_0234515_481_1395 291
68 3300049742 Ga0501080_0533340 Ga0501080_0533340_71_991 291
69 3300049743 Ga0501081_0128766 Ga0501081_0128766_492_1412 291
70 3300053161 Ga0500634_0000377 Ga0500634_0000377_13270_14157 291
71 3300054114 Ga0501084_0020970 Ga0501084_0020970_3919_4839 291
72 3300060353 Ga0501082_0027265 Ga0501082_0027265_3671_4591 291
73 3300061734 Ga0530510_0004408 Ga0530510_0004408_540_1460 291
74 3300001989 JGI24739J22299_10055207 JGI24739J22299_100552072 292
75 3300001990 JGI24737J22298_10002869 JGI24737J22298_100028692 292
76 3300002067 JGI24735J21928_10000213 JGI24735J21928_1000021313 292
77 3300003578 Ga0006562J51391_1007922 Ga0006562J51391_10079222 292
78 3300003578 Ga0006562J51391_1007923 Ga0006562J51391_10079234 292
79 3300003752 Ga0055539_1000014 Ga0055539_10000145 292
80 3300003756 Ga0055533_1000002 Ga0055533_1000002792 292
81 3300003759 Ga0055525_1005588 Ga0055525_10055882 292
82 3300003841 Ga0055541_1000497 Ga0055541_10004979 292
83 3300005327 Ga0070658_10000065 Ga0070658_1000006535 292
84 3300005327 Ga0070658_10016063 Ga0070658_100160633 292
85 3300005435 Ga0070714_100000007 Ga0070714_10000000781 292
86 3300005435 Ga0070714_100179606 Ga0070714_1001796062 292
87 3300005441 Ga0070700_100000015 Ga0070700_10000001564 292
88 3300005455 Ga0070663_100174476 Ga0070663_1001744762 292
89 3300005539 Ga0068853_100195851 Ga0068853_1001958512 292
90 3300009551 Ga0105238_10073696 Ga0105238_100736962 292
91 3300009551 Ga0105238_10543702 Ga0105238_105437022 292
92 3300013102 Ga0157371_10080697 Ga0157371_100806972 292
93 3300013104 Ga0157370_10065485 Ga0157370_100654853 292
94 3300013105 Ga0157369_10301602 Ga0157369_103016022 292
95 3300013296 Ga0157374_10265052 Ga0157374_102650522 292
96 3300013306 Ga0163162_10670611 Ga0163162_106706112 292
97 3300013307 Ga0157372_10000004 Ga0157372_10000004180 292
98 3300013307 Ga0157372_10118468 Ga0157372_101184682 292
99 3300013308 Ga0157375_10234511 Ga0157375_102345112 292
100 3300025225 Ga0209566_100056 Ga0209566_100056218 292
101 3300025226 Ga0209674_100001 Ga0209674_1000012772 292
102 3300025230 Ga0209563_100001 Ga0209563_1000012772 292
103 3300025253 Ga0209677_100001 Ga0209677_1000012772 292
104 3300025904 Ga0207647_10010284 Ga0207647_100102845 292
105 3300025904 Ga0207647_10026222 Ga0207647_100262223 292
106 3300025904 Ga0207647_10051240 Ga0207647_100512402 292
107 3300025909 Ga0207705_10000001 Ga0207705_100000011030 292
108 3300025929 Ga0207664_10000014 Ga0207664_10000014150 292
109 3300026067 Ga0207678_10043979 Ga0207678_100439791 292
110 3300026075 Ga0207708_10000004 Ga0207708_10000004231 292
111 3300037418 Ga0395900_0000888 Ga0395900_0000888_17404_18291 292
112 3300037466 Ga0395898_0000355 Ga0395898_0000355_61411_62298 292
113 3300044658 Ga0466972_0014295 Ga0466972_0014295_1447_2334 292
114 3300044658 Ga0466972_0020438 Ga0466972_0020438_300_1187 292
115 3300044683 Ga0466965_0055600 Ga0466965_0055600_447_1334 292
116 3300044901 Ga0466960_0007515 Ga0466960_0007515_821_1708 292
117 3300046535 Ga0495586_0127954 Ga0495586_0127954_146_1039 292
118 3300048904 Ga0496101_0022322 Ga0496101_0022322_3167_4054 292
119 3300048907 Ga0496104_0013018 Ga0496104_0013018_6248_7135 292
120 3300048909 Ga0496106_0265147 Ga0496106_0265147_402_1289 292
121 3300048912 Ga0496109_0193734 Ga0496109_0193734_125_1051 292
122 3300048915 Ga0496112_0046779 Ga0496112_0046779_332_1264 292
123 3300048916 Ga0496113_0046259 Ga0496113_0046259_563_1495 292
124 3300048917 Ga0496114_0203032 Ga0496114_0203032_381_1268 292
125 3300048918 Ga0496115_0231491 Ga0496115_0231491_551_1438 292
126 3300048922 Ga0496119_0034191 Ga0496119_0034191_1677_2564 292
127 3300048926 Ga0496123_0056542 Ga0496123_0056542_695_1582 292
128 3300049570 Ga0501033_0036085 Ga0501033_0036085_377_1264 292
129 3300049578 Ga0501042_0001952 Ga0501042_0001952_214_1101 292
130 3300049586 Ga0501070_0000269 Ga0501070_0000269_27673_28560 292
131 3300049744 Ga0501083_0000990 Ga0501083_0000990_6618_7505 292
132 3300049822 Ga0501035_0277633 Ga0501035_0277633_14_901 292
133 3300049823 Ga0501044_0432093 Ga0501044_0432093_92_979 292
134 iso_pu_bacteria 2852649853 2852652124 292
135 iso_pu_bacteria 8056037122 8056040431 292
136 3300035116 Ga0373945_0006636 Ga0373945_0006636_1517_2422 293
137 3300035170 Ga0373943_0002619 Ga0373943_0002619_4813_5718 293
138 3300035692 Ga0373935_0014070 Ga0373935_0014070_139_1044 293
139 3300035695 Ga0373927_0031176 Ga0373927_0031176_1651_2556 293
140 3300035724 Ga0373933_0018862 Ga0373933_0018862_2210_3115 293
141 3300035725 Ga0373947_0004896 Ga0373947_0004896_4411_5316 293
142 3300035725 Ga0373947_0036575 Ga0373947_0036575_1423_2304 293
143 3300036401 Ga0373937_0049907 Ga0373937_0049907_1117_2022 293
144 3300037068 Ga0373925_0000649 Ga0373925_0000649_9040_9945 293
145 3300046472 Ga0495580_0004583 Ga0495580_0004583_10020_10925 293
146 3300046473 Ga0495582_0000213 Ga0495582_0000213_23675_24580 293
147 3300046475 Ga0495639_0003220 Ga0495639_0003220_4523_5428 293
148 3300046476 Ga0495662_0021763 Ga0495662_0021763_599_1504 293
149 3300046531 Ga0495665_0000168 Ga0495665_0000168_20514_21419 293
150 3300046663 Ga0495635_0005328 Ga0495635_0005328_7607_8512 293
151 3300046681 Ga0495647_0000124 Ga0495647_0000124_11955_12860 293
152 3300046683 Ga0495658_0001608 Ga0495658_0001608_1701_2606 293
153 3300046689 Ga0495613_0002933 Ga0495613_0002933_8948_9853 293
154 3300046809 Ga0495600_0003112 Ga0495600_0003112_8495_9400 293
155 3300047315 Ga0495581_0000059 Ga0495581_0000059_28131_29036 293
156 3300047471 Ga0495684_0004922 Ga0495684_0004922_7736_8641 293
157 3300005331 Ga0070670_100086016 Ga0070670_1000860162 294
158 3300005354 Ga0070675_100025078 Ga0070675_1000250784 294
159 3300005577 Ga0068857_100014249 Ga0068857_1000142494 294
160 3300009094 Ga0111539_10043138 Ga0111539_100431382 294
161 3300009098 Ga0105245_10001804 Ga0105245_1000180411 294
162 3300009174 Ga0105241_10012868 Ga0105241_100128684 294
163 3300013104 Ga0157370_10082723 Ga0157370_100827233 294
164 3300025926 Ga0207659_10136197 Ga0207659_101361973 294
165 3300026089 Ga0207648_10030744 Ga0207648_100307444 294
166 3300026116 Ga0207674_10021680 Ga0207674_100216806 294
167 3300031852 Ga0307410_10002430 Ga0307410_100024305 294
168 3300031901 Ga0307406_10186025 Ga0307406_101860252 294
169 3300031995 Ga0307409_100063613 Ga0307409_1000636133 294
170 3300032005 Ga0307411_10084639 Ga0307411_100846393 294
171 3300037853 Ga0436364_1332114 Ga0436364_1332114_974_1894 294
172 3300047315 Ga0495581_0153730 Ga0495581_0153730_169_1125 294
173 3300047471 Ga0495684_0036199 Ga0495684_0036199_2778_3734 294
174 3300005459 Ga0068867_100299750 Ga0068867_1002997502 296
175 3300005843 Ga0068860_100061738 Ga0068860_1000617383 296
176 3300006844 Ga0075428_100008733 Ga0075428_10000873311 296
177 3300006881 Ga0068865_100122851 Ga0068865_1001228512 296
178 3300009148 Ga0105243_10008647 Ga0105243_100086472 296
179 3300009174 Ga0105241_10282502 Ga0105241_102825022 296
180 3300013297 Ga0157378_10144915 Ga0157378_101449152 296
181 3300025933 Ga0207706_10049448 Ga0207706_100494483 296
182 3300025940 Ga0207691_10046652 Ga0207691_100466523 296
183 3300026089 Ga0207648_10136587 Ga0207648_101365872 296
184 3300028381 Ga0268264_10298648 Ga0268264_102986481 296
185 3300046460 Ga0495638_0000526 Ga0495638_0000526_9292_10182 296
186 3300046528 Ga0495642_0008250 Ga0495642_0008250_1772_2662 296
187 3300048921 Ga0496118_0110485 Ga0496118_0110485_766_1656 296
188 iso_pu_bacteria 2576861471 2578456972 296
189 iso_pu_bacteria 2941475908 2941478747 296
190 iso_pu_bacteria 2941489479 2941492614 296
191 iso_pu_bacteria 2987605356 2987608822 296
192 iso_pu_bacteria 2995948881 2995949724 296
193 3300003203 JGI25406J46586_10015012 JGI25406J46586_100150123 297
194 3300003773 Ga0055537_1001615 Ga0055537_10016159 297
195 3300005435 Ga0070714_100000025 Ga0070714_10000002541 297
196 3300005536 Ga0070697_100053485 Ga0070697_1000534852 297
197 3300006051 Ga0075364_10061999 Ga0075364_100619992 297
198 3300006844 Ga0075428_100002309 Ga0075428_10000230923 297
199 3300006846 Ga0075430_100065318 Ga0075430_1000653183 297
200 3300006847 Ga0075431_100013904 Ga0075431_1000139046 297
201 3300009094 Ga0111539_10063244 Ga0111539_100632442 297
202 3300009147 Ga0114129_10001539 Ga0114129_1000153914 297
203 3300009147 Ga0114129_10014853 Ga0114129_100148539 297
204 3300009177 Ga0105248_10262904 Ga0105248_102629042 297
205 3300009551 Ga0105238_10002948 Ga0105238_100029487 297
206 3300009553 Ga0105249_10030480 Ga0105249_100304805 297
207 3300010375 Ga0105239_10319165 Ga0105239_103191651 297
208 3300013102 Ga0157371_10182732 Ga0157371_101827321 297
209 3300013105 Ga0157369_10030897 Ga0157369_100308973 297
210 3300013105 Ga0157369_10196583 Ga0157369_101965832 297
211 3300013306 Ga0163162_10009246 Ga0163162_100092465 297
212 3300013308 Ga0157375_10389508 Ga0157375_103895082 297
213 3300014325 Ga0163163_10091541 Ga0163163_100915413 297
214 3300014326 Ga0157380_10033964 Ga0157380_100339642 297
215 3300025929 Ga0207664_10000071 Ga0207664_1000007198 297
216 3300025972 Ga0207668_10018373 Ga0207668_100183732 297
217 3300026121 Ga0207683_10232436 Ga0207683_102324362 297
218 3300032126 Ga0307415_100354786 Ga0307415_1003547862 297
219 3300045051 Ga0451576_0049273 Ga0451576_0049273_28_921 297
220 3300046458 Ga0495591_013499 Ga0495591_013499_1823_2716 297
221 3300046681 Ga0495647_0087280 Ga0495647_0087280_365_1258 297
222 3300048915 Ga0496112_0204691 Ga0496112_0204691_164_1057 297
223 3300048921 Ga0496118_0007889 Ga0496118_0007889_2881_3774 297
224 3300048921 Ga0496118_0088913 Ga0496118_0088913_1227_2120 297
225 3300048925 Ga0496122_0126649 Ga0496122_0126649_463_1356 297
226 3300049570 Ga0501033_0024833 Ga0501033_0024833_3031_3924 297
227 3300049570 Ga0501033_0063173 Ga0501033_0063173_587_1480 297
228 3300049572 Ga0501036_0350644 Ga0501036_0350644_221_1114 297
229 3300049575 Ga0501039_0045023 Ga0501039_0045023_812_1705 297
230 3300049578 Ga0501042_0364241 Ga0501042_0364241_80_973 297
231 3300049585 Ga0501069_0004963 Ga0501069_0004963_1762_2655 297
232 3300049586 Ga0501070_0397768 Ga0501070_0397768_50_943 297
233 3300049588 Ga0501072_0019466 Ga0501072_0019466_1512_2405 297
234 3300049589 Ga0501073_0080842 Ga0501073_0080842_1060_1953 297
235 3300049590 Ga0501074_0011170 Ga0501074_0011170_4273_5166 297
236 3300049590 Ga0501074_0056693 Ga0501074_0056693_1434_2327 297
237 3300049592 Ga0501076_0001011 Ga0501076_0001011_3904_4797 297
238 3300049593 Ga0501077_0004162 Ga0501077_0004162_38_931 297
239 3300049741 Ga0501079_0251816 Ga0501079_0251816_113_1006 297
240 3300049742 Ga0501080_0030603 Ga0501080_0030603_2934_3827 297
241 3300049743 Ga0501081_0002043 Ga0501081_0002043_4565_5458 297
242 3300049822 Ga0501035_0020150 Ga0501035_0020150_2032_2925 297
243 3300049823 Ga0501044_0481197 Ga0501044_0481197_182_1075 297
244 3300050507 nmdc:mga05p37_22411_c1 nmdc:mga05p37_22411_c1_3626_4519 297
245 3300050508 nmdc:mga09592_1422_c1 nmdc:mga09592_1422_c1_5298_6191 297
246 3300050508 nmdc:mga09592_170495_c1 nmdc:mga09592_170495_c1_226_1119 297
247 3300050509 nmdc:mga0qj67_25287_c1 nmdc:mga0qj67_25287_c1_2681_3574 297
248 3300050510 nmdc:mga06r32_20879_c1 nmdc:mga06r32_20879_c1_2001_2894 297
249 3300050510 nmdc:mga06r32_247156_c1 nmdc:mga06r32_247156_c1_47_940 297
250 3300050511 nmdc:mga08y16_123927_c1 nmdc:mga08y16_123927_c1_1274_2167 297
251 3300050515 nmdc:mga0a205_113774_c1 nmdc:mga0a205_113774_c1_1014_1907 297
252 3300060353 Ga0501082_0334484 Ga0501082_0334484_381_1274 297
253 3300061734 Ga0530510_0002588 Ga0530510_0002588_323_1216 297
254 iso_pu_bacteria 2537561836 2538835230 297
255 iso_pu_bacteria 2547132130 2547503584 297
256 iso_pu_bacteria 2643221562 2643828613 297
257 iso_pu_bacteria 2643221577 2643896244 297
258 iso_pu_bacteria 2643221579 2643909325 297
259 iso_pu_bacteria 2643221581 2643914826 297
260 iso_pu_bacteria 2643221593 2643973271 297
261 iso_pu_bacteria 2643221685 2644478458 297
262 iso_pu_bacteria 2687453130 2687582201 297
263 iso_pu_bacteria 2747842428 2747949938 297
264 iso_pu_bacteria 2747842501 2748019670 297
265 iso_pu_bacteria 2765235840 2765580534 297
266 iso_pu_bacteria 2816332141 2816518442 297
267 iso_pu_bacteria 2842391507 2842394449 297
268 iso_pu_bacteria 2852684882 2852687184 297
269 iso_pu_bacteria 2857442823 2857446854 297
270 iso_pu_bacteria 2874220319 2874223197 297
271 iso_pu_bacteria 2884411467 2884414161 297
272 iso_pu_bacteria 2895395659 2895397974 297
273 iso_pu_bacteria 2919089067 2919093232 297
274 iso_pu_bacteria 2919130084 2919131059 297
275 iso_pu_bacteria 2919134579 2919138747 297
276 iso_pu_bacteria 2923516293 2923517265 297
277 iso_pu_bacteria 2928496128 2928499863 297
278 iso_pu_bacteria 2928963466 2928963689 297
279 iso_pu_bacteria 2929195423 2929196299 297
280 iso_pu_bacteria 2931380184 2931383366 297
281 iso_pu_bacteria 2937610967 2937614339 297
282 iso_pu_bacteria 2939589442 2939589835 297
283 iso_pu_bacteria 2939611941 2939613570 297
284 iso_pu_bacteria 2939626828 2939630929 297
285 iso_pu_bacteria 2952252522 2952255999 297
286 iso_pu_bacteria 2961047084 2961049961 297
287 iso_pu_bacteria 2961064222 2961064876 297
288 iso_pu_bacteria 2974307012 2974307620 297
289 iso_pu_bacteria 2977247770 2977248331 297
290 iso_pu_bacteria 2984514374 2984517176 297
291 iso_pu_bacteria 8021622325 8021625567 297
292 iso_pu_bacteria 8021626552 8021630554 297
293 iso_pu_bacteria 8021648035 8021649736 297
294 3300005338 Ga0068868_100169688 Ga0068868_1001696882 298
295 3300005343 Ga0070687_100100108 Ga0070687_1001001082 298
296 3300005347 Ga0070668_100297144 Ga0070668_1002971442 298
297 3300005365 Ga0070688_100213269 Ga0070688_1002132691 298
298 3300005544 Ga0070686_100193262 Ga0070686_1001932622 298
299 3300005549 Ga0070704_100071046 Ga0070704_1000710462 298
300 3300005842 Ga0068858_100098118 Ga0068858_1000981182 298
301 3300005985 Ga0081539_10000105 Ga0081539_10000105107 298
302 3300006844 Ga0075428_100713931 Ga0075428_1007139311 298
303 3300009147 Ga0114129_10148798 Ga0114129_101487982 298
304 3300009148 Ga0105243_10011470 Ga0105243_100114704 298
305 3300009176 Ga0105242_10007241 Ga0105242_100072418 298
306 3300013297 Ga0157378_10562746 Ga0157378_105627461 298
307 3300014326 Ga0157380_10299929 Ga0157380_102999291 298
308 3300017792 Ga0163161_10184246 Ga0163161_101842462 298
309 3300021388 Ga0213875_10049732 Ga0213875_100497322 298
310 3300025899 Ga0207642_10161387 Ga0207642_101613871 298
311 3300026118 Ga0207675_100031644 Ga0207675_1000316444 298
312 3300028380 Ga0268265_10566371 Ga0268265_105663711 298
313 3300037853 Ga0436364_0570527 Ga0436364_0570527_14962_15897 298
314 3300050509 nmdc:mga0qj67_338480_c1 nmdc:mga0qj67_338480_c1_54_950 298
315 3300053085 Ga0495619_0040301 Ga0495619_0040301_149_1051 298
316 3300001990 JGI24737J22298_10016551 JGI24737J22298_100165512 300
317 3300003771 Ga0055526_1000005 Ga0055526_1000005239 300
318 3300003773 Ga0055537_1000042 Ga0055537_100004291 300
319 3300003775 Ga0055524_1000005 Ga0055524_1000005240 300
320 3300003784 Ga0055534_1000002 Ga0055534_100000290 300
321 3300003790 Ga0055528_1000002 Ga0055528_100000290 300
322 3300005327 Ga0070658_10122941 Ga0070658_101229412 300
323 3300005328 Ga0070676_10002175 Ga0070676_100021753 300
324 3300005334 Ga0068869_100000848 Ga0068869_1000008483 300
325 3300005338 Ga0068868_100000154 Ga0068868_10000015420 300
326 3300005364 Ga0070673_100000023 Ga0070673_10000002382 300
327 3300005435 Ga0070714_100234025 Ga0070714_1002340252 300
328 3300005455 Ga0070663_100001998 Ga0070663_1000019984 300
329 3300005459 Ga0068867_100000007 Ga0068867_10000000724 300
330 3300005539 Ga0068853_100025947 Ga0068853_1000259475 300
331 3300005578 Ga0068854_100000027 Ga0068854_1000000273 300
332 3300005578 Ga0068854_100368849 Ga0068854_1003688492 300
333 3300005718 Ga0068866_10036810 Ga0068866_100368102 300
334 3300006237 Ga0097621_100002061 Ga0097621_1000020618 300
335 3300006358 Ga0068871_100002074 Ga0068871_1000020748 300
336 3300006881 Ga0068865_100000010 Ga0068865_100000010156 300
337 3300009098 Ga0105245_10056362 Ga0105245_100563622 300
338 3300009148 Ga0105243_10000950 Ga0105243_1000095024 300
339 3300009174 Ga0105241_10011546 Ga0105241_100115463 300
340 3300009176 Ga0105242_10000210 Ga0105242_1000021024 300
341 3300009553 Ga0105249_10017303 Ga0105249_100173036 300
342 3300009993 Ga0105028_101804 Ga0105028_1018042 300
343 3300010375 Ga0105239_10004123 Ga0105239_1000412311 300
344 3300013102 Ga0157371_10000397 Ga0157371_1000039726 300
345 3300013296 Ga0157374_10000830 Ga0157374_1000083024 300
346 3300013297 Ga0157378_10001477 Ga0157378_1000147717 300
347 3300013308 Ga0157375_10002120 Ga0157375_1000212013 300
348 3300014745 Ga0157377_10014848 Ga0157377_100148484 300
349 3300014969 Ga0157376_10000047 Ga0157376_1000004724 300
350 3300015261 Ga0182006_1012948 Ga0182006_10129484 300
351 3300015262 Ga0182007_10000079 Ga0182007_1000007917 300
352 3300015265 Ga0182005_1000166 Ga0182005_10001669 300
353 3300015689 Ga0183360_10002 Ga0183360_10002856 300
354 3300024227 Ga0228598_1013405 Ga0228598_10134052 300
355 3300025263 Ga0209565_1000001 Ga0209565_1000001546 300
356 3300025273 Ga0209673_1000001 Ga0209673_1000001546 300
357 3300025291 Ga0209675_1000001 Ga0209675_10000011986 300
358 3300025295 Ga0209564_1000001 Ga0209564_10000012148 300
359 3300025299 Ga0209256_1000006 Ga0209256_1000006584 300
360 3300025907 Ga0207645_10009242 Ga0207645_100092423 300
361 3300025909 Ga0207705_10059428 Ga0207705_100594282 300
362 3300025911 Ga0207654_10024425 Ga0207654_100244252 300
363 3300025927 Ga0207687_10008258 Ga0207687_100082582 300
364 3300025934 Ga0207686_10000598 Ga0207686_100005984 300
365 3300025935 Ga0207709_10000050 Ga0207709_10000050227 300
366 3300025938 Ga0207704_10000020 Ga0207704_10000020137 300
367 3300025942 Ga0207689_10001541 Ga0207689_1000154110 300
368 3300025960 Ga0207651_10000005 Ga0207651_1000000524 300
369 3300025961 Ga0207712_10021212 Ga0207712_100212122 300
370 3300025981 Ga0207640_10000145 Ga0207640_1000014539 300
371 3300026023 Ga0207677_10000373 Ga0207677_100003734 300
372 3300026041 Ga0207639_10007809 Ga0207639_100078092 300
373 3300026067 Ga0207678_10005889 Ga0207678_100058894 300
374 3300026089 Ga0207648_10000017 Ga0207648_10000017137 300
375 3300037853 Ga0436364_0714734 Ga0436364_0714734_963_1946 300
376 3300044712 Ga0453684_0671748 Ga0453684_0671748_63_983 300
377 3300045051 Ga0451576_0386162 Ga0451576_0386162_231_1151 300
378 3300046525 Ga0495663_0003358 Ga0495663_0003358_3082_3996 300
379 3300046525 Ga0495663_0004265 Ga0495663_0004265_2689_3591 300
380 3300046558 Ga0495633_0005215 Ga0495633_0005215_6559_7461 300
381 3300048907 Ga0496104_0013159 Ga0496104_0013159_3742_4644 300
382 3300048919 Ga0496116_0013614 Ga0496116_0013614_2038_2940 300
383 3300048919 Ga0496116_0014949 Ga0496116_0014949_2038_2940 300
384 3300048920 Ga0496117_0069791 Ga0496117_0069791_1387_2289 300
385 3300048921 Ga0496118_0058708 Ga0496118_0058708_1396_2304 300
386 3300048922 Ga0496119_0000711 Ga0496119_0000711_25212_26114 300
387 3300048922 Ga0496119_0046818 Ga0496119_0046818_35_937 300
388 3300048923 Ga0496120_0000727 Ga0496120_0000727_28620_29522 300
389 3300048924 Ga0496121_0005121 Ga0496121_0005121_4813_5715 300
390 3300048924 Ga0496121_0043735 Ga0496121_0043735_2016_2918 300
391 3300048925 Ga0496122_0001140 Ga0496122_0001140_39777_40685 300
392 3300048925 Ga0496122_0014529 Ga0496122_0014529_4029_4931 300
393 3300048926 Ga0496123_0000942 Ga0496123_0000942_39619_40527 300
394 3300048927 Ga0496124_0003834 Ga0496124_0003834_5601_6503 300
395 3300048927 Ga0496124_0089185 Ga0496124_0089185_1419_2321 300
396 3300048928 Ga0496125_0000722 Ga0496125_0000722_2657_3559 300
397 3300048928 Ga0496125_0013105 Ga0496125_0013105_4598_5500 300
398 3300048928 Ga0496125_0018451 Ga0496125_0018451_4672_5586 300
399 3300048928 Ga0496125_0035604 Ga0496125_0035604_1369_2271 300
400 3300048929 Ga0496126_0003861 Ga0496126_0003861_12027_12929 300
401 3300053148 Ga0500590_000735 Ga0500590_000735_6379_7356 300
402 3300001979 JGI24740J21852_10000230 JGI24740J21852_1000023010 301
403 3300002705 JGI25156J39149_1006824 JGI25156J39149_10068244 301
404 3300002737 JGI25162J39368_1000653 JGI25162J39368_100065318 301
405 3300002737 JGI25162J39368_1001259 JGI25162J39368_10012597 301
406 3300002737 JGI25162J39368_1001943 JGI25162J39368_100194310 301
407 3300002737 JGI25162J39368_1005494 JGI25162J39368_10054942 301
408 3300002741 JGI25157J39369_1002739 JGI25157J39369_10027391 301
409 3300002741 JGI25157J39369_1003624 JGI25157J39369_10036244 301
410 3300002772 JGI25164J39214_1000473 JGI25164J39214_10004733 301
411 3300002772 JGI25164J39214_1000490 JGI25164J39214_100049017 301
412 3300002773 JGI25152J39213_1000103 JGI25152J39213_100010315 301
413 3300002774 JGI25150J39212_1000183 JGI25150J39212_100018317 301
414 3300003187 JGI25151J46595_10000187 JGI25151J46595_100001876 301
415 3300003187 JGI25151J46595_10000271 JGI25151J46595_1000027136 301
416 3300003214 JGI25165J46597_1000625 JGI25165J46597_100062511 301
417 3300003215 JGI25153J46596_10000190 JGI25153J46596_1000019036 301
418 3300003756 Ga0055533_1000962 Ga0055533_10009627 301
419 3300003762 Ga0055542_1000010 Ga0055542_1000010115 301
420 3300003763 Ga0055529_1001798 Ga0055529_10017982 301
421 3300003781 Ga0055536_1000773 Ga0055536_10007732 301
422 3300003791 Ga0055530_10002647 Ga0055530_100026474 301
423 3300003856 Ga0058692_1000053 Ga0058692_100005377 301
424 3300003856 Ga0058692_1000065 Ga0058692_100006541 301
425 3300004803 Ga0058862_12823758 Ga0058862_128237581 301
426 3300005288 Ga0065714_10088992 Ga0065714_100889922 301
427 3300005293 Ga0065715_10005079 Ga0065715_100050794 301
428 3300005295 Ga0065707_10092011 Ga0065707_100920112 301
429 3300005327 Ga0070658_10136650 Ga0070658_101366502 301
430 3300005328 Ga0070676_10004260 Ga0070676_100042604 301
431 3300005329 Ga0070683_100058119 Ga0070683_1000581193 301
432 3300005329 Ga0070683_100102372 Ga0070683_1001023722 301
433 3300005331 Ga0070670_100120801 Ga0070670_1001208012 301
434 3300005331 Ga0070670_100295628 Ga0070670_1002956281 301
435 3300005334 Ga0068869_100005518 Ga0068869_10000551812 301
436 3300005334 Ga0068869_100178597 Ga0068869_1001785972 301
437 3300005336 Ga0070680_100000138 Ga0070680_10000013813 301
438 3300005336 Ga0070680_100019130 Ga0070680_1000191303 301
439 3300005336 Ga0070680_100026845 Ga0070680_1000268453 301
440 3300005336 Ga0070680_100065060 Ga0070680_1000650602 301
441 3300005336 Ga0070680_100249030 Ga0070680_1002490302 301
442 3300005337 Ga0070682_100004912 Ga0070682_1000049126 301
443 3300005337 Ga0070682_100013413 Ga0070682_1000134134 301
444 3300005337 Ga0070682_100183929 Ga0070682_1001839292 301
445 3300005339 Ga0070660_100355517 Ga0070660_1003555171 301
446 3300005340 Ga0070689_100006130 Ga0070689_1000061302 301
447 3300005341 Ga0070691_10000204 Ga0070691_100002045 301
448 3300005341 Ga0070691_10047295 Ga0070691_100472952 301
449 3300005343 Ga0070687_100001734 Ga0070687_1000017344 301
450 3300005344 Ga0070661_100014313 Ga0070661_1000143133 301
451 3300005344 Ga0070661_100019362 Ga0070661_1000193622 301
452 3300005344 Ga0070661_100022768 Ga0070661_1000227682 301
453 3300005344 Ga0070661_100137945 Ga0070661_1001379451 301
454 3300005344 Ga0070661_100221607 Ga0070661_1002216072 301
455 3300005344 Ga0070661_100505846 Ga0070661_1005058461 301
456 3300005345 Ga0070692_10000826 Ga0070692_100008265 301
457 3300005345 Ga0070692_10001376 Ga0070692_100013763 301
458 3300005345 Ga0070692_10024606 Ga0070692_100246062 301
459 3300005347 Ga0070668_100002627 Ga0070668_1000026274 301
460 3300005347 Ga0070668_100005675 Ga0070668_1000056753 301
461 3300005353 Ga0070669_100016734 Ga0070669_1000167345 301
462 3300005354 Ga0070675_100051402 Ga0070675_1000514023 301
463 3300005355 Ga0070671_100020254 Ga0070671_1000202544 301
464 3300005365 Ga0070688_100015057 Ga0070688_1000150571 301
465 3300005366 Ga0070659_100004369 Ga0070659_10000436911 301
466 3300005366 Ga0070659_100005005 Ga0070659_1000050054 301
467 3300005366 Ga0070659_100014512 Ga0070659_1000145122 301
468 3300005367 Ga0070667_100023098 Ga0070667_1000230983 301
469 3300005367 Ga0070667_100059611 Ga0070667_1000596113 301
470 3300005435 Ga0070714_100002188 Ga0070714_1000021888 301
471 3300005436 Ga0070713_100003658 Ga0070713_1000036585 301
472 3300005439 Ga0070711_100203553 Ga0070711_1002035532 301
473 3300005440 Ga0070705_100176800 Ga0070705_1001768002 301
474 3300005441 Ga0070700_100022316 Ga0070700_1000223162 301
475 3300005455 Ga0070663_100003552 Ga0070663_1000035522 301
476 3300005455 Ga0070663_100011137 Ga0070663_1000111372 301
477 3300005455 Ga0070663_100030594 Ga0070663_1000305943 301
478 3300005456 Ga0070678_100015225 Ga0070678_1000152251 301
479 3300005456 Ga0070678_100040799 Ga0070678_1000407992 301
480 3300005457 Ga0070662_100007688 Ga0070662_1000076883 301
481 3300005457 Ga0070662_100055165 Ga0070662_1000551652 301
482 3300005457 Ga0070662_100095797 Ga0070662_1000957972 301
483 3300005457 Ga0070662_100105335 Ga0070662_1001053351 301
484 3300005457 Ga0070662_100356393 Ga0070662_1003563931 301
485 3300005458 Ga0070681_10000076 Ga0070681_1000007623 301
486 3300005458 Ga0070681_10001058 Ga0070681_100010588 301
487 3300005458 Ga0070681_10005260 Ga0070681_100052609 301
488 3300005458 Ga0070681_10012818 Ga0070681_100128183 301
489 3300005458 Ga0070681_10051976 Ga0070681_100519763 301
490 3300005458 Ga0070681_10097017 Ga0070681_100970173 301
491 3300005458 Ga0070681_10231243 Ga0070681_102312432 301
492 3300005466 Ga0070685_10053205 Ga0070685_100532052 301
493 3300005467 Ga0070706_100075262 Ga0070706_1000752623 301
494 3300005530 Ga0070679_100000504 Ga0070679_10000050416 301
495 3300005530 Ga0070679_100005669 Ga0070679_1000056697 301
496 3300005530 Ga0070679_100094827 Ga0070679_1000948273 301
497 3300005530 Ga0070679_100229808 Ga0070679_1002298082 301
498 3300005530 Ga0070679_100245203 Ga0070679_1002452032 301
499 3300005535 Ga0070684_100142709 Ga0070684_1001427092 301
500 3300005535 Ga0070684_100431134 Ga0070684_1004311342 301
501 3300005535 Ga0070684_100608218 Ga0070684_1006082181 301
502 3300005536 Ga0070697_100147487 Ga0070697_1001474872 301
503 3300005539 Ga0068853_100026580 Ga0068853_1000265802 301
504 3300005539 Ga0068853_100087550 Ga0068853_1000875502 301
505 3300005539 Ga0068853_100241865 Ga0068853_1002418652 301
506 3300005539 Ga0068853_100295727 Ga0068853_1002957271 301
507 3300005543 Ga0070672_100003161 Ga0070672_1000031613 301
508 3300005546 Ga0070696_100003079 Ga0070696_1000030792 301
509 3300005546 Ga0070696_100015403 Ga0070696_1000154034 301
510 3300005546 Ga0070696_100027962 Ga0070696_1000279623 301
511 3300005547 Ga0070693_100014051 Ga0070693_1000140512 301
512 3300005548 Ga0070665_100000465 Ga0070665_10000046545 301
513 3300005548 Ga0070665_100237824 Ga0070665_1002378242 301
514 3300005548 Ga0070665_100503266 Ga0070665_1005032661 301
515 3300005563 Ga0068855_100000897 Ga0068855_1000008976 301
516 3300005563 Ga0068855_100034494 Ga0068855_1000344942 301
517 3300005563 Ga0068855_100059757 Ga0068855_1000597573 301
518 3300005563 Ga0068855_100167742 Ga0068855_1001677421 301
519 3300005563 Ga0068855_100192031 Ga0068855_1001920312 301
520 3300005563 Ga0068855_100593199 Ga0068855_1005931991 301
521 3300005577 Ga0068857_100019539 Ga0068857_1000195391 301
522 3300005577 Ga0068857_100082251 Ga0068857_1000822512 301
523 3300005577 Ga0068857_100120614 Ga0068857_1001206142 301
524 3300005577 Ga0068857_100150476 Ga0068857_1001504762 301
525 3300005578 Ga0068854_100000142 Ga0068854_10000014248 301
526 3300005578 Ga0068854_100063019 Ga0068854_1000630192 301
527 3300005614 Ga0068856_100000462 Ga0068856_10000046226 301
528 3300005614 Ga0068856_100004819 Ga0068856_1000048193 301
529 3300005614 Ga0068856_100025070 Ga0068856_1000250705 301
530 3300005614 Ga0068856_100336574 Ga0068856_1003365741 301
531 3300005616 Ga0068852_100112354 Ga0068852_1001123542 301
532 3300005719 Ga0068861_100004360 Ga0068861_1000043607 301
533 3300005834 Ga0068851_10026102 Ga0068851_100261023 301
534 3300005841 Ga0068863_100038707 Ga0068863_1000387074 301
535 3300005842 Ga0068858_100013390 Ga0068858_1000133909 301
536 3300005842 Ga0068858_100128673 Ga0068858_1001286731 301
537 3300005843 Ga0068860_100041224 Ga0068860_1000412244 301
538 3300005843 Ga0068860_100101230 Ga0068860_1001012302 301
539 3300005844 Ga0068862_100070914 Ga0068862_1000709142 301
540 3300005985 Ga0081539_10083936 Ga0081539_100839362 301
541 3300006175 Ga0070712_100056201 Ga0070712_1000562012 301
542 3300006175 Ga0070712_100218002 Ga0070712_1002180022 301
543 3300006358 Ga0068871_100137854 Ga0068871_1001378542 301
544 3300006844 Ga0075428_100415922 Ga0075428_1004159222 301
545 3300006852 Ga0075433_10039496 Ga0075433_100394963 301
546 3300006871 Ga0075434_100007756 Ga0075434_1000077567 301
547 3300006871 Ga0075434_100048328 Ga0075434_1000483286 301
548 3300006880 Ga0075429_100055515 Ga0075429_1000555153 301
549 3300006881 Ga0068865_100007765 Ga0068865_1000077652 301
550 3300009093 Ga0105240_10000049 Ga0105240_1000004939 301
551 3300009093 Ga0105240_10000113 Ga0105240_1000011374 301
552 3300009093 Ga0105240_10002816 Ga0105240_1000281617 301
553 3300009093 Ga0105240_10069114 Ga0105240_100691142 301
554 3300009093 Ga0105240_10081693 Ga0105240_100816934 301
555 3300009093 Ga0105240_10228162 Ga0105240_102281622 301
556 3300009093 Ga0105240_10680974 Ga0105240_106809741 301
557 3300009094 Ga0111539_10565172 Ga0111539_105651722 301
558 3300009098 Ga0105245_10062002 Ga0105245_100620022 301
559 3300009148 Ga0105243_10004757 Ga0105243_100047576 301
560 3300009174 Ga0105241_10013711 Ga0105241_100137114 301
561 3300009177 Ga0105248_10057736 Ga0105248_100577364 301
562 3300009545 Ga0105237_10000230 Ga0105237_1000023053 301
563 3300009545 Ga0105237_10284515 Ga0105237_102845152 301
564 3300009545 Ga0105237_10362694 Ga0105237_103626941 301
565 3300009551 Ga0105238_10041071 Ga0105238_100410713 301
566 3300009551 Ga0105238_10143947 Ga0105238_101439471 301
567 3300009553 Ga0105249_10000195 Ga0105249_1000019540 301
568 3300009553 Ga0105249_10007619 Ga0105249_100076194 301
569 3300009553 Ga0105249_10135624 Ga0105249_101356243 301
570 3300009553 Ga0105249_10294373 Ga0105249_102943732 301
571 3300009979 Ga0105032_101587 Ga0105032_1015873 301
572 3300010375 Ga0105239_10000034 Ga0105239_100000341 301
573 3300010375 Ga0105239_10095696 Ga0105239_100956963 301
574 3300010375 Ga0105239_10299995 Ga0105239_102999951 301
575 3300010375 Ga0105239_10485188 Ga0105239_104851882 301
576 3300013100 Ga0157373_10098054 Ga0157373_100980542 301
577 3300013102 Ga0157371_10019340 Ga0157371_100193403 301
578 3300013102 Ga0157371_10070140 Ga0157371_100701402 301
579 3300013102 Ga0157371_10236816 Ga0157371_102368161 301
580 3300013104 Ga0157370_10010248 Ga0157370_100102489 301
581 3300013104 Ga0157370_10024020 Ga0157370_100240207 301
582 3300013104 Ga0157370_10025407 Ga0157370_100254071 301
583 3300013104 Ga0157370_10035718 Ga0157370_100357183 301
584 3300013104 Ga0157370_10189137 Ga0157370_101891373 301
585 3300013105 Ga0157369_10045576 Ga0157369_100455762 301
586 3300013105 Ga0157369_10054676 Ga0157369_100546764 301
587 3300013105 Ga0157369_10219655 Ga0157369_102196552 301
588 3300013105 Ga0157369_10248017 Ga0157369_102480171 301
589 3300013296 Ga0157374_10002660 Ga0157374_1000266011 301
590 3300013296 Ga0157374_10079124 Ga0157374_100791242 301
591 3300013297 Ga0157378_10013933 Ga0157378_100139336 301
592 3300013306 Ga0163162_10000015 Ga0163162_1000001557 301
593 3300013306 Ga0163162_10033700 Ga0163162_100337004 301
594 3300013306 Ga0163162_10072625 Ga0163162_100726252 301
595 3300013307 Ga0157372_10008269 Ga0157372_100082692 301
596 3300013307 Ga0157372_10022871 Ga0157372_100228713 301
597 3300013307 Ga0157372_10047515 Ga0157372_100475151 301
598 3300013307 Ga0157372_10070446 Ga0157372_100704462 301
599 3300013307 Ga0157372_10122484 Ga0157372_101224842 301
600 3300013308 Ga0157375_10156411 Ga0157375_101564111 301
601 3300013308 Ga0157375_10663712 Ga0157375_106637121 301
602 3300014325 Ga0163163_10000205 Ga0163163_1000020543 301
603 3300014497 Ga0182008_10048966 Ga0182008_100489662 301
604 3300014497 Ga0182008_10069164 Ga0182008_100691642 301
605 3300014968 Ga0157379_10367839 Ga0157379_103678392 301
606 3300014969 Ga0157376_10112995 Ga0157376_101129952 301
607 3300014969 Ga0157376_10261459 Ga0157376_102614592 301
608 3300015261 Ga0182006_1032508 Ga0182006_10325082 301
609 3300015261 Ga0182006_1033197 Ga0182006_10331972 301
610 3300015262 Ga0182007_10003052 Ga0182007_100030523 301
611 3300015687 Ga0183368_1004 Ga0183368_1004710 301
612 3300017792 Ga0163161_10018593 Ga0163161_100185934 301
613 3300017792 Ga0163161_10039512 Ga0163161_100395123 301
614 3300020069 Ga0197907_10031041 Ga0197907_100310412 301
615 3300020070 Ga0206356_11162436 Ga0206356_111624362 301
616 3300020077 Ga0206351_10270042 Ga0206351_102700421 301
617 3300020078 Ga0206352_10784584 Ga0206352_107845842 301
618 3300020080 Ga0206350_10514329 Ga0206350_105143292 301
619 3300020081 Ga0206354_10512197 Ga0206354_105121971 301
620 3300020082 Ga0206353_11363697 Ga0206353_113636971 301
621 3300020610 Ga0154015_1208151 Ga0154015_12081511 301
622 3300020610 Ga0154015_1499885 Ga0154015_14998852 301
623 3300021384 Ga0213876_10001632 Ga0213876_1000163210 301
624 3300022467 Ga0224712_10020806 Ga0224712_100208062 301
625 3300022467 Ga0224712_10028061 Ga0224712_100280614 301
626 3300025226 Ga0209674_100063 Ga0209674_100063135 301
627 3300025226 Ga0209674_100836 Ga0209674_1008364 301
628 3300025228 Ga0209672_100509 Ga0209672_10050910 301
629 3300025231 Ga0207427_100132 Ga0207427_10013218 301
630 3300025231 Ga0207427_100322 Ga0207427_10032211 301
631 3300025231 Ga0207427_103057 Ga0207427_1030572 301
632 3300025233 Ga0209437_100005 Ga0209437_100005166 301
633 3300025233 Ga0209437_100118 Ga0209437_10011864 301
634 3300025233 Ga0209437_100233 Ga0209437_10023313 301
635 3300025242 Ga0209258_100935 Ga0209258_1009352 301
636 3300025242 Ga0209258_101545 Ga0209258_1015457 301
637 3300025245 Ga0207425_1000148 Ga0207425_100014815 301
638 3300025245 Ga0207425_1001805 Ga0207425_10018057 301
639 3300025246 Ga0209646_1004787 Ga0209646_10047871 301
640 3300025250 Ga0209026_1000010 Ga0209026_100001037 301
641 3300025250 Ga0209026_1000061 Ga0209026_1000061130 301
642 3300025254 Ga0209148_1000005 Ga0209148_1000005230 301
643 3300025256 Ga0209759_1003743 Ga0209759_10037437 301
644 3300025258 Ga0209129_1000239 Ga0209129_100023915 301
645 3300025261 Ga0209233_1000011 Ga0209233_1000011774 301
646 3300025261 Ga0209233_1000046 Ga0209233_1000046230 301
647 3300025261 Ga0209233_1011210 Ga0209233_10112102 301
648 3300025261 Ga0209233_1015398 Ga0209233_10153982 301
649 3300025272 Ga0209455_1000111 Ga0209455_1000111122 301
650 3300025292 Ga0209676_1000411 Ga0209676_100041141 301
651 3300025294 Ga0209025_1000006 Ga0209025_1000006549 301
652 3300025294 Ga0209025_1000048 Ga0209025_1000048260 301
653 3300025297 Ga0209758_1000056 Ga0209758_1000056260 301
654 3300025297 Ga0209758_1008030 Ga0209758_10080306 301
655 3300025298 Ga0209050_1000146 Ga0209050_100014620 301
656 3300025299 Ga0209256_1003699 Ga0209256_100369910 301
657 3300025321 Ga0207656_10008749 Ga0207656_100087492 301
658 3300025901 Ga0207688_10112355 Ga0207688_101123551 301
659 3300025903 Ga0207680_10047257 Ga0207680_100472572 301
660 3300025903 Ga0207680_10061889 Ga0207680_100618892 301
661 3300025904 Ga0207647_10001386 Ga0207647_100013864 301
662 3300025904 Ga0207647_10002100 Ga0207647_100021007 301
663 3300025904 Ga0207647_10003612 Ga0207647_100036126 301
664 3300025904 Ga0207647_10054217 Ga0207647_100542171 301
665 3300025907 Ga0207645_10000737 Ga0207645_1000073713 301
666 3300025909 Ga0207705_10000146 Ga0207705_1000014663 301
667 3300025909 Ga0207705_10000373 Ga0207705_1000037342 301
668 3300025909 Ga0207705_10000788 Ga0207705_100007882 301
669 3300025909 Ga0207705_10009432 Ga0207705_100094324 301
670 3300025909 Ga0207705_10081047 Ga0207705_100810472 301
671 3300025909 Ga0207705_10257657 Ga0207705_102576571 301
672 3300025910 Ga0207684_10321899 Ga0207684_103218992 301
673 3300025912 Ga0207707_10000018 Ga0207707_1000001837 301
674 3300025912 Ga0207707_10000036 Ga0207707_1000003649 301
675 3300025912 Ga0207707_10000868 Ga0207707_1000086813 301
676 3300025912 Ga0207707_10000944 Ga0207707_1000094422 301
677 3300025912 Ga0207707_10009741 Ga0207707_100097413 301
678 3300025912 Ga0207707_10015309 Ga0207707_100153091 301
679 3300025912 Ga0207707_10017108 Ga0207707_100171083 301
680 3300025912 Ga0207707_10023133 Ga0207707_100231331 301
681 3300025912 Ga0207707_10027620 Ga0207707_100276203 301
682 3300025912 Ga0207707_10050186 Ga0207707_100501863 301
683 3300025912 Ga0207707_10127412 Ga0207707_101274123 301
684 3300025913 Ga0207695_10000007 Ga0207695_10000007918 301
685 3300025913 Ga0207695_10000114 Ga0207695_10000114115 301
686 3300025913 Ga0207695_10000816 Ga0207695_1000081634 301
687 3300025913 Ga0207695_10001086 Ga0207695_1000108631 301
688 3300025913 Ga0207695_10002626 Ga0207695_100026269 301
689 3300025913 Ga0207695_10027868 Ga0207695_100278682 301
690 3300025913 Ga0207695_10050538 Ga0207695_100505382 301
691 3300025913 Ga0207695_10053798 Ga0207695_100537983 301
692 3300025913 Ga0207695_10073182 Ga0207695_100731824 301
693 3300025913 Ga0207695_10115114 Ga0207695_101151142 301
694 3300025913 Ga0207695_10182106 Ga0207695_101821061 301
695 3300025914 Ga0207671_10000639 Ga0207671_1000063929 301
696 3300025914 Ga0207671_10082200 Ga0207671_100822002 301
697 3300025914 Ga0207671_10321677 Ga0207671_103216771 301
698 3300025917 Ga0207660_10000389 Ga0207660_1000038913 301
699 3300025917 Ga0207660_10009240 Ga0207660_100092403 301
700 3300025917 Ga0207660_10009433 Ga0207660_100094333 301
701 3300025917 Ga0207660_10009884 Ga0207660_100098844 301
702 3300025917 Ga0207660_10010720 Ga0207660_100107203 301
703 3300025917 Ga0207660_10015984 Ga0207660_100159843 301
704 3300025917 Ga0207660_10028000 Ga0207660_100280004 301
705 3300025917 Ga0207660_10048875 Ga0207660_100488752 301
706 3300025917 Ga0207660_10145550 Ga0207660_101455502 301
707 3300025917 Ga0207660_10237378 Ga0207660_102373782 301
708 3300025918 Ga0207662_10001726 Ga0207662_100017267 301
709 3300025919 Ga0207657_10022248 Ga0207657_100222482 301
710 3300025920 Ga0207649_10001271 Ga0207649_100012716 301
711 3300025920 Ga0207649_10019583 Ga0207649_100195832 301
712 3300025920 Ga0207649_10065234 Ga0207649_100652342 301
713 3300025920 Ga0207649_10150937 Ga0207649_101509372 301
714 3300025921 Ga0207652_10000409 Ga0207652_1000040912 301
715 3300025921 Ga0207652_10004945 Ga0207652_100049457 301
716 3300025921 Ga0207652_10007521 Ga0207652_100075215 301
717 3300025921 Ga0207652_10038403 Ga0207652_100384032 301
718 3300025921 Ga0207652_10076977 Ga0207652_100769772 301
719 3300025921 Ga0207652_10212731 Ga0207652_102127312 301
720 3300025922 Ga0207646_10192292 Ga0207646_101922922 301
721 3300025923 Ga0207681_10027150 Ga0207681_100271505 301
722 3300025924 Ga0207694_10000930 Ga0207694_1000093012 301
723 3300025924 Ga0207694_10002010 Ga0207694_1000201014 301
724 3300025924 Ga0207694_10013293 Ga0207694_100132932 301
725 3300025924 Ga0207694_10085369 Ga0207694_100853692 301
726 3300025924 Ga0207694_10132693 Ga0207694_101326932 301
727 3300025925 Ga0207650_10059382 Ga0207650_100593824 301
728 3300025925 Ga0207650_10165686 Ga0207650_101656861 301
729 3300025925 Ga0207650_10244319 Ga0207650_102443192 301
730 3300025926 Ga0207659_10042135 Ga0207659_100421352 301
731 3300025927 Ga0207687_10062794 Ga0207687_100627942 301
732 3300025928 Ga0207700_10001535 Ga0207700_100015354 301
733 3300025928 Ga0207700_10296846 Ga0207700_102968462 301
734 3300025929 Ga0207664_10000601 Ga0207664_100006018 301
735 3300025931 Ga0207644_10042775 Ga0207644_100427752 301
736 3300025932 Ga0207690_10000532 Ga0207690_1000053214 301
737 3300025932 Ga0207690_10001860 Ga0207690_100018606 301
738 3300025932 Ga0207690_10108815 Ga0207690_101088151 301
739 3300025932 Ga0207690_10109772 Ga0207690_101097722 301
740 3300025932 Ga0207690_10137975 Ga0207690_101379752 301
741 3300025933 Ga0207706_10008698 Ga0207706_100086984 301
742 3300025933 Ga0207706_10011915 Ga0207706_100119151 301
743 3300025933 Ga0207706_10013100 Ga0207706_100131004 301
744 3300025933 Ga0207706_10042110 Ga0207706_100421102 301
745 3300025933 Ga0207706_10470496 Ga0207706_104704961 301
746 3300025935 Ga0207709_10000527 Ga0207709_1000052719 301
747 3300025935 Ga0207709_10009913 Ga0207709_100099135 301
748 3300025938 Ga0207704_10013639 Ga0207704_100136393 301
749 3300025940 Ga0207691_10003625 Ga0207691_100036254 301
750 3300025941 Ga0207711_10014427 Ga0207711_100144273 301
751 3300025941 Ga0207711_10023261 Ga0207711_100232613 301
752 3300025942 Ga0207689_10001783 Ga0207689_100017837 301
753 3300025944 Ga0207661_10001897 Ga0207661_100018976 301
754 3300025944 Ga0207661_10045981 Ga0207661_100459812 301
755 3300025944 Ga0207661_10209699 Ga0207661_102096992 301
756 3300025944 Ga0207661_10248469 Ga0207661_102484691 301
757 3300025945 Ga0207679_10004674 Ga0207679_100046743 301
758 3300025949 Ga0207667_10000040 Ga0207667_10000040213 301
759 3300025949 Ga0207667_10000947 Ga0207667_1000094723 301
760 3300025949 Ga0207667_10007762 Ga0207667_100077621 301
761 3300025949 Ga0207667_10072474 Ga0207667_100724742 301
762 3300025949 Ga0207667_10103191 Ga0207667_101031915 301
763 3300025949 Ga0207667_10149101 Ga0207667_101491012 301
764 3300025949 Ga0207667_10205878 Ga0207667_102058782 301
765 3300025949 Ga0207667_10238588 Ga0207667_102385882 301
766 3300025961 Ga0207712_10000277 Ga0207712_1000027739 301
767 3300025961 Ga0207712_10001146 Ga0207712_1000114610 301
768 3300025961 Ga0207712_10014077 Ga0207712_100140774 301
769 3300025972 Ga0207668_10005154 Ga0207668_100051541 301
770 3300025981 Ga0207640_10000009 Ga0207640_10000009214 301
771 3300025981 Ga0207640_10005290 Ga0207640_100052903 301
772 3300025981 Ga0207640_10014194 Ga0207640_100141942 301
773 3300025981 Ga0207640_10098268 Ga0207640_100982682 301
774 3300025981 Ga0207640_10133355 Ga0207640_101333552 301
775 3300026023 Ga0207677_10471654 Ga0207677_104716542 301
776 3300026035 Ga0207703_10004934 Ga0207703_100049346 301
777 3300026041 Ga0207639_10001840 Ga0207639_100018407 301
778 3300026041 Ga0207639_10004652 Ga0207639_100046527 301
779 3300026041 Ga0207639_10014224 Ga0207639_100142242 301
780 3300026041 Ga0207639_10020933 Ga0207639_100209332 301
781 3300026041 Ga0207639_10293628 Ga0207639_102936282 301
782 3300026041 Ga0207639_10693695 Ga0207639_106936951 301
783 3300026067 Ga0207678_10004979 Ga0207678_1000497914 301
784 3300026067 Ga0207678_10006369 Ga0207678_100063693 301
785 3300026067 Ga0207678_10020914 Ga0207678_100209147 301
786 3300026075 Ga0207708_10009224 Ga0207708_100092243 301
787 3300026078 Ga0207702_10000172 Ga0207702_1000017221 301
788 3300026078 Ga0207702_10008380 Ga0207702_100083803 301
789 3300026078 Ga0207702_10015708 Ga0207702_100157087 301
790 3300026078 Ga0207702_10036014 Ga0207702_100360143 301
791 3300026088 Ga0207641_10025775 Ga0207641_100257754 301
792 3300026088 Ga0207641_10043596 Ga0207641_100435962 301
793 3300026089 Ga0207648_10027096 Ga0207648_100270964 301
794 3300026116 Ga0207674_10001921 Ga0207674_1000192110 301
795 3300026116 Ga0207674_10004423 Ga0207674_100044238 301
796 3300026116 Ga0207674_10012476 Ga0207674_1001247613 301
797 3300026116 Ga0207674_10050289 Ga0207674_100502893 301
798 3300026116 Ga0207674_10227566 Ga0207674_102275661 301
799 3300026116 Ga0207674_10258908 Ga0207674_102589082 301
800 3300026116 Ga0207674_10341215 Ga0207674_103412151 301
801 3300026118 Ga0207675_100001976 Ga0207675_10000197613 301
802 3300026142 Ga0207698_10000931 Ga0207698_100009319 301
803 3300026142 Ga0207698_10054723 Ga0207698_100547233 301
804 3300026142 Ga0207698_10083396 Ga0207698_100833962 301
805 3300026142 Ga0207698_10332722 Ga0207698_103327222 301
806 3300027312 Ga0209371_1000018 Ga0209371_1000018539 301
807 3300027312 Ga0209371_1000025 Ga0209371_100002528 301
808 3300027876 Ga0209974_10004171 Ga0209974_100041714 301
809 3300028379 Ga0268266_10000006 Ga0268266_10000006994 301
810 3300028379 Ga0268266_10026003 Ga0268266_100260036 301
811 3300028379 Ga0268266_10027010 Ga0268266_100270102 301
812 3300028379 Ga0268266_10031407 Ga0268266_100314073 301
813 3300028379 Ga0268266_10305737 Ga0268266_103057372 301
814 3300028380 Ga0268265_10061048 Ga0268265_100610482 301
815 3300028381 Ga0268264_10148368 Ga0268264_101483682 301
816 3300028563 Ga0265319_1000240 Ga0265319_100024012 301
817 3300028577 Ga0265318_10002424 Ga0265318_100024245 301
818 3300028800 Ga0265338_10212940 Ga0265338_102129401 301
819 3300030500 Ga0268256_1000016 Ga0268256_1000016539 301
820 3300030500 Ga0268256_1000027 Ga0268256_100002728 301
821 3300030744 Ga0316181_1268996 Ga0316181_12689962 301
822 3300031238 Ga0265332_10014777 Ga0265332_100147772 301
823 3300031240 Ga0265320_10000136 Ga0265320_1000013649 301
824 3300031241 Ga0265325_10001525 Ga0265325_1000152513 301
825 3300031241 Ga0265325_10042548 Ga0265325_100425482 301
826 3300031242 Ga0265329_10000171 Ga0265329_1000017110 301
827 3300031247 Ga0265340_10003989 Ga0265340_100039893 301
828 3300031249 Ga0265339_10065646 Ga0265339_100656462 301
829 3300031250 Ga0265331_10000021 Ga0265331_1000002152 301
830 3300031250 Ga0265331_10016315 Ga0265331_100163155 301
831 3300031344 Ga0265316_10001078 Ga0265316_100010785 301
832 3300031344 Ga0265316_10012682 Ga0265316_100126823 301
833 3300031456 Ga0307513_10158437 Ga0307513_101584372 301
834 3300031548 Ga0307408_100005909 Ga0307408_1000059092 301
835 3300031548 Ga0307408_100073444 Ga0307408_1000734442 301
836 3300031595 Ga0265313_10001348 Ga0265313_100013485 301
837 3300031616 Ga0307508_10065258 Ga0307508_100652582 301
838 3300031616 Ga0307508_10284242 Ga0307508_102842422 301
839 3300031711 Ga0265314_10007149 Ga0265314_100071495 301
840 3300031712 Ga0265342_10000555 Ga0265342_100005555 301
841 3300031712 Ga0265342_10104745 Ga0265342_101047452 301
842 3300031824 Ga0307413_10085739 Ga0307413_100857392 301
843 3300031824 Ga0307413_10088902 Ga0307413_100889022 301
844 3300031824 Ga0307413_10126983 Ga0307413_101269832 301
845 3300031852 Ga0307410_10029439 Ga0307410_100294393 301
846 3300031852 Ga0307410_10040470 Ga0307410_100404703 301
847 3300031901 Ga0307406_10002083 Ga0307406_100020832 301
848 3300031901 Ga0307406_10005253 Ga0307406_100052538 301
849 3300031903 Ga0307407_10043860 Ga0307407_100438602 301
850 3300031911 Ga0307412_10093954 Ga0307412_100939542 301
851 3300031911 Ga0307412_10217952 Ga0307412_102179522 301
852 3300031995 Ga0307409_100049477 Ga0307409_1000494772 301
853 3300032002 Ga0307416_100110189 Ga0307416_1001101892 301
854 3300032004 Ga0307414_10000303 Ga0307414_1000030310 301
855 3300032004 Ga0307414_10002908 Ga0307414_100029083 301
856 3300032004 Ga0307414_10380382 Ga0307414_103803822 301
857 3300032005 Ga0307411_10076113 Ga0307411_100761131 301
858 3300032005 Ga0307411_10076436 Ga0307411_100764362 301
859 3300032126 Ga0307415_100140021 Ga0307415_1001400212 301
860 3300033179 Ga0307507_10093349 Ga0307507_100933493 301
861 3300035083 Ga0373926_0027212 Ga0373926_0027212_221_1135 301
862 3300035724 Ga0373933_0093035 Ga0373933_0093035_699_1613 301
863 3300037312 Ga0395899_0036394 Ga0395899_0036394_1216_2133 301
864 3300037418 Ga0395900_0000033 Ga0395900_0000033_47429_48361 301
865 3300037418 Ga0395900_0009693 Ga0395900_0009693_2395_3309 301
866 3300037418 Ga0395900_0010009 Ga0395900_0010009_2975_3907 301
867 3300037418 Ga0395900_0054926 Ga0395900_0054926_1542_2513 301
868 3300037466 Ga0395898_0040116 Ga0395898_0040116_249_1181 301
869 3300037466 Ga0395898_0425028 Ga0395898_0425028_162_1067 301
870 3300037471 Ga0395905_0006600 Ga0395905_0006600_2396_3310 301
871 3300037471 Ga0395905_0041832 Ga0395905_0041832_3046_3951 301
872 3300037471 Ga0395905_0109833 Ga0395905_0109833_1060_1965 301
873 3300037471 Ga0395905_0111481 Ga0395905_0111481_1358_2272 301
874 3300037471 Ga0395905_0116462 Ga0395905_0116462_623_1528 301
875 3300038443 Ga0395901_0008861 Ga0395901_0008861_7361_8275 301
876 3300038443 Ga0395901_0015001 Ga0395901_0015001_3580_4485 301
877 3300038705 Ga0237819_00212 Ga0237819_00212_1152_2081 301
878 3300038705 Ga0237819_06260 Ga0237819_06260_576_1481 301
879 3300039437 Ga0436365_0457258 Ga0436365_0457258_8552_9460 301
880 3300039437 Ga0436365_1712708 Ga0436365_1712708_51151_52167 301
881 3300041404 Ga0439436_0012161 Ga0439436_0012161_1375_2280 301
882 3300042001 Ga0439441_007876 Ga0439441_007876_132_1043 301
883 3300044712 Ga0453684_0121349 Ga0453684_0121349_1459_2367 301
884 3300045049 Ga0466959_0049070 Ga0466959_0049070_788_1693 301
885 3300045049 Ga0466959_0267173 Ga0466959_0267173_208_1119 301
886 3300045976 Ga0466967_0520577 Ga0466967_0520577_140_1045 301
887 3300046453 Ga0495627_003294 Ga0495627_003294_2534_3439 301
888 3300046454 Ga0495592_0001829 Ga0495592_0001829_7438_8352 301
889 3300046460 Ga0495638_0000087 Ga0495638_0000087_46612_47517 301
890 3300046460 Ga0495638_0000095 Ga0495638_0000095_80074_80979 301
891 3300046462 Ga0495651_0000112 Ga0495651_0000112_26740_27657 301
892 3300046462 Ga0495651_0004909 Ga0495651_0004909_5090_6004 301
893 3300046462 Ga0495651_0037275 Ga0495651_0037275_1737_2651 301
894 3300046463 Ga0495653_0008702 Ga0495653_0008702_3461_4375 301
895 3300046463 Ga0495653_0057144 Ga0495653_0057144_1129_2043 301
896 3300046471 Ga0495650_0000122 Ga0495650_0000122_173987_174892 301
897 3300046477 Ga0495664_0027212 Ga0495664_0027212_1855_2772 301
898 3300046477 Ga0495664_0029489 Ga0495664_0029489_1186_2100 301
899 3300046477 Ga0495664_0103014 Ga0495664_0103014_388_1302 301
900 3300046507 Ga0495606_0000154 Ga0495606_0000154_90688_91593 301
901 3300046511 Ga0495608_0005013 Ga0495608_0005013_7576_8490 301
902 3300046511 Ga0495608_0015212 Ga0495608_0015212_4355_5269 301
903 3300046516 Ga0495628_0010075 Ga0495628_0010075_4614_5528 301
904 3300046517 Ga0495630_0046901 Ga0495630_0046901_2197_3111 301
905 3300046517 Ga0495630_0111043 Ga0495630_0111043_160_1074 301
906 3300046517 Ga0495630_0172293 Ga0495630_0172293_287_1201 301
907 3300046529 Ga0495652_0001460 Ga0495652_0001460_12100_13014 301
908 3300046529 Ga0495652_0039539 Ga0495652_0039539_2811_3725 301
909 3300046531 Ga0495665_0002975 Ga0495665_0002975_2021_2935 301
910 3300046533 Ga0495640_0089957 Ga0495640_0089957_405_1319 301
911 3300046533 Ga0495640_0137767 Ga0495640_0137767_84_998 301
912 3300046535 Ga0495586_0007098 Ga0495586_0007098_1137_2051 301
913 3300046535 Ga0495586_0044609 Ga0495586_0044609_713_1627 301
914 3300046536 Ga0495587_0008194 Ga0495587_0008194_759_1673 301
915 3300046543 Ga0495645_0018582 Ga0495645_0018582_899_1813 301
916 3300046557 Ga0495622_0069635 Ga0495622_0069635_322_1227 301
917 3300046559 Ga0495667_0002346 Ga0495667_0002346_6279_7196 301
918 3300046559 Ga0495667_0021853 Ga0495667_0021853_531_1445 301
919 3300046615 Ga0495656_0001607 Ga0495656_0001607_970_1878 301
920 3300046616 Ga0495668_0000364 Ga0495668_0000364_3012_3917 301
921 3300046660 Ga0495625_0010997 Ga0495625_0010997_4983_5888 301
922 3300046660 Ga0495625_0025870 Ga0495625_0025870_879_1784 301
923 3300046663 Ga0495635_0181855 Ga0495635_0181855_132_1046 301
924 3300046675 Ga0495657_0004093 Ga0495657_0004093_6277_7191 301
925 3300046675 Ga0495657_0155154 Ga0495657_0155154_386_1300 301
926 3300046679 Ga0495623_0199603 Ga0495623_0199603_197_1111 301
927 3300046680 Ga0495646_0004052 Ga0495646_0004052_3892_4806 301
928 3300046689 Ga0495613_0068659 Ga0495613_0068659_1461_2375 301
929 3300046690 Ga0495624_0023365 Ga0495624_0023365_248_1162 301
930 3300046691 Ga0495670_0025528 Ga0495670_0025528_1425_2333 301
931 3300046692 Ga0495671_0033896 Ga0495671_0033896_354_1385 301
932 3300046694 Ga0495649_0010401 Ga0495649_0010401_3238_4143 301
933 3300046809 Ga0495600_0001620 Ga0495600_0001620_7027_7941 301
934 3300047317 Ga0495604_0004415 Ga0495604_0004415_6051_6965 301
935 3300047319 Ga0495674_0008146 Ga0495674_0008146_4535_5449 301
936 3300047319 Ga0495674_0142410 Ga0495674_0142410_696_1610 301
937 3300047322 Ga0495680_0001270 Ga0495680_0001270_10674_11591 301
938 3300047322 Ga0495680_0004117 Ga0495680_0004117_3459_4373 301
939 3300047322 Ga0495680_0014929 Ga0495680_0014929_5679_6593 301
940 3300047444 Ga0495675_0000121 Ga0495675_0000121_44679_45593 301
941 3300047444 Ga0495675_0010587 Ga0495675_0010587_104_1021 301
942 3300047444 Ga0495675_0068687 Ga0495675_0068687_1205_2119 301
943 3300047471 Ga0495684_0002904 Ga0495684_0002904_4503_5417 301
944 3300047471 Ga0495684_0005046 Ga0495684_0005046_6258_7172 301
945 3300047471 Ga0495684_0007540 Ga0495684_0007540_5845_6759 301
946 3300047472 Ga0495686_0004003 Ga0495686_0004003_5163_6092 301
947 3300047472 Ga0495686_0021929 Ga0495686_0021929_22_927 301
948 3300047673 Ga0495593_0020029 Ga0495593_0020029_2695_3609 301
949 3300048088 Ga0495602_0002431 Ga0495602_0002431_8030_8944 301
950 3300048903 Ga0496100_0034593 Ga0496100_0034593_481_1386 301
951 3300048904 Ga0496101_0061834 Ga0496101_0061834_1290_2195 301
952 3300048908 Ga0496105_0058392 Ga0496105_0058392_2260_3165 301
953 3300048911 Ga0496108_0119623 Ga0496108_0119623_327_1232 301
954 3300048912 Ga0496109_0083637 Ga0496109_0083637_473_1378 301
955 3300048913 Ga0496110_0144262 Ga0496110_0144262_349_1254 301
956 3300048915 Ga0496112_0224091 Ga0496112_0224091_215_1129 301
957 3300048916 Ga0496113_0013073 Ga0496113_0013073_3907_4812 301
958 3300048917 Ga0496114_0011751 Ga0496114_0011751_4752_5657 301
959 3300048917 Ga0496114_0075849 Ga0496114_0075849_1703_2608 301
960 3300048917 Ga0496114_0132116 Ga0496114_0132116_850_1755 301
961 3300048918 Ga0496115_0000116 Ga0496115_0000116_58694_59599 301
962 3300048918 Ga0496115_0000233 Ga0496115_0000233_30070_30975 301
963 3300048918 Ga0496115_0000293 Ga0496115_0000293_28722_29627 301
964 3300048918 Ga0496115_0007196 Ga0496115_0007196_5203_6108 301
965 3300048918 Ga0496115_0351060 Ga0496115_0351060_26_931 301
966 3300048919 Ga0496116_0002572 Ga0496116_0002572_5033_5938 301
967 3300048920 Ga0496117_0003980 Ga0496117_0003980_10258_11163 301
968 3300048920 Ga0496117_0008136 Ga0496117_0008136_7020_7925 301
969 3300048920 Ga0496117_0013164 Ga0496117_0013164_5316_6221 301
970 3300048921 Ga0496118_0000260 Ga0496118_0000260_50418_51323 301
971 3300048921 Ga0496118_0000953 Ga0496118_0000953_18455_19360 301
972 3300048921 Ga0496118_0006046 Ga0496118_0006046_9889_10794 301
973 3300048921 Ga0496118_0015832 Ga0496118_0015832_37_942 301
974 3300048921 Ga0496118_0023738 Ga0496118_0023738_1455_2360 301
975 3300048922 Ga0496119_0000048 Ga0496119_0000048_13537_14442 301
976 3300048922 Ga0496119_0004893 Ga0496119_0004893_8515_9420 301
977 3300048923 Ga0496120_0000113 Ga0496120_0000113_73960_74865 301
978 3300048923 Ga0496120_0000519 Ga0496120_0000519_13480_14385 301
979 3300048924 Ga0496121_0000013 Ga0496121_0000013_359098_360003 301
980 3300048924 Ga0496121_0004863 Ga0496121_0004863_12513_13418 301
981 3300048924 Ga0496121_0042740 Ga0496121_0042740_957_1862 301
982 3300048927 Ga0496124_0001552 Ga0496124_0001552_17038_17943 301
983 3300048927 Ga0496124_0027671 Ga0496124_0027671_1986_2891 301
984 3300048927 Ga0496124_0106341 Ga0496124_0106341_295_1200 301
985 3300048929 Ga0496126_0000057 Ga0496126_0000057_125662_126567 301
986 3300048929 Ga0496126_0000320 Ga0496126_0000320_26426_27331 301
987 3300048929 Ga0496126_0016096 Ga0496126_0016096_5219_6175 301
988 3300048929 Ga0496126_0023194 Ga0496126_0023194_1923_2828 301
989 3300048929 Ga0496126_0023341 Ga0496126_0023341_3692_4597 301
990 3300049568 Ga0501031_0001796 Ga0501031_0001796_6201_7106 301
991 3300049569 Ga0501032_0007207 Ga0501032_0007207_5489_6394 301
992 3300049569 Ga0501032_0010231 Ga0501032_0010231_3960_4865 301
993 3300049569 Ga0501032_0044695 Ga0501032_0044695_2051_2956 301
994 3300049570 Ga0501033_0000086 Ga0501033_0000086_58097_59008 301
995 3300049570 Ga0501033_0006023 Ga0501033_0006023_4635_5540 301
996 3300049570 Ga0501033_0060447 Ga0501033_0060447_1173_2078 301
997 3300049571 Ga0501034_0093322 Ga0501034_0093322_376_1281 301
998 3300049571 Ga0501034_0200942 Ga0501034_0200942_126_1031 301
999 3300049572 Ga0501036_0011588 Ga0501036_0011588_2435_3340 301
1000 3300049572 Ga0501036_0018586 Ga0501036_0018586_4187_5092 301
1001 3300049572 Ga0501036_0025725 Ga0501036_0025725_3399_4304 301
1002 3300049572 Ga0501036_0152836 Ga0501036_0152836_670_1575 301
1003 3300049573 Ga0501037_0041500 Ga0501037_0041500_2046_2951 301
1004 3300049573 Ga0501037_0086830 Ga0501037_0086830_353_1339 301
1005 3300049574 Ga0501038_0016254 Ga0501038_0016254_4577_5482 301
1006 3300049574 Ga0501038_0022471 Ga0501038_0022471_1136_2041 301
1007 3300049574 Ga0501038_0061319 Ga0501038_0061319_2282_3187 301
1008 3300049574 Ga0501038_0109817 Ga0501038_0109817_589_1494 301
1009 3300049575 Ga0501039_0010959 Ga0501039_0010959_1246_2151 301
1010 3300049575 Ga0501039_0013495 Ga0501039_0013495_3965_4870 301
1011 3300049576 Ga0501040_0017688 Ga0501040_0017688_3542_4447 301
1012 3300049578 Ga0501042_0002596 Ga0501042_0002596_6109_7014 301
1013 3300049579 Ga0501043_0005825 Ga0501043_0005825_6091_6996 301
1014 3300049579 Ga0501043_0045918 Ga0501043_0045918_451_1356 301
1015 3300049579 Ga0501043_0111954 Ga0501043_0111954_1057_1962 301
1016 3300049580 Ga0501046_0001919 Ga0501046_0001919_14536_15441 301
1017 3300049580 Ga0501046_0007819 Ga0501046_0007819_5141_6046 301
1018 3300049581 Ga0501047_0011238 Ga0501047_0011238_2164_3150 301
1019 3300049581 Ga0501047_0011692 Ga0501047_0011692_3295_4200 301
1020 3300049581 Ga0501047_0466423 Ga0501047_0466423_122_1033 301
1021 3300049582 Ga0501048_0209232 Ga0501048_0209232_369_1274 301
1022 3300049584 Ga0501068_0001687 Ga0501068_0001687_2581_3486 301
1023 3300049586 Ga0501070_0170031 Ga0501070_0170031_593_1579 301
1024 3300049586 Ga0501070_0267493 Ga0501070_0267493_16_948 301
1025 3300049589 Ga0501073_0000408 Ga0501073_0000408_26522_27508 301
1026 3300049591 Ga0501075_0158630 Ga0501075_0158630_407_1312 301
1027 3300049592 Ga0501076_0122416 Ga0501076_0122416_351_1256 301
1028 3300049593 Ga0501077_0020571 Ga0501077_0020571_1704_2609 301
1029 3300049742 Ga0501080_0012126 Ga0501080_0012126_1570_2646 301
1030 3300049822 Ga0501035_0008776 Ga0501035_0008776_7257_8162 301
1031 3300049822 Ga0501035_0029675 Ga0501035_0029675_1603_2514 301
1032 3300049822 Ga0501035_0072308 Ga0501035_0072308_1081_1986 301
1033 3300049823 Ga0501044_0000749 Ga0501044_0000749_32037_32942 301
1034 3300049823 Ga0501044_0002590 Ga0501044_0002590_13881_14792 301
1035 3300049823 Ga0501044_0013084 Ga0501044_0013084_7646_8557 301
1036 3300049823 Ga0501044_0039363 Ga0501044_0039363_64_969 301
1037 3300049823 Ga0501044_0358588 Ga0501044_0358588_195_1181 301
1038 3300049823 Ga0501044_0622771 Ga0501044_0622771_30_935 301
1039 3300049824 Ga0501045_0005098 Ga0501045_0005098_4084_4989 301
1040 3300050511 nmdc:mga08y16_1627_c1 nmdc:mga08y16_1627_c1_1624_2532 301
1041 3300053093 Ga0500651_0047289 Ga0500651_0047289_231_1136 301
1042 3300053119 Ga0500595_000162 Ga0500595_000162_32343_33359 301
1043 3300053139 Ga0500568_0000316 Ga0500568_0000316_6308_7213 301
1044 3300053140 Ga0500573_0000049 Ga0500573_0000049_15666_16757 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

59

221

0.98

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

226

358

0.87

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

59

153

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j39-assembly1.cif.gz_A crystal structure of cmis2 with inhibitor 0.967 1 32
6vpb-assembly1.cif.gz_B-2 a novel membrane-bound 6-phosphogluconate dehydrogenase from the acetic acid bacteria gluconacetobacter diazotrophicus (gd6pgd) 0.9533 1 293
5x6r-assembly2.cif.gz_B crystal structure of saccharomyces cerevisiae kmo in complex with ro 61-8048 0.9514 1 33
4e21-assembly1.cif.gz_B-2 the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens 0.9496 2 293
4e21-assembly1.cif.gz_A-2 the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens 0.9485 2 290
ID Description Score Start End Superfamily
af_Q5VQP1_29_415_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9478 3 30 3.50.50.60
6fqxH01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9427 2 169 3.40.50.720
af_A4HWA7_1_176_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9405 2 30 3.50.50.60
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9386 2 33 3.50.50.60
5y8iB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9356 2 164 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6I5CPF4-F1-model_v4 6-phosphogluconate dehydrogenase 0.9949 47 154 GO:0004616
GO:0050661
AF-T1B9E1-F1-model_v4 6-phosphogluconate dehydrogenase, NAD-binding domain protein (EC 1.1.-.-) 0.9865 1 67 GO:0016491
GO:0050661
AF-A0A328P4C0-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9862 1 301 GO:0004616
GO:0006098
GO:0016054
GO:0019521
GO:0050661
AF-A0A2D6IMQ2-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9862 1 301 GO:0004616
GO:0006098
GO:0016054
GO:0019521
GO:0050661
AF-A0A6A0JM29-F1-model_v4 6-phosphogluconate dehydrogenase 0.9857 1 75 GO:0016491
GO:0050661

Feature Viewer

pLDDT pTM Quality
94.76 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map