F487592
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 989 | 536 | 932 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300044656|Ga0466969_0024483|Ga0466969_0024483_1142_1567 |
| Length | 141 |
| Sequence | VPRQTSAIELKELAEMARLVGVDLPREKRLEIALTYIYGIGRTRAQATCAGAGVSPDVRVKDLSEDDLIKLRDWIDGNYKIEGDLRREVAADIRRKMEIGCYQGLRHRRGLPVRGQRTHTNARTRKGPRRAIAGKKKPGKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 2 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 3 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 4 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 5 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 6 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 7 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 8 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 9 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 10 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 11 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 12 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 13 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 14 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 15 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 16 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 17 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 18 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 19 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 20 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 21 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 22 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 23 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 24 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 25 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 26 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 27 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 28 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 29 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 30 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 31 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 32 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 33 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 34 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 35 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 36 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 37 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 38 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 39 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 40 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 41 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 42 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 43 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 44 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 45 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 46 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 47 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 48 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 49 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 50 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 51 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 52 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 53 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 54 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 55 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 57 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 58 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 59 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 60 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 61 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 62 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 63 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 64 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 65 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 66 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 67 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 68 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 69 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 72 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 73 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 87 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 97 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 100 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 101 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 102 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 103 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 105 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 106 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 107 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 108 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 109 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 110 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 113 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 114 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 126 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 141 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020071 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 146 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 153 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 202 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 203 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 204 | 3300029282 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 | Metatranscriptome | Rhizosphere |
| 205 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 206 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 207 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 208 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 209 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 210 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 211 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 212 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 213 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 214 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 215 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 216 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 217 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 220 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 221 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 223 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 224 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 225 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 226 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 227 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 228 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 229 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 230 | 3300031667 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 231 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 232 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 234 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 235 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 236 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 237 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 238 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 239 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 240 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 241 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 242 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 243 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 244 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 245 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 246 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 247 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 248 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 249 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 250 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 252 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 253 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 254 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 255 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 259 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 260 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 261 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 262 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 263 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 264 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 265 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 266 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 267 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 268 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 269 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 270 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 271 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 272 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 273 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 276 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 277 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 278 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 279 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 280 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 281 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 282 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 283 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 284 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 285 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 286 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 287 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 288 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 289 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 290 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 291 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 292 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 293 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 294 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 295 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 296 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 297 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 298 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 299 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 300 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 301 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 302 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 303 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 304 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 305 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 306 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 307 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 308 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 309 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 310 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 311 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 312 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 375 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 376 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 377 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 378 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 379 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 380 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 383 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 384 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 385 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 386 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 387 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 388 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 389 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 390 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 391 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 392 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 393 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 394 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 443 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 444 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 445 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 446 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 447 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 455 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 456 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 457 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 458 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 459 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 460 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 464 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 467 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 470 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 471 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 472 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 473 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 474 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 475 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 476 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 477 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 478 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 479 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 480 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 481 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 482 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 483 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 484 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 485 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 486 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 487 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 488 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 489 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 490 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 491 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 492 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 494 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 495 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 496 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 497 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 498 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 502 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 503 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 504 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 505 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 506 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 507 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 508 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 509 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 510 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 511 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 512 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 513 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 514 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 515 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 516 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 517 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 518 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 519 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 520 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 521 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 522 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 523 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 524 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 525 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 526 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 527 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 528 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 529 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 530 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 531 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 532 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 533 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 534 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 535 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 536 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.13 |
| Metatranscriptomes | 19.11 |
| Isolates | 5.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.56 |
| Nodule | 2.53 |
| Rhizoplane | 3.64 |
| Rhizosphere | 79.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10012589 | 3300001989 | Bacteria | 3103 |
| 2 | JGI24737J22298_10004109 | 3300001990 | Bacteria | 5084 |
| 3 | JGI24735J21928_10037966 | 3300002067 | Bacteria | 1411 |
| 4 | JGI24738J21930_10009088 | 3300002075 | Bacteria | 2248 |
| 5 | JGI25406J46586_10054419 | 3300003203 | Bacteria | 1324 |
| 6 | Ga0006777J48905_1016128 | 3300003308 | Bacteria | 1474 |
| 7 | rootH1_10087441 | 3300003316 | Bacteria | 1319 |
| 8 | rootH1_10044574 | 3300003323 | Bacteria | 1269 |
| 9 | JGI25160J50197_1013781 | 3300003354 | Bacteria | 2738 |
| 10 | JGI25160J50197_1026569 | 3300003354 | Bacteria | 1593 |
| 11 | Ga0007410J51695_1079086 | 3300003574 | Bacteria | 815 |
| 12 | Ga0007409J51694_1027373 | 3300003575 | Bacteria | 920 |
| 13 | Ga0007409J51694_1095426 | 3300003575 | Bacteria | 836 |
| 14 | Ga0007429J51699_1077728 | 3300003579 | Bacteria | 773 |
| 15 | Ga0007429J51699_1098508 | 3300003579 | Bacteria | 590 |
| 16 | Ga0058858_1005032 | 3300004785 | Bacteria | 2048 |
| 17 | Ga0058859_11826058 | 3300004798 | Bacteria | 929 |
| 18 | Ga0058863_10085417 | 3300004799 | Bacteria | 885 |
| 19 | Ga0058863_10169109 | 3300004799 | Bacteria | 997 |
| 20 | Ga0058863_11770428 | 3300004799 | Bacteria | 982 |
| 21 | Ga0058861_10106487 | 3300004800 | Bacteria | 846 |
| 22 | Ga0058861_10162069 | 3300004800 | Bacteria | 677 |
| 23 | Ga0058861_10186282 | 3300004800 | Bacteria | 597 |
| 24 | Ga0058861_11881892 | 3300004800 | Bacteria | 865 |
| 25 | Ga0058860_10025829 | 3300004801 | Bacteria | 1322 |
| 26 | Ga0058860_10028160 | 3300004801 | Bacteria | 1054 |
| 27 | Ga0058860_10106898 | 3300004801 | Bacteria | 637 |
| 28 | Ga0058860_10115660 | 3300004801 | Bacteria | 982 |
| 29 | Ga0058860_10229221 | 3300004801 | Bacteria | 940 |
| 30 | Ga0058862_10127495 | 3300004803 | Bacteria | 979 |
| 31 | Ga0058862_10191375 | 3300004803 | Bacteria | 860 |
| 32 | Ga0058862_12724420 | 3300004803 | Bacteria | 855 |
| 33 | Ga0070658_10786068 | 3300005327 | Bacteria | 827 |
| 34 | Ga0070670_100338738 | 3300005331 | Bacteria | 1320 |
| 35 | Ga0070670_101097127 | 3300005331 | Bacteria | 726 |
| 36 | Ga0068869_100018620 | 3300005334 | Bacteria | 4731 |
| 37 | Ga0068869_100883330 | 3300005334 | Bacteria | 773 |
| 38 | Ga0068869_100940981 | 3300005334 | Bacteria | 750 |
| 39 | Ga0068868_100702561 | 3300005338 | Bacteria | 905 |
| 40 | Ga0070687_101127276 | 3300005343 | Bacteria | 575 |
| 41 | Ga0070668_100196908 | 3300005347 | Bacteria | 1653 |
| 42 | Ga0070675_100194727 | 3300005354 | Bacteria | 1757 |
| 43 | Ga0070674_100077936 | 3300005356 | Bacteria | 2361 |
| 44 | Ga0070667_102079642 | 3300005367 | Bacteria | 535 |
| 45 | Ga0070709_10111103 | 3300005434 | Bacteria | 1843 |
| 46 | Ga0070709_11011019 | 3300005434 | Bacteria | 662 |
| 47 | Ga0070714_100182078 | 3300005435 | Bacteria | 1912 |
| 48 | Ga0070714_101424383 | 3300005435 | Bacteria | 677 |
| 49 | Ga0070713_100075640 | 3300005436 | Bacteria | 2856 |
| 50 | Ga0070710_10000334 | 3300005437 | Bacteria | 22500 |
| 51 | Ga0070701_10390157 | 3300005438 | Bacteria | 880 |
| 52 | Ga0070711_100127812 | 3300005439 | Bacteria | 1889 |
| 53 | Ga0070678_100314920 | 3300005456 | Bacteria | 1334 |
| 54 | Ga0070678_101138709 | 3300005456 | Bacteria | 722 |
| 55 | Ga0070681_10448711 | 3300005458 | Bacteria | 1202 |
| 56 | Ga0068853_101415438 | 3300005539 | Bacteria | 673 |
| 57 | Ga0070672_100332582 | 3300005543 | Bacteria | 1293 |
| 58 | Ga0070693_101327412 | 3300005547 | Bacteria | 557 |
| 59 | Ga0068856_100081044 | 3300005614 | Bacteria | 3220 |
| 60 | Ga0068856_102522922 | 3300005614 | Bacteria | 521 |
| 61 | Ga0068859_100034160 | 3300005617 | Bacteria | 5105 |
| 62 | Ga0068859_100092242 | 3300005617 | Bacteria | 3080 |
| 63 | Ga0068864_101053908 | 3300005618 | Bacteria | 808 |
| 64 | Ga0068863_100001338 | 3300005841 | Bacteria | 24526 |
| 65 | Ga0068858_100000010 | 3300005842 | Bacteria | 234748 |
| 66 | Ga0068858_100010928 | 3300005842 | Bacteria | 8579 |
| 67 | Ga0068862_100000362 | 3300005844 | Bacteria | 49253 |
| 68 | Ga0081455_10006542 | 3300005937 | Bacteria | 12469 |
| 69 | Ga0081540_1245936 | 3300005983 | Bacteria | 626 |
| 70 | Ga0081539_10002050 | 3300005985 | Bacteria | 30294 |
| 71 | Ga0081539_10021084 | 3300005985 | Bacteria | 4370 |
| 72 | Ga0070717_10294088 | 3300006028 | Bacteria | 1442 |
| 73 | Ga0075365_10244325 | 3300006038 | Bacteria | 1261 |
| 74 | Ga0075368_10003605 | 3300006042 | Bacteria | 5187 |
| 75 | Ga0075363_100018785 | 3300006048 | Bacteria | 3447 |
| 76 | Ga0075364_10008222 | 3300006051 | Bacteria | 6229 |
| 77 | Ga0070712_100506623 | 3300006175 | Bacteria | 1012 |
| 78 | Ga0075367_10075343 | 3300006178 | Bacteria | 2035 |
| 79 | Ga0075367_10172232 | 3300006178 | Bacteria | 1348 |
| 80 | Ga0075369_10014830 | 3300006186 | Bacteria | 3118 |
| 81 | Ga0075366_10481228 | 3300006195 | Bacteria | 767 |
| 82 | Ga0075370_10088385 | 3300006353 | Bacteria | 1786 |
| 83 | Ga0075370_10119183 | 3300006353 | Bacteria | 1535 |
| 84 | Ga0075430_100325169 | 3300006846 | Bacteria | 1271 |
| 85 | Ga0075431_100246785 | 3300006847 | Bacteria | 1815 |
| 86 | Ga0075431_100657837 | 3300006847 | Bacteria | 1028 |
| 87 | Ga0075429_100140830 | 3300006880 | Bacteria | 2111 |
| 88 | Ga0097620_100034160 | 3300006931 | Bacteria | 5105 |
| 89 | Ga0097620_100092239 | 3300006931 | Bacteria | 3080 |
| 90 | Ga0099826_10027493 | 3300006948 | Bacteria | 4179 |
| 91 | Ga0099794_10369792 | 3300007265 | Bacteria | 747 |
| 92 | Ga0105244_10100475 | 3300009036 | Bacteria | 1415 |
| 93 | Ga0105240_10204243 | 3300009093 | Bacteria | 2314 |
| 94 | Ga0111539_11717097 | 3300009094 | Bacteria | 728 |
| 95 | Ga0105245_10575897 | 3300009098 | Bacteria | 1150 |
| 96 | Ga0105247_10000016 | 3300009101 | Bacteria | 263389 |
| 97 | Ga0105247_10212251 | 3300009101 | Bacteria | 1306 |
| 98 | Ga0105243_10162470 | 3300009148 | Bacteria | 1927 |
| 99 | Ga0105243_10994620 | 3300009148 | Bacteria | 841 |
| 100 | Ga0105241_10796030 | 3300009174 | Bacteria | 870 |
| 101 | Ga0105248_10000035 | 3300009177 | Bacteria | 187578 |
| 102 | Ga0105248_10002899 | 3300009177 | Bacteria | 19028 |
| 103 | Ga0105248_12584018 | 3300009177 | Bacteria | 579 |
| 104 | Ga0105248_13437596 | 3300009177 | Bacteria | 503 |
| 105 | Ga0105249_10068762 | 3300009553 | Bacteria | 3267 |
| 106 | Ga0105249_10687247 | 3300009553 | Bacteria | 1083 |
| 107 | Ga0105239_11608217 | 3300010375 | Bacteria | 751 |
| 108 | Ga0105239_12859172 | 3300010375 | Bacteria | 563 |
| 109 | Ga0105239_13205203 | 3300010375 | Bacteria | 533 |
| 110 | Ga0105246_10002569 | 3300011119 | Bacteria | 10977 |
| 111 | Ga0105246_10434317 | 3300011119 | Bacteria | 1099 |
| 112 | Ga0157322_1013348 | 3300012490 | Bacteria | 705 |
| 113 | Ga0154012_109278 | 3300013059 | Bacteria | 1212 |
| 114 | Ga0154010_148221 | 3300013062 | Bacteria | 888 |
| 115 | Ga0157370_12126253 | 3300013104 | Bacteria | 503 |
| 116 | Ga0157374_10520828 | 3300013296 | Bacteria | 1195 |
| 117 | Ga0157378_10490338 | 3300013297 | Bacteria | 1226 |
| 118 | Ga0157378_11560850 | 3300013297 | Bacteria | 705 |
| 119 | Ga0157375_11093622 | 3300013308 | Bacteria | 933 |
| 120 | Ga0163163_10010268 | 3300014325 | Bacteria | 8414 |
| 121 | Ga0163163_12067520 | 3300014325 | Bacteria | 629 |
| 122 | Ga0157380_10213417 | 3300014326 | Bacteria | 1722 |
| 123 | Ga0182008_10009535 | 3300014497 | Bacteria | 5233 |
| 124 | Ga0182008_10354699 | 3300014497 | Bacteria | 779 |
| 125 | Ga0157377_10543637 | 3300014745 | Bacteria | 819 |
| 126 | Ga0157379_10009461 | 3300014968 | Bacteria | 8492 |
| 127 | Ga0157379_10101600 | 3300014968 | Bacteria | 2581 |
| 128 | Ga0157379_10388618 | 3300014968 | Bacteria | 1281 |
| 129 | Ga0157379_10784670 | 3300014968 | Bacteria | 898 |
| 130 | Ga0157376_10865869 | 3300014969 | Bacteria | 920 |
| 131 | Ga0182006_1012482 | 3300015261 | Bacteria | 3715 |
| 132 | Ga0182007_10010395 | 3300015262 | Bacteria | 3680 |
| 133 | Ga0183367_1002 | 3300015688 | Bacteria | 1101531 |
| 134 | Ga0197907_10071147 | 3300020069 | Bacteria | 1633 |
| 135 | Ga0197907_10456483 | 3300020069 | Bacteria | 3929 |
| 136 | Ga0197907_10872862 | 3300020069 | Bacteria | 1123 |
| 137 | Ga0197907_10874185 | 3300020069 | Bacteria | 1074 |
| 138 | Ga0197907_11028216 | 3300020069 | Bacteria | 816 |
| 139 | Ga0206356_10671161 | 3300020070 | Bacteria | 1880 |
| 140 | Ga0206356_10797342 | 3300020070 | Bacteria | 1342 |
| 141 | Ga0206356_10880070 | 3300020070 | Bacteria | 587 |
| 142 | Ga0206356_10946215 | 3300020070 | Bacteria | 2606 |
| 143 | Ga0206348_113828 | 3300020071 | Bacteria | 859 |
| 144 | Ga0206349_1484921 | 3300020075 | Bacteria | 1124 |
| 145 | Ga0206349_1782543 | 3300020075 | Bacteria | 949 |
| 146 | Ga0206349_1815480 | 3300020075 | Bacteria | 2024 |
| 147 | Ga0206355_1131249 | 3300020076 | Bacteria | 2134 |
| 148 | Ga0206355_1350876 | 3300020076 | Bacteria | 1097 |
| 149 | Ga0206351_10013403 | 3300020077 | Bacteria | 1454 |
| 150 | Ga0206351_10035715 | 3300020077 | Bacteria | 1337 |
| 151 | Ga0206351_10267213 | 3300020077 | Bacteria | 1843 |
| 152 | Ga0206351_10945162 | 3300020077 | Bacteria | 1666 |
| 153 | Ga0206352_10000892 | 3300020078 | Bacteria | 1414 |
| 154 | Ga0206352_10048704 | 3300020078 | Bacteria | 1153 |
| 155 | Ga0206352_10486095 | 3300020078 | Bacteria | 949 |
| 156 | Ga0206352_10571914 | 3300020078 | Bacteria | 1283 |
| 157 | Ga0206352_10718751 | 3300020078 | Bacteria | 1697 |
| 158 | Ga0206350_10201708 | 3300020080 | Bacteria | 908 |
| 159 | Ga0206350_10308689 | 3300020080 | Bacteria | 2085 |
| 160 | Ga0206350_10386703 | 3300020080 | Bacteria | 1202 |
| 161 | Ga0206350_10762397 | 3300020080 | Bacteria | 777 |
| 162 | Ga0206350_11076420 | 3300020080 | Bacteria | 668 |
| 163 | Ga0206354_10049783 | 3300020081 | Bacteria | 1695 |
| 164 | Ga0206354_10458357 | 3300020081 | Bacteria | 1553 |
| 165 | Ga0206354_10517799 | 3300020081 | Bacteria | 2547 |
| 166 | Ga0206354_11155240 | 3300020081 | Bacteria | 2060 |
| 167 | Ga0206353_10186563 | 3300020082 | Bacteria | 1139 |
| 168 | Ga0206353_10222344 | 3300020082 | Bacteria | 4182 |
| 169 | Ga0206353_11116048 | 3300020082 | Bacteria | 8566 |
| 170 | Ga0206353_11628847 | 3300020082 | Bacteria | 1009 |
| 171 | Ga0154015_1218295 | 3300020610 | Bacteria | 1822 |
| 172 | Ga0154015_1608521 | 3300020610 | Bacteria | 883 |
| 173 | Ga0213875_10001257 | 3300021388 | Bacteria | 17050 |
| 174 | Ga0213875_10001291 | 3300021388 | Bacteria | 16695 |
| 175 | Ga0213875_10050952 | 3300021388 | Bacteria | 1939 |
| 176 | Ga0224712_10000543 | 3300022467 | Bacteria | 7653 |
| 177 | Ga0224712_10113455 | 3300022467 | Bacteria | 1165 |
| 178 | Ga0224712_10141630 | 3300022467 | Bacteria | 1059 |
| 179 | Ga0224712_10182575 | 3300022467 | Bacteria | 946 |
| 180 | Ga0209758_1000870 | 3300025297 | Bacteria | 41550 |
| 181 | Ga0207426_1005272 | 3300025302 | Bacteria | 5953 |
| 182 | Ga0207426_1012521 | 3300025302 | Bacteria | 3181 |
| 183 | Ga0207426_1061190 | 3300025302 | Bacteria | 1082 |
| 184 | Ga0209051_1121767 | 3300025303 | Bacteria | 661 |
| 185 | Ga0207655_1087485 | 3300025728 | Bacteria | 1105 |
| 186 | Ga0207692_10007633 | 3300025898 | Bacteria | 4437 |
| 187 | Ga0207710_10000017 | 3300025900 | Bacteria | 370962 |
| 188 | Ga0207710_10000048 | 3300025900 | Bacteria | 189597 |
| 189 | Ga0207688_10041350 | 3300025901 | Bacteria | 2564 |
| 190 | Ga0207688_10972313 | 3300025901 | Bacteria | 537 |
| 191 | Ga0207647_10006322 | 3300025904 | Bacteria | 8617 |
| 192 | Ga0207699_10027891 | 3300025906 | Bacteria | 3132 |
| 193 | Ga0207699_10275966 | 3300025906 | Bacteria | 1166 |
| 194 | Ga0207705_10003438 | 3300025909 | Bacteria | 12045 |
| 195 | Ga0207705_10989837 | 3300025909 | Bacteria | 650 |
| 196 | Ga0207707_10241686 | 3300025912 | Bacteria | 1570 |
| 197 | Ga0207695_10715601 | 3300025913 | Bacteria | 882 |
| 198 | Ga0207693_10451024 | 3300025915 | Bacteria | 1005 |
| 199 | Ga0207663_10047146 | 3300025916 | Bacteria | 2659 |
| 200 | Ga0207662_10975540 | 3300025918 | Bacteria | 601 |
| 201 | Ga0207649_10604024 | 3300025920 | Bacteria | 844 |
| 202 | Ga0207652_10386953 | 3300025921 | Bacteria | 1262 |
| 203 | Ga0207652_11042144 | 3300025921 | Bacteria | 717 |
| 204 | Ga0207681_11787568 | 3300025923 | Bacteria | 513 |
| 205 | Ga0207694_11063285 | 3300025924 | Bacteria | 685 |
| 206 | Ga0207659_10145326 | 3300025926 | Bacteria | 1846 |
| 207 | Ga0207659_11303460 | 3300025926 | Bacteria | 623 |
| 208 | Ga0207687_10380765 | 3300025927 | Bacteria | 1156 |
| 209 | Ga0207700_10075738 | 3300025928 | Bacteria | 2609 |
| 210 | Ga0207664_10003521 | 3300025929 | Bacteria | 10458 |
| 211 | Ga0207664_10187099 | 3300025929 | Bacteria | 1781 |
| 212 | Ga0207664_10823035 | 3300025929 | Bacteria | 835 |
| 213 | Ga0207690_11281629 | 3300025932 | Bacteria | 612 |
| 214 | Ga0207706_10285731 | 3300025933 | Bacteria | 1438 |
| 215 | Ga0207686_10589347 | 3300025934 | Bacteria | 874 |
| 216 | Ga0207669_10278193 | 3300025937 | Bacteria | 1261 |
| 217 | Ga0207691_10220168 | 3300025940 | Bacteria | 1646 |
| 218 | Ga0207691_10223984 | 3300025940 | Bacteria | 1630 |
| 219 | Ga0207711_10000134 | 3300025941 | Bacteria | 77843 |
| 220 | Ga0207711_10002995 | 3300025941 | Bacteria | 14760 |
| 221 | Ga0207689_10020564 | 3300025942 | Bacteria | 5554 |
| 222 | Ga0207661_10721492 | 3300025944 | Bacteria | 917 |
| 223 | Ga0207679_10912924 | 3300025945 | Bacteria | 803 |
| 224 | Ga0207651_10189905 | 3300025960 | Bacteria | 1638 |
| 225 | Ga0207712_10040803 | 3300025961 | Bacteria | 3187 |
| 226 | Ga0207712_10119117 | 3300025961 | Bacteria | 1994 |
| 227 | Ga0207712_11405517 | 3300025961 | Bacteria | 624 |
| 228 | Ga0207668_10264527 | 3300025972 | Bacteria | 1403 |
| 229 | Ga0207640_11328698 | 3300025981 | Bacteria | 642 |
| 230 | Ga0207658_10002262 | 3300025986 | Bacteria | 14246 |
| 231 | Ga0207658_12136008 | 3300025986 | Bacteria | 509 |
| 232 | Ga0207677_11330309 | 3300026023 | Bacteria | 660 |
| 233 | Ga0207677_11416085 | 3300026023 | Bacteria | 640 |
| 234 | Ga0207703_10000002 | 3300026035 | Bacteria | 600711 |
| 235 | Ga0207703_10003502 | 3300026035 | Bacteria | 13129 |
| 236 | Ga0207639_11335699 | 3300026041 | Bacteria | 673 |
| 237 | Ga0207702_10123630 | 3300026078 | Bacteria | 2319 |
| 238 | Ga0207702_10204359 | 3300026078 | Bacteria | 1833 |
| 239 | Ga0207702_10547570 | 3300026078 | Bacteria | 1132 |
| 240 | Ga0207641_10002679 | 3300026088 | Bacteria | 16261 |
| 241 | Ga0207674_10226074 | 3300026116 | Bacteria | 1820 |
| 242 | Ga0207683_10691384 | 3300026121 | Bacteria | 945 |
| 243 | Ga0209371_1016429 | 3300027312 | Bacteria | 1952 |
| 244 | Ga0209813_10004425 | 3300027866 | Bacteria | 3355 |
| 245 | Ga0268265_10000363 | 3300028380 | Bacteria | 49150 |
| 246 | Ga0268265_10373786 | 3300028380 | Bacteria | 1309 |
| 247 | Ga0265334_10003386 | 3300028573 | Bacteria | 7272 |
| 248 | Ga0307517_10006905 | 3300028786 | Bacteria | 16700 |
| 249 | Ga0307515_10107145 | 3300028794 | Bacteria | 3307 |
| 250 | Ga0307515_10255141 | 3300028794 | Bacteria | 1499 |
| 251 | Ga0311003_147053 | 3300029282 | Bacteria | 926 |
| 252 | Ga0310981_1041238 | 3300029285 | Bacteria | 910 |
| 253 | Ga0268256_1015007 | 3300030500 | Bacteria | 2277 |
| 254 | Ga0307511_10017698 | 3300030521 | Bacteria | 6830 |
| 255 | Ga0307511_10100912 | 3300030521 | Bacteria | 1896 |
| 256 | Ga0307512_10083358 | 3300030522 | Bacteria | 2280 |
| 257 | Ga0307512_10197589 | 3300030522 | Bacteria | 1095 |
| 258 | Ga0316177_1047979 | 3300030731 | Bacteria | 3401 |
| 259 | Ga0316176_1038867 | 3300030732 | Bacteria | 1785 |
| 260 | Ga0314311_1019554 | 3300030733 | Bacteria | 3266 |
| 261 | Ga0314311_1063336 | 3300030733 | Bacteria | 534 |
| 262 | Ga0316179_1032206 | 3300030734 | Bacteria | 2864 |
| 263 | Ga0316178_1099044 | 3300030735 | Bacteria | 1529 |
| 264 | Ga0316180_1042781 | 3300030736 | Bacteria | 1586 |
| 265 | Ga0316181_1204309 | 3300030744 | Bacteria | 1025 |
| 266 | Ga0316181_1229376 | 3300030744 | Bacteria | 964 |
| 267 | Ga0316182_1033344 | 3300030745 | Bacteria | 2098 |
| 268 | Ga0265766_1000574 | 3300030863 | Bacteria | 1640 |
| 269 | Ga0265768_108547 | 3300030963 | Bacteria | 637 |
| 270 | Ga0265325_10040754 | 3300031241 | Bacteria | 2437 |
| 271 | Ga0265340_10007092 | 3300031247 | Bacteria | 6109 |
| 272 | Ga0265340_10074702 | 3300031247 | Bacteria | 1602 |
| 273 | Ga0265339_10047818 | 3300031249 | Bacteria | 2348 |
| 274 | Ga0265316_10124459 | 3300031344 | Bacteria | 1945 |
| 275 | Ga0307513_10342355 | 3300031456 | Bacteria | 1245 |
| 276 | Ga0307509_10009247 | 3300031507 | Bacteria | 12366 |
| 277 | Ga0307509_10411162 | 3300031507 | Bacteria | 1056 |
| 278 | Ga0307408_102136462 | 3300031548 | Bacteria | 540 |
| 279 | Ga0310117_105392 | 3300031592 | Bacteria | 1385 |
| 280 | Ga0310103_131967 | 3300031614 | Bacteria | 629 |
| 281 | Ga0307508_10000924 | 3300031616 | Bacteria | 34111 |
| 282 | Ga0307508_10031723 | 3300031616 | Bacteria | 4775 |
| 283 | Ga0307508_10066550 | 3300031616 | Bacteria | 3172 |
| 284 | Ga0307508_10115798 | 3300031616 | Bacteria | 2282 |
| 285 | Ga0307514_10117565 | 3300031649 | Bacteria | 1864 |
| 286 | Ga0307514_10121653 | 3300031649 | Bacteria | 1819 |
| 287 | Ga0307514_10219817 | 3300031649 | Bacteria | 1166 |
| 288 | Ga0310111_106844 | 3300031667 | Bacteria | 1477 |
| 289 | Ga0316579_10000038 | 3300031691 | Bacteria | 30399 |
| 290 | Ga0265342_10057885 | 3300031712 | Bacteria | 2292 |
| 291 | Ga0316576_10109103 | 3300031727 | Bacteria | 2074 |
| 292 | Ga0316576_10350768 | 3300031727 | Bacteria | 1098 |
| 293 | Ga0307516_10034474 | 3300031730 | Bacteria | 5085 |
| 294 | Ga0307516_10594784 | 3300031730 | Bacteria | 760 |
| 295 | Ga0307405_10309324 | 3300031731 | Bacteria | 1202 |
| 296 | Ga0307405_10476937 | 3300031731 | Bacteria | 995 |
| 297 | Ga0307405_10517444 | 3300031731 | Bacteria | 959 |
| 298 | Ga0316577_10165966 | 3300031733 | Bacteria | 1246 |
| 299 | Ga0307413_10556118 | 3300031824 | Bacteria | 932 |
| 300 | Ga0307413_11065620 | 3300031824 | Bacteria | 696 |
| 301 | Ga0307413_11171584 | 3300031824 | Bacteria | 667 |
| 302 | Ga0307518_10578106 | 3300031838 | Bacteria | 545 |
| 303 | Ga0307410_10137079 | 3300031852 | Bacteria | 1805 |
| 304 | Ga0307406_10004670 | 3300031901 | Bacteria | 7462 |
| 305 | Ga0307406_10465426 | 3300031901 | Bacteria | 1017 |
| 306 | Ga0307406_10754113 | 3300031901 | Bacteria | 817 |
| 307 | Ga0307406_11264342 | 3300031901 | Bacteria | 643 |
| 308 | Ga0307406_11729656 | 3300031901 | Bacteria | 555 |
| 309 | Ga0307406_11867102 | 3300031901 | Bacteria | 535 |
| 310 | Ga0307407_10029824 | 3300031903 | Bacteria | 2935 |
| 311 | Ga0307407_10199153 | 3300031903 | Bacteria | 1341 |
| 312 | Ga0307412_10692764 | 3300031911 | Bacteria | 874 |
| 313 | Ga0307409_100330395 | 3300031995 | Bacteria | 1430 |
| 314 | Ga0307409_100399841 | 3300031995 | Bacteria | 1312 |
| 315 | Ga0307409_100416549 | 3300031995 | Bacteria | 1287 |
| 316 | Ga0307409_100651764 | 3300031995 | Bacteria | 1047 |
| 317 | Ga0307409_101081770 | 3300031995 | Bacteria | 822 |
| 318 | Ga0307409_102410040 | 3300031995 | Bacteria | 555 |
| 319 | Ga0307416_100124216 | 3300032002 | Bacteria | 2308 |
| 320 | Ga0307416_100583936 | 3300032002 | Bacteria | 1195 |
| 321 | Ga0307416_100721571 | 3300032002 | Bacteria | 1087 |
| 322 | Ga0307414_10423502 | 3300032004 | Bacteria | 1161 |
| 323 | Ga0307411_10148286 | 3300032005 | Bacteria | 1740 |
| 324 | Ga0307411_10283867 | 3300032005 | Bacteria | 1319 |
| 325 | Ga0307415_100029200 | 3300032126 | Bacteria | 3521 |
| 326 | Ga0307415_100049757 | 3300032126 | Bacteria | 2836 |
| 327 | Ga0307415_100591499 | 3300032126 | Bacteria | 986 |
| 328 | Ga0307415_101146559 | 3300032126 | Bacteria | 730 |
| 329 | Ga0307507_10003799 | 3300033179 | Bacteria | 28240 |
| 330 | Ga0307507_10024930 | 3300033179 | Bacteria | 6500 |
| 331 | Ga0307507_10025585 | 3300033179 | Bacteria | 6396 |
| 332 | Ga0307510_10090689 | 3300033180 | Bacteria | 2901 |
| 333 | Ga0307510_10206325 | 3300033180 | Bacteria | 1493 |
| 334 | Ga0307510_10229710 | 3300033180 | Bacteria | 1359 |
| 335 | Ga0373958_0132797 | 3300034819 | Bacteria | 611 |
| 336 | Ga0316574_0197315 | 3300035398 | Bacteria | 1293 |
| 337 | Ga0316574_0631025 | 3300035398 | Bacteria | 660 |
| 338 | Ga0373947_0204412 | 3300035725 | Bacteria | 1293 |
| 339 | Ga0316582_0184816 | 3300036647 | Bacteria | 1419 |
| 340 | Ga0316584_0038993 | 3300036712 | Bacteria | 3536 |
| 341 | Ga0373925_0106577 | 3300037068 | Bacteria | 2161 |
| 342 | Ga0395899_0008026 | 3300037312 | Bacteria | 8128 |
| 343 | Ga0395900_0199314 | 3300037418 | Bacteria | 2026 |
| 344 | Ga0395898_0026184 | 3300037466 | Bacteria | 5870 |
| 345 | Ga0395898_0030243 | 3300037466 | Bacteria | 5420 |
| 346 | Ga0436364_0010700 | 3300037853 | Bacteria | 115369 |
| 347 | Ga0436364_0424211 | 3300037853 | Bacteria | 2368 |
| 348 | Ga0436364_1354648 | 3300037853 | Bacteria | 115417 |
| 349 | Ga0395901_0031729 | 3300038443 | Bacteria | 5447 |
| 350 | Ga0400485_08169 | 3300038735 | Bacteria | 55719 |
| 351 | Ga0400486_03564 | 3300038742 | Bacteria | 38786 |
| 352 | Ga0400483_019574 | 3300039062 | Bacteria | 7106 |
| 353 | Ga0436365_0340703 | 3300039437 | Bacteria | 1430 |
| 354 | Ga0436363_0020748 | 3300039450 | Bacteria | 1009 |
| 355 | Ga0436362_0399705 | 3300039453 | Bacteria | 1097 |
| 356 | Ga0439436_0003559 | 3300041404 | Bacteria | 4735 |
| 357 | Ga0439436_0029047 | 3300041404 | Bacteria | 1611 |
| 358 | Ga0439439_0004725 | 3300041406 | Bacteria | 3080 |
| 359 | Ga0439453_0083764 | 3300041408 | Bacteria | 691 |
| 360 | Ga0439461_0044338 | 3300041410 | Bacteria | 970 |
| 361 | Ga0439465_0069611 | 3300041413 | Bacteria | 1178 |
| 362 | Ga0451801_20119 | 3300041455 | Bacteria | 536 |
| 363 | Ga0451798_0882651 | 3300041458 | Bacteria | 714 |
| 364 | Ga0451802_0369205 | 3300041460 | Bacteria | 1034 |
| 365 | Ga0451805_128977 | 3300041461 | Bacteria | 1445 |
| 366 | Ga0451839_0534569 | 3300041496 | Bacteria | 1178 |
| 367 | Ga0451847_0358713 | 3300041503 | Bacteria | 806 |
| 368 | Ga0451843_1340122 | 3300041509 | Bacteria | 1786 |
| 369 | Ga0451853_1319955 | 3300041512 | Bacteria | 1805 |
| 370 | Ga0451853_1446781 | 3300041512 | Bacteria | 1028 |
| 371 | Ga0439431_0105579 | 3300041997 | Bacteria | 777 |
| 372 | Ga0439433_0002570 | 3300041999 | Bacteria | 3854 |
| 373 | Ga0439433_0005893 | 3300041999 | Bacteria | 2631 |
| 374 | Ga0439442_049219 | 3300042002 | Bacteria | 888 |
| 375 | Ga0439449_0009099 | 3300042007 | Bacteria | 3766 |
| 376 | Ga0439449_0011760 | 3300042007 | Bacteria | 3289 |
| 377 | Ga0439450_071020 | 3300042008 | Bacteria | 854 |
| 378 | Ga0439454_012822 | 3300042011 | Bacteria | 1142 |
| 379 | Ga0439455_0001031 | 3300042012 | Bacteria | 4400 |
| 380 | Ga0439457_002785 | 3300042014 | Bacteria | 4890 |
| 381 | Ga0439457_068365 | 3300042014 | Bacteria | 808 |
| 382 | Ga0439462_0000539 | 3300042015 | Bacteria | 7498 |
| 383 | Ga0450890_006468 | 3300042127 | Bacteria | 1498 |
| 384 | Ga0450894_015795 | 3300042131 | Bacteria | 1001 |
| 385 | Ga0450899_001611 | 3300042135 | Bacteria | 2496 |
| 386 | Ga0450900_015844 | 3300042136 | Bacteria | 1016 |
| 387 | Ga0450903_000013 | 3300042138 | Bacteria | 34246 |
| 388 | Ga0450903_047020 | 3300042138 | Bacteria | 634 |
| 389 | Ga0439458_0000117 | 3300042157 | Bacteria | 16127 |
| 390 | Ga0439458_0039956 | 3300042157 | Bacteria | 1136 |
| 391 | Ga0439458_0083099 | 3300042157 | Bacteria | 818 |
| 392 | Ga0439434_0091373 | 3300042435 | Bacteria | 974 |
| 393 | Ga0439434_0154515 | 3300042435 | Bacteria | 761 |
| 394 | Ga0466969_0024483 | 3300044656 | Bacteria | 3104 |
| 395 | Ga0466969_0035870 | 3300044656 | Bacteria | 2507 |
| 396 | Ga0466969_0096611 | 3300044656 | Bacteria | 1394 |
| 397 | Ga0466972_0004874 | 3300044658 | Bacteria | 6730 |
| 398 | Ga0466972_0156714 | 3300044658 | Bacteria | 1070 |
| 399 | Ga0466972_0272087 | 3300044658 | Bacteria | 791 |
| 400 | Ga0466965_0011265 | 3300044683 | Bacteria | 4187 |
| 401 | Ga0466966_0004478 | 3300044684 | Bacteria | 9214 |
| 402 | Ga0466966_0025877 | 3300044684 | Bacteria | 3832 |
| 403 | Ga0466966_0038688 | 3300044684 | Bacteria | 3073 |
| 404 | Ga0466966_0548959 | 3300044684 | Bacteria | 695 |
| 405 | Ga0466961_0004915 | 3300044693 | Bacteria | 8405 |
| 406 | Ga0466961_0007268 | 3300044693 | Bacteria | 7046 |
| 407 | Ga0466961_0051070 | 3300044693 | Bacteria | 2641 |
| 408 | Ga0466961_0139137 | 3300044693 | Bacteria | 1520 |
| 409 | Ga0466961_0424699 | 3300044693 | Bacteria | 805 |
| 410 | Ga0466961_0970695 | 3300044693 | Bacteria | 505 |
| 411 | Ga0466963_0097420 | 3300044694 | Bacteria | 2009 |
| 412 | Ga0466963_0143823 | 3300044694 | Bacteria | 1653 |
| 413 | Ga0466963_0359955 | 3300044694 | Bacteria | 1025 |
| 414 | Ga0466963_0464430 | 3300044694 | Bacteria | 893 |
| 415 | Ga0466963_1046536 | 3300044694 | Bacteria | 574 |
| 416 | Ga0466964_0062147 | 3300044706 | Bacteria | 1556 |
| 417 | Ga0466964_0390469 | 3300044706 | Bacteria | 725 |
| 418 | Ga0453684_0949489 | 3300044712 | Bacteria | 918 |
| 419 | Ga0466971_0000019 | 3300044719 | Bacteria | 79360 |
| 420 | Ga0466971_0007920 | 3300044719 | Bacteria | 4628 |
| 421 | Ga0466971_0113681 | 3300044719 | Bacteria | 1250 |
| 422 | Ga0466971_0365821 | 3300044719 | Bacteria | 699 |
| 423 | Ga0466968_0019909 | 3300044735 | Bacteria | 2705 |
| 424 | Ga0466968_0030937 | 3300044735 | Bacteria | 2219 |
| 425 | Ga0466968_0106395 | 3300044735 | Bacteria | 1257 |
| 426 | Ga0466968_0359593 | 3300044735 | Bacteria | 708 |
| 427 | Ga0466970_0003004 | 3300044765 | Bacteria | 8183 |
| 428 | Ga0466970_0039008 | 3300044765 | Bacteria | 2520 |
| 429 | Ga0466970_0067568 | 3300044765 | Bacteria | 1919 |
| 430 | Ga0466970_0158678 | 3300044765 | Bacteria | 1250 |
| 431 | Ga0466970_0751525 | 3300044765 | Bacteria | 570 |
| 432 | Ga0466957_0015619 | 3300044842 | Bacteria | 4435 |
| 433 | Ga0466957_0045585 | 3300044842 | Bacteria | 2659 |
| 434 | Ga0466957_0203573 | 3300044842 | Bacteria | 1301 |
| 435 | Ga0466957_0297570 | 3300044842 | Bacteria | 1083 |
| 436 | Ga0466957_0859709 | 3300044842 | Bacteria | 647 |
| 437 | Ga0466957_1269351 | 3300044842 | Bacteria | 534 |
| 438 | Ga0466960_0005266 | 3300044901 | Bacteria | 5111 |
| 439 | Ga0466960_0066960 | 3300044901 | Bacteria | 1777 |
| 440 | Ga0466960_0103264 | 3300044901 | Bacteria | 1471 |
| 441 | Ga0466960_0294693 | 3300044901 | Bacteria | 912 |
| 442 | Ga0466960_0800708 | 3300044901 | Bacteria | 570 |
| 443 | Ga0466960_0880139 | 3300044901 | Bacteria | 545 |
| 444 | Ga0466959_0004638 | 3300045049 | Bacteria | 9244 |
| 445 | Ga0466959_0032055 | 3300045049 | Bacteria | 3889 |
| 446 | Ga0466959_0048320 | 3300045049 | Bacteria | 3126 |
| 447 | Ga0466959_0064455 | 3300045049 | Bacteria | 2660 |
| 448 | Ga0466959_0274074 | 3300045049 | Bacteria | 1159 |
| 449 | Ga0466959_0293401 | 3300045049 | Bacteria | 1114 |
| 450 | Ga0466959_0743902 | 3300045049 | Bacteria | 656 |
| 451 | Ga0466959_0937830 | 3300045049 | Bacteria | 577 |
| 452 | Ga0466958_0000701 | 3300045836 | Bacteria | 14601 |
| 453 | Ga0466958_0054273 | 3300045836 | Bacteria | 2430 |
| 454 | Ga0466958_0195593 | 3300045836 | Bacteria | 1286 |
| 455 | Ga0466958_0261995 | 3300045836 | Bacteria | 1107 |
| 456 | Ga0466958_0275195 | 3300045836 | Bacteria | 1078 |
| 457 | Ga0466958_0849536 | 3300045836 | Bacteria | 595 |
| 458 | Ga0466967_0075222 | 3300045976 | Bacteria | 3035 |
| 459 | Ga0466967_0188862 | 3300045976 | Bacteria | 1946 |
| 460 | Ga0466967_0215478 | 3300045976 | Bacteria | 1822 |
| 461 | Ga0466967_0308089 | 3300045976 | Bacteria | 1525 |
| 462 | Ga0466967_0321893 | 3300045976 | Bacteria | 1491 |
| 463 | Ga0466967_0841565 | 3300045976 | Bacteria | 911 |
| 464 | Ga0466967_0984587 | 3300045976 | Bacteria | 839 |
| 465 | Ga0466967_1447019 | 3300045976 | Bacteria | 684 |
| 466 | Ga0466967_1623790 | 3300045976 | Bacteria | 644 |
| 467 | Ga0495592_0002384 | 3300046454 | Bacteria | 13242 |
| 468 | Ga0495592_0011378 | 3300046454 | Bacteria | 6730 |
| 469 | Ga0495592_0052602 | 3300046454 | Bacteria | 3023 |
| 470 | Ga0495629_0037614 | 3300046459 | Bacteria | 3411 |
| 471 | Ga0495629_0247996 | 3300046459 | Bacteria | 1225 |
| 472 | Ga0495629_0498077 | 3300046459 | Bacteria | 822 |
| 473 | Ga0495638_0024349 | 3300046460 | Bacteria | 3947 |
| 474 | Ga0495638_0105562 | 3300046460 | Bacteria | 1679 |
| 475 | Ga0495638_0119177 | 3300046460 | Bacteria | 1561 |
| 476 | Ga0495641_0474423 | 3300046461 | Bacteria | 570 |
| 477 | Ga0495651_0000169 | 3300046462 | Bacteria | 48128 |
| 478 | Ga0495651_0002063 | 3300046462 | Bacteria | 15529 |
| 479 | Ga0495651_0011730 | 3300046462 | Bacteria | 6733 |
| 480 | Ga0495653_0023969 | 3300046463 | Bacteria | 4923 |
| 481 | Ga0495653_0317694 | 3300046463 | Bacteria | 1010 |
| 482 | Ga0495653_0828413 | 3300046463 | Bacteria | 555 |
| 483 | Ga0495580_0005827 | 3300046472 | Bacteria | 10107 |
| 484 | Ga0495582_0156632 | 3300046473 | Bacteria | 1294 |
| 485 | Ga0495639_0235128 | 3300046475 | Bacteria | 903 |
| 486 | Ga0495662_0002247 | 3300046476 | Bacteria | 9741 |
| 487 | Ga0495662_0005288 | 3300046476 | Bacteria | 6466 |
| 488 | Ga0495662_0018980 | 3300046476 | Bacteria | 3328 |
| 489 | Ga0495662_0190885 | 3300046476 | Bacteria | 1010 |
| 490 | Ga0495664_0002322 | 3300046477 | Bacteria | 10191 |
| 491 | Ga0495664_0072068 | 3300046477 | Bacteria | 2063 |
| 492 | Ga0495664_0245293 | 3300046477 | Bacteria | 1083 |
| 493 | Ga0495584_0346047 | 3300046491 | Bacteria | 755 |
| 494 | Ga0495594_0143365 | 3300046499 | Bacteria | 1355 |
| 495 | Ga0495594_0211202 | 3300046499 | Bacteria | 1106 |
| 496 | Ga0495608_0014048 | 3300046511 | Bacteria | 5557 |
| 497 | Ga0495608_0465813 | 3300046511 | Bacteria | 768 |
| 498 | Ga0495610_0340423 | 3300046512 | Bacteria | 567 |
| 499 | Ga0495618_0347589 | 3300046514 | Bacteria | 914 |
| 500 | Ga0495628_0007000 | 3300046516 | Bacteria | 9781 |
| 501 | Ga0495628_0403214 | 3300046516 | Bacteria | 998 |
| 502 | Ga0495630_0015711 | 3300046517 | Bacteria | 5530 |
| 503 | Ga0495630_0087245 | 3300046517 | Bacteria | 2356 |
| 504 | Ga0495631_0238779 | 3300046518 | Bacteria | 775 |
| 505 | Ga0495643_0000013 | 3300046522 | Bacteria | 315700 |
| 506 | Ga0495666_0000307 | 3300046526 | Bacteria | 21312 |
| 507 | Ga0495652_0000728 | 3300046529 | Bacteria | 38187 |
| 508 | Ga0495652_0030154 | 3300046529 | Bacteria | 4759 |
| 509 | Ga0495652_0319361 | 3300046529 | Bacteria | 1122 |
| 510 | Ga0495665_0013217 | 3300046531 | Bacteria | 4466 |
| 511 | Ga0495640_0027443 | 3300046533 | Bacteria | 4106 |
| 512 | Ga0495640_0124534 | 3300046533 | Bacteria | 1672 |
| 513 | Ga0495640_0237058 | 3300046533 | Bacteria | 1146 |
| 514 | Ga0495586_0065641 | 3300046535 | Bacteria | 1978 |
| 515 | Ga0495586_0223039 | 3300046535 | Bacteria | 1071 |
| 516 | Ga0495587_0000793 | 3300046536 | Bacteria | 21073 |
| 517 | Ga0495587_0139260 | 3300046536 | Bacteria | 1385 |
| 518 | Ga0495645_0002261 | 3300046543 | Bacteria | 13098 |
| 519 | Ga0495645_0007022 | 3300046543 | Bacteria | 7830 |
| 520 | Ga0495645_0052372 | 3300046543 | Bacteria | 2969 |
| 521 | Ga0495645_0300633 | 3300046543 | Bacteria | 1048 |
| 522 | Ga0495622_0017744 | 3300046557 | Bacteria | 3313 |
| 523 | Ga0495633_0327938 | 3300046558 | Bacteria | 694 |
| 524 | Ga0495667_0034555 | 3300046559 | Bacteria | 3380 |
| 525 | Ga0495667_0337720 | 3300046559 | Bacteria | 953 |
| 526 | Ga0495667_0481324 | 3300046559 | Bacteria | 778 |
| 527 | Ga0495667_0837715 | 3300046559 | Bacteria | 566 |
| 528 | Ga0495634_0005875 | 3300046642 | Bacteria | 9378 |
| 529 | Ga0495634_0044010 | 3300046642 | Bacteria | 3023 |
| 530 | Ga0495625_0095757 | 3300046660 | Bacteria | 2045 |
| 531 | Ga0495625_0261981 | 3300046660 | Bacteria | 1118 |
| 532 | Ga0495635_0015642 | 3300046663 | Bacteria | 5299 |
| 533 | Ga0495635_0067659 | 3300046663 | Bacteria | 2449 |
| 534 | Ga0495635_0613993 | 3300046663 | Bacteria | 709 |
| 535 | Ga0495659_0095751 | 3300046664 | Bacteria | 1145 |
| 536 | Ga0495588_0026982 | 3300046674 | Bacteria | 2868 |
| 537 | Ga0495588_0160161 | 3300046674 | Bacteria | 1190 |
| 538 | Ga0495657_0014293 | 3300046675 | Bacteria | 5830 |
| 539 | Ga0495657_0024880 | 3300046675 | Bacteria | 4256 |
| 540 | Ga0495657_0866061 | 3300046675 | Bacteria | 514 |
| 541 | Ga0495599_0031629 | 3300046678 | Bacteria | 3321 |
| 542 | Ga0495599_0076762 | 3300046678 | Bacteria | 2086 |
| 543 | Ga0495599_0183912 | 3300046678 | Bacteria | 1287 |
| 544 | Ga0495623_0012719 | 3300046679 | Bacteria | 5449 |
| 545 | Ga0495623_0030831 | 3300046679 | Bacteria | 3449 |
| 546 | Ga0495623_0054899 | 3300046679 | Bacteria | 2512 |
| 547 | Ga0495623_0242477 | 3300046679 | Bacteria | 1017 |
| 548 | Ga0495646_0009635 | 3300046680 | Bacteria | 6132 |
| 549 | Ga0495646_0021225 | 3300046680 | Bacteria | 4105 |
| 550 | Ga0495646_0061524 | 3300046680 | Bacteria | 2235 |
| 551 | Ga0495658_0120358 | 3300046683 | Bacteria | 1587 |
| 552 | Ga0495669_0047578 | 3300046684 | Bacteria | 1916 |
| 553 | Ga0495613_0037419 | 3300046689 | Bacteria | 3597 |
| 554 | Ga0495613_0263347 | 3300046689 | Bacteria | 1200 |
| 555 | Ga0495613_0675840 | 3300046689 | Bacteria | 681 |
| 556 | Ga0495624_0278293 | 3300046690 | Bacteria | 1010 |
| 557 | Ga0495670_0561469 | 3300046691 | Bacteria | 621 |
| 558 | Ga0495649_0097685 | 3300046694 | Bacteria | 1562 |
| 559 | Ga0495600_0008026 | 3300046809 | Bacteria | 6470 |
| 560 | Ga0495600_0055477 | 3300046809 | Bacteria | 2587 |
| 561 | Ga0495600_0068521 | 3300046809 | Bacteria | 2318 |
| 562 | Ga0495581_0105647 | 3300047315 | Bacteria | 1636 |
| 563 | Ga0495581_0131774 | 3300047315 | Bacteria | 1456 |
| 564 | Ga0495604_0000113 | 3300047317 | Bacteria | 68389 |
| 565 | Ga0495604_0013519 | 3300047317 | Bacteria | 6506 |
| 566 | Ga0495604_0015097 | 3300047317 | Bacteria | 6162 |
| 567 | Ga0495636_0188804 | 3300047318 | Bacteria | 937 |
| 568 | Ga0495674_0018748 | 3300047319 | Bacteria | 6440 |
| 569 | Ga0495674_0262273 | 3300047319 | Bacteria | 1419 |
| 570 | Ga0495674_0335241 | 3300047319 | Bacteria | 1230 |
| 571 | Ga0495674_1096470 | 3300047319 | Bacteria | 606 |
| 572 | Ga0495676_0059662 | 3300047321 | Bacteria | 2994 |
| 573 | Ga0495680_0551908 | 3300047322 | Bacteria | 776 |
| 574 | Ga0495687_015578 | 3300047443 | Bacteria | 3860 |
| 575 | Ga0495675_0013484 | 3300047444 | Bacteria | 5159 |
| 576 | Ga0495675_0017801 | 3300047444 | Bacteria | 4504 |
| 577 | Ga0495675_0295316 | 3300047444 | Bacteria | 963 |
| 578 | Ga0495675_0487073 | 3300047444 | Bacteria | 709 |
| 579 | Ga0495685_063453 | 3300047447 | Bacteria | 1243 |
| 580 | Ga0495685_183751 | 3300047447 | Bacteria | 673 |
| 581 | Ga0495685_193437 | 3300047447 | Bacteria | 653 |
| 582 | Ga0495681_0011573 | 3300047470 | Bacteria | 5243 |
| 583 | Ga0495684_0004072 | 3300047471 | Bacteria | 11412 |
| 584 | Ga0495684_0340967 | 3300047471 | Bacteria | 1066 |
| 585 | Ga0495686_0066423 | 3300047472 | Bacteria | 2228 |
| 586 | Ga0495593_0005852 | 3300047673 | Bacteria | 7246 |
| 587 | Ga0495593_0054339 | 3300047673 | Bacteria | 2111 |
| 588 | Ga0495602_0014250 | 3300048088 | Bacteria | 8077 |
| 589 | Ga0495602_0083799 | 3300048088 | Bacteria | 2669 |
| 590 | Ga0495614_0023593 | 3300048089 | Bacteria | 2655 |
| 591 | Ga0496101_1096877 | 3300048904 | Bacteria | 625 |
| 592 | Ga0496102_0000840 | 3300048905 | Bacteria | 29492 |
| 593 | Ga0496102_0064536 | 3300048905 | Bacteria | 3354 |
| 594 | Ga0496102_0384958 | 3300048905 | Bacteria | 1320 |
| 595 | Ga0496102_1208301 | 3300048905 | Bacteria | 675 |
| 596 | Ga0496103_0024379 | 3300048906 | Bacteria | 3652 |
| 597 | Ga0496103_0042936 | 3300048906 | Bacteria | 2783 |
| 598 | Ga0496103_0690213 | 3300048906 | Bacteria | 647 |
| 599 | Ga0496104_0463699 | 3300048907 | Bacteria | 1178 |
| 600 | Ga0496104_0761824 | 3300048907 | Bacteria | 875 |
| 601 | Ga0496104_0877151 | 3300048907 | Bacteria | 802 |
| 602 | Ga0496104_1149751 | 3300048907 | Bacteria | 680 |
| 603 | Ga0496104_1528605 | 3300048907 | Bacteria | 570 |
| 604 | Ga0496104_1723267 | 3300048907 | Bacteria | 529 |
| 605 | Ga0496105_0096230 | 3300048908 | Bacteria | 2445 |
| 606 | Ga0496105_0672910 | 3300048908 | Bacteria | 797 |
| 607 | Ga0496105_0791532 | 3300048908 | Bacteria | 722 |
| 608 | Ga0496105_0805483 | 3300048908 | Bacteria | 714 |
| 609 | Ga0496106_1374099 | 3300048909 | Bacteria | 546 |
| 610 | Ga0496107_0126090 | 3300048910 | Bacteria | 1888 |
| 611 | Ga0496108_0048893 | 3300048911 | Bacteria | 3537 |
| 612 | Ga0496108_0446455 | 3300048911 | Bacteria | 1130 |
| 613 | Ga0496108_1042862 | 3300048911 | Bacteria | 697 |
| 614 | Ga0496109_0954148 | 3300048912 | Bacteria | 795 |
| 615 | Ga0496110_0216609 | 3300048913 | Bacteria | 1741 |
| 616 | Ga0496111_0402489 | 3300048914 | Bacteria | 1011 |
| 617 | Ga0496113_0639166 | 3300048916 | Bacteria | 851 |
| 618 | Ga0496113_1329193 | 3300048916 | Bacteria | 558 |
| 619 | Ga0496114_0183723 | 3300048917 | Bacteria | 1827 |
| 620 | Ga0496114_0317906 | 3300048917 | Bacteria | 1375 |
| 621 | Ga0496115_0703040 | 3300048918 | Bacteria | 794 |
| 622 | Ga0496116_0001739 | 3300048919 | Bacteria | 23720 |
| 623 | Ga0496117_0027016 | 3300048920 | Bacteria | 4479 |
| 624 | Ga0496118_0000359 | 3300048921 | Bacteria | 77146 |
| 625 | Ga0496118_0040681 | 3300048921 | Bacteria | 3693 |
| 626 | Ga0496118_0046572 | 3300048921 | Bacteria | 3371 |
| 627 | Ga0496118_0104172 | 3300048921 | Bacteria | 1905 |
| 628 | Ga0496119_0000855 | 3300048922 | Bacteria | 40135 |
| 629 | Ga0496119_0014521 | 3300048922 | Bacteria | 6154 |
| 630 | Ga0496119_0020106 | 3300048922 | Bacteria | 4882 |
| 631 | Ga0496120_0000372 | 3300048923 | Bacteria | 72951 |
| 632 | Ga0496120_0219854 | 3300048923 | Bacteria | 908 |
| 633 | Ga0496121_0013339 | 3300048924 | Bacteria | 8843 |
| 634 | Ga0496121_0048393 | 3300048924 | Bacteria | 3617 |
| 635 | Ga0496126_0231208 | 3300048929 | Bacteria | 1549 |
| 636 | Ga0501306_001285 | 3300049127 | Bacteria | 2319 |
| 637 | Ga0501306_002479 | 3300049127 | Bacteria | 1896 |
| 638 | Ga0501306_037217 | 3300049127 | Bacteria | 744 |
| 639 | Ga0501306_041690 | 3300049127 | Bacteria | 714 |
| 640 | Ga0501308_014057 | 3300049128 | Bacteria | 932 |
| 641 | Ga0501309_001533 | 3300049129 | Bacteria | 2299 |
| 642 | Ga0501310_002257 | 3300049130 | Bacteria | 1820 |
| 643 | Ga0501310_015292 | 3300049130 | Bacteria | 909 |
| 644 | Ga0501310_023831 | 3300049130 | Bacteria | 780 |
| 645 | Ga0501304_000819 | 3300049160 | Bacteria | 1796 |
| 646 | Ga0501304_019525 | 3300049160 | Bacteria | 662 |
| 647 | Ga0501305_009204 | 3300049161 | Bacteria | 1294 |
| 648 | Ga0501305_015320 | 3300049161 | Bacteria | 1082 |
| 649 | Ga0501305_025799 | 3300049161 | Bacteria | 893 |
| 650 | Ga0501305_066565 | 3300049161 | Bacteria | 628 |
| 651 | Ga0501307_005481 | 3300049162 | Bacteria | 1339 |
| 652 | Ga0501307_008933 | 3300049162 | Bacteria | 1137 |
| 653 | Ga0501307_009579 | 3300049162 | Bacteria | 1109 |
| 654 | Ga0501311_000597 | 3300049527 | Bacteria | 2637 |
| 655 | Ga0501311_029531 | 3300049527 | Bacteria | 787 |
| 656 | Ga0501311_078820 | 3300049527 | Bacteria | 557 |
| 657 | Ga0501312_001837 | 3300049528 | Bacteria | 2184 |
| 658 | Ga0501313_000328 | 3300049529 | Bacteria | 3055 |
| 659 | Ga0501314_005184 | 3300049530 | Bacteria | 1103 |
| 660 | Ga0501314_005250 | 3300049530 | Bacteria | 1098 |
| 661 | Ga0501315_000243 | 3300049531 | Bacteria | 3402 |
| 662 | Ga0501315_014041 | 3300049531 | Bacteria | 1010 |
| 663 | Ga0501315_021352 | 3300049531 | Bacteria | 876 |
| 664 | Ga0501315_081123 | 3300049531 | Bacteria | 551 |
| 665 | Ga0501316_002447 | 3300049532 | Bacteria | 1718 |
| 666 | Ga0501316_026425 | 3300049532 | Bacteria | 760 |
| 667 | Ga0501316_038014 | 3300049532 | Bacteria | 663 |
| 668 | Ga0501316_075151 | 3300049532 | Bacteria | 516 |
| 669 | Ga0501317_000282 | 3300049533 | Bacteria | 3286 |
| 670 | Ga0501317_015074 | 3300049533 | Bacteria | 988 |
| 671 | Ga0501317_017825 | 3300049533 | Bacteria | 934 |
| 672 | Ga0501317_027117 | 3300049533 | Bacteria | 812 |
| 673 | Ga0501318_000119 | 3300049534 | Bacteria | 3651 |
| 674 | Ga0501318_029316 | 3300049534 | Bacteria | 741 |
| 675 | Ga0501318_049585 | 3300049534 | Bacteria | 621 |
| 676 | Ga0501319_001265 | 3300049535 | Bacteria | 1428 |
| 677 | Ga0501320_000186 | 3300049536 | Bacteria | 3154 |
| 678 | Ga0501320_000755 | 3300049536 | Bacteria | 2053 |
| 679 | Ga0501320_004388 | 3300049536 | Bacteria | 1244 |
| 680 | Ga0501321_002301 | 3300049537 | Bacteria | 1642 |
| 681 | Ga0501321_005600 | 3300049537 | Bacteria | 1248 |
| 682 | Ga0501321_028860 | 3300049537 | Bacteria | 732 |
| 683 | Ga0501322_001303 | 3300049538 | Bacteria | 1379 |
| 684 | Ga0501322_002966 | 3300049538 | Bacteria | 1073 |
| 685 | Ga0501322_006978 | 3300049538 | Bacteria | 814 |
| 686 | Ga0501323_001192 | 3300049539 | Bacteria | 2228 |
| 687 | Ga0501323_010056 | 3300049539 | Bacteria | 1123 |
| 688 | Ga0501323_017099 | 3300049539 | Bacteria | 929 |
| 689 | Ga0501323_026907 | 3300049539 | Bacteria | 790 |
| 690 | Ga0501324_000083 | 3300049540 | Bacteria | 3478 |
| 691 | Ga0501324_001843 | 3300049540 | Bacteria | 1472 |
| 692 | Ga0501324_003168 | 3300049540 | Bacteria | 1245 |
| 693 | Ga0501324_011359 | 3300049540 | Bacteria | 822 |
| 694 | Ga0501324_017437 | 3300049540 | Bacteria | 712 |
| 695 | Ga0501325_009559 | 3300049541 | Bacteria | 863 |
| 696 | Ga0501031_0010894 | 3300049568 | Bacteria | 5922 |
| 697 | Ga0501031_0213047 | 3300049568 | Bacteria | 1258 |
| 698 | Ga0501031_0223452 | 3300049568 | Bacteria | 1226 |
| 699 | Ga0501032_0001347 | 3300049569 | Bacteria | 19514 |
| 700 | Ga0501032_0002622 | 3300049569 | Bacteria | 14061 |
| 701 | Ga0501032_0021244 | 3300049569 | Bacteria | 4514 |
| 702 | Ga0501032_0072160 | 3300049569 | Bacteria | 2301 |
| 703 | Ga0501032_0194673 | 3300049569 | Bacteria | 1324 |
| 704 | Ga0501033_0053340 | 3300049570 | Bacteria | 2994 |
| 705 | Ga0501033_0055262 | 3300049570 | Bacteria | 2935 |
| 706 | Ga0501033_0067467 | 3300049570 | Bacteria | 2630 |
| 707 | Ga0501033_0157907 | 3300049570 | Bacteria | 1633 |
| 708 | Ga0501033_0215801 | 3300049570 | Bacteria | 1367 |
| 709 | Ga0501033_0498729 | 3300049570 | Bacteria | 842 |
| 710 | Ga0501034_0011858 | 3300049571 | Bacteria | 9022 |
| 711 | Ga0501034_0017758 | 3300049571 | Bacteria | 7296 |
| 712 | Ga0501034_0039901 | 3300049571 | Bacteria | 4755 |
| 713 | Ga0501034_0147492 | 3300049571 | Bacteria | 2329 |
| 714 | Ga0501034_0154851 | 3300049571 | Bacteria | 2266 |
| 715 | Ga0501034_0461188 | 3300049571 | Bacteria | 1187 |
| 716 | Ga0501034_0507480 | 3300049571 | Bacteria | 1119 |
| 717 | Ga0501036_0005851 | 3300049572 | Bacteria | 9958 |
| 718 | Ga0501036_0012989 | 3300049572 | Bacteria | 6914 |
| 719 | Ga0501036_0034382 | 3300049572 | Bacteria | 4286 |
| 720 | Ga0501036_0193864 | 3300049572 | Bacteria | 1709 |
| 721 | Ga0501036_0728855 | 3300049572 | Bacteria | 818 |
| 722 | Ga0501037_0003123 | 3300049573 | Bacteria | 12009 |
| 723 | Ga0501037_0018283 | 3300049573 | Bacteria | 5164 |
| 724 | Ga0501037_0064068 | 3300049573 | Bacteria | 2679 |
| 725 | Ga0501038_0008698 | 3300049574 | Bacteria | 9320 |
| 726 | Ga0501038_0031768 | 3300049574 | Bacteria | 4664 |
| 727 | Ga0501038_0163095 | 3300049574 | Bacteria | 1809 |
| 728 | Ga0501039_0015102 | 3300049575 | Bacteria | 5908 |
| 729 | Ga0501039_0023714 | 3300049575 | Bacteria | 4709 |
| 730 | Ga0501039_0210458 | 3300049575 | Bacteria | 1529 |
| 731 | Ga0501039_0584517 | 3300049575 | Bacteria | 876 |
| 732 | Ga0501039_0768942 | 3300049575 | Bacteria | 752 |
| 733 | Ga0501040_0008475 | 3300049576 | Bacteria | 6677 |
| 734 | Ga0501040_0860682 | 3300049576 | Bacteria | 656 |
| 735 | Ga0501041_0009850 | 3300049577 | Bacteria | 5627 |
| 736 | Ga0501041_0518724 | 3300049577 | Bacteria | 759 |
| 737 | Ga0501041_0642533 | 3300049577 | Bacteria | 678 |
| 738 | Ga0501042_0021020 | 3300049578 | Bacteria | 4544 |
| 739 | Ga0501042_0037805 | 3300049578 | Bacteria | 3426 |
| 740 | Ga0501042_0320729 | 3300049578 | Bacteria | 1119 |
| 741 | Ga0501042_1248859 | 3300049578 | Bacteria | 542 |
| 742 | Ga0501043_0005651 | 3300049579 | Bacteria | 10076 |
| 743 | Ga0501043_0176539 | 3300049579 | Bacteria | 1665 |
| 744 | Ga0501043_0178224 | 3300049579 | Bacteria | 1656 |
| 745 | Ga0501043_0408922 | 3300049579 | Bacteria | 1024 |
| 746 | Ga0501043_1100598 | 3300049579 | Bacteria | 561 |
| 747 | Ga0501046_0002011 | 3300049580 | Bacteria | 19297 |
| 748 | Ga0501046_0124048 | 3300049580 | Bacteria | 1963 |
| 749 | Ga0501047_0000005 | 3300049581 | Bacteria | 456524 |
| 750 | Ga0501047_0000278 | 3300049581 | Bacteria | 59271 |
| 751 | Ga0501047_0004445 | 3300049581 | Bacteria | 13204 |
| 752 | Ga0501047_0067707 | 3300049581 | Bacteria | 3440 |
| 753 | Ga0501047_0087734 | 3300049581 | Bacteria | 2989 |
| 754 | Ga0501047_0281796 | 3300049581 | Bacteria | 1506 |
| 755 | Ga0501047_0284524 | 3300049581 | Bacteria | 1497 |
| 756 | Ga0501048_0001026 | 3300049582 | Bacteria | 20878 |
| 757 | Ga0501048_0120527 | 3300049582 | Bacteria | 1853 |
| 758 | Ga0501048_0669896 | 3300049582 | Bacteria | 745 |
| 759 | Ga0501048_0681329 | 3300049582 | Bacteria | 738 |
| 760 | Ga0501067_0000592 | 3300049583 | Bacteria | 19503 |
| 761 | Ga0501067_0431140 | 3300049583 | Bacteria | 736 |
| 762 | Ga0501068_0001668 | 3300049584 | Bacteria | 11862 |
| 763 | Ga0501068_0124538 | 3300049584 | Bacteria | 1609 |
| 764 | Ga0501068_0697278 | 3300049584 | Bacteria | 664 |
| 765 | Ga0501069_0003831 | 3300049585 | Bacteria | 7749 |
| 766 | Ga0501070_0000089 | 3300049586 | Bacteria | 77368 |
| 767 | Ga0501070_0021842 | 3300049586 | Bacteria | 5362 |
| 768 | Ga0501070_0025003 | 3300049586 | Bacteria | 5008 |
| 769 | Ga0501070_0162235 | 3300049586 | Bacteria | 1842 |
| 770 | Ga0501070_0425216 | 3300049586 | Bacteria | 1072 |
| 771 | Ga0501070_0806179 | 3300049586 | Bacteria | 737 |
| 772 | Ga0501071_0008674 | 3300049587 | Bacteria | 6724 |
| 773 | Ga0501071_0011550 | 3300049587 | Bacteria | 5959 |
| 774 | Ga0501071_0718294 | 3300049587 | Bacteria | 769 |
| 775 | Ga0501072_0001152 | 3300049588 | Bacteria | 19660 |
| 776 | Ga0501072_0589979 | 3300049588 | Bacteria | 876 |
| 777 | Ga0501072_0609189 | 3300049588 | Bacteria | 861 |
| 778 | Ga0501073_0078941 | 3300049589 | Bacteria | 2290 |
| 779 | Ga0501074_0005219 | 3300049590 | Bacteria | 9340 |
| 780 | Ga0501074_0011734 | 3300049590 | Bacteria | 6369 |
| 781 | Ga0501074_0026050 | 3300049590 | Bacteria | 4241 |
| 782 | Ga0501074_0507749 | 3300049590 | Bacteria | 854 |
| 783 | Ga0501075_1549946 | 3300049591 | Bacteria | 501 |
| 784 | Ga0501076_0051723 | 3300049592 | Bacteria | 3252 |
| 785 | Ga0501077_0087819 | 3300049593 | Bacteria | 1970 |
| 786 | Ga0501202_019719 | 3300049652 | Bacteria | 1335 |
| 787 | Ga0501217_044712 | 3300049661 | Bacteria | 1138 |
| 788 | Ga0501250_032907 | 3300049680 | Bacteria | 728 |
| 789 | Ga0501257_106123 | 3300049686 | Bacteria | 741 |
| 790 | Ga0501221_181713 | 3300049704 | Bacteria | 575 |
| 791 | Ga0501079_0023462 | 3300049741 | Bacteria | 4733 |
| 792 | Ga0501079_0285006 | 3300049741 | Bacteria | 1292 |
| 793 | Ga0501080_0002681 | 3300049742 | Bacteria | 15586 |
| 794 | Ga0501080_0004649 | 3300049742 | Bacteria | 12241 |
| 795 | Ga0501080_0007063 | 3300049742 | Bacteria | 10140 |
| 796 | Ga0501080_0094218 | 3300049742 | Bacteria | 2781 |
| 797 | Ga0501080_0364990 | 3300049742 | Bacteria | 1302 |
| 798 | Ga0501081_0361548 | 3300049743 | Bacteria | 1071 |
| 799 | Ga0501083_0004200 | 3300049744 | Bacteria | 10143 |
| 800 | Ga0501035_0006472 | 3300049822 | Bacteria | 11004 |
| 801 | Ga0501035_0042008 | 3300049822 | Bacteria | 4125 |
| 802 | Ga0501035_0045844 | 3300049822 | Bacteria | 3932 |
| 803 | Ga0501035_0062362 | 3300049822 | Bacteria | 3317 |
| 804 | Ga0501035_0145280 | 3300049822 | Bacteria | 2060 |
| 805 | Ga0501035_0500276 | 3300049822 | Bacteria | 1000 |
| 806 | Ga0501044_0000425 | 3300049823 | Bacteria | 52201 |
| 807 | Ga0501044_0005788 | 3300049823 | Bacteria | 13687 |
| 808 | Ga0501044_0013601 | 3300049823 | Bacteria | 8795 |
| 809 | Ga0501044_0064165 | 3300049823 | Bacteria | 3750 |
| 810 | Ga0501044_1198351 | 3300049823 | Bacteria | 627 |
| 811 | Ga0501044_1642641 | 3300049823 | Bacteria | 507 |
| 812 | Ga0501045_0079425 | 3300049824 | Bacteria | 2418 |
| 813 | Ga0501045_0282589 | 3300049824 | Bacteria | 1235 |
| 814 | nmdc:mga03n38_275355_c1 | 3300050490 | Bacteria | 897 |
| 815 | nmdc:mga00v17_382505_c1 | 3300050491 | Bacteria | 915 |
| 816 | nmdc:mga00v17_937_c1 | 3300050491 | Bacteria | 15681 |
| 817 | nmdc:mga0k408_221211_c1 | 3300050493 | Bacteria | 1130 |
| 818 | nmdc:mga06z11_27935_c1 | 3300050494 | Bacteria | 2702 |
| 819 | nmdc:mga04h51_1822_c1 | 3300050495 | Bacteria | 4980 |
| 820 | nmdc:mga04h51_230696_c1 | 3300050495 | Bacteria | 736 |
| 821 | nmdc:mga07m45_19238_c1 | 3300050496 | Bacteria | 1941 |
| 822 | nmdc:mga07m45_20663_c1 | 3300050496 | Bacteria | 3577 |
| 823 | nmdc:mga09592_535318_c1 | 3300050508 | Bacteria | 1007 |
| 824 | nmdc:mga09592_70174_c1 | 3300050508 | Bacteria | 2973 |
| 825 | nmdc:mga0qj67_248168_c1 | 3300050509 | Bacteria | 1444 |
| 826 | nmdc:mga06r32_228853_c1 | 3300050510 | Bacteria | 1847 |
| 827 | nmdc:mga06r32_328695_c1 | 3300050510 | Bacteria | 1514 |
| 828 | nmdc:mga0sz30_5215_c1 | 3300050516 | Bacteria | 3169 |
| 829 | Ga0495601_0019194 | 3300053077 | Bacteria | 4167 |
| 830 | Ga0495601_0097418 | 3300053077 | Bacteria | 1898 |
| 831 | Ga0495612_0003894 | 3300053078 | Bacteria | 6188 |
| 832 | Ga0495612_0033956 | 3300053078 | Bacteria | 2065 |
| 833 | Ga0495612_0114248 | 3300053078 | Bacteria | 1158 |
| 834 | Ga0500610_0035276 | 3300053079 | Bacteria | 2564 |
| 835 | Ga0495655_0063403 | 3300053083 | Bacteria | 1014 |
| 836 | Ga0495655_0095229 | 3300053083 | Bacteria | 873 |
| 837 | Ga0495655_0097352 | 3300053083 | Bacteria | 866 |
| 838 | Ga0495655_0303268 | 3300053083 | Bacteria | 549 |
| 839 | Ga0495655_0375449 | 3300053083 | Bacteria | 501 |
| 840 | Ga0495619_0016029 | 3300053085 | Bacteria | 4744 |
| 841 | Ga0495619_0044831 | 3300053085 | Bacteria | 2904 |
| 842 | Ga0495619_0239380 | 3300053085 | Bacteria | 1258 |
| 843 | Ga0495619_0382459 | 3300053085 | Bacteria | 973 |
| 844 | Ga0500644_0019335 | 3300053088 | Bacteria | 2009 |
| 845 | Ga0500644_0338151 | 3300053088 | Bacteria | 650 |
| 846 | Ga0500647_0039633 | 3300053091 | Bacteria | 2259 |
| 847 | Ga0500583_0062555 | 3300053092 | Bacteria | 1761 |
| 848 | Ga0500583_0131398 | 3300053092 | Bacteria | 1242 |
| 849 | Ga0500566_0227339 | 3300053094 | Bacteria | 923 |
| 850 | Ga0500640_018648 | 3300053095 | Bacteria | 2962 |
| 851 | Ga0500660_108747 | 3300053100 | Bacteria | 1188 |
| 852 | Ga0500553_035854 | 3300053101 | Bacteria | 2456 |
| 853 | Ga0500562_034742 | 3300053108 | Bacteria | 1334 |
| 854 | Ga0500572_004783 | 3300053111 | Bacteria | 3069 |
| 855 | Ga0500608_059636 | 3300053122 | Bacteria | 1825 |
| 856 | Ga0500614_080617 | 3300053123 | Bacteria | 910 |
| 857 | Ga0500618_101516 | 3300053125 | Bacteria | 648 |
| 858 | Ga0500628_055816 | 3300053129 | Bacteria | 951 |
| 859 | Ga0500642_0078535 | 3300053130 | Bacteria | 1512 |
| 860 | Ga0500642_0267373 | 3300053130 | Bacteria | 781 |
| 861 | Ga0500652_244217 | 3300053131 | Bacteria | 713 |
| 862 | Ga0500655_082250 | 3300053133 | Bacteria | 663 |
| 863 | Ga0500573_0482656 | 3300053140 | Bacteria | 564 |
| 864 | Ga0500577_0093719 | 3300053142 | Bacteria | 1218 |
| 865 | Ga0500586_066611 | 3300053145 | Bacteria | 1258 |
| 866 | Ga0500616_0063036 | 3300053153 | Bacteria | 1913 |
| 867 | Ga0500624_001345 | 3300053157 | Bacteria | 4158 |
| 868 | Ga0500634_0081366 | 3300053161 | Bacteria | 1668 |
| 869 | Ga0500636_0224281 | 3300053177 | Bacteria | 977 |
| 870 | Ga0501084_0001550 | 3300054114 | Bacteria | 18271 |
| 871 | Ga0501084_0426431 | 3300054114 | Bacteria | 1121 |
| 872 | Ga0501084_0443129 | 3300054114 | Bacteria | 1098 |
| 873 | Ga0587084_020516 | 3300059477 | Bacteria | 983 |
| 874 | Ga0587084_040445 | 3300059477 | Bacteria | 790 |
| 875 | Ga0587084_047703 | 3300059477 | Bacteria | 749 |
| 876 | Ga0587073_0019682 | 3300059492 | Bacteria | 1278 |
| 877 | Ga0587073_0117642 | 3300059492 | Bacteria | 713 |
| 878 | Ga0587077_081037 | 3300059493 | Bacteria | 745 |
| 879 | Ga0587080_017869 | 3300059503 | Bacteria | 1134 |
| 880 | Ga0587082_022970 | 3300059504 | Bacteria | 1031 |
| 881 | Ga0587082_053755 | 3300059504 | Bacteria | 776 |
| 882 | Ga0587082_164409 | 3300059504 | Bacteria | 534 |
| 883 | Ga0587083_0090540 | 3300059505 | Bacteria | 745 |
| 884 | Ga0587085_050956 | 3300059506 | Bacteria | 754 |
| 885 | Ga0587085_083532 | 3300059506 | Bacteria | 647 |
| 886 | Ga0587086_009836 | 3300059507 | Bacteria | 1145 |
| 887 | Ga0587088_047833 | 3300059508 | Bacteria | 828 |
| 888 | Ga0587088_069038 | 3300059508 | Bacteria | 733 |
| 889 | Ga0587090_042555 | 3300059510 | Bacteria | 805 |
| 890 | Ga0587092_042458 | 3300059512 | Bacteria | 796 |
| 891 | Ga0587092_051993 | 3300059512 | Bacteria | 745 |
| 892 | Ga0587095_006161 | 3300059514 | Bacteria | 926 |
| 893 | Ga0587095_017025 | 3300059514 | Bacteria | 671 |
| 894 | Ga0587098_006769 | 3300059604 | Bacteria | 1173 |
| 895 | Ga0587106_015835 | 3300059605 | Bacteria | 1059 |
| 896 | Ga0587129_015014 | 3300059608 | Bacteria | 642 |
| 897 | Ga0587101_056672 | 3300059623 | Bacteria | 689 |
| 898 | Ga0587101_149617 | 3300059623 | Bacteria | 505 |
| 899 | Ga0587109_094454 | 3300059624 | Bacteria | 679 |
| 900 | Ga0587115_013310 | 3300059626 | Bacteria | 1063 |
| 901 | Ga0587117_079424 | 3300059627 | Bacteria | 595 |
| 902 | Ga0587122_001696 | 3300059628 | Bacteria | 1484 |
| 903 | Ga0587062_013640 | 3300059639 | Bacteria | 1061 |
| 904 | Ga0587067_017595 | 3300059640 | Bacteria | 1189 |
| 905 | Ga0587067_036608 | 3300059640 | Bacteria | 934 |
| 906 | Ga0587068_007908 | 3300059641 | Bacteria | 1528 |
| 907 | Ga0587072_137080 | 3300059643 | Bacteria | 581 |
| 908 | Ga0587075_014952 | 3300059644 | Bacteria | 1087 |
| 909 | Ga0587076_008284 | 3300059645 | Bacteria | 1447 |
| 910 | Ga0587100_005415 | 3300059648 | Bacteria | 949 |
| 911 | Ga0587100_008942 | 3300059648 | Bacteria | 819 |
| 912 | Ga0587100_035933 | 3300059648 | Bacteria | 543 |
| 913 | Ga0587102_010002 | 3300059649 | Bacteria | 930 |
| 914 | Ga0587107_003716 | 3300059652 | Bacteria | 1501 |
| 915 | Ga0587108_006945 | 3300059653 | Bacteria | 887 |
| 916 | Ga0587114_009440 | 3300059655 | Bacteria | 1169 |
| 917 | Ga0587114_060338 | 3300059655 | Bacteria | 664 |
| 918 | Ga0587119_017129 | 3300059658 | Bacteria | 893 |
| 919 | Ga0587071_008622 | 3300060344 | Bacteria | 1657 |
| 920 | Ga0587071_023819 | 3300060344 | Bacteria | 1139 |
| 921 | Ga0587111_0020096 | 3300060346 | Bacteria | 1274 |
| 922 | Ga0587111_0061905 | 3300060346 | Bacteria | 853 |
| 923 | Ga0587111_0076183 | 3300060346 | Bacteria | 793 |
| 924 | Ga0587111_0273527 | 3300060346 | Bacteria | 508 |
| 925 | Ga0501082_0044117 | 3300060353 | Bacteria | 3846 |
| 926 | Ga0501082_0109969 | 3300060353 | Bacteria | 2386 |
| 927 | Ga0501082_0392570 | 3300060353 | Bacteria | 1211 |
| 928 | Ga0466962_0000779 | 3300061719 | Bacteria | 14329 |
| 929 | Ga0466962_0004946 | 3300061719 | Bacteria | 6409 |
| 930 | Ga0466962_0008164 | 3300061719 | Bacteria | 5019 |
| 931 | Ga0530510_0060320 | 3300061734 | Bacteria | 2745 |
| 932 | Ga0530510_0925468 | 3300061734 | Bacteria | 666 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045976 | Ga0466967_0321893 | Ga0466967_0321893_20_352 | 97 |
| 2 | 3300053108 | Ga0500562_034742 | Ga0500562_034742_123_455 | 97 |
| 3 | 3300053130 | Ga0500642_0078535 | Ga0500642_0078535_638_970 | 97 |
| 4 | 3300041460 | Ga0451802_0369205 | Ga0451802_0369205_40_378 | 100 |
| 5 | 3300049579 | Ga0501043_0176539 | Ga0501043_0176539_582_914 | 101 |
| 6 | 3300020070 | Ga0206356_10880070 | Ga0206356_108800701 | 105 |
| 7 | 3300047319 | Ga0495674_1096470 | Ga0495674_1096470_237_575 | 105 |
| 8 | 3300048918 | Ga0496115_0703040 | Ga0496115_0703040_426_764 | 105 |
| 9 | 3300053083 | Ga0495655_0375449 | Ga0495655_0375449_105_485 | 105 |
| 10 | 3300044684 | Ga0466966_0548959 | Ga0466966_0548959_321_683 | 107 |
| 11 | 3300044765 | Ga0466970_0003004 | Ga0466970_0003004_74_436 | 107 |
| 12 | 3300049570 | Ga0501033_0067467 | Ga0501033_0067467_1358_1720 | 107 |
| 13 | 3300049571 | Ga0501034_0507480 | Ga0501034_0507480_354_716 | 107 |
| 14 | 3300049572 | Ga0501036_0728855 | Ga0501036_0728855_394_756 | 107 |
| 15 | 3300049581 | Ga0501047_0067707 | Ga0501047_0067707_2310_2672 | 107 |
| 16 | 3300049822 | Ga0501035_0006472 | Ga0501035_0006472_2610_2972 | 107 |
| 17 | 3300049823 | Ga0501044_0000425 | Ga0501044_0000425_8033_8395 | 107 |
| 18 | 3300025944 | Ga0207661_10721492 | Ga0207661_107214922 | 109 |
| 19 | 3300039453 | Ga0436362_0399705 | Ga0436362_0399705_49_420 | 109 |
| 20 | 3300006038 | Ga0075365_10244325 | Ga0075365_102443252 | 111 |
| 21 | 3300006048 | Ga0075363_100018785 | Ga0075363_1000187851 | 111 |
| 22 | 3300006051 | Ga0075364_10008222 | Ga0075364_100082223 | 111 |
| 23 | 3300006186 | Ga0075369_10014830 | Ga0075369_100148302 | 111 |
| 24 | 3300006353 | Ga0075370_10119183 | Ga0075370_101191833 | 111 |
| 25 | 3300021388 | Ga0213875_10050952 | Ga0213875_100509521 | 111 |
| 26 | 3300037853 | Ga0436364_0424211 | Ga0436364_0424211_423_797 | 111 |
| 27 | 3300044693 | Ga0466961_0051070 | Ga0466961_0051070_2195_2569 | 111 |
| 28 | 3300044735 | Ga0466968_0019909 | Ga0466968_0019909_1970_2344 | 111 |
| 29 | 3300044842 | Ga0466957_0203573 | Ga0466957_0203573_390_764 | 111 |
| 30 | 3300045049 | Ga0466959_0032055 | Ga0466959_0032055_3138_3512 | 111 |
| 31 | 3300045836 | Ga0466958_0195593 | Ga0466958_0195593_503_877 | 111 |
| 32 | 3300048905 | Ga0496102_0064536 | Ga0496102_0064536_841_1215 | 111 |
| 33 | 3300048906 | Ga0496103_0024379 | Ga0496103_0024379_2947_3321 | 111 |
| 34 | 3300048921 | Ga0496118_0000359 | Ga0496118_0000359_22650_23024 | 111 |
| 35 | 3300050491 | nmdc:mga00v17_937_c1 | nmdc:mga00v17_937_c1_3180_3554 | 111 |
| 36 | 3300050495 | nmdc:mga04h51_230696_c1 | nmdc:mga04h51_230696_c1_112_486 | 111 |
| 37 | 3300050496 | nmdc:mga07m45_19238_c1 | nmdc:mga07m45_19238_c1_1272_1646 | 111 |
| 38 | 3300050516 | nmdc:mga0sz30_5215_c1 | nmdc:mga0sz30_5215_c1_160_534 | 111 |
| 39 | 3300041509 | Ga0451843_1340122 | Ga0451843_1340122_1146_1526 | 113 |
| 40 | 3300049538 | Ga0501322_006978 | Ga0501322_006978_158_526 | 113 |
| 41 | 3300004803 | Ga0058862_10127495 | Ga0058862_101274952 | 114 |
| 42 | 3300033180 | Ga0307510_10206325 | Ga0307510_102063253 | 114 |
| 43 | 3300041461 | Ga0451805_128977 | Ga0451805_128977_804_1184 | 114 |
| 44 | 3300041503 | Ga0451847_0358713 | Ga0451847_0358713_218_598 | 114 |
| 45 | 3300044765 | Ga0466970_0751525 | Ga0466970_0751525_177_557 | 114 |
| 46 | 3300045836 | Ga0466958_0261995 | Ga0466958_0261995_319_699 | 114 |
| 47 | 3300049569 | Ga0501032_0072160 | Ga0501032_0072160_1513_1893 | 114 |
| 48 | 3300049578 | Ga0501042_1248859 | Ga0501042_1248859_109_489 | 114 |
| 49 | 3300014326 | Ga0157380_10213417 | Ga0157380_102134174 | 115 |
| 50 | 3300021388 | Ga0213875_10001291 | Ga0213875_1000129117 | 115 |
| 51 | 3300037853 | Ga0436364_1354648 | Ga0436364_1354648_41400_41798 | 115 |
| 52 | 3300044712 | Ga0453684_0949489 | Ga0453684_0949489_177_542 | 115 |
| 53 | iso_pu_bacteria | 2956939328 | 2956940996 | 115 |
| 54 | iso_pu_bacteria | 3001119090 | 3001120689 | 115 |
| 55 | 3300005543 | Ga0070672_100332582 | Ga0070672_1003325822 | 116 |
| 56 | 3300014968 | Ga0157379_10388618 | Ga0157379_103886183 | 116 |
| 57 | 3300053129 | Ga0500628_055816 | Ga0500628_055816_560_937 | 116 |
| 58 | 3300059653 | Ga0587108_006945 | Ga0587108_006945_226_606 | 116 |
| 59 | 3300003308 | Ga0006777J48905_1016128 | Ga0006777J48905_10161282 | 117 |
| 60 | 3300003316 | rootH1_10087441 | rootH1_100874412 | 117 |
| 61 | 3300003323 | rootH1_10044574 | rootH1_100445741 | 117 |
| 62 | 3300004799 | Ga0058863_10085417 | Ga0058863_100854171 | 117 |
| 63 | 3300004800 | Ga0058861_10106487 | Ga0058861_101064871 | 117 |
| 64 | 3300005334 | Ga0068869_100883330 | Ga0068869_1008833302 | 117 |
| 65 | 3300005434 | Ga0070709_11011019 | Ga0070709_110110191 | 117 |
| 66 | 3300006178 | Ga0075367_10075343 | Ga0075367_100753434 | 117 |
| 67 | 3300011119 | Ga0105246_10434317 | Ga0105246_104343172 | 117 |
| 68 | 3300025932 | Ga0207690_11281629 | Ga0207690_112816292 | 117 |
| 69 | 3300025986 | Ga0207658_10002262 | Ga0207658_100022622 | 117 |
| 70 | 3300028786 | Ga0307517_10006905 | Ga0307517_1000690528 | 117 |
| 71 | 3300028794 | Ga0307515_10107145 | Ga0307515_101071453 | 117 |
| 72 | 3300028794 | Ga0307515_10255141 | Ga0307515_102551412 | 117 |
| 73 | 3300030521 | Ga0307511_10017698 | Ga0307511_1001769811 | 117 |
| 74 | 3300030522 | Ga0307512_10083358 | Ga0307512_100833584 | 117 |
| 75 | 3300030522 | Ga0307512_10197589 | Ga0307512_101975891 | 117 |
| 76 | 3300031456 | Ga0307513_10342355 | Ga0307513_103423553 | 117 |
| 77 | 3300031507 | Ga0307509_10411162 | Ga0307509_104111621 | 117 |
| 78 | 3300031616 | Ga0307508_10115798 | Ga0307508_101157983 | 117 |
| 79 | 3300031649 | Ga0307514_10121653 | Ga0307514_101216533 | 117 |
| 80 | 3300031649 | Ga0307514_10219817 | Ga0307514_102198172 | 117 |
| 81 | 3300031730 | Ga0307516_10594784 | Ga0307516_105947842 | 117 |
| 82 | 3300031838 | Ga0307518_10578106 | Ga0307518_105781061 | 117 |
| 83 | 3300033179 | Ga0307507_10024930 | Ga0307507_100249303 | 117 |
| 84 | 3300033179 | Ga0307507_10025585 | Ga0307507_100255854 | 117 |
| 85 | 3300033180 | Ga0307510_10090689 | Ga0307510_100906893 | 117 |
| 86 | 3300039062 | Ga0400483_019574 | Ga0400483_019574_4139_4507 | 117 |
| 87 | 3300041458 | Ga0451798_0882651 | Ga0451798_0882651_169_552 | 117 |
| 88 | 3300046454 | Ga0495592_0011378 | Ga0495592_0011378_3231_3611 | 117 |
| 89 | 3300046459 | Ga0495629_0247996 | Ga0495629_0247996_636_1016 | 117 |
| 90 | 3300046460 | Ga0495638_0119177 | Ga0495638_0119177_429_809 | 117 |
| 91 | 3300046462 | Ga0495651_0011730 | Ga0495651_0011730_726_1106 | 117 |
| 92 | 3300046463 | Ga0495653_0317694 | Ga0495653_0317694_309_689 | 117 |
| 93 | 3300046473 | Ga0495582_0156632 | Ga0495582_0156632_106_486 | 117 |
| 94 | 3300046475 | Ga0495639_0235128 | Ga0495639_0235128_336_716 | 117 |
| 95 | 3300046476 | Ga0495662_0005288 | Ga0495662_0005288_280_660 | 117 |
| 96 | 3300046476 | Ga0495662_0018980 | Ga0495662_0018980_621_1001 | 117 |
| 97 | 3300046477 | Ga0495664_0072068 | Ga0495664_0072068_1433_1813 | 117 |
| 98 | 3300046499 | Ga0495594_0143365 | Ga0495594_0143365_548_928 | 117 |
| 99 | 3300046499 | Ga0495594_0211202 | Ga0495594_0211202_251_631 | 117 |
| 100 | 3300046512 | Ga0495610_0340423 | Ga0495610_0340423_88_468 | 117 |
| 101 | 3300046517 | Ga0495630_0087245 | Ga0495630_0087245_1187_1567 | 117 |
| 102 | 3300046518 | Ga0495631_0238779 | Ga0495631_0238779_260_640 | 117 |
| 103 | 3300046529 | Ga0495652_0319361 | Ga0495652_0319361_245_625 | 117 |
| 104 | 3300046533 | Ga0495640_0124534 | Ga0495640_0124534_17_397 | 117 |
| 105 | 3300046535 | Ga0495586_0223039 | Ga0495586_0223039_31_411 | 117 |
| 106 | 3300046536 | Ga0495587_0000793 | Ga0495587_0000793_19952_20332 | 117 |
| 107 | 3300046543 | Ga0495645_0007022 | Ga0495645_0007022_3793_4173 | 117 |
| 108 | 3300046557 | Ga0495622_0017744 | Ga0495622_0017744_155_535 | 117 |
| 109 | 3300046559 | Ga0495667_0337720 | Ga0495667_0337720_455_823 | 117 |
| 110 | 3300046559 | Ga0495667_0481324 | Ga0495667_0481324_17_397 | 117 |
| 111 | 3300046642 | Ga0495634_0005875 | Ga0495634_0005875_725_1105 | 117 |
| 112 | 3300046660 | Ga0495625_0095757 | Ga0495625_0095757_1164_1544 | 117 |
| 113 | 3300046660 | Ga0495625_0261981 | Ga0495625_0261981_170_550 | 117 |
| 114 | 3300046663 | Ga0495635_0015642 | Ga0495635_0015642_719_1099 | 117 |
| 115 | 3300046674 | Ga0495588_0026982 | Ga0495588_0026982_2214_2594 | 117 |
| 116 | 3300046674 | Ga0495588_0160161 | Ga0495588_0160161_770_1150 | 117 |
| 117 | 3300046675 | Ga0495657_0014293 | Ga0495657_0014293_338_718 | 117 |
| 118 | 3300046678 | Ga0495599_0183912 | Ga0495599_0183912_854_1234 | 117 |
| 119 | 3300046679 | Ga0495623_0054899 | Ga0495623_0054899_1114_1494 | 117 |
| 120 | 3300046679 | Ga0495623_0242477 | Ga0495623_0242477_139_519 | 117 |
| 121 | 3300046680 | Ga0495646_0009635 | Ga0495646_0009635_5478_5858 | 117 |
| 122 | 3300046683 | Ga0495658_0120358 | Ga0495658_0120358_741_1121 | 117 |
| 123 | 3300046689 | Ga0495613_0263347 | Ga0495613_0263347_232_612 | 117 |
| 124 | 3300046690 | Ga0495624_0278293 | Ga0495624_0278293_278_658 | 117 |
| 125 | 3300046691 | Ga0495670_0561469 | Ga0495670_0561469_176_556 | 117 |
| 126 | 3300046809 | Ga0495600_0055477 | Ga0495600_0055477_338_718 | 117 |
| 127 | 3300047315 | Ga0495581_0131774 | Ga0495581_0131774_734_1114 | 117 |
| 128 | 3300047317 | Ga0495604_0013519 | Ga0495604_0013519_1592_1972 | 117 |
| 129 | 3300047317 | Ga0495604_0015097 | Ga0495604_0015097_687_1067 | 117 |
| 130 | 3300047318 | Ga0495636_0188804 | Ga0495636_0188804_158_538 | 117 |
| 131 | 3300047319 | Ga0495674_0262273 | Ga0495674_0262273_725_1105 | 117 |
| 132 | 3300047321 | Ga0495676_0059662 | Ga0495676_0059662_249_629 | 117 |
| 133 | 3300047443 | Ga0495687_015578 | Ga0495687_015578_512_892 | 117 |
| 134 | 3300047444 | Ga0495675_0013484 | Ga0495675_0013484_3800_4180 | 117 |
| 135 | 3300047444 | Ga0495675_0295316 | Ga0495675_0295316_534_914 | 117 |
| 136 | 3300047447 | Ga0495685_063453 | Ga0495685_063453_589_969 | 117 |
| 137 | 3300047447 | Ga0495685_183751 | Ga0495685_183751_263_643 | 117 |
| 138 | 3300047447 | Ga0495685_193437 | Ga0495685_193437_133_513 | 117 |
| 139 | 3300047470 | Ga0495681_0011573 | Ga0495681_0011573_865_1245 | 117 |
| 140 | 3300047471 | Ga0495684_0340967 | Ga0495684_0340967_507_887 | 117 |
| 141 | 3300047472 | Ga0495686_0066423 | Ga0495686_0066423_717_1097 | 117 |
| 142 | 3300047673 | Ga0495593_0005852 | Ga0495593_0005852_5655_6035 | 117 |
| 143 | 3300048088 | Ga0495602_0083799 | Ga0495602_0083799_617_997 | 117 |
| 144 | 3300048089 | Ga0495614_0023593 | Ga0495614_0023593_1976_2356 | 117 |
| 145 | 3300048908 | Ga0496105_0096230 | Ga0496105_0096230_1857_2237 | 117 |
| 146 | 3300048909 | Ga0496106_1374099 | Ga0496106_1374099_122_502 | 117 |
| 147 | 3300048911 | Ga0496108_1042862 | Ga0496108_1042862_214_594 | 117 |
| 148 | 3300048912 | Ga0496109_0954148 | Ga0496109_0954148_225_605 | 117 |
| 149 | 3300049127 | Ga0501306_001285 | Ga0501306_001285_891_1271 | 117 |
| 150 | 3300049130 | Ga0501310_002257 | Ga0501310_002257_504_884 | 117 |
| 151 | 3300049160 | Ga0501304_000819 | Ga0501304_000819_733_1113 | 117 |
| 152 | 3300049162 | Ga0501307_008933 | Ga0501307_008933_503_883 | 117 |
| 153 | 3300049527 | Ga0501311_000597 | Ga0501311_000597_677_1057 | 117 |
| 154 | 3300049529 | Ga0501313_000328 | Ga0501313_000328_2312_2692 | 117 |
| 155 | 3300049530 | Ga0501314_005250 | Ga0501314_005250_411_791 | 117 |
| 156 | 3300049531 | Ga0501315_000243 | Ga0501315_000243_640_1020 | 117 |
| 157 | 3300049532 | Ga0501316_002447 | Ga0501316_002447_445_825 | 117 |
| 158 | 3300049533 | Ga0501317_000282 | Ga0501317_000282_925_1305 | 117 |
| 159 | 3300049534 | Ga0501318_000119 | Ga0501318_000119_2388_2768 | 117 |
| 160 | 3300049535 | Ga0501319_001265 | Ga0501319_001265_362_742 | 117 |
| 161 | 3300049536 | Ga0501320_000755 | Ga0501320_000755_680_1060 | 117 |
| 162 | 3300049538 | Ga0501322_001303 | Ga0501322_001303_413_793 | 117 |
| 163 | 3300049539 | Ga0501323_001192 | Ga0501323_001192_920_1300 | 117 |
| 164 | 3300049540 | Ga0501324_000083 | Ga0501324_000083_2382_2762 | 117 |
| 165 | 3300049652 | Ga0501202_019719 | Ga0501202_019719_915_1295 | 117 |
| 166 | 3300049661 | Ga0501217_044712 | Ga0501217_044712_176_556 | 117 |
| 167 | 3300049686 | Ga0501257_106123 | Ga0501257_106123_28_408 | 117 |
| 168 | 3300049704 | Ga0501221_181713 | Ga0501221_181713_169_549 | 117 |
| 169 | 3300050491 | nmdc:mga00v17_382505_c1 | nmdc:mga00v17_382505_c1_48_428 | 117 |
| 170 | 3300053078 | Ga0495612_0033956 | Ga0495612_0033956_323_703 | 117 |
| 171 | 3300053079 | Ga0500610_0035276 | Ga0500610_0035276_1316_1696 | 117 |
| 172 | 3300053083 | Ga0495655_0095229 | Ga0495655_0095229_368_748 | 117 |
| 173 | 3300053088 | Ga0500644_0019335 | Ga0500644_0019335_44_424 | 117 |
| 174 | 3300053088 | Ga0500644_0338151 | Ga0500644_0338151_96_464 | 117 |
| 175 | 3300053091 | Ga0500647_0039633 | Ga0500647_0039633_1370_1750 | 117 |
| 176 | 3300053092 | Ga0500583_0131398 | Ga0500583_0131398_301_681 | 117 |
| 177 | 3300053094 | Ga0500566_0227339 | Ga0500566_0227339_159_539 | 117 |
| 178 | 3300053095 | Ga0500640_018648 | Ga0500640_018648_1869_2249 | 117 |
| 179 | 3300053100 | Ga0500660_108747 | Ga0500660_108747_280_660 | 117 |
| 180 | 3300053101 | Ga0500553_035854 | Ga0500553_035854_1821_2201 | 117 |
| 181 | 3300053111 | Ga0500572_004783 | Ga0500572_004783_742_1122 | 117 |
| 182 | 3300053122 | Ga0500608_059636 | Ga0500608_059636_984_1364 | 117 |
| 183 | 3300053123 | Ga0500614_080617 | Ga0500614_080617_404_784 | 117 |
| 184 | 3300053125 | Ga0500618_101516 | Ga0500618_101516_13_393 | 117 |
| 185 | 3300053130 | Ga0500642_0267373 | Ga0500642_0267373_361_741 | 117 |
| 186 | 3300053131 | Ga0500652_244217 | Ga0500652_244217_231_611 | 117 |
| 187 | 3300053133 | Ga0500655_082250 | Ga0500655_082250_219_599 | 117 |
| 188 | 3300053142 | Ga0500577_0093719 | Ga0500577_0093719_211_591 | 117 |
| 189 | 3300053145 | Ga0500586_066611 | Ga0500586_066611_785_1165 | 117 |
| 190 | 3300053157 | Ga0500624_001345 | Ga0500624_001345_2682_3062 | 117 |
| 191 | 3300053161 | Ga0500634_0081366 | Ga0500634_0081366_904_1284 | 117 |
| 192 | 3300053177 | Ga0500636_0224281 | Ga0500636_0224281_391_771 | 117 |
| 193 | 3300059512 | Ga0587092_042458 | Ga0587092_042458_361_741 | 117 |
| 194 | 3300059514 | Ga0587095_017025 | Ga0587095_017025_264_644 | 117 |
| 195 | 3300059641 | Ga0587068_007908 | Ga0587068_007908_415_795 | 117 |
| 196 | 3300059648 | Ga0587100_035933 | Ga0587100_035933_45_425 | 117 |
| 197 | 3300059652 | Ga0587107_003716 | Ga0587107_003716_688_1068 | 117 |
| 198 | iso_pu_bacteria | 2506783011 | 2506868501 | 117 |
| 199 | iso_pu_bacteria | 2508501039 | 2508670615 | 117 |
| 200 | iso_pu_bacteria | 2515154155 | 2515851639 | 117 |
| 201 | iso_pu_bacteria | 2517572101 | 2517762559 | 117 |
| 202 | iso_pu_bacteria | 2527291627 | 2528204305 | 117 |
| 203 | iso_pu_bacteria | 2527291629 | 2528212125 | 117 |
| 204 | iso_pu_bacteria | 2546825537 | 2546946876 | 117 |
| 205 | iso_pu_bacteria | 2558860280 | 2559428752 | 117 |
| 206 | iso_pu_bacteria | 2576861822 | 2579747614 | 117 |
| 207 | iso_pu_bacteria | 2579778521 | 2579853579 | 117 |
| 208 | iso_pu_bacteria | 2619618881 | 2619853740 | 117 |
| 209 | iso_pu_bacteria | 2619619003 | 2620349866 | 117 |
| 210 | iso_pu_bacteria | 2626541554 | 2626634914 | 117 |
| 211 | iso_pu_bacteria | 2643221587 | 2643941973 | 117 |
| 212 | iso_pu_bacteria | 2643221670 | 2644389596 | 117 |
| 213 | iso_pu_bacteria | 2643221677 | 2644429056 | 117 |
| 214 | iso_pu_bacteria | 2671180195 | 2671835719 | 117 |
| 215 | iso_pu_bacteria | 2675902999 | 2676199457 | 117 |
| 216 | iso_pu_bacteria | 2684623035 | 2686539256 | 117 |
| 217 | iso_pu_bacteria | 2684623036 | 2686543608 | 117 |
| 218 | iso_pu_bacteria | 2687453737 | 2689960393 | 117 |
| 219 | iso_pu_bacteria | 2687453743 | 2689992372 | 117 |
| 220 | iso_pu_bacteria | 2710264753 | 2710602537 | 117 |
| 221 | iso_pu_bacteria | 2721755702 | 2723643130 | 117 |
| 222 | iso_pu_bacteria | 2728369276 | 2729906656 | 117 |
| 223 | iso_pu_bacteria | 2731639228 | 2731908949 | 117 |
| 224 | iso_pu_bacteria | 2751185734 | 2753069957 | 117 |
| 225 | iso_pu_bacteria | 2773857921 | 2774844035 | 117 |
| 226 | iso_pu_bacteria | 2773857922 | 2774853875 | 117 |
| 227 | iso_pu_bacteria | 2773857924 | 2774866998 | 117 |
| 228 | iso_pu_bacteria | 2773857933 | 2774902882 | 117 |
| 229 | iso_pu_bacteria | 2784746768 | 2785370798 | 117 |
| 230 | iso_pu_bacteria | 2786546132 | 2786671982 | 117 |
| 231 | iso_pu_bacteria | 2799112218 | 2799184978 | 117 |
| 232 | iso_pu_bacteria | 2808606375 | 2808912948 | 117 |
| 233 | iso_pu_bacteria | 2861520306 | 2861525554 | 117 |
| 234 | iso_pu_bacteria | 2862574272 | 2862578153 | 117 |
| 235 | iso_pu_bacteria | 2870721527 | 2870727546 | 117 |
| 236 | iso_pu_bacteria | 2877676314 | 2877679780 | 117 |
| 237 | iso_pu_bacteria | 2895880812 | 2895884587 | 117 |
| 238 | iso_pu_bacteria | 2918501144 | 2918505854 | 117 |
| 239 | iso_pu_bacteria | 2919443155 | 2919445575 | 117 |
| 240 | iso_pu_bacteria | 2935409751 | 2935412140 | 117 |
| 241 | iso_pu_bacteria | 2954002825 | 2954003149 | 117 |
| 242 | iso_pu_bacteria | 2954380949 | 2954384710 | 117 |
| 243 | iso_pu_bacteria | 2954673503 | 2954678254 | 117 |
| 244 | iso_pu_bacteria | 2954682443 | 2954685903 | 117 |
| 245 | iso_pu_bacteria | 3006321560 | 3006326196 | 117 |
| 246 | iso_pu_bacteria | 637000116 | 637877940 | 117 |
| 247 | iso_pu_bacteria | 8002775197 | 8002782915 | 117 |
| 248 | iso_pu_bacteria | 8047710418 | 8047717755 | 117 |
| 249 | iso_pu_bacteria | 8054913762 | 8054918450 | 117 |
| 250 | iso_pu_bacteria | 8054920844 | 8054926309 | 117 |
| 251 | iso_pu_bacteria | 8055157932 | 8055160622 | 117 |
| 252 | iso_pu_bacteria | 8057568493 | 8057570075 | 117 |
| 253 | 3300003579 | Ga0007429J51699_1098508 | Ga0007429J51699_10985081 | 118 |
| 254 | 3300004801 | Ga0058860_10229221 | Ga0058860_102292211 | 118 |
| 255 | 3300005456 | Ga0070678_101138709 | Ga0070678_1011387091 | 118 |
| 256 | 3300006353 | Ga0075370_10088385 | Ga0075370_100883854 | 118 |
| 257 | 3300009174 | Ga0105241_10796030 | Ga0105241_107960301 | 118 |
| 258 | 3300025934 | Ga0207686_10589347 | Ga0207686_105893472 | 118 |
| 259 | 3300025937 | Ga0207669_10278193 | Ga0207669_102781932 | 118 |
| 260 | 3300044694 | Ga0466963_0143823 | Ga0466963_0143823_417_797 | 118 |
| 261 | 3300044842 | Ga0466957_0297570 | Ga0466957_0297570_514_894 | 118 |
| 262 | 3300045976 | Ga0466967_0841565 | Ga0466967_0841565_52_432 | 118 |
| 263 | 3300046460 | Ga0495638_0105562 | Ga0495638_0105562_1115_1495 | 118 |
| 264 | 3300046463 | Ga0495653_0828413 | Ga0495653_0828413_149_526 | 118 |
| 265 | 3300046675 | Ga0495657_0866061 | Ga0495657_0866061_20_400 | 118 |
| 266 | 3300046684 | Ga0495669_0047578 | Ga0495669_0047578_661_1038 | 118 |
| 267 | 3300049576 | Ga0501040_0860682 | Ga0501040_0860682_60_434 | 118 |
| 268 | 3300049577 | Ga0501041_0642533 | Ga0501041_0642533_271_645 | 118 |
| 269 | 3300049582 | Ga0501048_0669896 | Ga0501048_0669896_164_535 | 118 |
| 270 | 3300050490 | nmdc:mga03n38_275355_c1 | nmdc:mga03n38_275355_c1_195_575 | 118 |
| 271 | 3300050496 | nmdc:mga07m45_20663_c1 | nmdc:mga07m45_20663_c1_919_1299 | 118 |
| 272 | 3300053083 | Ga0495655_0063403 | Ga0495655_0063403_247_627 | 118 |
| 273 | 3300054114 | Ga0501084_0443129 | Ga0501084_0443129_483_857 | 118 |
| 274 | 3300060353 | Ga0501082_0109969 | Ga0501082_0109969_1609_1983 | 118 |
| 275 | 3300061734 | Ga0530510_0060320 | Ga0530510_0060320_611_985 | 118 |
| 276 | 3300003354 | JGI25160J50197_1013781 | JGI25160J50197_10137813 | 119 |
| 277 | 3300003354 | JGI25160J50197_1026569 | JGI25160J50197_10265692 | 119 |
| 278 | 3300003575 | Ga0007409J51694_1027373 | Ga0007409J51694_10273731 | 119 |
| 279 | 3300003579 | Ga0007429J51699_1077728 | Ga0007429J51699_10777282 | 119 |
| 280 | 3300005435 | Ga0070714_101424383 | Ga0070714_1014243832 | 119 |
| 281 | 3300005458 | Ga0070681_10448711 | Ga0070681_104487112 | 119 |
| 282 | 3300005614 | Ga0068856_102522922 | Ga0068856_1025229221 | 119 |
| 283 | 3300006028 | Ga0070717_10294088 | Ga0070717_102940883 | 119 |
| 284 | 3300006175 | Ga0070712_100506623 | Ga0070712_1005066232 | 119 |
| 285 | 3300006847 | Ga0075431_100657837 | Ga0075431_1006578372 | 119 |
| 286 | 3300006880 | Ga0075429_100140830 | Ga0075429_1001408304 | 119 |
| 287 | 3300014497 | Ga0182008_10354699 | Ga0182008_103546991 | 119 |
| 288 | 3300014969 | Ga0157376_10865869 | Ga0157376_108658692 | 119 |
| 289 | 3300021388 | Ga0213875_10001257 | Ga0213875_1000125713 | 119 |
| 290 | 3300025297 | Ga0209758_1000870 | Ga0209758_100087047 | 119 |
| 291 | 3300025302 | Ga0207426_1005272 | Ga0207426_10052726 | 119 |
| 292 | 3300025302 | Ga0207426_1012521 | Ga0207426_10125213 | 119 |
| 293 | 3300025302 | Ga0207426_1061190 | Ga0207426_10611901 | 119 |
| 294 | 3300025303 | Ga0209051_1121767 | Ga0209051_11217672 | 119 |
| 295 | 3300025906 | Ga0207699_10275966 | Ga0207699_102759662 | 119 |
| 296 | 3300025912 | Ga0207707_10241686 | Ga0207707_102416862 | 119 |
| 297 | 3300025915 | Ga0207693_10451024 | Ga0207693_104510242 | 119 |
| 298 | 3300031616 | Ga0307508_10000924 | Ga0307508_1000092419 | 119 |
| 299 | 3300035725 | Ga0373947_0204412 | Ga0373947_0204412_177_557 | 119 |
| 300 | 3300037068 | Ga0373925_0106577 | Ga0373925_0106577_809_1189 | 119 |
| 301 | 3300037853 | Ga0436364_0010700 | Ga0436364_0010700_82913_83293 | 119 |
| 302 | 3300045049 | Ga0466959_0743902 | Ga0466959_0743902_118_498 | 119 |
| 303 | 3300045836 | Ga0466958_0849536 | Ga0466958_0849536_57_437 | 119 |
| 304 | 3300045976 | Ga0466967_0075222 | Ga0466967_0075222_336_716 | 119 |
| 305 | 3300045976 | Ga0466967_0188862 | Ga0466967_0188862_157_537 | 119 |
| 306 | 3300046454 | Ga0495592_0002384 | Ga0495592_0002384_7128_7508 | 119 |
| 307 | 3300046459 | Ga0495629_0037614 | Ga0495629_0037614_143_523 | 119 |
| 308 | 3300046459 | Ga0495629_0498077 | Ga0495629_0498077_70_450 | 119 |
| 309 | 3300046462 | Ga0495651_0002063 | Ga0495651_0002063_12568_12948 | 119 |
| 310 | 3300046463 | Ga0495653_0023969 | Ga0495653_0023969_1962_2342 | 119 |
| 311 | 3300046472 | Ga0495580_0005827 | Ga0495580_0005827_1093_1473 | 119 |
| 312 | 3300046476 | Ga0495662_0002247 | Ga0495662_0002247_3499_3879 | 119 |
| 313 | 3300046476 | Ga0495662_0190885 | Ga0495662_0190885_286_666 | 119 |
| 314 | 3300046477 | Ga0495664_0002322 | Ga0495664_0002322_655_1035 | 119 |
| 315 | 3300046511 | Ga0495608_0014048 | Ga0495608_0014048_2190_2570 | 119 |
| 316 | 3300046516 | Ga0495628_0007000 | Ga0495628_0007000_6007_6387 | 119 |
| 317 | 3300046517 | Ga0495630_0015711 | Ga0495630_0015711_3507_3887 | 119 |
| 318 | 3300046526 | Ga0495666_0000307 | Ga0495666_0000307_17642_18022 | 119 |
| 319 | 3300046529 | Ga0495652_0030154 | Ga0495652_0030154_2747_3127 | 119 |
| 320 | 3300046531 | Ga0495665_0013217 | Ga0495665_0013217_1506_1886 | 119 |
| 321 | 3300046533 | Ga0495640_0027443 | Ga0495640_0027443_969_1349 | 119 |
| 322 | 3300046535 | Ga0495586_0065641 | Ga0495586_0065641_730_1110 | 119 |
| 323 | 3300046536 | Ga0495587_0139260 | Ga0495587_0139260_752_1132 | 119 |
| 324 | 3300046543 | Ga0495645_0002261 | Ga0495645_0002261_12064_12444 | 119 |
| 325 | 3300046543 | Ga0495645_0300633 | Ga0495645_0300633_141_521 | 119 |
| 326 | 3300046559 | Ga0495667_0034555 | Ga0495667_0034555_2747_3127 | 119 |
| 327 | 3300046559 | Ga0495667_0837715 | Ga0495667_0837715_153_533 | 119 |
| 328 | 3300046642 | Ga0495634_0044010 | Ga0495634_0044010_1052_1432 | 119 |
| 329 | 3300046663 | Ga0495635_0067659 | Ga0495635_0067659_966_1346 | 119 |
| 330 | 3300046663 | Ga0495635_0613993 | Ga0495635_0613993_110_490 | 119 |
| 331 | 3300046675 | Ga0495657_0024880 | Ga0495657_0024880_3495_3875 | 119 |
| 332 | 3300046678 | Ga0495599_0031629 | Ga0495599_0031629_2190_2570 | 119 |
| 333 | 3300046679 | Ga0495623_0030831 | Ga0495623_0030831_2318_2698 | 119 |
| 334 | 3300046680 | Ga0495646_0061524 | Ga0495646_0061524_752_1132 | 119 |
| 335 | 3300046689 | Ga0495613_0037419 | Ga0495613_0037419_969_1349 | 119 |
| 336 | 3300046689 | Ga0495613_0675840 | Ga0495613_0675840_21_401 | 119 |
| 337 | 3300046809 | Ga0495600_0068521 | Ga0495600_0068521_976_1356 | 119 |
| 338 | 3300047315 | Ga0495581_0105647 | Ga0495581_0105647_562_942 | 119 |
| 339 | 3300047317 | Ga0495604_0000113 | Ga0495604_0000113_4334_4714 | 119 |
| 340 | 3300047319 | Ga0495674_0018748 | Ga0495674_0018748_3246_3626 | 119 |
| 341 | 3300047444 | Ga0495675_0017801 | Ga0495675_0017801_2747_3127 | 119 |
| 342 | 3300047444 | Ga0495675_0487073 | Ga0495675_0487073_214_594 | 119 |
| 343 | 3300047471 | Ga0495684_0004072 | Ga0495684_0004072_6850_7230 | 119 |
| 344 | 3300047673 | Ga0495593_0054339 | Ga0495593_0054339_740_1120 | 119 |
| 345 | 3300048088 | Ga0495602_0014250 | Ga0495602_0014250_976_1356 | 119 |
| 346 | 3300048905 | Ga0496102_0000840 | Ga0496102_0000840_26381_26761 | 119 |
| 347 | 3300048905 | Ga0496102_0384958 | Ga0496102_0384958_634_1014 | 119 |
| 348 | 3300048906 | Ga0496103_0042936 | Ga0496103_0042936_1043_1423 | 119 |
| 349 | 3300048907 | Ga0496104_0877151 | Ga0496104_0877151_86_466 | 119 |
| 350 | 3300048911 | Ga0496108_0048893 | Ga0496108_0048893_1682_2062 | 119 |
| 351 | 3300048913 | Ga0496110_0216609 | Ga0496110_0216609_500_880 | 119 |
| 352 | 3300048916 | Ga0496113_1329193 | Ga0496113_1329193_112_492 | 119 |
| 353 | 3300048917 | Ga0496114_0317906 | Ga0496114_0317906_431_811 | 119 |
| 354 | 3300048929 | Ga0496126_0231208 | Ga0496126_0231208_670_1050 | 119 |
| 355 | 3300050508 | nmdc:mga09592_70174_c1 | nmdc:mga09592_70174_c1_1360_1740 | 119 |
| 356 | 3300053077 | Ga0495601_0019194 | Ga0495601_0019194_1025_1405 | 119 |
| 357 | 3300053078 | Ga0495612_0114248 | Ga0495612_0114248_518_898 | 119 |
| 358 | 3300053085 | Ga0495619_0016029 | Ga0495619_0016029_1377_1757 | 119 |
| 359 | 3300053085 | Ga0495619_0239380 | Ga0495619_0239380_448_828 | 119 |
| 360 | 3300053140 | Ga0500573_0482656 | Ga0500573_0482656_14_394 | 119 |
| 361 | 3300005331 | Ga0070670_100338738 | Ga0070670_1003387383 | 120 |
| 362 | 3300005334 | Ga0068869_100018620 | Ga0068869_1000186206 | 120 |
| 363 | 3300005347 | Ga0070668_100196908 | Ga0070668_1001969082 | 120 |
| 364 | 3300005354 | Ga0070675_100194727 | Ga0070675_1001947273 | 120 |
| 365 | 3300005356 | Ga0070674_100077936 | Ga0070674_1000779363 | 120 |
| 366 | 3300005367 | Ga0070667_102079642 | Ga0070667_1020796421 | 120 |
| 367 | 3300005438 | Ga0070701_10390157 | Ga0070701_103901572 | 120 |
| 368 | 3300005456 | Ga0070678_100314920 | Ga0070678_1003149202 | 120 |
| 369 | 3300005618 | Ga0068864_101053908 | Ga0068864_1010539082 | 120 |
| 370 | 3300006195 | Ga0075366_10481228 | Ga0075366_104812282 | 120 |
| 371 | 3300007265 | Ga0099794_10369792 | Ga0099794_103697921 | 120 |
| 372 | 3300009098 | Ga0105245_10575897 | Ga0105245_105758972 | 120 |
| 373 | 3300009148 | Ga0105243_10162470 | Ga0105243_101624702 | 120 |
| 374 | 3300009148 | Ga0105243_10994620 | Ga0105243_109946202 | 120 |
| 375 | 3300009177 | Ga0105248_12584018 | Ga0105248_125840181 | 120 |
| 376 | 3300009553 | Ga0105249_10687247 | Ga0105249_106872471 | 120 |
| 377 | 3300010375 | Ga0105239_12859172 | Ga0105239_128591721 | 120 |
| 378 | 3300013104 | Ga0157370_12126253 | Ga0157370_121262531 | 120 |
| 379 | 3300013297 | Ga0157378_10490338 | Ga0157378_104903383 | 120 |
| 380 | 3300013297 | Ga0157378_11560850 | Ga0157378_115608502 | 120 |
| 381 | 3300014745 | Ga0157377_10543637 | Ga0157377_105436372 | 120 |
| 382 | 3300025901 | Ga0207688_10041350 | Ga0207688_100413503 | 120 |
| 383 | 3300025909 | Ga0207705_10003438 | Ga0207705_100034385 | 120 |
| 384 | 3300025920 | Ga0207649_10604024 | Ga0207649_106040242 | 120 |
| 385 | 3300025923 | Ga0207681_11787568 | Ga0207681_117875681 | 120 |
| 386 | 3300025924 | Ga0207694_11063285 | Ga0207694_110632851 | 120 |
| 387 | 3300025926 | Ga0207659_10145326 | Ga0207659_101453263 | 120 |
| 388 | 3300025927 | Ga0207687_10380765 | Ga0207687_103807651 | 120 |
| 389 | 3300025940 | Ga0207691_10220168 | Ga0207691_102201683 | 120 |
| 390 | 3300025942 | Ga0207689_10020564 | Ga0207689_100205645 | 120 |
| 391 | 3300025960 | Ga0207651_10189905 | Ga0207651_101899053 | 120 |
| 392 | 3300025961 | Ga0207712_10119117 | Ga0207712_101191172 | 120 |
| 393 | 3300025972 | Ga0207668_10264527 | Ga0207668_102645272 | 120 |
| 394 | 3300025986 | Ga0207658_12136008 | Ga0207658_121360081 | 120 |
| 395 | 3300026023 | Ga0207677_11416085 | Ga0207677_114160852 | 120 |
| 396 | 3300026121 | Ga0207683_10691384 | Ga0207683_106913843 | 120 |
| 397 | 3300028380 | Ga0268265_10373786 | Ga0268265_103737863 | 120 |
| 398 | 3300031727 | Ga0316576_10109103 | Ga0316576_101091034 | 120 |
| 399 | 3300031727 | Ga0316576_10350768 | Ga0316576_103507682 | 120 |
| 400 | 3300031731 | Ga0307405_10309324 | Ga0307405_103093241 | 120 |
| 401 | 3300031733 | Ga0316577_10165966 | Ga0316577_101659663 | 120 |
| 402 | 3300031911 | Ga0307412_10692764 | Ga0307412_106927641 | 120 |
| 403 | 3300031995 | Ga0307409_100651764 | Ga0307409_1006517642 | 120 |
| 404 | 3300032002 | Ga0307416_100583936 | Ga0307416_1005839362 | 120 |
| 405 | 3300032126 | Ga0307415_100049757 | Ga0307415_1000497575 | 120 |
| 406 | 3300034819 | Ga0373958_0132797 | Ga0373958_0132797_61_438 | 120 |
| 407 | 3300035398 | Ga0316574_0197315 | Ga0316574_0197315_823_1200 | 120 |
| 408 | 3300035398 | Ga0316574_0631025 | Ga0316574_0631025_150_527 | 120 |
| 409 | 3300036647 | Ga0316582_0184816 | Ga0316582_0184816_459_836 | 120 |
| 410 | 3300036712 | Ga0316584_0038993 | Ga0316584_0038993_2051_2428 | 120 |
| 411 | 3300041496 | Ga0451839_0534569 | Ga0451839_0534569_729_1106 | 120 |
| 412 | 3300041512 | Ga0451853_1319955 | Ga0451853_1319955_1247_1624 | 120 |
| 413 | 3300041512 | Ga0451853_1446781 | Ga0451853_1446781_184_561 | 120 |
| 414 | 3300046461 | Ga0495641_0474423 | Ga0495641_0474423_154_531 | 120 |
| 415 | 3300046511 | Ga0495608_0465813 | Ga0495608_0465813_113_490 | 120 |
| 416 | 3300047322 | Ga0495680_0551908 | Ga0495680_0551908_251_628 | 120 |
| 417 | 3300048907 | Ga0496104_0761824 | Ga0496104_0761824_426_803 | 120 |
| 418 | 3300048908 | Ga0496105_0672910 | Ga0496105_0672910_284_661 | 120 |
| 419 | 3300048914 | Ga0496111_0402489 | Ga0496111_0402489_70_447 | 120 |
| 420 | 3300048917 | Ga0496114_0183723 | Ga0496114_0183723_1123_1500 | 120 |
| 421 | 3300049161 | Ga0501305_066565 | Ga0501305_066565_51_428 | 120 |
| 422 | 3300049527 | Ga0501311_078820 | Ga0501311_078820_32_409 | 120 |
| 423 | 3300049532 | Ga0501316_026425 | Ga0501316_026425_335_712 | 120 |
| 424 | 3300049533 | Ga0501317_027117 | Ga0501317_027117_262_639 | 120 |
| 425 | 3300049537 | Ga0501321_005600 | Ga0501321_005600_457_834 | 120 |
| 426 | 3300049541 | Ga0501325_009559 | Ga0501325_009559_369_746 | 120 |
| 427 | 3300049568 | Ga0501031_0223452 | Ga0501031_0223452_226_603 | 120 |
| 428 | 3300049569 | Ga0501032_0002622 | Ga0501032_0002622_9096_9473 | 120 |
| 429 | 3300049570 | Ga0501033_0215801 | Ga0501033_0215801_322_699 | 120 |
| 430 | 3300049570 | Ga0501033_0498729 | Ga0501033_0498729_353_730 | 120 |
| 431 | 3300049571 | Ga0501034_0039901 | Ga0501034_0039901_624_1001 | 120 |
| 432 | 3300049571 | Ga0501034_0461188 | Ga0501034_0461188_394_771 | 120 |
| 433 | 3300049572 | Ga0501036_0193864 | Ga0501036_0193864_299_676 | 120 |
| 434 | 3300049573 | Ga0501037_0003123 | Ga0501037_0003123_8199_8576 | 120 |
| 435 | 3300049574 | Ga0501038_0031768 | Ga0501038_0031768_2846_3223 | 120 |
| 436 | 3300049575 | Ga0501039_0210458 | Ga0501039_0210458_915_1292 | 120 |
| 437 | 3300049579 | Ga0501043_0408922 | Ga0501043_0408922_46_423 | 120 |
| 438 | 3300049581 | Ga0501047_0087734 | Ga0501047_0087734_1987_2364 | 120 |
| 439 | 3300049584 | Ga0501068_0697278 | Ga0501068_0697278_167_544 | 120 |
| 440 | 3300049586 | Ga0501070_0025003 | Ga0501070_0025003_3069_3446 | 120 |
| 441 | 3300049586 | Ga0501070_0806179 | Ga0501070_0806179_30_407 | 120 |
| 442 | 3300049588 | Ga0501072_0589979 | Ga0501072_0589979_419_796 | 120 |
| 443 | 3300049590 | Ga0501074_0026050 | Ga0501074_0026050_1053_1430 | 120 |
| 444 | 3300049742 | Ga0501080_0007063 | Ga0501080_0007063_6301_6678 | 120 |
| 445 | 3300049822 | Ga0501035_0062362 | Ga0501035_0062362_1843_2220 | 120 |
| 446 | 3300049823 | Ga0501044_0005788 | Ga0501044_0005788_12908_13285 | 120 |
| 447 | 3300050493 | nmdc:mga0k408_221211_c1 | nmdc:mga0k408_221211_c1_435_812 | 120 |
| 448 | 3300059624 | Ga0587109_094454 | Ga0587109_094454_284_661 | 120 |
| 449 | 3300059655 | Ga0587114_060338 | Ga0587114_060338_232_609 | 120 |
| 450 | 3300001989 | JGI24739J22299_10012589 | JGI24739J22299_100125893 | 121 |
| 451 | 3300001990 | JGI24737J22298_10004109 | JGI24737J22298_100041093 | 121 |
| 452 | 3300002067 | JGI24735J21928_10037966 | JGI24735J21928_100379662 | 121 |
| 453 | 3300002075 | JGI24738J21930_10009088 | JGI24738J21930_100090882 | 121 |
| 454 | 3300003203 | JGI25406J46586_10054419 | JGI25406J46586_100544193 | 121 |
| 455 | 3300003574 | Ga0007410J51695_1079086 | Ga0007410J51695_10790861 | 121 |
| 456 | 3300003575 | Ga0007409J51694_1095426 | Ga0007409J51694_10954262 | 121 |
| 457 | 3300004785 | Ga0058858_1005032 | Ga0058858_10050322 | 121 |
| 458 | 3300004798 | Ga0058859_11826058 | Ga0058859_118260581 | 121 |
| 459 | 3300004799 | Ga0058863_10169109 | Ga0058863_101691091 | 121 |
| 460 | 3300004799 | Ga0058863_11770428 | Ga0058863_117704282 | 121 |
| 461 | 3300004800 | Ga0058861_10162069 | Ga0058861_101620691 | 121 |
| 462 | 3300004800 | Ga0058861_10186282 | Ga0058861_101862821 | 121 |
| 463 | 3300004800 | Ga0058861_11881892 | Ga0058861_118818921 | 121 |
| 464 | 3300004801 | Ga0058860_10025829 | Ga0058860_100258292 | 121 |
| 465 | 3300004801 | Ga0058860_10028160 | Ga0058860_100281602 | 121 |
| 466 | 3300004801 | Ga0058860_10106898 | Ga0058860_101068981 | 121 |
| 467 | 3300004801 | Ga0058860_10115660 | Ga0058860_101156601 | 121 |
| 468 | 3300004803 | Ga0058862_10191375 | Ga0058862_101913751 | 121 |
| 469 | 3300004803 | Ga0058862_12724420 | Ga0058862_127244201 | 121 |
| 470 | 3300005327 | Ga0070658_10786068 | Ga0070658_107860682 | 121 |
| 471 | 3300005331 | Ga0070670_101097127 | Ga0070670_1010971272 | 121 |
| 472 | 3300005334 | Ga0068869_100940981 | Ga0068869_1009409811 | 121 |
| 473 | 3300005338 | Ga0068868_100702561 | Ga0068868_1007025611 | 121 |
| 474 | 3300005343 | Ga0070687_101127276 | Ga0070687_1011272761 | 121 |
| 475 | 3300005434 | Ga0070709_10111103 | Ga0070709_101111032 | 121 |
| 476 | 3300005435 | Ga0070714_100182078 | Ga0070714_1001820783 | 121 |
| 477 | 3300005436 | Ga0070713_100075640 | Ga0070713_1000756403 | 121 |
| 478 | 3300005437 | Ga0070710_10000334 | Ga0070710_1000033417 | 121 |
| 479 | 3300005439 | Ga0070711_100127812 | Ga0070711_1001278123 | 121 |
| 480 | 3300005539 | Ga0068853_101415438 | Ga0068853_1014154381 | 121 |
| 481 | 3300005547 | Ga0070693_101327412 | Ga0070693_1013274121 | 121 |
| 482 | 3300005614 | Ga0068856_100081044 | Ga0068856_1000810443 | 121 |
| 483 | 3300005617 | Ga0068859_100034160 | Ga0068859_1000341604 | 121 |
| 484 | 3300005617 | Ga0068859_100092242 | Ga0068859_1000922425 | 121 |
| 485 | 3300005841 | Ga0068863_100001338 | Ga0068863_10000133815 | 121 |
| 486 | 3300005842 | Ga0068858_100000010 | Ga0068858_100000010154 | 121 |
| 487 | 3300005842 | Ga0068858_100010928 | Ga0068858_1000109284 | 121 |
| 488 | 3300005844 | Ga0068862_100000362 | Ga0068862_10000036243 | 121 |
| 489 | 3300005937 | Ga0081455_10006542 | Ga0081455_1000654223 | 121 |
| 490 | 3300005983 | Ga0081540_1245936 | Ga0081540_12459362 | 121 |
| 491 | 3300005985 | Ga0081539_10002050 | Ga0081539_100020506 | 121 |
| 492 | 3300005985 | Ga0081539_10021084 | Ga0081539_100210844 | 121 |
| 493 | 3300006042 | Ga0075368_10003605 | Ga0075368_100036056 | 121 |
| 494 | 3300006178 | Ga0075367_10172232 | Ga0075367_101722323 | 121 |
| 495 | 3300006846 | Ga0075430_100325169 | Ga0075430_1003251692 | 121 |
| 496 | 3300006847 | Ga0075431_100246785 | Ga0075431_1002467852 | 121 |
| 497 | 3300006931 | Ga0097620_100034160 | Ga0097620_1000341604 | 121 |
| 498 | 3300006931 | Ga0097620_100092239 | Ga0097620_1000922392 | 121 |
| 499 | 3300006948 | Ga0099826_10027493 | Ga0099826_100274934 | 121 |
| 500 | 3300009036 | Ga0105244_10100475 | Ga0105244_101004752 | 121 |
| 501 | 3300009093 | Ga0105240_10204243 | Ga0105240_102042434 | 121 |
| 502 | 3300009094 | Ga0111539_11717097 | Ga0111539_117170972 | 121 |
| 503 | 3300009101 | Ga0105247_10000016 | Ga0105247_10000016203 | 121 |
| 504 | 3300009101 | Ga0105247_10212251 | Ga0105247_102122513 | 121 |
| 505 | 3300009177 | Ga0105248_10000035 | Ga0105248_10000035124 | 121 |
| 506 | 3300009177 | Ga0105248_10002899 | Ga0105248_100028997 | 121 |
| 507 | 3300009177 | Ga0105248_13437596 | Ga0105248_134375962 | 121 |
| 508 | 3300009553 | Ga0105249_10068762 | Ga0105249_100687624 | 121 |
| 509 | 3300010375 | Ga0105239_11608217 | Ga0105239_116082171 | 121 |
| 510 | 3300010375 | Ga0105239_13205203 | Ga0105239_132052031 | 121 |
| 511 | 3300011119 | Ga0105246_10002569 | Ga0105246_1000256912 | 121 |
| 512 | 3300012490 | Ga0157322_1013348 | Ga0157322_10133481 | 121 |
| 513 | 3300013059 | Ga0154012_109278 | Ga0154012_1092781 | 121 |
| 514 | 3300013062 | Ga0154010_148221 | Ga0154010_1482211 | 121 |
| 515 | 3300013296 | Ga0157374_10520828 | Ga0157374_105208284 | 121 |
| 516 | 3300013308 | Ga0157375_11093622 | Ga0157375_110936223 | 121 |
| 517 | 3300014325 | Ga0163163_10010268 | Ga0163163_100102684 | 121 |
| 518 | 3300014325 | Ga0163163_12067520 | Ga0163163_120675201 | 121 |
| 519 | 3300014497 | Ga0182008_10009535 | Ga0182008_100095356 | 121 |
| 520 | 3300014968 | Ga0157379_10009461 | Ga0157379_100094613 | 121 |
| 521 | 3300014968 | Ga0157379_10101600 | Ga0157379_101016003 | 121 |
| 522 | 3300014968 | Ga0157379_10784670 | Ga0157379_107846702 | 121 |
| 523 | 3300015261 | Ga0182006_1012482 | Ga0182006_10124825 | 121 |
| 524 | 3300015262 | Ga0182007_10010395 | Ga0182007_100103953 | 121 |
| 525 | 3300015688 | Ga0183367_1002 | Ga0183367_1002744 | 121 |
| 526 | 3300020069 | Ga0197907_10071147 | Ga0197907_100711473 | 121 |
| 527 | 3300020069 | Ga0197907_10456483 | Ga0197907_104564835 | 121 |
| 528 | 3300020069 | Ga0197907_10872862 | Ga0197907_108728623 | 121 |
| 529 | 3300020069 | Ga0197907_10874185 | Ga0197907_108741851 | 121 |
| 530 | 3300020069 | Ga0197907_11028216 | Ga0197907_110282162 | 121 |
| 531 | 3300020070 | Ga0206356_10671161 | Ga0206356_106711612 | 121 |
| 532 | 3300020070 | Ga0206356_10797342 | Ga0206356_107973422 | 121 |
| 533 | 3300020070 | Ga0206356_10946215 | Ga0206356_109462154 | 121 |
| 534 | 3300020071 | Ga0206348_113828 | Ga0206348_1138282 | 121 |
| 535 | 3300020075 | Ga0206349_1484921 | Ga0206349_14849213 | 121 |
| 536 | 3300020075 | Ga0206349_1782543 | Ga0206349_17825432 | 121 |
| 537 | 3300020075 | Ga0206349_1815480 | Ga0206349_18154802 | 121 |
| 538 | 3300020076 | Ga0206355_1131249 | Ga0206355_11312493 | 121 |
| 539 | 3300020076 | Ga0206355_1350876 | Ga0206355_13508762 | 121 |
| 540 | 3300020077 | Ga0206351_10013403 | Ga0206351_100134032 | 121 |
| 541 | 3300020077 | Ga0206351_10035715 | Ga0206351_100357152 | 121 |
| 542 | 3300020077 | Ga0206351_10267213 | Ga0206351_102672133 | 121 |
| 543 | 3300020077 | Ga0206351_10945162 | Ga0206351_109451623 | 121 |
| 544 | 3300020078 | Ga0206352_10000892 | Ga0206352_100008923 | 121 |
| 545 | 3300020078 | Ga0206352_10048704 | Ga0206352_100487043 | 121 |
| 546 | 3300020078 | Ga0206352_10486095 | Ga0206352_104860952 | 121 |
| 547 | 3300020078 | Ga0206352_10571914 | Ga0206352_105719142 | 121 |
| 548 | 3300020078 | Ga0206352_10718751 | Ga0206352_107187513 | 121 |
| 549 | 3300020080 | Ga0206350_10201708 | Ga0206350_102017082 | 121 |
| 550 | 3300020080 | Ga0206350_10308689 | Ga0206350_103086893 | 121 |
| 551 | 3300020080 | Ga0206350_10386703 | Ga0206350_103867033 | 121 |
| 552 | 3300020080 | Ga0206350_10762397 | Ga0206350_107623971 | 121 |
| 553 | 3300020080 | Ga0206350_11076420 | Ga0206350_110764201 | 121 |
| 554 | 3300020081 | Ga0206354_10049783 | Ga0206354_100497833 | 121 |
| 555 | 3300020081 | Ga0206354_10458357 | Ga0206354_104583573 | 121 |
| 556 | 3300020081 | Ga0206354_10517799 | Ga0206354_105177993 | 121 |
| 557 | 3300020081 | Ga0206354_11155240 | Ga0206354_111552403 | 121 |
| 558 | 3300020082 | Ga0206353_10186563 | Ga0206353_101865632 | 121 |
| 559 | 3300020082 | Ga0206353_10222344 | Ga0206353_102223445 | 121 |
| 560 | 3300020082 | Ga0206353_11116048 | Ga0206353_111160485 | 121 |
| 561 | 3300020082 | Ga0206353_11628847 | Ga0206353_116288472 | 121 |
| 562 | 3300020610 | Ga0154015_1218295 | Ga0154015_12182953 | 121 |
| 563 | 3300020610 | Ga0154015_1608521 | Ga0154015_16085211 | 121 |
| 564 | 3300022467 | Ga0224712_10000543 | Ga0224712_100005437 | 121 |
| 565 | 3300022467 | Ga0224712_10113455 | Ga0224712_101134551 | 121 |
| 566 | 3300022467 | Ga0224712_10141630 | Ga0224712_101416302 | 121 |
| 567 | 3300022467 | Ga0224712_10182575 | Ga0224712_101825752 | 121 |
| 568 | 3300025728 | Ga0207655_1087485 | Ga0207655_10874852 | 121 |
| 569 | 3300025898 | Ga0207692_10007633 | Ga0207692_100076336 | 121 |
| 570 | 3300025900 | Ga0207710_10000017 | Ga0207710_10000017130 | 121 |
| 571 | 3300025900 | Ga0207710_10000048 | Ga0207710_1000004810 | 121 |
| 572 | 3300025901 | Ga0207688_10972313 | Ga0207688_109723131 | 121 |
| 573 | 3300025904 | Ga0207647_10006322 | Ga0207647_100063224 | 121 |
| 574 | 3300025906 | Ga0207699_10027891 | Ga0207699_100278914 | 121 |
| 575 | 3300025909 | Ga0207705_10989837 | Ga0207705_109898372 | 121 |
| 576 | 3300025913 | Ga0207695_10715601 | Ga0207695_107156012 | 121 |
| 577 | 3300025916 | Ga0207663_10047146 | Ga0207663_100471462 | 121 |
| 578 | 3300025918 | Ga0207662_10975540 | Ga0207662_109755401 | 121 |
| 579 | 3300025921 | Ga0207652_10386953 | Ga0207652_103869532 | 121 |
| 580 | 3300025921 | Ga0207652_11042144 | Ga0207652_110421441 | 121 |
| 581 | 3300025926 | Ga0207659_11303460 | Ga0207659_113034602 | 121 |
| 582 | 3300025928 | Ga0207700_10075738 | Ga0207700_100757383 | 121 |
| 583 | 3300025929 | Ga0207664_10003521 | Ga0207664_1000352113 | 121 |
| 584 | 3300025929 | Ga0207664_10187099 | Ga0207664_101870994 | 121 |
| 585 | 3300025929 | Ga0207664_10823035 | Ga0207664_108230351 | 121 |
| 586 | 3300025933 | Ga0207706_10285731 | Ga0207706_102857313 | 121 |
| 587 | 3300025940 | Ga0207691_10223984 | Ga0207691_102239844 | 121 |
| 588 | 3300025941 | Ga0207711_10000134 | Ga0207711_1000013427 | 121 |
| 589 | 3300025941 | Ga0207711_10002995 | Ga0207711_100029957 | 121 |
| 590 | 3300025945 | Ga0207679_10912924 | Ga0207679_109129242 | 121 |
| 591 | 3300025961 | Ga0207712_10040803 | Ga0207712_100408034 | 121 |
| 592 | 3300025961 | Ga0207712_11405517 | Ga0207712_114055172 | 121 |
| 593 | 3300025981 | Ga0207640_11328698 | Ga0207640_113286981 | 121 |
| 594 | 3300026023 | Ga0207677_11330309 | Ga0207677_113303091 | 121 |
| 595 | 3300026035 | Ga0207703_10000002 | Ga0207703_10000002117 | 121 |
| 596 | 3300026035 | Ga0207703_10003502 | Ga0207703_100035027 | 121 |
| 597 | 3300026041 | Ga0207639_11335699 | Ga0207639_113356991 | 121 |
| 598 | 3300026078 | Ga0207702_10123630 | Ga0207702_101236302 | 121 |
| 599 | 3300026078 | Ga0207702_10204359 | Ga0207702_102043594 | 121 |
| 600 | 3300026078 | Ga0207702_10547570 | Ga0207702_105475702 | 121 |
| 601 | 3300026088 | Ga0207641_10002679 | Ga0207641_100026797 | 121 |
| 602 | 3300026116 | Ga0207674_10226074 | Ga0207674_102260743 | 121 |
| 603 | 3300027312 | Ga0209371_1016429 | Ga0209371_10164294 | 121 |
| 604 | 3300027866 | Ga0209813_10004425 | Ga0209813_100044253 | 121 |
| 605 | 3300028380 | Ga0268265_10000363 | Ga0268265_1000036340 | 121 |
| 606 | 3300028573 | Ga0265334_10003386 | Ga0265334_100033864 | 121 |
| 607 | 3300029282 | Ga0311003_147053 | Ga0311003_1470532 | 121 |
| 608 | 3300029285 | Ga0310981_1041238 | Ga0310981_10412381 | 121 |
| 609 | 3300030500 | Ga0268256_1015007 | Ga0268256_10150073 | 121 |
| 610 | 3300030521 | Ga0307511_10100912 | Ga0307511_101009123 | 121 |
| 611 | 3300030731 | Ga0316177_1047979 | Ga0316177_10479795 | 121 |
| 612 | 3300030732 | Ga0316176_1038867 | Ga0316176_10388673 | 121 |
| 613 | 3300030733 | Ga0314311_1019554 | Ga0314311_10195543 | 121 |
| 614 | 3300030733 | Ga0314311_1063336 | Ga0314311_10633361 | 121 |
| 615 | 3300030734 | Ga0316179_1032206 | Ga0316179_10322063 | 121 |
| 616 | 3300030735 | Ga0316178_1099044 | Ga0316178_10990442 | 121 |
| 617 | 3300030736 | Ga0316180_1042781 | Ga0316180_10427813 | 121 |
| 618 | 3300030744 | Ga0316181_1204309 | Ga0316181_12043092 | 121 |
| 619 | 3300030744 | Ga0316181_1229376 | Ga0316181_12293761 | 121 |
| 620 | 3300030745 | Ga0316182_1033344 | Ga0316182_10333442 | 121 |
| 621 | 3300030863 | Ga0265766_1000574 | Ga0265766_10005742 | 121 |
| 622 | 3300030963 | Ga0265768_108547 | Ga0265768_1085471 | 121 |
| 623 | 3300031241 | Ga0265325_10040754 | Ga0265325_100407544 | 121 |
| 624 | 3300031247 | Ga0265340_10007092 | Ga0265340_100070928 | 121 |
| 625 | 3300031247 | Ga0265340_10074702 | Ga0265340_100747023 | 121 |
| 626 | 3300031249 | Ga0265339_10047818 | Ga0265339_100478184 | 121 |
| 627 | 3300031344 | Ga0265316_10124459 | Ga0265316_101244592 | 121 |
| 628 | 3300031507 | Ga0307509_10009247 | Ga0307509_1000924716 | 121 |
| 629 | 3300031548 | Ga0307408_102136462 | Ga0307408_1021364621 | 121 |
| 630 | 3300031592 | Ga0310117_105392 | Ga0310117_1053923 | 121 |
| 631 | 3300031614 | Ga0310103_131967 | Ga0310103_1319671 | 121 |
| 632 | 3300031616 | Ga0307508_10031723 | Ga0307508_100317237 | 121 |
| 633 | 3300031616 | Ga0307508_10066550 | Ga0307508_100665505 | 121 |
| 634 | 3300031649 | Ga0307514_10117565 | Ga0307514_101175653 | 121 |
| 635 | 3300031667 | Ga0310111_106844 | Ga0310111_1068442 | 121 |
| 636 | 3300031691 | Ga0316579_10000038 | Ga0316579_1000003830 | 121 |
| 637 | 3300031712 | Ga0265342_10057885 | Ga0265342_100578854 | 121 |
| 638 | 3300031730 | Ga0307516_10034474 | Ga0307516_100344742 | 121 |
| 639 | 3300031731 | Ga0307405_10476937 | Ga0307405_104769372 | 121 |
| 640 | 3300031731 | Ga0307405_10517444 | Ga0307405_105174441 | 121 |
| 641 | 3300031824 | Ga0307413_10556118 | Ga0307413_105561181 | 121 |
| 642 | 3300031824 | Ga0307413_11065620 | Ga0307413_110656202 | 121 |
| 643 | 3300031824 | Ga0307413_11171584 | Ga0307413_111715841 | 121 |
| 644 | 3300031852 | Ga0307410_10137079 | Ga0307410_101370792 | 121 |
| 645 | 3300031901 | Ga0307406_10004670 | Ga0307406_100046709 | 121 |
| 646 | 3300031901 | Ga0307406_10465426 | Ga0307406_104654263 | 121 |
| 647 | 3300031901 | Ga0307406_10754113 | Ga0307406_107541132 | 121 |
| 648 | 3300031901 | Ga0307406_11264342 | Ga0307406_112643421 | 121 |
| 649 | 3300031901 | Ga0307406_11729656 | Ga0307406_117296561 | 121 |
| 650 | 3300031901 | Ga0307406_11867102 | Ga0307406_118671021 | 121 |
| 651 | 3300031903 | Ga0307407_10029824 | Ga0307407_100298243 | 121 |
| 652 | 3300031903 | Ga0307407_10199153 | Ga0307407_101991532 | 121 |
| 653 | 3300031995 | Ga0307409_100330395 | Ga0307409_1003303952 | 121 |
| 654 | 3300031995 | Ga0307409_100399841 | Ga0307409_1003998412 | 121 |
| 655 | 3300031995 | Ga0307409_100416549 | Ga0307409_1004165492 | 121 |
| 656 | 3300031995 | Ga0307409_101081770 | Ga0307409_1010817702 | 121 |
| 657 | 3300031995 | Ga0307409_102410040 | Ga0307409_1024100401 | 121 |
| 658 | 3300032002 | Ga0307416_100124216 | Ga0307416_1001242163 | 121 |
| 659 | 3300032002 | Ga0307416_100721571 | Ga0307416_1007215712 | 121 |
| 660 | 3300032004 | Ga0307414_10423502 | Ga0307414_104235023 | 121 |
| 661 | 3300032005 | Ga0307411_10148286 | Ga0307411_101482864 | 121 |
| 662 | 3300032005 | Ga0307411_10283867 | Ga0307411_102838672 | 121 |
| 663 | 3300032126 | Ga0307415_100029200 | Ga0307415_1000292007 | 121 |
| 664 | 3300032126 | Ga0307415_100591499 | Ga0307415_1005914991 | 121 |
| 665 | 3300032126 | Ga0307415_101146559 | Ga0307415_1011465591 | 121 |
| 666 | 3300033179 | Ga0307507_10003799 | Ga0307507_100037995 | 121 |
| 667 | 3300033180 | Ga0307510_10229710 | Ga0307510_102297103 | 121 |
| 668 | 3300037312 | Ga0395899_0008026 | Ga0395899_0008026_3951_4331 | 121 |
| 669 | 3300037418 | Ga0395900_0199314 | Ga0395900_0199314_1187_1567 | 121 |
| 670 | 3300037466 | Ga0395898_0026184 | Ga0395898_0026184_4602_4982 | 121 |
| 671 | 3300037466 | Ga0395898_0030243 | Ga0395898_0030243_4338_4718 | 121 |
| 672 | 3300038443 | Ga0395901_0031729 | Ga0395901_0031729_4589_4969 | 121 |
| 673 | 3300038735 | Ga0400485_08169 | Ga0400485_08169_21194_21574 | 121 |
| 674 | 3300038742 | Ga0400486_03564 | Ga0400486_03564_21184_21564 | 121 |
| 675 | 3300039437 | Ga0436365_0340703 | Ga0436365_0340703_988_1368 | 121 |
| 676 | 3300039450 | Ga0436363_0020748 | Ga0436363_0020748_120_500 | 121 |
| 677 | 3300041404 | Ga0439436_0003559 | Ga0439436_0003559_3241_3621 | 121 |
| 678 | 3300041404 | Ga0439436_0029047 | Ga0439436_0029047_900_1280 | 121 |
| 679 | 3300041406 | Ga0439439_0004725 | Ga0439439_0004725_1061_1441 | 121 |
| 680 | 3300041408 | Ga0439453_0083764 | Ga0439453_0083764_16_396 | 121 |
| 681 | 3300041410 | Ga0439461_0044338 | Ga0439461_0044338_301_681 | 121 |
| 682 | 3300041413 | Ga0439465_0069611 | Ga0439465_0069611_189_569 | 121 |
| 683 | 3300041455 | Ga0451801_20119 | Ga0451801_20119_41_421 | 121 |
| 684 | 3300041997 | Ga0439431_0105579 | Ga0439431_0105579_190_570 | 121 |
| 685 | 3300041999 | Ga0439433_0002570 | Ga0439433_0002570_3283_3663 | 121 |
| 686 | 3300041999 | Ga0439433_0005893 | Ga0439433_0005893_1836_2216 | 121 |
| 687 | 3300042002 | Ga0439442_049219 | Ga0439442_049219_302_682 | 121 |
| 688 | 3300042007 | Ga0439449_0009099 | Ga0439449_0009099_1047_1427 | 121 |
| 689 | 3300042007 | Ga0439449_0011760 | Ga0439449_0011760_700_1080 | 121 |
| 690 | 3300042008 | Ga0439450_071020 | Ga0439450_071020_408_788 | 121 |
| 691 | 3300042011 | Ga0439454_012822 | Ga0439454_012822_431_811 | 121 |
| 692 | 3300042012 | Ga0439455_0001031 | Ga0439455_0001031_2717_3097 | 121 |
| 693 | 3300042014 | Ga0439457_002785 | Ga0439457_002785_3645_4025 | 121 |
| 694 | 3300042014 | Ga0439457_068365 | Ga0439457_068365_171_551 | 121 |
| 695 | 3300042015 | Ga0439462_0000539 | Ga0439462_0000539_927_1307 | 121 |
| 696 | 3300042127 | Ga0450890_006468 | Ga0450890_006468_792_1172 | 121 |
| 697 | 3300042131 | Ga0450894_015795 | Ga0450894_015795_292_672 | 121 |
| 698 | 3300042135 | Ga0450899_001611 | Ga0450899_001611_1200_1580 | 121 |
| 699 | 3300042136 | Ga0450900_015844 | Ga0450900_015844_464_844 | 121 |
| 700 | 3300042138 | Ga0450903_000013 | Ga0450903_000013_12054_12434 | 121 |
| 701 | 3300042138 | Ga0450903_047020 | Ga0450903_047020_66_446 | 121 |
| 702 | 3300042157 | Ga0439458_0000117 | Ga0439458_0000117_10314_10694 | 121 |
| 703 | 3300042157 | Ga0439458_0039956 | Ga0439458_0039956_399_779 | 121 |
| 704 | 3300042157 | Ga0439458_0083099 | Ga0439458_0083099_140_520 | 121 |
| 705 | 3300042435 | Ga0439434_0091373 | Ga0439434_0091373_396_776 | 121 |
| 706 | 3300042435 | Ga0439434_0154515 | Ga0439434_0154515_322_702 | 121 |
| 707 | 3300044656 | Ga0466969_0024483 | Ga0466969_0024483_1142_1567 | 121 |
| 708 | 3300044656 | Ga0466969_0035870 | Ga0466969_0035870_2054_2434 | 121 |
| 709 | 3300044656 | Ga0466969_0096611 | Ga0466969_0096611_1003_1383 | 121 |
| 710 | 3300044658 | Ga0466972_0004874 | Ga0466972_0004874_1911_2291 | 121 |
| 711 | 3300044658 | Ga0466972_0156714 | Ga0466972_0156714_375_755 | 121 |
| 712 | 3300044658 | Ga0466972_0272087 | Ga0466972_0272087_126_506 | 121 |
| 713 | 3300044683 | Ga0466965_0011265 | Ga0466965_0011265_567_947 | 121 |
| 714 | 3300044684 | Ga0466966_0004478 | Ga0466966_0004478_4960_5340 | 121 |
| 715 | 3300044684 | Ga0466966_0025877 | Ga0466966_0025877_1537_1962 | 121 |
| 716 | 3300044684 | Ga0466966_0038688 | Ga0466966_0038688_1082_1462 | 121 |
| 717 | 3300044693 | Ga0466961_0004915 | Ga0466961_0004915_4794_5174 | 121 |
| 718 | 3300044693 | Ga0466961_0007268 | Ga0466961_0007268_4334_4714 | 121 |
| 719 | 3300044693 | Ga0466961_0139137 | Ga0466961_0139137_307_732 | 121 |
| 720 | 3300044693 | Ga0466961_0424699 | Ga0466961_0424699_286_666 | 121 |
| 721 | 3300044693 | Ga0466961_0970695 | Ga0466961_0970695_107_487 | 121 |
| 722 | 3300044694 | Ga0466963_0097420 | Ga0466963_0097420_1001_1381 | 121 |
| 723 | 3300044694 | Ga0466963_0359955 | Ga0466963_0359955_457_837 | 121 |
| 724 | 3300044694 | Ga0466963_0464430 | Ga0466963_0464430_157_537 | 121 |
| 725 | 3300044694 | Ga0466963_1046536 | Ga0466963_1046536_149_529 | 121 |
| 726 | 3300044706 | Ga0466964_0062147 | Ga0466964_0062147_347_727 | 121 |
| 727 | 3300044706 | Ga0466964_0390469 | Ga0466964_0390469_184_564 | 121 |
| 728 | 3300044719 | Ga0466971_0000019 | Ga0466971_0000019_8545_8925 | 121 |
| 729 | 3300044719 | Ga0466971_0007920 | Ga0466971_0007920_4002_4382 | 121 |
| 730 | 3300044719 | Ga0466971_0113681 | Ga0466971_0113681_47_472 | 121 |
| 731 | 3300044719 | Ga0466971_0365821 | Ga0466971_0365821_110_490 | 121 |
| 732 | 3300044735 | Ga0466968_0030937 | Ga0466968_0030937_685_1065 | 121 |
| 733 | 3300044735 | Ga0466968_0106395 | Ga0466968_0106395_52_432 | 121 |
| 734 | 3300044735 | Ga0466968_0359593 | Ga0466968_0359593_92_472 | 121 |
| 735 | 3300044765 | Ga0466970_0039008 | Ga0466970_0039008_295_720 | 121 |
| 736 | 3300044765 | Ga0466970_0067568 | Ga0466970_0067568_1051_1431 | 121 |
| 737 | 3300044765 | Ga0466970_0158678 | Ga0466970_0158678_492_872 | 121 |
| 738 | 3300044842 | Ga0466957_0015619 | Ga0466957_0015619_3863_4243 | 121 |
| 739 | 3300044842 | Ga0466957_0045585 | Ga0466957_0045585_576_956 | 121 |
| 740 | 3300044842 | Ga0466957_0859709 | Ga0466957_0859709_117_497 | 121 |
| 741 | 3300044842 | Ga0466957_1269351 | Ga0466957_1269351_95_475 | 121 |
| 742 | 3300044901 | Ga0466960_0005266 | Ga0466960_0005266_349_729 | 121 |
| 743 | 3300044901 | Ga0466960_0066960 | Ga0466960_0066960_1082_1462 | 121 |
| 744 | 3300044901 | Ga0466960_0103264 | Ga0466960_0103264_850_1230 | 121 |
| 745 | 3300044901 | Ga0466960_0294693 | Ga0466960_0294693_57_437 | 121 |
| 746 | 3300044901 | Ga0466960_0800708 | Ga0466960_0800708_171_551 | 121 |
| 747 | 3300044901 | Ga0466960_0880139 | Ga0466960_0880139_43_423 | 121 |
| 748 | 3300045049 | Ga0466959_0004638 | Ga0466959_0004638_6676_7056 | 121 |
| 749 | 3300045049 | Ga0466959_0048320 | Ga0466959_0048320_596_1021 | 121 |
| 750 | 3300045049 | Ga0466959_0064455 | Ga0466959_0064455_1991_2371 | 121 |
| 751 | 3300045049 | Ga0466959_0274074 | Ga0466959_0274074_744_1124 | 121 |
| 752 | 3300045049 | Ga0466959_0293401 | Ga0466959_0293401_76_456 | 121 |
| 753 | 3300045049 | Ga0466959_0937830 | Ga0466959_0937830_94_474 | 121 |
| 754 | 3300045836 | Ga0466958_0000701 | Ga0466958_0000701_3875_4255 | 121 |
| 755 | 3300045836 | Ga0466958_0054273 | Ga0466958_0054273_1593_1973 | 121 |
| 756 | 3300045836 | Ga0466958_0275195 | Ga0466958_0275195_373_753 | 121 |
| 757 | 3300045976 | Ga0466967_0215478 | Ga0466967_0215478_337_717 | 121 |
| 758 | 3300045976 | Ga0466967_0308089 | Ga0466967_0308089_202_582 | 121 |
| 759 | 3300045976 | Ga0466967_0984587 | Ga0466967_0984587_27_407 | 121 |
| 760 | 3300045976 | Ga0466967_1447019 | Ga0466967_1447019_68_448 | 121 |
| 761 | 3300045976 | Ga0466967_1623790 | Ga0466967_1623790_246_626 | 121 |
| 762 | 3300046454 | Ga0495592_0052602 | Ga0495592_0052602_2478_2858 | 121 |
| 763 | 3300046460 | Ga0495638_0024349 | Ga0495638_0024349_1664_2044 | 121 |
| 764 | 3300046462 | Ga0495651_0000169 | Ga0495651_0000169_33858_34238 | 121 |
| 765 | 3300046477 | Ga0495664_0245293 | Ga0495664_0245293_464_844 | 121 |
| 766 | 3300046491 | Ga0495584_0346047 | Ga0495584_0346047_215_595 | 121 |
| 767 | 3300046514 | Ga0495618_0347589 | Ga0495618_0347589_180_560 | 121 |
| 768 | 3300046516 | Ga0495628_0403214 | Ga0495628_0403214_164_544 | 121 |
| 769 | 3300046522 | Ga0495643_0000013 | Ga0495643_0000013_64169_64549 | 121 |
| 770 | 3300046529 | Ga0495652_0000728 | Ga0495652_0000728_36133_36513 | 121 |
| 771 | 3300046533 | Ga0495640_0237058 | Ga0495640_0237058_218_598 | 121 |
| 772 | 3300046543 | Ga0495645_0052372 | Ga0495645_0052372_1046_1426 | 121 |
| 773 | 3300046558 | Ga0495633_0327938 | Ga0495633_0327938_147_527 | 121 |
| 774 | 3300046664 | Ga0495659_0095751 | Ga0495659_0095751_603_983 | 121 |
| 775 | 3300046678 | Ga0495599_0076762 | Ga0495599_0076762_1238_1618 | 121 |
| 776 | 3300046679 | Ga0495623_0012719 | Ga0495623_0012719_4561_4941 | 121 |
| 777 | 3300046680 | Ga0495646_0021225 | Ga0495646_0021225_2034_2414 | 121 |
| 778 | 3300046694 | Ga0495649_0097685 | Ga0495649_0097685_788_1168 | 121 |
| 779 | 3300046809 | Ga0495600_0008026 | Ga0495600_0008026_3815_4195 | 121 |
| 780 | 3300047319 | Ga0495674_0335241 | Ga0495674_0335241_621_1001 | 121 |
| 781 | 3300048904 | Ga0496101_1096877 | Ga0496101_1096877_226_606 | 121 |
| 782 | 3300048905 | Ga0496102_1208301 | Ga0496102_1208301_107_487 | 121 |
| 783 | 3300048906 | Ga0496103_0690213 | Ga0496103_0690213_233_613 | 121 |
| 784 | 3300048907 | Ga0496104_0463699 | Ga0496104_0463699_700_1080 | 121 |
| 785 | 3300048907 | Ga0496104_1149751 | Ga0496104_1149751_280_660 | 121 |
| 786 | 3300048907 | Ga0496104_1528605 | Ga0496104_1528605_115_495 | 121 |
| 787 | 3300048907 | Ga0496104_1723267 | Ga0496104_1723267_128_508 | 121 |
| 788 | 3300048908 | Ga0496105_0791532 | Ga0496105_0791532_302_682 | 121 |
| 789 | 3300048908 | Ga0496105_0805483 | Ga0496105_0805483_58_438 | 121 |
| 790 | 3300048910 | Ga0496107_0126090 | Ga0496107_0126090_441_821 | 121 |
| 791 | 3300048911 | Ga0496108_0446455 | Ga0496108_0446455_427_807 | 121 |
| 792 | 3300048916 | Ga0496113_0639166 | Ga0496113_0639166_155_535 | 121 |
| 793 | 3300048919 | Ga0496116_0001739 | Ga0496116_0001739_1307_1687 | 121 |
| 794 | 3300048920 | Ga0496117_0027016 | Ga0496117_0027016_1048_1428 | 121 |
| 795 | 3300048921 | Ga0496118_0040681 | Ga0496118_0040681_1141_1521 | 121 |
| 796 | 3300048921 | Ga0496118_0046572 | Ga0496118_0046572_2752_3132 | 121 |
| 797 | 3300048921 | Ga0496118_0104172 | Ga0496118_0104172_332_712 | 121 |
| 798 | 3300048922 | Ga0496119_0000855 | Ga0496119_0000855_26461_26841 | 121 |
| 799 | 3300048922 | Ga0496119_0014521 | Ga0496119_0014521_1189_1569 | 121 |
| 800 | 3300048922 | Ga0496119_0020106 | Ga0496119_0020106_2906_3286 | 121 |
| 801 | 3300048923 | Ga0496120_0000372 | Ga0496120_0000372_56902_57282 | 121 |
| 802 | 3300048923 | Ga0496120_0219854 | Ga0496120_0219854_306_686 | 121 |
| 803 | 3300048924 | Ga0496121_0013339 | Ga0496121_0013339_5403_5783 | 121 |
| 804 | 3300048924 | Ga0496121_0048393 | Ga0496121_0048393_1493_1873 | 121 |
| 805 | 3300049127 | Ga0501306_002479 | Ga0501306_002479_615_995 | 121 |
| 806 | 3300049127 | Ga0501306_037217 | Ga0501306_037217_30_410 | 121 |
| 807 | 3300049127 | Ga0501306_041690 | Ga0501306_041690_289_669 | 121 |
| 808 | 3300049128 | Ga0501308_014057 | Ga0501308_014057_28_408 | 121 |
| 809 | 3300049129 | Ga0501309_001533 | Ga0501309_001533_323_703 | 121 |
| 810 | 3300049130 | Ga0501310_015292 | Ga0501310_015292_311_691 | 121 |
| 811 | 3300049130 | Ga0501310_023831 | Ga0501310_023831_301_681 | 121 |
| 812 | 3300049160 | Ga0501304_019525 | Ga0501304_019525_146_526 | 121 |
| 813 | 3300049161 | Ga0501305_009204 | Ga0501305_009204_880_1260 | 121 |
| 814 | 3300049161 | Ga0501305_015320 | Ga0501305_015320_237_617 | 121 |
| 815 | 3300049161 | Ga0501305_025799 | Ga0501305_025799_212_592 | 121 |
| 816 | 3300049162 | Ga0501307_005481 | Ga0501307_005481_692_1072 | 121 |
| 817 | 3300049162 | Ga0501307_009579 | Ga0501307_009579_525_905 | 121 |
| 818 | 3300049527 | Ga0501311_029531 | Ga0501311_029531_97_477 | 121 |
| 819 | 3300049528 | Ga0501312_001837 | Ga0501312_001837_1767_2147 | 121 |
| 820 | 3300049530 | Ga0501314_005184 | Ga0501314_005184_54_434 | 121 |
| 821 | 3300049531 | Ga0501315_014041 | Ga0501315_014041_327_707 | 121 |
| 822 | 3300049531 | Ga0501315_021352 | Ga0501315_021352_342_722 | 121 |
| 823 | 3300049531 | Ga0501315_081123 | Ga0501315_081123_18_398 | 121 |
| 824 | 3300049532 | Ga0501316_038014 | Ga0501316_038014_40_420 | 121 |
| 825 | 3300049532 | Ga0501316_075151 | Ga0501316_075151_78_458 | 121 |
| 826 | 3300049533 | Ga0501317_015074 | Ga0501317_015074_315_695 | 121 |
| 827 | 3300049533 | Ga0501317_017825 | Ga0501317_017825_323_703 | 121 |
| 828 | 3300049534 | Ga0501318_029316 | Ga0501318_029316_25_405 | 121 |
| 829 | 3300049534 | Ga0501318_049585 | Ga0501318_049585_94_474 | 121 |
| 830 | 3300049536 | Ga0501320_000186 | Ga0501320_000186_782_1162 | 121 |
| 831 | 3300049536 | Ga0501320_004388 | Ga0501320_004388_214_594 | 121 |
| 832 | 3300049537 | Ga0501321_002301 | Ga0501321_002301_869_1249 | 121 |
| 833 | 3300049537 | Ga0501321_028860 | Ga0501321_028860_147_527 | 121 |
| 834 | 3300049538 | Ga0501322_002966 | Ga0501322_002966_20_400 | 121 |
| 835 | 3300049539 | Ga0501323_010056 | Ga0501323_010056_390_770 | 121 |
| 836 | 3300049539 | Ga0501323_017099 | Ga0501323_017099_295_675 | 121 |
| 837 | 3300049539 | Ga0501323_026907 | Ga0501323_026907_342_722 | 121 |
| 838 | 3300049540 | Ga0501324_001843 | Ga0501324_001843_302_682 | 121 |
| 839 | 3300049540 | Ga0501324_003168 | Ga0501324_003168_186_566 | 121 |
| 840 | 3300049540 | Ga0501324_011359 | Ga0501324_011359_186_566 | 121 |
| 841 | 3300049540 | Ga0501324_017437 | Ga0501324_017437_316_696 | 121 |
| 842 | 3300049568 | Ga0501031_0010894 | Ga0501031_0010894_4908_5288 | 121 |
| 843 | 3300049568 | Ga0501031_0213047 | Ga0501031_0213047_681_1061 | 121 |
| 844 | 3300049569 | Ga0501032_0001347 | Ga0501032_0001347_15244_15624 | 121 |
| 845 | 3300049569 | Ga0501032_0021244 | Ga0501032_0021244_187_567 | 121 |
| 846 | 3300049569 | Ga0501032_0194673 | Ga0501032_0194673_447_827 | 121 |
| 847 | 3300049570 | Ga0501033_0053340 | Ga0501033_0053340_2184_2564 | 121 |
| 848 | 3300049570 | Ga0501033_0055262 | Ga0501033_0055262_953_1333 | 121 |
| 849 | 3300049570 | Ga0501033_0157907 | Ga0501033_0157907_495_875 | 121 |
| 850 | 3300049571 | Ga0501034_0011858 | Ga0501034_0011858_4734_5114 | 121 |
| 851 | 3300049571 | Ga0501034_0017758 | Ga0501034_0017758_6186_6566 | 121 |
| 852 | 3300049571 | Ga0501034_0147492 | Ga0501034_0147492_598_978 | 121 |
| 853 | 3300049571 | Ga0501034_0154851 | Ga0501034_0154851_1291_1671 | 121 |
| 854 | 3300049572 | Ga0501036_0005851 | Ga0501036_0005851_1381_1761 | 121 |
| 855 | 3300049572 | Ga0501036_0012989 | Ga0501036_0012989_4734_5114 | 121 |
| 856 | 3300049572 | Ga0501036_0034382 | Ga0501036_0034382_3161_3541 | 121 |
| 857 | 3300049573 | Ga0501037_0018283 | Ga0501037_0018283_3891_4271 | 121 |
| 858 | 3300049573 | Ga0501037_0064068 | Ga0501037_0064068_808_1188 | 121 |
| 859 | 3300049574 | Ga0501038_0008698 | Ga0501038_0008698_3910_4290 | 121 |
| 860 | 3300049574 | Ga0501038_0163095 | Ga0501038_0163095_458_838 | 121 |
| 861 | 3300049575 | Ga0501039_0015102 | Ga0501039_0015102_3169_3549 | 121 |
| 862 | 3300049575 | Ga0501039_0023714 | Ga0501039_0023714_966_1346 | 121 |
| 863 | 3300049575 | Ga0501039_0584517 | Ga0501039_0584517_231_611 | 121 |
| 864 | 3300049575 | Ga0501039_0768942 | Ga0501039_0768942_32_412 | 121 |
| 865 | 3300049576 | Ga0501040_0008475 | Ga0501040_0008475_2184_2564 | 121 |
| 866 | 3300049577 | Ga0501041_0009850 | Ga0501041_0009850_4099_4479 | 121 |
| 867 | 3300049577 | Ga0501041_0518724 | Ga0501041_0518724_92_472 | 121 |
| 868 | 3300049578 | Ga0501042_0021020 | Ga0501042_0021020_3927_4307 | 121 |
| 869 | 3300049578 | Ga0501042_0037805 | Ga0501042_0037805_2261_2641 | 121 |
| 870 | 3300049578 | Ga0501042_0320729 | Ga0501042_0320729_206_586 | 121 |
| 871 | 3300049579 | Ga0501043_0005651 | Ga0501043_0005651_4912_5292 | 121 |
| 872 | 3300049579 | Ga0501043_0178224 | Ga0501043_0178224_732_1112 | 121 |
| 873 | 3300049579 | Ga0501043_1100598 | Ga0501043_1100598_25_405 | 121 |
| 874 | 3300049580 | Ga0501046_0002011 | Ga0501046_0002011_13967_14347 | 121 |
| 875 | 3300049580 | Ga0501046_0124048 | Ga0501046_0124048_839_1219 | 121 |
| 876 | 3300049581 | Ga0501047_0000005 | Ga0501047_0000005_5108_5488 | 121 |
| 877 | 3300049581 | Ga0501047_0000278 | Ga0501047_0000278_42582_42962 | 121 |
| 878 | 3300049581 | Ga0501047_0004445 | Ga0501047_0004445_7762_8142 | 121 |
| 879 | 3300049581 | Ga0501047_0281796 | Ga0501047_0281796_581_961 | 121 |
| 880 | 3300049581 | Ga0501047_0284524 | Ga0501047_0284524_418_798 | 121 |
| 881 | 3300049582 | Ga0501048_0001026 | Ga0501048_0001026_16269_16649 | 121 |
| 882 | 3300049582 | Ga0501048_0120527 | Ga0501048_0120527_598_978 | 121 |
| 883 | 3300049582 | Ga0501048_0681329 | Ga0501048_0681329_124_504 | 121 |
| 884 | 3300049583 | Ga0501067_0000592 | Ga0501067_0000592_15015_15395 | 121 |
| 885 | 3300049583 | Ga0501067_0431140 | Ga0501067_0431140_215_595 | 121 |
| 886 | 3300049584 | Ga0501068_0001668 | Ga0501068_0001668_4866_5246 | 121 |
| 887 | 3300049584 | Ga0501068_0124538 | Ga0501068_0124538_566_946 | 121 |
| 888 | 3300049585 | Ga0501069_0003831 | Ga0501069_0003831_3274_3654 | 121 |
| 889 | 3300049586 | Ga0501070_0000089 | Ga0501070_0000089_61904_62284 | 121 |
| 890 | 3300049586 | Ga0501070_0021842 | Ga0501070_0021842_894_1274 | 121 |
| 891 | 3300049586 | Ga0501070_0162235 | Ga0501070_0162235_558_938 | 121 |
| 892 | 3300049586 | Ga0501070_0425216 | Ga0501070_0425216_405_785 | 121 |
| 893 | 3300049587 | Ga0501071_0008674 | Ga0501071_0008674_894_1274 | 121 |
| 894 | 3300049587 | Ga0501071_0011550 | Ga0501071_0011550_645_1025 | 121 |
| 895 | 3300049587 | Ga0501071_0718294 | Ga0501071_0718294_65_445 | 121 |
| 896 | 3300049588 | Ga0501072_0001152 | Ga0501072_0001152_15248_15628 | 121 |
| 897 | 3300049588 | Ga0501072_0609189 | Ga0501072_0609189_45_425 | 121 |
| 898 | 3300049589 | Ga0501073_0078941 | Ga0501073_0078941_1801_2181 | 121 |
| 899 | 3300049590 | Ga0501074_0005219 | Ga0501074_0005219_781_1161 | 121 |
| 900 | 3300049590 | Ga0501074_0011734 | Ga0501074_0011734_3390_3770 | 121 |
| 901 | 3300049590 | Ga0501074_0507749 | Ga0501074_0507749_70_450 | 121 |
| 902 | 3300049591 | Ga0501075_1549946 | Ga0501075_1549946_40_420 | 121 |
| 903 | 3300049592 | Ga0501076_0051723 | Ga0501076_0051723_2573_2953 | 121 |
| 904 | 3300049593 | Ga0501077_0087819 | Ga0501077_0087819_856_1236 | 121 |
| 905 | 3300049680 | Ga0501250_032907 | Ga0501250_032907_106_486 | 121 |
| 906 | 3300049741 | Ga0501079_0023462 | Ga0501079_0023462_4116_4496 | 121 |
| 907 | 3300049741 | Ga0501079_0285006 | Ga0501079_0285006_843_1223 | 121 |
| 908 | 3300049742 | Ga0501080_0002681 | Ga0501080_0002681_255_635 | 121 |
| 909 | 3300049742 | Ga0501080_0004649 | Ga0501080_0004649_635_1015 | 121 |
| 910 | 3300049742 | Ga0501080_0094218 | Ga0501080_0094218_1970_2350 | 121 |
| 911 | 3300049742 | Ga0501080_0364990 | Ga0501080_0364990_706_1086 | 121 |
| 912 | 3300049743 | Ga0501081_0361548 | Ga0501081_0361548_589_969 | 121 |
| 913 | 3300049744 | Ga0501083_0004200 | Ga0501083_0004200_1830_2210 | 121 |
| 914 | 3300049822 | Ga0501035_0042008 | Ga0501035_0042008_472_852 | 121 |
| 915 | 3300049822 | Ga0501035_0045844 | Ga0501035_0045844_1332_1712 | 121 |
| 916 | 3300049822 | Ga0501035_0145280 | Ga0501035_0145280_597_977 | 121 |
| 917 | 3300049822 | Ga0501035_0500276 | Ga0501035_0500276_443_823 | 121 |
| 918 | 3300049823 | Ga0501044_0013601 | Ga0501044_0013601_4519_4899 | 121 |
| 919 | 3300049823 | Ga0501044_0064165 | Ga0501044_0064165_2925_3305 | 121 |
| 920 | 3300049823 | Ga0501044_1198351 | Ga0501044_1198351_17_397 | 121 |
| 921 | 3300049823 | Ga0501044_1642641 | Ga0501044_1642641_38_418 | 121 |
| 922 | 3300049824 | Ga0501045_0079425 | Ga0501045_0079425_1929_2309 | 121 |
| 923 | 3300049824 | Ga0501045_0282589 | Ga0501045_0282589_365_745 | 121 |
| 924 | 3300050494 | nmdc:mga06z11_27935_c1 | nmdc:mga06z11_27935_c1_1134_1514 | 121 |
| 925 | 3300050495 | nmdc:mga04h51_1822_c1 | nmdc:mga04h51_1822_c1_1172_1552 | 121 |
| 926 | 3300050508 | nmdc:mga09592_535318_c1 | nmdc:mga09592_535318_c1_51_431 | 121 |
| 927 | 3300050509 | nmdc:mga0qj67_248168_c1 | nmdc:mga0qj67_248168_c1_553_933 | 121 |
| 928 | 3300050510 | nmdc:mga06r32_228853_c1 | nmdc:mga06r32_228853_c1_1147_1527 | 121 |
| 929 | 3300050510 | nmdc:mga06r32_328695_c1 | nmdc:mga06r32_328695_c1_1070_1450 | 121 |
| 930 | 3300053077 | Ga0495601_0097418 | Ga0495601_0097418_1305_1685 | 121 |
| 931 | 3300053078 | Ga0495612_0003894 | Ga0495612_0003894_2971_3351 | 121 |
| 932 | 3300053083 | Ga0495655_0097352 | Ga0495655_0097352_282_662 | 121 |
| 933 | 3300053083 | Ga0495655_0303268 | Ga0495655_0303268_151_531 | 121 |
| 934 | 3300053085 | Ga0495619_0044831 | Ga0495619_0044831_2185_2565 | 121 |
| 935 | 3300053085 | Ga0495619_0382459 | Ga0495619_0382459_168_548 | 121 |
| 936 | 3300053092 | Ga0500583_0062555 | Ga0500583_0062555_219_599 | 121 |
| 937 | 3300053153 | Ga0500616_0063036 | Ga0500616_0063036_630_1010 | 121 |
| 938 | 3300054114 | Ga0501084_0001550 | Ga0501084_0001550_14477_14857 | 121 |
| 939 | 3300054114 | Ga0501084_0426431 | Ga0501084_0426431_708_1088 | 121 |
| 940 | 3300059477 | Ga0587084_020516 | Ga0587084_020516_189_569 | 121 |
| 941 | 3300059477 | Ga0587084_040445 | Ga0587084_040445_271_651 | 121 |
| 942 | 3300059477 | Ga0587084_047703 | Ga0587084_047703_76_456 | 121 |
| 943 | 3300059492 | Ga0587073_0019682 | Ga0587073_0019682_564_944 | 121 |
| 944 | 3300059492 | Ga0587073_0117642 | Ga0587073_0117642_287_667 | 121 |
| 945 | 3300059493 | Ga0587077_081037 | Ga0587077_081037_324_704 | 121 |
| 946 | 3300059503 | Ga0587080_017869 | Ga0587080_017869_335_715 | 121 |
| 947 | 3300059504 | Ga0587082_022970 | Ga0587082_022970_631_1011 | 121 |
| 948 | 3300059504 | Ga0587082_053755 | Ga0587082_053755_213_593 | 121 |
| 949 | 3300059504 | Ga0587082_164409 | Ga0587082_164409_22_402 | 121 |
| 950 | 3300059505 | Ga0587083_0090540 | Ga0587083_0090540_251_631 | 121 |
| 951 | 3300059506 | Ga0587085_050956 | Ga0587085_050956_177_557 | 121 |
| 952 | 3300059506 | Ga0587085_083532 | Ga0587085_083532_88_468 | 121 |
| 953 | 3300059507 | Ga0587086_009836 | Ga0587086_009836_482_862 | 121 |
| 954 | 3300059508 | Ga0587088_047833 | Ga0587088_047833_84_464 | 121 |
| 955 | 3300059508 | Ga0587088_069038 | Ga0587088_069038_320_700 | 121 |
| 956 | 3300059510 | Ga0587090_042555 | Ga0587090_042555_30_410 | 121 |
| 957 | 3300059512 | Ga0587092_051993 | Ga0587092_051993_323_703 | 121 |
| 958 | 3300059514 | Ga0587095_006161 | Ga0587095_006161_323_703 | 121 |
| 959 | 3300059604 | Ga0587098_006769 | Ga0587098_006769_518_898 | 121 |
| 960 | 3300059605 | Ga0587106_015835 | Ga0587106_015835_133_513 | 121 |
| 961 | 3300059608 | Ga0587129_015014 | Ga0587129_015014_61_441 | 121 |
| 962 | 3300059623 | Ga0587101_056672 | Ga0587101_056672_242_622 | 121 |
| 963 | 3300059623 | Ga0587101_149617 | Ga0587101_149617_83_463 | 121 |
| 964 | 3300059626 | Ga0587115_013310 | Ga0587115_013310_276_656 | 121 |
| 965 | 3300059627 | Ga0587117_079424 | Ga0587117_079424_166_546 | 121 |
| 966 | 3300059628 | Ga0587122_001696 | Ga0587122_001696_412_792 | 121 |
| 967 | 3300059639 | Ga0587062_013640 | Ga0587062_013640_244_624 | 121 |
| 968 | 3300059640 | Ga0587067_017595 | Ga0587067_017595_306_686 | 121 |
| 969 | 3300059640 | Ga0587067_036608 | Ga0587067_036608_407_787 | 121 |
| 970 | 3300059643 | Ga0587072_137080 | Ga0587072_137080_17_397 | 121 |
| 971 | 3300059644 | Ga0587075_014952 | Ga0587075_014952_109_489 | 121 |
| 972 | 3300059645 | Ga0587076_008284 | Ga0587076_008284_711_1091 | 121 |
| 973 | 3300059648 | Ga0587100_005415 | Ga0587100_005415_315_695 | 121 |
| 974 | 3300059648 | Ga0587100_008942 | Ga0587100_008942_25_405 | 121 |
| 975 | 3300059649 | Ga0587102_010002 | Ga0587102_010002_29_409 | 121 |
| 976 | 3300059655 | Ga0587114_009440 | Ga0587114_009440_736_1116 | 121 |
| 977 | 3300059658 | Ga0587119_017129 | Ga0587119_017129_353_733 | 121 |
| 978 | 3300060344 | Ga0587071_008622 | Ga0587071_008622_245_625 | 121 |
| 979 | 3300060344 | Ga0587071_023819 | Ga0587071_023819_91_471 | 121 |
| 980 | 3300060346 | Ga0587111_0020096 | Ga0587111_0020096_713_1093 | 121 |
| 981 | 3300060346 | Ga0587111_0061905 | Ga0587111_0061905_430_810 | 121 |
| 982 | 3300060346 | Ga0587111_0076183 | Ga0587111_0076183_234_614 | 121 |
| 983 | 3300060346 | Ga0587111_0273527 | Ga0587111_0273527_39_419 | 121 |
| 984 | 3300060353 | Ga0501082_0044117 | Ga0501082_0044117_970_1350 | 121 |
| 985 | 3300060353 | Ga0501082_0392570 | Ga0501082_0392570_429_809 | 121 |
| 986 | 3300061719 | Ga0466962_0000779 | Ga0466962_0000779_6143_6523 | 121 |
| 987 | 3300061719 | Ga0466962_0004946 | Ga0466962_0004946_1070_1450 | 121 |
| 988 | 3300061719 | Ga0466962_0008164 | Ga0466962_0008164_2087_2512 | 121 |
| 989 | 3300061734 | Ga0530510_0925468 | Ga0530510_0925468_217_597 | 121 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar