F487592

General Info

Members Datasets Scaffolds Average Seq Length
989 536 932 122

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0024483|Ga0466969_0024483_1142_1567
Length 141
Sequence VPRQTSAIELKELAEMARLVGVDLPREKRLEIALTYIYGIGRTRAQATCAGAGVSPDVRVKDLSEDDLIKLRDWIDGNYKIEGDLRREVAADIRRKMEIGCYQGLRHRRGLPVRGQRTHTNARTRKGPRRAIAGKKKPGKK

Samples

Sample ID Description Type Environment
1 2506783011 Frankia datiscae Dg1 Isolate Nodule
2 2508501039 Frankia saprophytica CN3 Isolate Nodule
3 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
4 2517572101 Frankia sp. DC12 Isolate Nodule
5 2527291627 Frankia casuarinae Thr Isolate Nodule
6 2527291629 Frankia sp. BMG5.23 Isolate Nodule
7 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
8 2558860280 Kutzneria sp. 744 Isolate Unclassified
9 2576861822 Frankia sp. CeD Isolate Nodule
10 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
11 2619618881 Frankia sp. ACN1ag Isolate Unclassified
12 2619619003 Frankia sp. CpI1-P Isolate Nodule
13 2626541554 Frankia sp. AvcI.1 Isolate Nodule
14 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
15 2643221670 Streptomyces sp. Root431 Isolate Unclassified
16 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
17 2671180195 Frankia sp. CcI49 Isolate Nodule
18 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
19 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
20 2684623036 Frankia sp. CgIM4 Isolate Nodule
21 2687453737 Frankia sp. BMG5.36 Isolate Nodule
22 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
23 2710264753 Frankia sp. KB5 Isolate Nodule
24 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
25 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
26 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
27 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
28 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
29 2773857922 Frankia sp. CcI49 Isolate Nodule
30 2773857924 Frankia sp. CgIS1 Isolate Nodule
31 2773857933 Frankia sp. BMG5.30 Isolate Nodule
32 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
33 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
34 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
35 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
36 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
37 2862574272 Streptomyces sp. AcE210 Isolate Nodule
38 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
39 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
40 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
41 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
42 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
43 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
44 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
45 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
46 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
47 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
48 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
49 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
50 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
51 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
52 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
53 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
54 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
55 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
57 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
58 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
59 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
60 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
61 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
62 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
63 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
64 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
65 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
68 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
70 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
71 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
72 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
73 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
74 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
75 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
76 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
77 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
78 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
79 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
80 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
81 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
82 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
83 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
84 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
85 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
88 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
109 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
113 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
114 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
126 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
139 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
140 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
141 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020071 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
146 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
153 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
155 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
156 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
202 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300029282 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 Metatranscriptome Rhizosphere
205 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
206 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
207 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
208 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
209 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
210 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
211 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
212 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
213 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
214 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
215 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
216 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
217 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
220 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
221 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
224 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
227 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
228 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
229 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
230 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
231 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
232 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
233 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
234 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
235 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
236 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
237 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
238 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
239 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
240 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
241 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
242 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
243 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
244 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
245 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
246 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
247 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
248 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
249 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
250 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
251 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
252 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
253 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
254 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
255 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
260 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
261 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
262 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
263 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
264 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
265 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
266 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
267 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
268 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
269 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
270 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
271 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
272 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
273 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
274 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
275 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
276 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
277 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
278 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
279 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
280 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
281 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
282 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
283 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
284 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
285 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
286 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
287 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
288 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
289 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
290 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
291 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
292 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
293 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
294 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
295 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
296 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
297 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
298 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
299 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
300 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
301 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
302 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
303 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
304 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
305 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
306 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
307 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
308 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
309 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
310 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
311 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
312 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
313 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
314 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
315 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
316 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
317 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
318 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
319 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
320 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
321 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
322 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
323 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
324 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
325 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
326 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
327 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
328 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
329 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
330 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
331 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
332 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
333 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
334 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
335 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
336 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
337 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
338 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
339 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
340 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
341 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
342 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
343 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
344 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
345 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
346 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
347 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
348 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
349 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
350 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
351 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
352 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
353 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
354 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
355 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
356 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
357 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
358 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
359 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
360 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
361 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
362 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
363 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
364 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
365 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
366 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
367 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
368 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
369 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
370 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
371 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
372 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
373 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
374 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
375 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
376 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
377 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
378 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
379 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
380 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
381 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
382 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
383 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
384 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
385 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
386 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
387 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
388 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
389 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
390 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
391 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
392 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
393 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
394 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
432 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
433 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
434 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
435 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
436 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
437 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
438 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
439 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
440 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
441 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
442 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
443 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
444 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
445 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
446 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
447 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
448 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
449 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
450 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
451 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
454 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
455 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
456 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
457 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
458 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
459 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
460 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
461 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
462 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
463 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
464 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
465 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
466 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
467 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
468 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
469 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
470 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
471 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
472 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
473 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
474 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
475 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
476 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
477 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
478 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
479 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
480 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
481 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
482 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
483 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
484 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
485 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
486 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
487 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
488 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
489 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
490 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
491 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
492 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
493 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
508 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
510 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
511 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
512 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
513 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
514 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
515 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
516 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
517 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
518 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
519 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
520 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
521 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
522 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
523 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
524 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
526 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
528 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
529 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
530 637000116 Frankia casuarinae CcI3 Isolate Nodule
531 8002775197 Frankia nepalensis CN7 Isolate Nodule
532 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
533 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
534 8054920844 Frankia tisae Agncl-8 Isolate Nodule
535 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
536 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.13
Metatranscriptomes 19.11
Isolates 5.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.56
Nodule 2.53
Rhizoplane 3.64
Rhizosphere 79.98
Stem 0
Stem Tuber 0
Unclassified 8.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10012589 3300001989 Bacteria 3103
2 JGI24737J22298_10004109 3300001990 Bacteria 5084
3 JGI24735J21928_10037966 3300002067 Bacteria 1411
4 JGI24738J21930_10009088 3300002075 Bacteria 2248
5 JGI25406J46586_10054419 3300003203 Bacteria 1324
6 Ga0006777J48905_1016128 3300003308 Bacteria 1474
7 rootH1_10087441 3300003316 Bacteria 1319
8 rootH1_10044574 3300003323 Bacteria 1269
9 JGI25160J50197_1013781 3300003354 Bacteria 2738
10 JGI25160J50197_1026569 3300003354 Bacteria 1593
11 Ga0007410J51695_1079086 3300003574 Bacteria 815
12 Ga0007409J51694_1027373 3300003575 Bacteria 920
13 Ga0007409J51694_1095426 3300003575 Bacteria 836
14 Ga0007429J51699_1077728 3300003579 Bacteria 773
15 Ga0007429J51699_1098508 3300003579 Bacteria 590
16 Ga0058858_1005032 3300004785 Bacteria 2048
17 Ga0058859_11826058 3300004798 Bacteria 929
18 Ga0058863_10085417 3300004799 Bacteria 885
19 Ga0058863_10169109 3300004799 Bacteria 997
20 Ga0058863_11770428 3300004799 Bacteria 982
21 Ga0058861_10106487 3300004800 Bacteria 846
22 Ga0058861_10162069 3300004800 Bacteria 677
23 Ga0058861_10186282 3300004800 Bacteria 597
24 Ga0058861_11881892 3300004800 Bacteria 865
25 Ga0058860_10025829 3300004801 Bacteria 1322
26 Ga0058860_10028160 3300004801 Bacteria 1054
27 Ga0058860_10106898 3300004801 Bacteria 637
28 Ga0058860_10115660 3300004801 Bacteria 982
29 Ga0058860_10229221 3300004801 Bacteria 940
30 Ga0058862_10127495 3300004803 Bacteria 979
31 Ga0058862_10191375 3300004803 Bacteria 860
32 Ga0058862_12724420 3300004803 Bacteria 855
33 Ga0070658_10786068 3300005327 Bacteria 827
34 Ga0070670_100338738 3300005331 Bacteria 1320
35 Ga0070670_101097127 3300005331 Bacteria 726
36 Ga0068869_100018620 3300005334 Bacteria 4731
37 Ga0068869_100883330 3300005334 Bacteria 773
38 Ga0068869_100940981 3300005334 Bacteria 750
39 Ga0068868_100702561 3300005338 Bacteria 905
40 Ga0070687_101127276 3300005343 Bacteria 575
41 Ga0070668_100196908 3300005347 Bacteria 1653
42 Ga0070675_100194727 3300005354 Bacteria 1757
43 Ga0070674_100077936 3300005356 Bacteria 2361
44 Ga0070667_102079642 3300005367 Bacteria 535
45 Ga0070709_10111103 3300005434 Bacteria 1843
46 Ga0070709_11011019 3300005434 Bacteria 662
47 Ga0070714_100182078 3300005435 Bacteria 1912
48 Ga0070714_101424383 3300005435 Bacteria 677
49 Ga0070713_100075640 3300005436 Bacteria 2856
50 Ga0070710_10000334 3300005437 Bacteria 22500
51 Ga0070701_10390157 3300005438 Bacteria 880
52 Ga0070711_100127812 3300005439 Bacteria 1889
53 Ga0070678_100314920 3300005456 Bacteria 1334
54 Ga0070678_101138709 3300005456 Bacteria 722
55 Ga0070681_10448711 3300005458 Bacteria 1202
56 Ga0068853_101415438 3300005539 Bacteria 673
57 Ga0070672_100332582 3300005543 Bacteria 1293
58 Ga0070693_101327412 3300005547 Bacteria 557
59 Ga0068856_100081044 3300005614 Bacteria 3220
60 Ga0068856_102522922 3300005614 Bacteria 521
61 Ga0068859_100034160 3300005617 Bacteria 5105
62 Ga0068859_100092242 3300005617 Bacteria 3080
63 Ga0068864_101053908 3300005618 Bacteria 808
64 Ga0068863_100001338 3300005841 Bacteria 24526
65 Ga0068858_100000010 3300005842 Bacteria 234748
66 Ga0068858_100010928 3300005842 Bacteria 8579
67 Ga0068862_100000362 3300005844 Bacteria 49253
68 Ga0081455_10006542 3300005937 Bacteria 12469
69 Ga0081540_1245936 3300005983 Bacteria 626
70 Ga0081539_10002050 3300005985 Bacteria 30294
71 Ga0081539_10021084 3300005985 Bacteria 4370
72 Ga0070717_10294088 3300006028 Bacteria 1442
73 Ga0075365_10244325 3300006038 Bacteria 1261
74 Ga0075368_10003605 3300006042 Bacteria 5187
75 Ga0075363_100018785 3300006048 Bacteria 3447
76 Ga0075364_10008222 3300006051 Bacteria 6229
77 Ga0070712_100506623 3300006175 Bacteria 1012
78 Ga0075367_10075343 3300006178 Bacteria 2035
79 Ga0075367_10172232 3300006178 Bacteria 1348
80 Ga0075369_10014830 3300006186 Bacteria 3118
81 Ga0075366_10481228 3300006195 Bacteria 767
82 Ga0075370_10088385 3300006353 Bacteria 1786
83 Ga0075370_10119183 3300006353 Bacteria 1535
84 Ga0075430_100325169 3300006846 Bacteria 1271
85 Ga0075431_100246785 3300006847 Bacteria 1815
86 Ga0075431_100657837 3300006847 Bacteria 1028
87 Ga0075429_100140830 3300006880 Bacteria 2111
88 Ga0097620_100034160 3300006931 Bacteria 5105
89 Ga0097620_100092239 3300006931 Bacteria 3080
90 Ga0099826_10027493 3300006948 Bacteria 4179
91 Ga0099794_10369792 3300007265 Bacteria 747
92 Ga0105244_10100475 3300009036 Bacteria 1415
93 Ga0105240_10204243 3300009093 Bacteria 2314
94 Ga0111539_11717097 3300009094 Bacteria 728
95 Ga0105245_10575897 3300009098 Bacteria 1150
96 Ga0105247_10000016 3300009101 Bacteria 263389
97 Ga0105247_10212251 3300009101 Bacteria 1306
98 Ga0105243_10162470 3300009148 Bacteria 1927
99 Ga0105243_10994620 3300009148 Bacteria 841
100 Ga0105241_10796030 3300009174 Bacteria 870
101 Ga0105248_10000035 3300009177 Bacteria 187578
102 Ga0105248_10002899 3300009177 Bacteria 19028
103 Ga0105248_12584018 3300009177 Bacteria 579
104 Ga0105248_13437596 3300009177 Bacteria 503
105 Ga0105249_10068762 3300009553 Bacteria 3267
106 Ga0105249_10687247 3300009553 Bacteria 1083
107 Ga0105239_11608217 3300010375 Bacteria 751
108 Ga0105239_12859172 3300010375 Bacteria 563
109 Ga0105239_13205203 3300010375 Bacteria 533
110 Ga0105246_10002569 3300011119 Bacteria 10977
111 Ga0105246_10434317 3300011119 Bacteria 1099
112 Ga0157322_1013348 3300012490 Bacteria 705
113 Ga0154012_109278 3300013059 Bacteria 1212
114 Ga0154010_148221 3300013062 Bacteria 888
115 Ga0157370_12126253 3300013104 Bacteria 503
116 Ga0157374_10520828 3300013296 Bacteria 1195
117 Ga0157378_10490338 3300013297 Bacteria 1226
118 Ga0157378_11560850 3300013297 Bacteria 705
119 Ga0157375_11093622 3300013308 Bacteria 933
120 Ga0163163_10010268 3300014325 Bacteria 8414
121 Ga0163163_12067520 3300014325 Bacteria 629
122 Ga0157380_10213417 3300014326 Bacteria 1722
123 Ga0182008_10009535 3300014497 Bacteria 5233
124 Ga0182008_10354699 3300014497 Bacteria 779
125 Ga0157377_10543637 3300014745 Bacteria 819
126 Ga0157379_10009461 3300014968 Bacteria 8492
127 Ga0157379_10101600 3300014968 Bacteria 2581
128 Ga0157379_10388618 3300014968 Bacteria 1281
129 Ga0157379_10784670 3300014968 Bacteria 898
130 Ga0157376_10865869 3300014969 Bacteria 920
131 Ga0182006_1012482 3300015261 Bacteria 3715
132 Ga0182007_10010395 3300015262 Bacteria 3680
133 Ga0183367_1002 3300015688 Bacteria 1101531
134 Ga0197907_10071147 3300020069 Bacteria 1633
135 Ga0197907_10456483 3300020069 Bacteria 3929
136 Ga0197907_10872862 3300020069 Bacteria 1123
137 Ga0197907_10874185 3300020069 Bacteria 1074
138 Ga0197907_11028216 3300020069 Bacteria 816
139 Ga0206356_10671161 3300020070 Bacteria 1880
140 Ga0206356_10797342 3300020070 Bacteria 1342
141 Ga0206356_10880070 3300020070 Bacteria 587
142 Ga0206356_10946215 3300020070 Bacteria 2606
143 Ga0206348_113828 3300020071 Bacteria 859
144 Ga0206349_1484921 3300020075 Bacteria 1124
145 Ga0206349_1782543 3300020075 Bacteria 949
146 Ga0206349_1815480 3300020075 Bacteria 2024
147 Ga0206355_1131249 3300020076 Bacteria 2134
148 Ga0206355_1350876 3300020076 Bacteria 1097
149 Ga0206351_10013403 3300020077 Bacteria 1454
150 Ga0206351_10035715 3300020077 Bacteria 1337
151 Ga0206351_10267213 3300020077 Bacteria 1843
152 Ga0206351_10945162 3300020077 Bacteria 1666
153 Ga0206352_10000892 3300020078 Bacteria 1414
154 Ga0206352_10048704 3300020078 Bacteria 1153
155 Ga0206352_10486095 3300020078 Bacteria 949
156 Ga0206352_10571914 3300020078 Bacteria 1283
157 Ga0206352_10718751 3300020078 Bacteria 1697
158 Ga0206350_10201708 3300020080 Bacteria 908
159 Ga0206350_10308689 3300020080 Bacteria 2085
160 Ga0206350_10386703 3300020080 Bacteria 1202
161 Ga0206350_10762397 3300020080 Bacteria 777
162 Ga0206350_11076420 3300020080 Bacteria 668
163 Ga0206354_10049783 3300020081 Bacteria 1695
164 Ga0206354_10458357 3300020081 Bacteria 1553
165 Ga0206354_10517799 3300020081 Bacteria 2547
166 Ga0206354_11155240 3300020081 Bacteria 2060
167 Ga0206353_10186563 3300020082 Bacteria 1139
168 Ga0206353_10222344 3300020082 Bacteria 4182
169 Ga0206353_11116048 3300020082 Bacteria 8566
170 Ga0206353_11628847 3300020082 Bacteria 1009
171 Ga0154015_1218295 3300020610 Bacteria 1822
172 Ga0154015_1608521 3300020610 Bacteria 883
173 Ga0213875_10001257 3300021388 Bacteria 17050
174 Ga0213875_10001291 3300021388 Bacteria 16695
175 Ga0213875_10050952 3300021388 Bacteria 1939
176 Ga0224712_10000543 3300022467 Bacteria 7653
177 Ga0224712_10113455 3300022467 Bacteria 1165
178 Ga0224712_10141630 3300022467 Bacteria 1059
179 Ga0224712_10182575 3300022467 Bacteria 946
180 Ga0209758_1000870 3300025297 Bacteria 41550
181 Ga0207426_1005272 3300025302 Bacteria 5953
182 Ga0207426_1012521 3300025302 Bacteria 3181
183 Ga0207426_1061190 3300025302 Bacteria 1082
184 Ga0209051_1121767 3300025303 Bacteria 661
185 Ga0207655_1087485 3300025728 Bacteria 1105
186 Ga0207692_10007633 3300025898 Bacteria 4437
187 Ga0207710_10000017 3300025900 Bacteria 370962
188 Ga0207710_10000048 3300025900 Bacteria 189597
189 Ga0207688_10041350 3300025901 Bacteria 2564
190 Ga0207688_10972313 3300025901 Bacteria 537
191 Ga0207647_10006322 3300025904 Bacteria 8617
192 Ga0207699_10027891 3300025906 Bacteria 3132
193 Ga0207699_10275966 3300025906 Bacteria 1166
194 Ga0207705_10003438 3300025909 Bacteria 12045
195 Ga0207705_10989837 3300025909 Bacteria 650
196 Ga0207707_10241686 3300025912 Bacteria 1570
197 Ga0207695_10715601 3300025913 Bacteria 882
198 Ga0207693_10451024 3300025915 Bacteria 1005
199 Ga0207663_10047146 3300025916 Bacteria 2659
200 Ga0207662_10975540 3300025918 Bacteria 601
201 Ga0207649_10604024 3300025920 Bacteria 844
202 Ga0207652_10386953 3300025921 Bacteria 1262
203 Ga0207652_11042144 3300025921 Bacteria 717
204 Ga0207681_11787568 3300025923 Bacteria 513
205 Ga0207694_11063285 3300025924 Bacteria 685
206 Ga0207659_10145326 3300025926 Bacteria 1846
207 Ga0207659_11303460 3300025926 Bacteria 623
208 Ga0207687_10380765 3300025927 Bacteria 1156
209 Ga0207700_10075738 3300025928 Bacteria 2609
210 Ga0207664_10003521 3300025929 Bacteria 10458
211 Ga0207664_10187099 3300025929 Bacteria 1781
212 Ga0207664_10823035 3300025929 Bacteria 835
213 Ga0207690_11281629 3300025932 Bacteria 612
214 Ga0207706_10285731 3300025933 Bacteria 1438
215 Ga0207686_10589347 3300025934 Bacteria 874
216 Ga0207669_10278193 3300025937 Bacteria 1261
217 Ga0207691_10220168 3300025940 Bacteria 1646
218 Ga0207691_10223984 3300025940 Bacteria 1630
219 Ga0207711_10000134 3300025941 Bacteria 77843
220 Ga0207711_10002995 3300025941 Bacteria 14760
221 Ga0207689_10020564 3300025942 Bacteria 5554
222 Ga0207661_10721492 3300025944 Bacteria 917
223 Ga0207679_10912924 3300025945 Bacteria 803
224 Ga0207651_10189905 3300025960 Bacteria 1638
225 Ga0207712_10040803 3300025961 Bacteria 3187
226 Ga0207712_10119117 3300025961 Bacteria 1994
227 Ga0207712_11405517 3300025961 Bacteria 624
228 Ga0207668_10264527 3300025972 Bacteria 1403
229 Ga0207640_11328698 3300025981 Bacteria 642
230 Ga0207658_10002262 3300025986 Bacteria 14246
231 Ga0207658_12136008 3300025986 Bacteria 509
232 Ga0207677_11330309 3300026023 Bacteria 660
233 Ga0207677_11416085 3300026023 Bacteria 640
234 Ga0207703_10000002 3300026035 Bacteria 600711
235 Ga0207703_10003502 3300026035 Bacteria 13129
236 Ga0207639_11335699 3300026041 Bacteria 673
237 Ga0207702_10123630 3300026078 Bacteria 2319
238 Ga0207702_10204359 3300026078 Bacteria 1833
239 Ga0207702_10547570 3300026078 Bacteria 1132
240 Ga0207641_10002679 3300026088 Bacteria 16261
241 Ga0207674_10226074 3300026116 Bacteria 1820
242 Ga0207683_10691384 3300026121 Bacteria 945
243 Ga0209371_1016429 3300027312 Bacteria 1952
244 Ga0209813_10004425 3300027866 Bacteria 3355
245 Ga0268265_10000363 3300028380 Bacteria 49150
246 Ga0268265_10373786 3300028380 Bacteria 1309
247 Ga0265334_10003386 3300028573 Bacteria 7272
248 Ga0307517_10006905 3300028786 Bacteria 16700
249 Ga0307515_10107145 3300028794 Bacteria 3307
250 Ga0307515_10255141 3300028794 Bacteria 1499
251 Ga0311003_147053 3300029282 Bacteria 926
252 Ga0310981_1041238 3300029285 Bacteria 910
253 Ga0268256_1015007 3300030500 Bacteria 2277
254 Ga0307511_10017698 3300030521 Bacteria 6830
255 Ga0307511_10100912 3300030521 Bacteria 1896
256 Ga0307512_10083358 3300030522 Bacteria 2280
257 Ga0307512_10197589 3300030522 Bacteria 1095
258 Ga0316177_1047979 3300030731 Bacteria 3401
259 Ga0316176_1038867 3300030732 Bacteria 1785
260 Ga0314311_1019554 3300030733 Bacteria 3266
261 Ga0314311_1063336 3300030733 Bacteria 534
262 Ga0316179_1032206 3300030734 Bacteria 2864
263 Ga0316178_1099044 3300030735 Bacteria 1529
264 Ga0316180_1042781 3300030736 Bacteria 1586
265 Ga0316181_1204309 3300030744 Bacteria 1025
266 Ga0316181_1229376 3300030744 Bacteria 964
267 Ga0316182_1033344 3300030745 Bacteria 2098
268 Ga0265766_1000574 3300030863 Bacteria 1640
269 Ga0265768_108547 3300030963 Bacteria 637
270 Ga0265325_10040754 3300031241 Bacteria 2437
271 Ga0265340_10007092 3300031247 Bacteria 6109
272 Ga0265340_10074702 3300031247 Bacteria 1602
273 Ga0265339_10047818 3300031249 Bacteria 2348
274 Ga0265316_10124459 3300031344 Bacteria 1945
275 Ga0307513_10342355 3300031456 Bacteria 1245
276 Ga0307509_10009247 3300031507 Bacteria 12366
277 Ga0307509_10411162 3300031507 Bacteria 1056
278 Ga0307408_102136462 3300031548 Bacteria 540
279 Ga0310117_105392 3300031592 Bacteria 1385
280 Ga0310103_131967 3300031614 Bacteria 629
281 Ga0307508_10000924 3300031616 Bacteria 34111
282 Ga0307508_10031723 3300031616 Bacteria 4775
283 Ga0307508_10066550 3300031616 Bacteria 3172
284 Ga0307508_10115798 3300031616 Bacteria 2282
285 Ga0307514_10117565 3300031649 Bacteria 1864
286 Ga0307514_10121653 3300031649 Bacteria 1819
287 Ga0307514_10219817 3300031649 Bacteria 1166
288 Ga0310111_106844 3300031667 Bacteria 1477
289 Ga0316579_10000038 3300031691 Bacteria 30399
290 Ga0265342_10057885 3300031712 Bacteria 2292
291 Ga0316576_10109103 3300031727 Bacteria 2074
292 Ga0316576_10350768 3300031727 Bacteria 1098
293 Ga0307516_10034474 3300031730 Bacteria 5085
294 Ga0307516_10594784 3300031730 Bacteria 760
295 Ga0307405_10309324 3300031731 Bacteria 1202
296 Ga0307405_10476937 3300031731 Bacteria 995
297 Ga0307405_10517444 3300031731 Bacteria 959
298 Ga0316577_10165966 3300031733 Bacteria 1246
299 Ga0307413_10556118 3300031824 Bacteria 932
300 Ga0307413_11065620 3300031824 Bacteria 696
301 Ga0307413_11171584 3300031824 Bacteria 667
302 Ga0307518_10578106 3300031838 Bacteria 545
303 Ga0307410_10137079 3300031852 Bacteria 1805
304 Ga0307406_10004670 3300031901 Bacteria 7462
305 Ga0307406_10465426 3300031901 Bacteria 1017
306 Ga0307406_10754113 3300031901 Bacteria 817
307 Ga0307406_11264342 3300031901 Bacteria 643
308 Ga0307406_11729656 3300031901 Bacteria 555
309 Ga0307406_11867102 3300031901 Bacteria 535
310 Ga0307407_10029824 3300031903 Bacteria 2935
311 Ga0307407_10199153 3300031903 Bacteria 1341
312 Ga0307412_10692764 3300031911 Bacteria 874
313 Ga0307409_100330395 3300031995 Bacteria 1430
314 Ga0307409_100399841 3300031995 Bacteria 1312
315 Ga0307409_100416549 3300031995 Bacteria 1287
316 Ga0307409_100651764 3300031995 Bacteria 1047
317 Ga0307409_101081770 3300031995 Bacteria 822
318 Ga0307409_102410040 3300031995 Bacteria 555
319 Ga0307416_100124216 3300032002 Bacteria 2308
320 Ga0307416_100583936 3300032002 Bacteria 1195
321 Ga0307416_100721571 3300032002 Bacteria 1087
322 Ga0307414_10423502 3300032004 Bacteria 1161
323 Ga0307411_10148286 3300032005 Bacteria 1740
324 Ga0307411_10283867 3300032005 Bacteria 1319
325 Ga0307415_100029200 3300032126 Bacteria 3521
326 Ga0307415_100049757 3300032126 Bacteria 2836
327 Ga0307415_100591499 3300032126 Bacteria 986
328 Ga0307415_101146559 3300032126 Bacteria 730
329 Ga0307507_10003799 3300033179 Bacteria 28240
330 Ga0307507_10024930 3300033179 Bacteria 6500
331 Ga0307507_10025585 3300033179 Bacteria 6396
332 Ga0307510_10090689 3300033180 Bacteria 2901
333 Ga0307510_10206325 3300033180 Bacteria 1493
334 Ga0307510_10229710 3300033180 Bacteria 1359
335 Ga0373958_0132797 3300034819 Bacteria 611
336 Ga0316574_0197315 3300035398 Bacteria 1293
337 Ga0316574_0631025 3300035398 Bacteria 660
338 Ga0373947_0204412 3300035725 Bacteria 1293
339 Ga0316582_0184816 3300036647 Bacteria 1419
340 Ga0316584_0038993 3300036712 Bacteria 3536
341 Ga0373925_0106577 3300037068 Bacteria 2161
342 Ga0395899_0008026 3300037312 Bacteria 8128
343 Ga0395900_0199314 3300037418 Bacteria 2026
344 Ga0395898_0026184 3300037466 Bacteria 5870
345 Ga0395898_0030243 3300037466 Bacteria 5420
346 Ga0436364_0010700 3300037853 Bacteria 115369
347 Ga0436364_0424211 3300037853 Bacteria 2368
348 Ga0436364_1354648 3300037853 Bacteria 115417
349 Ga0395901_0031729 3300038443 Bacteria 5447
350 Ga0400485_08169 3300038735 Bacteria 55719
351 Ga0400486_03564 3300038742 Bacteria 38786
352 Ga0400483_019574 3300039062 Bacteria 7106
353 Ga0436365_0340703 3300039437 Bacteria 1430
354 Ga0436363_0020748 3300039450 Bacteria 1009
355 Ga0436362_0399705 3300039453 Bacteria 1097
356 Ga0439436_0003559 3300041404 Bacteria 4735
357 Ga0439436_0029047 3300041404 Bacteria 1611
358 Ga0439439_0004725 3300041406 Bacteria 3080
359 Ga0439453_0083764 3300041408 Bacteria 691
360 Ga0439461_0044338 3300041410 Bacteria 970
361 Ga0439465_0069611 3300041413 Bacteria 1178
362 Ga0451801_20119 3300041455 Bacteria 536
363 Ga0451798_0882651 3300041458 Bacteria 714
364 Ga0451802_0369205 3300041460 Bacteria 1034
365 Ga0451805_128977 3300041461 Bacteria 1445
366 Ga0451839_0534569 3300041496 Bacteria 1178
367 Ga0451847_0358713 3300041503 Bacteria 806
368 Ga0451843_1340122 3300041509 Bacteria 1786
369 Ga0451853_1319955 3300041512 Bacteria 1805
370 Ga0451853_1446781 3300041512 Bacteria 1028
371 Ga0439431_0105579 3300041997 Bacteria 777
372 Ga0439433_0002570 3300041999 Bacteria 3854
373 Ga0439433_0005893 3300041999 Bacteria 2631
374 Ga0439442_049219 3300042002 Bacteria 888
375 Ga0439449_0009099 3300042007 Bacteria 3766
376 Ga0439449_0011760 3300042007 Bacteria 3289
377 Ga0439450_071020 3300042008 Bacteria 854
378 Ga0439454_012822 3300042011 Bacteria 1142
379 Ga0439455_0001031 3300042012 Bacteria 4400
380 Ga0439457_002785 3300042014 Bacteria 4890
381 Ga0439457_068365 3300042014 Bacteria 808
382 Ga0439462_0000539 3300042015 Bacteria 7498
383 Ga0450890_006468 3300042127 Bacteria 1498
384 Ga0450894_015795 3300042131 Bacteria 1001
385 Ga0450899_001611 3300042135 Bacteria 2496
386 Ga0450900_015844 3300042136 Bacteria 1016
387 Ga0450903_000013 3300042138 Bacteria 34246
388 Ga0450903_047020 3300042138 Bacteria 634
389 Ga0439458_0000117 3300042157 Bacteria 16127
390 Ga0439458_0039956 3300042157 Bacteria 1136
391 Ga0439458_0083099 3300042157 Bacteria 818
392 Ga0439434_0091373 3300042435 Bacteria 974
393 Ga0439434_0154515 3300042435 Bacteria 761
394 Ga0466969_0024483 3300044656 Bacteria 3104
395 Ga0466969_0035870 3300044656 Bacteria 2507
396 Ga0466969_0096611 3300044656 Bacteria 1394
397 Ga0466972_0004874 3300044658 Bacteria 6730
398 Ga0466972_0156714 3300044658 Bacteria 1070
399 Ga0466972_0272087 3300044658 Bacteria 791
400 Ga0466965_0011265 3300044683 Bacteria 4187
401 Ga0466966_0004478 3300044684 Bacteria 9214
402 Ga0466966_0025877 3300044684 Bacteria 3832
403 Ga0466966_0038688 3300044684 Bacteria 3073
404 Ga0466966_0548959 3300044684 Bacteria 695
405 Ga0466961_0004915 3300044693 Bacteria 8405
406 Ga0466961_0007268 3300044693 Bacteria 7046
407 Ga0466961_0051070 3300044693 Bacteria 2641
408 Ga0466961_0139137 3300044693 Bacteria 1520
409 Ga0466961_0424699 3300044693 Bacteria 805
410 Ga0466961_0970695 3300044693 Bacteria 505
411 Ga0466963_0097420 3300044694 Bacteria 2009
412 Ga0466963_0143823 3300044694 Bacteria 1653
413 Ga0466963_0359955 3300044694 Bacteria 1025
414 Ga0466963_0464430 3300044694 Bacteria 893
415 Ga0466963_1046536 3300044694 Bacteria 574
416 Ga0466964_0062147 3300044706 Bacteria 1556
417 Ga0466964_0390469 3300044706 Bacteria 725
418 Ga0453684_0949489 3300044712 Bacteria 918
419 Ga0466971_0000019 3300044719 Bacteria 79360
420 Ga0466971_0007920 3300044719 Bacteria 4628
421 Ga0466971_0113681 3300044719 Bacteria 1250
422 Ga0466971_0365821 3300044719 Bacteria 699
423 Ga0466968_0019909 3300044735 Bacteria 2705
424 Ga0466968_0030937 3300044735 Bacteria 2219
425 Ga0466968_0106395 3300044735 Bacteria 1257
426 Ga0466968_0359593 3300044735 Bacteria 708
427 Ga0466970_0003004 3300044765 Bacteria 8183
428 Ga0466970_0039008 3300044765 Bacteria 2520
429 Ga0466970_0067568 3300044765 Bacteria 1919
430 Ga0466970_0158678 3300044765 Bacteria 1250
431 Ga0466970_0751525 3300044765 Bacteria 570
432 Ga0466957_0015619 3300044842 Bacteria 4435
433 Ga0466957_0045585 3300044842 Bacteria 2659
434 Ga0466957_0203573 3300044842 Bacteria 1301
435 Ga0466957_0297570 3300044842 Bacteria 1083
436 Ga0466957_0859709 3300044842 Bacteria 647
437 Ga0466957_1269351 3300044842 Bacteria 534
438 Ga0466960_0005266 3300044901 Bacteria 5111
439 Ga0466960_0066960 3300044901 Bacteria 1777
440 Ga0466960_0103264 3300044901 Bacteria 1471
441 Ga0466960_0294693 3300044901 Bacteria 912
442 Ga0466960_0800708 3300044901 Bacteria 570
443 Ga0466960_0880139 3300044901 Bacteria 545
444 Ga0466959_0004638 3300045049 Bacteria 9244
445 Ga0466959_0032055 3300045049 Bacteria 3889
446 Ga0466959_0048320 3300045049 Bacteria 3126
447 Ga0466959_0064455 3300045049 Bacteria 2660
448 Ga0466959_0274074 3300045049 Bacteria 1159
449 Ga0466959_0293401 3300045049 Bacteria 1114
450 Ga0466959_0743902 3300045049 Bacteria 656
451 Ga0466959_0937830 3300045049 Bacteria 577
452 Ga0466958_0000701 3300045836 Bacteria 14601
453 Ga0466958_0054273 3300045836 Bacteria 2430
454 Ga0466958_0195593 3300045836 Bacteria 1286
455 Ga0466958_0261995 3300045836 Bacteria 1107
456 Ga0466958_0275195 3300045836 Bacteria 1078
457 Ga0466958_0849536 3300045836 Bacteria 595
458 Ga0466967_0075222 3300045976 Bacteria 3035
459 Ga0466967_0188862 3300045976 Bacteria 1946
460 Ga0466967_0215478 3300045976 Bacteria 1822
461 Ga0466967_0308089 3300045976 Bacteria 1525
462 Ga0466967_0321893 3300045976 Bacteria 1491
463 Ga0466967_0841565 3300045976 Bacteria 911
464 Ga0466967_0984587 3300045976 Bacteria 839
465 Ga0466967_1447019 3300045976 Bacteria 684
466 Ga0466967_1623790 3300045976 Bacteria 644
467 Ga0495592_0002384 3300046454 Bacteria 13242
468 Ga0495592_0011378 3300046454 Bacteria 6730
469 Ga0495592_0052602 3300046454 Bacteria 3023
470 Ga0495629_0037614 3300046459 Bacteria 3411
471 Ga0495629_0247996 3300046459 Bacteria 1225
472 Ga0495629_0498077 3300046459 Bacteria 822
473 Ga0495638_0024349 3300046460 Bacteria 3947
474 Ga0495638_0105562 3300046460 Bacteria 1679
475 Ga0495638_0119177 3300046460 Bacteria 1561
476 Ga0495641_0474423 3300046461 Bacteria 570
477 Ga0495651_0000169 3300046462 Bacteria 48128
478 Ga0495651_0002063 3300046462 Bacteria 15529
479 Ga0495651_0011730 3300046462 Bacteria 6733
480 Ga0495653_0023969 3300046463 Bacteria 4923
481 Ga0495653_0317694 3300046463 Bacteria 1010
482 Ga0495653_0828413 3300046463 Bacteria 555
483 Ga0495580_0005827 3300046472 Bacteria 10107
484 Ga0495582_0156632 3300046473 Bacteria 1294
485 Ga0495639_0235128 3300046475 Bacteria 903
486 Ga0495662_0002247 3300046476 Bacteria 9741
487 Ga0495662_0005288 3300046476 Bacteria 6466
488 Ga0495662_0018980 3300046476 Bacteria 3328
489 Ga0495662_0190885 3300046476 Bacteria 1010
490 Ga0495664_0002322 3300046477 Bacteria 10191
491 Ga0495664_0072068 3300046477 Bacteria 2063
492 Ga0495664_0245293 3300046477 Bacteria 1083
493 Ga0495584_0346047 3300046491 Bacteria 755
494 Ga0495594_0143365 3300046499 Bacteria 1355
495 Ga0495594_0211202 3300046499 Bacteria 1106
496 Ga0495608_0014048 3300046511 Bacteria 5557
497 Ga0495608_0465813 3300046511 Bacteria 768
498 Ga0495610_0340423 3300046512 Bacteria 567
499 Ga0495618_0347589 3300046514 Bacteria 914
500 Ga0495628_0007000 3300046516 Bacteria 9781
501 Ga0495628_0403214 3300046516 Bacteria 998
502 Ga0495630_0015711 3300046517 Bacteria 5530
503 Ga0495630_0087245 3300046517 Bacteria 2356
504 Ga0495631_0238779 3300046518 Bacteria 775
505 Ga0495643_0000013 3300046522 Bacteria 315700
506 Ga0495666_0000307 3300046526 Bacteria 21312
507 Ga0495652_0000728 3300046529 Bacteria 38187
508 Ga0495652_0030154 3300046529 Bacteria 4759
509 Ga0495652_0319361 3300046529 Bacteria 1122
510 Ga0495665_0013217 3300046531 Bacteria 4466
511 Ga0495640_0027443 3300046533 Bacteria 4106
512 Ga0495640_0124534 3300046533 Bacteria 1672
513 Ga0495640_0237058 3300046533 Bacteria 1146
514 Ga0495586_0065641 3300046535 Bacteria 1978
515 Ga0495586_0223039 3300046535 Bacteria 1071
516 Ga0495587_0000793 3300046536 Bacteria 21073
517 Ga0495587_0139260 3300046536 Bacteria 1385
518 Ga0495645_0002261 3300046543 Bacteria 13098
519 Ga0495645_0007022 3300046543 Bacteria 7830
520 Ga0495645_0052372 3300046543 Bacteria 2969
521 Ga0495645_0300633 3300046543 Bacteria 1048
522 Ga0495622_0017744 3300046557 Bacteria 3313
523 Ga0495633_0327938 3300046558 Bacteria 694
524 Ga0495667_0034555 3300046559 Bacteria 3380
525 Ga0495667_0337720 3300046559 Bacteria 953
526 Ga0495667_0481324 3300046559 Bacteria 778
527 Ga0495667_0837715 3300046559 Bacteria 566
528 Ga0495634_0005875 3300046642 Bacteria 9378
529 Ga0495634_0044010 3300046642 Bacteria 3023
530 Ga0495625_0095757 3300046660 Bacteria 2045
531 Ga0495625_0261981 3300046660 Bacteria 1118
532 Ga0495635_0015642 3300046663 Bacteria 5299
533 Ga0495635_0067659 3300046663 Bacteria 2449
534 Ga0495635_0613993 3300046663 Bacteria 709
535 Ga0495659_0095751 3300046664 Bacteria 1145
536 Ga0495588_0026982 3300046674 Bacteria 2868
537 Ga0495588_0160161 3300046674 Bacteria 1190
538 Ga0495657_0014293 3300046675 Bacteria 5830
539 Ga0495657_0024880 3300046675 Bacteria 4256
540 Ga0495657_0866061 3300046675 Bacteria 514
541 Ga0495599_0031629 3300046678 Bacteria 3321
542 Ga0495599_0076762 3300046678 Bacteria 2086
543 Ga0495599_0183912 3300046678 Bacteria 1287
544 Ga0495623_0012719 3300046679 Bacteria 5449
545 Ga0495623_0030831 3300046679 Bacteria 3449
546 Ga0495623_0054899 3300046679 Bacteria 2512
547 Ga0495623_0242477 3300046679 Bacteria 1017
548 Ga0495646_0009635 3300046680 Bacteria 6132
549 Ga0495646_0021225 3300046680 Bacteria 4105
550 Ga0495646_0061524 3300046680 Bacteria 2235
551 Ga0495658_0120358 3300046683 Bacteria 1587
552 Ga0495669_0047578 3300046684 Bacteria 1916
553 Ga0495613_0037419 3300046689 Bacteria 3597
554 Ga0495613_0263347 3300046689 Bacteria 1200
555 Ga0495613_0675840 3300046689 Bacteria 681
556 Ga0495624_0278293 3300046690 Bacteria 1010
557 Ga0495670_0561469 3300046691 Bacteria 621
558 Ga0495649_0097685 3300046694 Bacteria 1562
559 Ga0495600_0008026 3300046809 Bacteria 6470
560 Ga0495600_0055477 3300046809 Bacteria 2587
561 Ga0495600_0068521 3300046809 Bacteria 2318
562 Ga0495581_0105647 3300047315 Bacteria 1636
563 Ga0495581_0131774 3300047315 Bacteria 1456
564 Ga0495604_0000113 3300047317 Bacteria 68389
565 Ga0495604_0013519 3300047317 Bacteria 6506
566 Ga0495604_0015097 3300047317 Bacteria 6162
567 Ga0495636_0188804 3300047318 Bacteria 937
568 Ga0495674_0018748 3300047319 Bacteria 6440
569 Ga0495674_0262273 3300047319 Bacteria 1419
570 Ga0495674_0335241 3300047319 Bacteria 1230
571 Ga0495674_1096470 3300047319 Bacteria 606
572 Ga0495676_0059662 3300047321 Bacteria 2994
573 Ga0495680_0551908 3300047322 Bacteria 776
574 Ga0495687_015578 3300047443 Bacteria 3860
575 Ga0495675_0013484 3300047444 Bacteria 5159
576 Ga0495675_0017801 3300047444 Bacteria 4504
577 Ga0495675_0295316 3300047444 Bacteria 963
578 Ga0495675_0487073 3300047444 Bacteria 709
579 Ga0495685_063453 3300047447 Bacteria 1243
580 Ga0495685_183751 3300047447 Bacteria 673
581 Ga0495685_193437 3300047447 Bacteria 653
582 Ga0495681_0011573 3300047470 Bacteria 5243
583 Ga0495684_0004072 3300047471 Bacteria 11412
584 Ga0495684_0340967 3300047471 Bacteria 1066
585 Ga0495686_0066423 3300047472 Bacteria 2228
586 Ga0495593_0005852 3300047673 Bacteria 7246
587 Ga0495593_0054339 3300047673 Bacteria 2111
588 Ga0495602_0014250 3300048088 Bacteria 8077
589 Ga0495602_0083799 3300048088 Bacteria 2669
590 Ga0495614_0023593 3300048089 Bacteria 2655
591 Ga0496101_1096877 3300048904 Bacteria 625
592 Ga0496102_0000840 3300048905 Bacteria 29492
593 Ga0496102_0064536 3300048905 Bacteria 3354
594 Ga0496102_0384958 3300048905 Bacteria 1320
595 Ga0496102_1208301 3300048905 Bacteria 675
596 Ga0496103_0024379 3300048906 Bacteria 3652
597 Ga0496103_0042936 3300048906 Bacteria 2783
598 Ga0496103_0690213 3300048906 Bacteria 647
599 Ga0496104_0463699 3300048907 Bacteria 1178
600 Ga0496104_0761824 3300048907 Bacteria 875
601 Ga0496104_0877151 3300048907 Bacteria 802
602 Ga0496104_1149751 3300048907 Bacteria 680
603 Ga0496104_1528605 3300048907 Bacteria 570
604 Ga0496104_1723267 3300048907 Bacteria 529
605 Ga0496105_0096230 3300048908 Bacteria 2445
606 Ga0496105_0672910 3300048908 Bacteria 797
607 Ga0496105_0791532 3300048908 Bacteria 722
608 Ga0496105_0805483 3300048908 Bacteria 714
609 Ga0496106_1374099 3300048909 Bacteria 546
610 Ga0496107_0126090 3300048910 Bacteria 1888
611 Ga0496108_0048893 3300048911 Bacteria 3537
612 Ga0496108_0446455 3300048911 Bacteria 1130
613 Ga0496108_1042862 3300048911 Bacteria 697
614 Ga0496109_0954148 3300048912 Bacteria 795
615 Ga0496110_0216609 3300048913 Bacteria 1741
616 Ga0496111_0402489 3300048914 Bacteria 1011
617 Ga0496113_0639166 3300048916 Bacteria 851
618 Ga0496113_1329193 3300048916 Bacteria 558
619 Ga0496114_0183723 3300048917 Bacteria 1827
620 Ga0496114_0317906 3300048917 Bacteria 1375
621 Ga0496115_0703040 3300048918 Bacteria 794
622 Ga0496116_0001739 3300048919 Bacteria 23720
623 Ga0496117_0027016 3300048920 Bacteria 4479
624 Ga0496118_0000359 3300048921 Bacteria 77146
625 Ga0496118_0040681 3300048921 Bacteria 3693
626 Ga0496118_0046572 3300048921 Bacteria 3371
627 Ga0496118_0104172 3300048921 Bacteria 1905
628 Ga0496119_0000855 3300048922 Bacteria 40135
629 Ga0496119_0014521 3300048922 Bacteria 6154
630 Ga0496119_0020106 3300048922 Bacteria 4882
631 Ga0496120_0000372 3300048923 Bacteria 72951
632 Ga0496120_0219854 3300048923 Bacteria 908
633 Ga0496121_0013339 3300048924 Bacteria 8843
634 Ga0496121_0048393 3300048924 Bacteria 3617
635 Ga0496126_0231208 3300048929 Bacteria 1549
636 Ga0501306_001285 3300049127 Bacteria 2319
637 Ga0501306_002479 3300049127 Bacteria 1896
638 Ga0501306_037217 3300049127 Bacteria 744
639 Ga0501306_041690 3300049127 Bacteria 714
640 Ga0501308_014057 3300049128 Bacteria 932
641 Ga0501309_001533 3300049129 Bacteria 2299
642 Ga0501310_002257 3300049130 Bacteria 1820
643 Ga0501310_015292 3300049130 Bacteria 909
644 Ga0501310_023831 3300049130 Bacteria 780
645 Ga0501304_000819 3300049160 Bacteria 1796
646 Ga0501304_019525 3300049160 Bacteria 662
647 Ga0501305_009204 3300049161 Bacteria 1294
648 Ga0501305_015320 3300049161 Bacteria 1082
649 Ga0501305_025799 3300049161 Bacteria 893
650 Ga0501305_066565 3300049161 Bacteria 628
651 Ga0501307_005481 3300049162 Bacteria 1339
652 Ga0501307_008933 3300049162 Bacteria 1137
653 Ga0501307_009579 3300049162 Bacteria 1109
654 Ga0501311_000597 3300049527 Bacteria 2637
655 Ga0501311_029531 3300049527 Bacteria 787
656 Ga0501311_078820 3300049527 Bacteria 557
657 Ga0501312_001837 3300049528 Bacteria 2184
658 Ga0501313_000328 3300049529 Bacteria 3055
659 Ga0501314_005184 3300049530 Bacteria 1103
660 Ga0501314_005250 3300049530 Bacteria 1098
661 Ga0501315_000243 3300049531 Bacteria 3402
662 Ga0501315_014041 3300049531 Bacteria 1010
663 Ga0501315_021352 3300049531 Bacteria 876
664 Ga0501315_081123 3300049531 Bacteria 551
665 Ga0501316_002447 3300049532 Bacteria 1718
666 Ga0501316_026425 3300049532 Bacteria 760
667 Ga0501316_038014 3300049532 Bacteria 663
668 Ga0501316_075151 3300049532 Bacteria 516
669 Ga0501317_000282 3300049533 Bacteria 3286
670 Ga0501317_015074 3300049533 Bacteria 988
671 Ga0501317_017825 3300049533 Bacteria 934
672 Ga0501317_027117 3300049533 Bacteria 812
673 Ga0501318_000119 3300049534 Bacteria 3651
674 Ga0501318_029316 3300049534 Bacteria 741
675 Ga0501318_049585 3300049534 Bacteria 621
676 Ga0501319_001265 3300049535 Bacteria 1428
677 Ga0501320_000186 3300049536 Bacteria 3154
678 Ga0501320_000755 3300049536 Bacteria 2053
679 Ga0501320_004388 3300049536 Bacteria 1244
680 Ga0501321_002301 3300049537 Bacteria 1642
681 Ga0501321_005600 3300049537 Bacteria 1248
682 Ga0501321_028860 3300049537 Bacteria 732
683 Ga0501322_001303 3300049538 Bacteria 1379
684 Ga0501322_002966 3300049538 Bacteria 1073
685 Ga0501322_006978 3300049538 Bacteria 814
686 Ga0501323_001192 3300049539 Bacteria 2228
687 Ga0501323_010056 3300049539 Bacteria 1123
688 Ga0501323_017099 3300049539 Bacteria 929
689 Ga0501323_026907 3300049539 Bacteria 790
690 Ga0501324_000083 3300049540 Bacteria 3478
691 Ga0501324_001843 3300049540 Bacteria 1472
692 Ga0501324_003168 3300049540 Bacteria 1245
693 Ga0501324_011359 3300049540 Bacteria 822
694 Ga0501324_017437 3300049540 Bacteria 712
695 Ga0501325_009559 3300049541 Bacteria 863
696 Ga0501031_0010894 3300049568 Bacteria 5922
697 Ga0501031_0213047 3300049568 Bacteria 1258
698 Ga0501031_0223452 3300049568 Bacteria 1226
699 Ga0501032_0001347 3300049569 Bacteria 19514
700 Ga0501032_0002622 3300049569 Bacteria 14061
701 Ga0501032_0021244 3300049569 Bacteria 4514
702 Ga0501032_0072160 3300049569 Bacteria 2301
703 Ga0501032_0194673 3300049569 Bacteria 1324
704 Ga0501033_0053340 3300049570 Bacteria 2994
705 Ga0501033_0055262 3300049570 Bacteria 2935
706 Ga0501033_0067467 3300049570 Bacteria 2630
707 Ga0501033_0157907 3300049570 Bacteria 1633
708 Ga0501033_0215801 3300049570 Bacteria 1367
709 Ga0501033_0498729 3300049570 Bacteria 842
710 Ga0501034_0011858 3300049571 Bacteria 9022
711 Ga0501034_0017758 3300049571 Bacteria 7296
712 Ga0501034_0039901 3300049571 Bacteria 4755
713 Ga0501034_0147492 3300049571 Bacteria 2329
714 Ga0501034_0154851 3300049571 Bacteria 2266
715 Ga0501034_0461188 3300049571 Bacteria 1187
716 Ga0501034_0507480 3300049571 Bacteria 1119
717 Ga0501036_0005851 3300049572 Bacteria 9958
718 Ga0501036_0012989 3300049572 Bacteria 6914
719 Ga0501036_0034382 3300049572 Bacteria 4286
720 Ga0501036_0193864 3300049572 Bacteria 1709
721 Ga0501036_0728855 3300049572 Bacteria 818
722 Ga0501037_0003123 3300049573 Bacteria 12009
723 Ga0501037_0018283 3300049573 Bacteria 5164
724 Ga0501037_0064068 3300049573 Bacteria 2679
725 Ga0501038_0008698 3300049574 Bacteria 9320
726 Ga0501038_0031768 3300049574 Bacteria 4664
727 Ga0501038_0163095 3300049574 Bacteria 1809
728 Ga0501039_0015102 3300049575 Bacteria 5908
729 Ga0501039_0023714 3300049575 Bacteria 4709
730 Ga0501039_0210458 3300049575 Bacteria 1529
731 Ga0501039_0584517 3300049575 Bacteria 876
732 Ga0501039_0768942 3300049575 Bacteria 752
733 Ga0501040_0008475 3300049576 Bacteria 6677
734 Ga0501040_0860682 3300049576 Bacteria 656
735 Ga0501041_0009850 3300049577 Bacteria 5627
736 Ga0501041_0518724 3300049577 Bacteria 759
737 Ga0501041_0642533 3300049577 Bacteria 678
738 Ga0501042_0021020 3300049578 Bacteria 4544
739 Ga0501042_0037805 3300049578 Bacteria 3426
740 Ga0501042_0320729 3300049578 Bacteria 1119
741 Ga0501042_1248859 3300049578 Bacteria 542
742 Ga0501043_0005651 3300049579 Bacteria 10076
743 Ga0501043_0176539 3300049579 Bacteria 1665
744 Ga0501043_0178224 3300049579 Bacteria 1656
745 Ga0501043_0408922 3300049579 Bacteria 1024
746 Ga0501043_1100598 3300049579 Bacteria 561
747 Ga0501046_0002011 3300049580 Bacteria 19297
748 Ga0501046_0124048 3300049580 Bacteria 1963
749 Ga0501047_0000005 3300049581 Bacteria 456524
750 Ga0501047_0000278 3300049581 Bacteria 59271
751 Ga0501047_0004445 3300049581 Bacteria 13204
752 Ga0501047_0067707 3300049581 Bacteria 3440
753 Ga0501047_0087734 3300049581 Bacteria 2989
754 Ga0501047_0281796 3300049581 Bacteria 1506
755 Ga0501047_0284524 3300049581 Bacteria 1497
756 Ga0501048_0001026 3300049582 Bacteria 20878
757 Ga0501048_0120527 3300049582 Bacteria 1853
758 Ga0501048_0669896 3300049582 Bacteria 745
759 Ga0501048_0681329 3300049582 Bacteria 738
760 Ga0501067_0000592 3300049583 Bacteria 19503
761 Ga0501067_0431140 3300049583 Bacteria 736
762 Ga0501068_0001668 3300049584 Bacteria 11862
763 Ga0501068_0124538 3300049584 Bacteria 1609
764 Ga0501068_0697278 3300049584 Bacteria 664
765 Ga0501069_0003831 3300049585 Bacteria 7749
766 Ga0501070_0000089 3300049586 Bacteria 77368
767 Ga0501070_0021842 3300049586 Bacteria 5362
768 Ga0501070_0025003 3300049586 Bacteria 5008
769 Ga0501070_0162235 3300049586 Bacteria 1842
770 Ga0501070_0425216 3300049586 Bacteria 1072
771 Ga0501070_0806179 3300049586 Bacteria 737
772 Ga0501071_0008674 3300049587 Bacteria 6724
773 Ga0501071_0011550 3300049587 Bacteria 5959
774 Ga0501071_0718294 3300049587 Bacteria 769
775 Ga0501072_0001152 3300049588 Bacteria 19660
776 Ga0501072_0589979 3300049588 Bacteria 876
777 Ga0501072_0609189 3300049588 Bacteria 861
778 Ga0501073_0078941 3300049589 Bacteria 2290
779 Ga0501074_0005219 3300049590 Bacteria 9340
780 Ga0501074_0011734 3300049590 Bacteria 6369
781 Ga0501074_0026050 3300049590 Bacteria 4241
782 Ga0501074_0507749 3300049590 Bacteria 854
783 Ga0501075_1549946 3300049591 Bacteria 501
784 Ga0501076_0051723 3300049592 Bacteria 3252
785 Ga0501077_0087819 3300049593 Bacteria 1970
786 Ga0501202_019719 3300049652 Bacteria 1335
787 Ga0501217_044712 3300049661 Bacteria 1138
788 Ga0501250_032907 3300049680 Bacteria 728
789 Ga0501257_106123 3300049686 Bacteria 741
790 Ga0501221_181713 3300049704 Bacteria 575
791 Ga0501079_0023462 3300049741 Bacteria 4733
792 Ga0501079_0285006 3300049741 Bacteria 1292
793 Ga0501080_0002681 3300049742 Bacteria 15586
794 Ga0501080_0004649 3300049742 Bacteria 12241
795 Ga0501080_0007063 3300049742 Bacteria 10140
796 Ga0501080_0094218 3300049742 Bacteria 2781
797 Ga0501080_0364990 3300049742 Bacteria 1302
798 Ga0501081_0361548 3300049743 Bacteria 1071
799 Ga0501083_0004200 3300049744 Bacteria 10143
800 Ga0501035_0006472 3300049822 Bacteria 11004
801 Ga0501035_0042008 3300049822 Bacteria 4125
802 Ga0501035_0045844 3300049822 Bacteria 3932
803 Ga0501035_0062362 3300049822 Bacteria 3317
804 Ga0501035_0145280 3300049822 Bacteria 2060
805 Ga0501035_0500276 3300049822 Bacteria 1000
806 Ga0501044_0000425 3300049823 Bacteria 52201
807 Ga0501044_0005788 3300049823 Bacteria 13687
808 Ga0501044_0013601 3300049823 Bacteria 8795
809 Ga0501044_0064165 3300049823 Bacteria 3750
810 Ga0501044_1198351 3300049823 Bacteria 627
811 Ga0501044_1642641 3300049823 Bacteria 507
812 Ga0501045_0079425 3300049824 Bacteria 2418
813 Ga0501045_0282589 3300049824 Bacteria 1235
814 nmdc:mga03n38_275355_c1 3300050490 Bacteria 897
815 nmdc:mga00v17_382505_c1 3300050491 Bacteria 915
816 nmdc:mga00v17_937_c1 3300050491 Bacteria 15681
817 nmdc:mga0k408_221211_c1 3300050493 Bacteria 1130
818 nmdc:mga06z11_27935_c1 3300050494 Bacteria 2702
819 nmdc:mga04h51_1822_c1 3300050495 Bacteria 4980
820 nmdc:mga04h51_230696_c1 3300050495 Bacteria 736
821 nmdc:mga07m45_19238_c1 3300050496 Bacteria 1941
822 nmdc:mga07m45_20663_c1 3300050496 Bacteria 3577
823 nmdc:mga09592_535318_c1 3300050508 Bacteria 1007
824 nmdc:mga09592_70174_c1 3300050508 Bacteria 2973
825 nmdc:mga0qj67_248168_c1 3300050509 Bacteria 1444
826 nmdc:mga06r32_228853_c1 3300050510 Bacteria 1847
827 nmdc:mga06r32_328695_c1 3300050510 Bacteria 1514
828 nmdc:mga0sz30_5215_c1 3300050516 Bacteria 3169
829 Ga0495601_0019194 3300053077 Bacteria 4167
830 Ga0495601_0097418 3300053077 Bacteria 1898
831 Ga0495612_0003894 3300053078 Bacteria 6188
832 Ga0495612_0033956 3300053078 Bacteria 2065
833 Ga0495612_0114248 3300053078 Bacteria 1158
834 Ga0500610_0035276 3300053079 Bacteria 2564
835 Ga0495655_0063403 3300053083 Bacteria 1014
836 Ga0495655_0095229 3300053083 Bacteria 873
837 Ga0495655_0097352 3300053083 Bacteria 866
838 Ga0495655_0303268 3300053083 Bacteria 549
839 Ga0495655_0375449 3300053083 Bacteria 501
840 Ga0495619_0016029 3300053085 Bacteria 4744
841 Ga0495619_0044831 3300053085 Bacteria 2904
842 Ga0495619_0239380 3300053085 Bacteria 1258
843 Ga0495619_0382459 3300053085 Bacteria 973
844 Ga0500644_0019335 3300053088 Bacteria 2009
845 Ga0500644_0338151 3300053088 Bacteria 650
846 Ga0500647_0039633 3300053091 Bacteria 2259
847 Ga0500583_0062555 3300053092 Bacteria 1761
848 Ga0500583_0131398 3300053092 Bacteria 1242
849 Ga0500566_0227339 3300053094 Bacteria 923
850 Ga0500640_018648 3300053095 Bacteria 2962
851 Ga0500660_108747 3300053100 Bacteria 1188
852 Ga0500553_035854 3300053101 Bacteria 2456
853 Ga0500562_034742 3300053108 Bacteria 1334
854 Ga0500572_004783 3300053111 Bacteria 3069
855 Ga0500608_059636 3300053122 Bacteria 1825
856 Ga0500614_080617 3300053123 Bacteria 910
857 Ga0500618_101516 3300053125 Bacteria 648
858 Ga0500628_055816 3300053129 Bacteria 951
859 Ga0500642_0078535 3300053130 Bacteria 1512
860 Ga0500642_0267373 3300053130 Bacteria 781
861 Ga0500652_244217 3300053131 Bacteria 713
862 Ga0500655_082250 3300053133 Bacteria 663
863 Ga0500573_0482656 3300053140 Bacteria 564
864 Ga0500577_0093719 3300053142 Bacteria 1218
865 Ga0500586_066611 3300053145 Bacteria 1258
866 Ga0500616_0063036 3300053153 Bacteria 1913
867 Ga0500624_001345 3300053157 Bacteria 4158
868 Ga0500634_0081366 3300053161 Bacteria 1668
869 Ga0500636_0224281 3300053177 Bacteria 977
870 Ga0501084_0001550 3300054114 Bacteria 18271
871 Ga0501084_0426431 3300054114 Bacteria 1121
872 Ga0501084_0443129 3300054114 Bacteria 1098
873 Ga0587084_020516 3300059477 Bacteria 983
874 Ga0587084_040445 3300059477 Bacteria 790
875 Ga0587084_047703 3300059477 Bacteria 749
876 Ga0587073_0019682 3300059492 Bacteria 1278
877 Ga0587073_0117642 3300059492 Bacteria 713
878 Ga0587077_081037 3300059493 Bacteria 745
879 Ga0587080_017869 3300059503 Bacteria 1134
880 Ga0587082_022970 3300059504 Bacteria 1031
881 Ga0587082_053755 3300059504 Bacteria 776
882 Ga0587082_164409 3300059504 Bacteria 534
883 Ga0587083_0090540 3300059505 Bacteria 745
884 Ga0587085_050956 3300059506 Bacteria 754
885 Ga0587085_083532 3300059506 Bacteria 647
886 Ga0587086_009836 3300059507 Bacteria 1145
887 Ga0587088_047833 3300059508 Bacteria 828
888 Ga0587088_069038 3300059508 Bacteria 733
889 Ga0587090_042555 3300059510 Bacteria 805
890 Ga0587092_042458 3300059512 Bacteria 796
891 Ga0587092_051993 3300059512 Bacteria 745
892 Ga0587095_006161 3300059514 Bacteria 926
893 Ga0587095_017025 3300059514 Bacteria 671
894 Ga0587098_006769 3300059604 Bacteria 1173
895 Ga0587106_015835 3300059605 Bacteria 1059
896 Ga0587129_015014 3300059608 Bacteria 642
897 Ga0587101_056672 3300059623 Bacteria 689
898 Ga0587101_149617 3300059623 Bacteria 505
899 Ga0587109_094454 3300059624 Bacteria 679
900 Ga0587115_013310 3300059626 Bacteria 1063
901 Ga0587117_079424 3300059627 Bacteria 595
902 Ga0587122_001696 3300059628 Bacteria 1484
903 Ga0587062_013640 3300059639 Bacteria 1061
904 Ga0587067_017595 3300059640 Bacteria 1189
905 Ga0587067_036608 3300059640 Bacteria 934
906 Ga0587068_007908 3300059641 Bacteria 1528
907 Ga0587072_137080 3300059643 Bacteria 581
908 Ga0587075_014952 3300059644 Bacteria 1087
909 Ga0587076_008284 3300059645 Bacteria 1447
910 Ga0587100_005415 3300059648 Bacteria 949
911 Ga0587100_008942 3300059648 Bacteria 819
912 Ga0587100_035933 3300059648 Bacteria 543
913 Ga0587102_010002 3300059649 Bacteria 930
914 Ga0587107_003716 3300059652 Bacteria 1501
915 Ga0587108_006945 3300059653 Bacteria 887
916 Ga0587114_009440 3300059655 Bacteria 1169
917 Ga0587114_060338 3300059655 Bacteria 664
918 Ga0587119_017129 3300059658 Bacteria 893
919 Ga0587071_008622 3300060344 Bacteria 1657
920 Ga0587071_023819 3300060344 Bacteria 1139
921 Ga0587111_0020096 3300060346 Bacteria 1274
922 Ga0587111_0061905 3300060346 Bacteria 853
923 Ga0587111_0076183 3300060346 Bacteria 793
924 Ga0587111_0273527 3300060346 Bacteria 508
925 Ga0501082_0044117 3300060353 Bacteria 3846
926 Ga0501082_0109969 3300060353 Bacteria 2386
927 Ga0501082_0392570 3300060353 Bacteria 1211
928 Ga0466962_0000779 3300061719 Bacteria 14329
929 Ga0466962_0004946 3300061719 Bacteria 6409
930 Ga0466962_0008164 3300061719 Bacteria 5019
931 Ga0530510_0060320 3300061734 Bacteria 2745
932 Ga0530510_0925468 3300061734 Bacteria 666

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0321893 Ga0466967_0321893_20_352 97
2 3300053108 Ga0500562_034742 Ga0500562_034742_123_455 97
3 3300053130 Ga0500642_0078535 Ga0500642_0078535_638_970 97
4 3300041460 Ga0451802_0369205 Ga0451802_0369205_40_378 100
5 3300049579 Ga0501043_0176539 Ga0501043_0176539_582_914 101
6 3300020070 Ga0206356_10880070 Ga0206356_108800701 105
7 3300047319 Ga0495674_1096470 Ga0495674_1096470_237_575 105
8 3300048918 Ga0496115_0703040 Ga0496115_0703040_426_764 105
9 3300053083 Ga0495655_0375449 Ga0495655_0375449_105_485 105
10 3300044684 Ga0466966_0548959 Ga0466966_0548959_321_683 107
11 3300044765 Ga0466970_0003004 Ga0466970_0003004_74_436 107
12 3300049570 Ga0501033_0067467 Ga0501033_0067467_1358_1720 107
13 3300049571 Ga0501034_0507480 Ga0501034_0507480_354_716 107
14 3300049572 Ga0501036_0728855 Ga0501036_0728855_394_756 107
15 3300049581 Ga0501047_0067707 Ga0501047_0067707_2310_2672 107
16 3300049822 Ga0501035_0006472 Ga0501035_0006472_2610_2972 107
17 3300049823 Ga0501044_0000425 Ga0501044_0000425_8033_8395 107
18 3300025944 Ga0207661_10721492 Ga0207661_107214922 109
19 3300039453 Ga0436362_0399705 Ga0436362_0399705_49_420 109
20 3300006038 Ga0075365_10244325 Ga0075365_102443252 111
21 3300006048 Ga0075363_100018785 Ga0075363_1000187851 111
22 3300006051 Ga0075364_10008222 Ga0075364_100082223 111
23 3300006186 Ga0075369_10014830 Ga0075369_100148302 111
24 3300006353 Ga0075370_10119183 Ga0075370_101191833 111
25 3300021388 Ga0213875_10050952 Ga0213875_100509521 111
26 3300037853 Ga0436364_0424211 Ga0436364_0424211_423_797 111
27 3300044693 Ga0466961_0051070 Ga0466961_0051070_2195_2569 111
28 3300044735 Ga0466968_0019909 Ga0466968_0019909_1970_2344 111
29 3300044842 Ga0466957_0203573 Ga0466957_0203573_390_764 111
30 3300045049 Ga0466959_0032055 Ga0466959_0032055_3138_3512 111
31 3300045836 Ga0466958_0195593 Ga0466958_0195593_503_877 111
32 3300048905 Ga0496102_0064536 Ga0496102_0064536_841_1215 111
33 3300048906 Ga0496103_0024379 Ga0496103_0024379_2947_3321 111
34 3300048921 Ga0496118_0000359 Ga0496118_0000359_22650_23024 111
35 3300050491 nmdc:mga00v17_937_c1 nmdc:mga00v17_937_c1_3180_3554 111
36 3300050495 nmdc:mga04h51_230696_c1 nmdc:mga04h51_230696_c1_112_486 111
37 3300050496 nmdc:mga07m45_19238_c1 nmdc:mga07m45_19238_c1_1272_1646 111
38 3300050516 nmdc:mga0sz30_5215_c1 nmdc:mga0sz30_5215_c1_160_534 111
39 3300041509 Ga0451843_1340122 Ga0451843_1340122_1146_1526 113
40 3300049538 Ga0501322_006978 Ga0501322_006978_158_526 113
41 3300004803 Ga0058862_10127495 Ga0058862_101274952 114
42 3300033180 Ga0307510_10206325 Ga0307510_102063253 114
43 3300041461 Ga0451805_128977 Ga0451805_128977_804_1184 114
44 3300041503 Ga0451847_0358713 Ga0451847_0358713_218_598 114
45 3300044765 Ga0466970_0751525 Ga0466970_0751525_177_557 114
46 3300045836 Ga0466958_0261995 Ga0466958_0261995_319_699 114
47 3300049569 Ga0501032_0072160 Ga0501032_0072160_1513_1893 114
48 3300049578 Ga0501042_1248859 Ga0501042_1248859_109_489 114
49 3300014326 Ga0157380_10213417 Ga0157380_102134174 115
50 3300021388 Ga0213875_10001291 Ga0213875_1000129117 115
51 3300037853 Ga0436364_1354648 Ga0436364_1354648_41400_41798 115
52 3300044712 Ga0453684_0949489 Ga0453684_0949489_177_542 115
53 iso_pu_bacteria 2956939328 2956940996 115
54 iso_pu_bacteria 3001119090 3001120689 115
55 3300005543 Ga0070672_100332582 Ga0070672_1003325822 116
56 3300014968 Ga0157379_10388618 Ga0157379_103886183 116
57 3300053129 Ga0500628_055816 Ga0500628_055816_560_937 116
58 3300059653 Ga0587108_006945 Ga0587108_006945_226_606 116
59 3300003308 Ga0006777J48905_1016128 Ga0006777J48905_10161282 117
60 3300003316 rootH1_10087441 rootH1_100874412 117
61 3300003323 rootH1_10044574 rootH1_100445741 117
62 3300004799 Ga0058863_10085417 Ga0058863_100854171 117
63 3300004800 Ga0058861_10106487 Ga0058861_101064871 117
64 3300005334 Ga0068869_100883330 Ga0068869_1008833302 117
65 3300005434 Ga0070709_11011019 Ga0070709_110110191 117
66 3300006178 Ga0075367_10075343 Ga0075367_100753434 117
67 3300011119 Ga0105246_10434317 Ga0105246_104343172 117
68 3300025932 Ga0207690_11281629 Ga0207690_112816292 117
69 3300025986 Ga0207658_10002262 Ga0207658_100022622 117
70 3300028786 Ga0307517_10006905 Ga0307517_1000690528 117
71 3300028794 Ga0307515_10107145 Ga0307515_101071453 117
72 3300028794 Ga0307515_10255141 Ga0307515_102551412 117
73 3300030521 Ga0307511_10017698 Ga0307511_1001769811 117
74 3300030522 Ga0307512_10083358 Ga0307512_100833584 117
75 3300030522 Ga0307512_10197589 Ga0307512_101975891 117
76 3300031456 Ga0307513_10342355 Ga0307513_103423553 117
77 3300031507 Ga0307509_10411162 Ga0307509_104111621 117
78 3300031616 Ga0307508_10115798 Ga0307508_101157983 117
79 3300031649 Ga0307514_10121653 Ga0307514_101216533 117
80 3300031649 Ga0307514_10219817 Ga0307514_102198172 117
81 3300031730 Ga0307516_10594784 Ga0307516_105947842 117
82 3300031838 Ga0307518_10578106 Ga0307518_105781061 117
83 3300033179 Ga0307507_10024930 Ga0307507_100249303 117
84 3300033179 Ga0307507_10025585 Ga0307507_100255854 117
85 3300033180 Ga0307510_10090689 Ga0307510_100906893 117
86 3300039062 Ga0400483_019574 Ga0400483_019574_4139_4507 117
87 3300041458 Ga0451798_0882651 Ga0451798_0882651_169_552 117
88 3300046454 Ga0495592_0011378 Ga0495592_0011378_3231_3611 117
89 3300046459 Ga0495629_0247996 Ga0495629_0247996_636_1016 117
90 3300046460 Ga0495638_0119177 Ga0495638_0119177_429_809 117
91 3300046462 Ga0495651_0011730 Ga0495651_0011730_726_1106 117
92 3300046463 Ga0495653_0317694 Ga0495653_0317694_309_689 117
93 3300046473 Ga0495582_0156632 Ga0495582_0156632_106_486 117
94 3300046475 Ga0495639_0235128 Ga0495639_0235128_336_716 117
95 3300046476 Ga0495662_0005288 Ga0495662_0005288_280_660 117
96 3300046476 Ga0495662_0018980 Ga0495662_0018980_621_1001 117
97 3300046477 Ga0495664_0072068 Ga0495664_0072068_1433_1813 117
98 3300046499 Ga0495594_0143365 Ga0495594_0143365_548_928 117
99 3300046499 Ga0495594_0211202 Ga0495594_0211202_251_631 117
100 3300046512 Ga0495610_0340423 Ga0495610_0340423_88_468 117
101 3300046517 Ga0495630_0087245 Ga0495630_0087245_1187_1567 117
102 3300046518 Ga0495631_0238779 Ga0495631_0238779_260_640 117
103 3300046529 Ga0495652_0319361 Ga0495652_0319361_245_625 117
104 3300046533 Ga0495640_0124534 Ga0495640_0124534_17_397 117
105 3300046535 Ga0495586_0223039 Ga0495586_0223039_31_411 117
106 3300046536 Ga0495587_0000793 Ga0495587_0000793_19952_20332 117
107 3300046543 Ga0495645_0007022 Ga0495645_0007022_3793_4173 117
108 3300046557 Ga0495622_0017744 Ga0495622_0017744_155_535 117
109 3300046559 Ga0495667_0337720 Ga0495667_0337720_455_823 117
110 3300046559 Ga0495667_0481324 Ga0495667_0481324_17_397 117
111 3300046642 Ga0495634_0005875 Ga0495634_0005875_725_1105 117
112 3300046660 Ga0495625_0095757 Ga0495625_0095757_1164_1544 117
113 3300046660 Ga0495625_0261981 Ga0495625_0261981_170_550 117
114 3300046663 Ga0495635_0015642 Ga0495635_0015642_719_1099 117
115 3300046674 Ga0495588_0026982 Ga0495588_0026982_2214_2594 117
116 3300046674 Ga0495588_0160161 Ga0495588_0160161_770_1150 117
117 3300046675 Ga0495657_0014293 Ga0495657_0014293_338_718 117
118 3300046678 Ga0495599_0183912 Ga0495599_0183912_854_1234 117
119 3300046679 Ga0495623_0054899 Ga0495623_0054899_1114_1494 117
120 3300046679 Ga0495623_0242477 Ga0495623_0242477_139_519 117
121 3300046680 Ga0495646_0009635 Ga0495646_0009635_5478_5858 117
122 3300046683 Ga0495658_0120358 Ga0495658_0120358_741_1121 117
123 3300046689 Ga0495613_0263347 Ga0495613_0263347_232_612 117
124 3300046690 Ga0495624_0278293 Ga0495624_0278293_278_658 117
125 3300046691 Ga0495670_0561469 Ga0495670_0561469_176_556 117
126 3300046809 Ga0495600_0055477 Ga0495600_0055477_338_718 117
127 3300047315 Ga0495581_0131774 Ga0495581_0131774_734_1114 117
128 3300047317 Ga0495604_0013519 Ga0495604_0013519_1592_1972 117
129 3300047317 Ga0495604_0015097 Ga0495604_0015097_687_1067 117
130 3300047318 Ga0495636_0188804 Ga0495636_0188804_158_538 117
131 3300047319 Ga0495674_0262273 Ga0495674_0262273_725_1105 117
132 3300047321 Ga0495676_0059662 Ga0495676_0059662_249_629 117
133 3300047443 Ga0495687_015578 Ga0495687_015578_512_892 117
134 3300047444 Ga0495675_0013484 Ga0495675_0013484_3800_4180 117
135 3300047444 Ga0495675_0295316 Ga0495675_0295316_534_914 117
136 3300047447 Ga0495685_063453 Ga0495685_063453_589_969 117
137 3300047447 Ga0495685_183751 Ga0495685_183751_263_643 117
138 3300047447 Ga0495685_193437 Ga0495685_193437_133_513 117
139 3300047470 Ga0495681_0011573 Ga0495681_0011573_865_1245 117
140 3300047471 Ga0495684_0340967 Ga0495684_0340967_507_887 117
141 3300047472 Ga0495686_0066423 Ga0495686_0066423_717_1097 117
142 3300047673 Ga0495593_0005852 Ga0495593_0005852_5655_6035 117
143 3300048088 Ga0495602_0083799 Ga0495602_0083799_617_997 117
144 3300048089 Ga0495614_0023593 Ga0495614_0023593_1976_2356 117
145 3300048908 Ga0496105_0096230 Ga0496105_0096230_1857_2237 117
146 3300048909 Ga0496106_1374099 Ga0496106_1374099_122_502 117
147 3300048911 Ga0496108_1042862 Ga0496108_1042862_214_594 117
148 3300048912 Ga0496109_0954148 Ga0496109_0954148_225_605 117
149 3300049127 Ga0501306_001285 Ga0501306_001285_891_1271 117
150 3300049130 Ga0501310_002257 Ga0501310_002257_504_884 117
151 3300049160 Ga0501304_000819 Ga0501304_000819_733_1113 117
152 3300049162 Ga0501307_008933 Ga0501307_008933_503_883 117
153 3300049527 Ga0501311_000597 Ga0501311_000597_677_1057 117
154 3300049529 Ga0501313_000328 Ga0501313_000328_2312_2692 117
155 3300049530 Ga0501314_005250 Ga0501314_005250_411_791 117
156 3300049531 Ga0501315_000243 Ga0501315_000243_640_1020 117
157 3300049532 Ga0501316_002447 Ga0501316_002447_445_825 117
158 3300049533 Ga0501317_000282 Ga0501317_000282_925_1305 117
159 3300049534 Ga0501318_000119 Ga0501318_000119_2388_2768 117
160 3300049535 Ga0501319_001265 Ga0501319_001265_362_742 117
161 3300049536 Ga0501320_000755 Ga0501320_000755_680_1060 117
162 3300049538 Ga0501322_001303 Ga0501322_001303_413_793 117
163 3300049539 Ga0501323_001192 Ga0501323_001192_920_1300 117
164 3300049540 Ga0501324_000083 Ga0501324_000083_2382_2762 117
165 3300049652 Ga0501202_019719 Ga0501202_019719_915_1295 117
166 3300049661 Ga0501217_044712 Ga0501217_044712_176_556 117
167 3300049686 Ga0501257_106123 Ga0501257_106123_28_408 117
168 3300049704 Ga0501221_181713 Ga0501221_181713_169_549 117
169 3300050491 nmdc:mga00v17_382505_c1 nmdc:mga00v17_382505_c1_48_428 117
170 3300053078 Ga0495612_0033956 Ga0495612_0033956_323_703 117
171 3300053079 Ga0500610_0035276 Ga0500610_0035276_1316_1696 117
172 3300053083 Ga0495655_0095229 Ga0495655_0095229_368_748 117
173 3300053088 Ga0500644_0019335 Ga0500644_0019335_44_424 117
174 3300053088 Ga0500644_0338151 Ga0500644_0338151_96_464 117
175 3300053091 Ga0500647_0039633 Ga0500647_0039633_1370_1750 117
176 3300053092 Ga0500583_0131398 Ga0500583_0131398_301_681 117
177 3300053094 Ga0500566_0227339 Ga0500566_0227339_159_539 117
178 3300053095 Ga0500640_018648 Ga0500640_018648_1869_2249 117
179 3300053100 Ga0500660_108747 Ga0500660_108747_280_660 117
180 3300053101 Ga0500553_035854 Ga0500553_035854_1821_2201 117
181 3300053111 Ga0500572_004783 Ga0500572_004783_742_1122 117
182 3300053122 Ga0500608_059636 Ga0500608_059636_984_1364 117
183 3300053123 Ga0500614_080617 Ga0500614_080617_404_784 117
184 3300053125 Ga0500618_101516 Ga0500618_101516_13_393 117
185 3300053130 Ga0500642_0267373 Ga0500642_0267373_361_741 117
186 3300053131 Ga0500652_244217 Ga0500652_244217_231_611 117
187 3300053133 Ga0500655_082250 Ga0500655_082250_219_599 117
188 3300053142 Ga0500577_0093719 Ga0500577_0093719_211_591 117
189 3300053145 Ga0500586_066611 Ga0500586_066611_785_1165 117
190 3300053157 Ga0500624_001345 Ga0500624_001345_2682_3062 117
191 3300053161 Ga0500634_0081366 Ga0500634_0081366_904_1284 117
192 3300053177 Ga0500636_0224281 Ga0500636_0224281_391_771 117
193 3300059512 Ga0587092_042458 Ga0587092_042458_361_741 117
194 3300059514 Ga0587095_017025 Ga0587095_017025_264_644 117
195 3300059641 Ga0587068_007908 Ga0587068_007908_415_795 117
196 3300059648 Ga0587100_035933 Ga0587100_035933_45_425 117
197 3300059652 Ga0587107_003716 Ga0587107_003716_688_1068 117
198 iso_pu_bacteria 2506783011 2506868501 117
199 iso_pu_bacteria 2508501039 2508670615 117
200 iso_pu_bacteria 2515154155 2515851639 117
201 iso_pu_bacteria 2517572101 2517762559 117
202 iso_pu_bacteria 2527291627 2528204305 117
203 iso_pu_bacteria 2527291629 2528212125 117
204 iso_pu_bacteria 2546825537 2546946876 117
205 iso_pu_bacteria 2558860280 2559428752 117
206 iso_pu_bacteria 2576861822 2579747614 117
207 iso_pu_bacteria 2579778521 2579853579 117
208 iso_pu_bacteria 2619618881 2619853740 117
209 iso_pu_bacteria 2619619003 2620349866 117
210 iso_pu_bacteria 2626541554 2626634914 117
211 iso_pu_bacteria 2643221587 2643941973 117
212 iso_pu_bacteria 2643221670 2644389596 117
213 iso_pu_bacteria 2643221677 2644429056 117
214 iso_pu_bacteria 2671180195 2671835719 117
215 iso_pu_bacteria 2675902999 2676199457 117
216 iso_pu_bacteria 2684623035 2686539256 117
217 iso_pu_bacteria 2684623036 2686543608 117
218 iso_pu_bacteria 2687453737 2689960393 117
219 iso_pu_bacteria 2687453743 2689992372 117
220 iso_pu_bacteria 2710264753 2710602537 117
221 iso_pu_bacteria 2721755702 2723643130 117
222 iso_pu_bacteria 2728369276 2729906656 117
223 iso_pu_bacteria 2731639228 2731908949 117
224 iso_pu_bacteria 2751185734 2753069957 117
225 iso_pu_bacteria 2773857921 2774844035 117
226 iso_pu_bacteria 2773857922 2774853875 117
227 iso_pu_bacteria 2773857924 2774866998 117
228 iso_pu_bacteria 2773857933 2774902882 117
229 iso_pu_bacteria 2784746768 2785370798 117
230 iso_pu_bacteria 2786546132 2786671982 117
231 iso_pu_bacteria 2799112218 2799184978 117
232 iso_pu_bacteria 2808606375 2808912948 117
233 iso_pu_bacteria 2861520306 2861525554 117
234 iso_pu_bacteria 2862574272 2862578153 117
235 iso_pu_bacteria 2870721527 2870727546 117
236 iso_pu_bacteria 2877676314 2877679780 117
237 iso_pu_bacteria 2895880812 2895884587 117
238 iso_pu_bacteria 2918501144 2918505854 117
239 iso_pu_bacteria 2919443155 2919445575 117
240 iso_pu_bacteria 2935409751 2935412140 117
241 iso_pu_bacteria 2954002825 2954003149 117
242 iso_pu_bacteria 2954380949 2954384710 117
243 iso_pu_bacteria 2954673503 2954678254 117
244 iso_pu_bacteria 2954682443 2954685903 117
245 iso_pu_bacteria 3006321560 3006326196 117
246 iso_pu_bacteria 637000116 637877940 117
247 iso_pu_bacteria 8002775197 8002782915 117
248 iso_pu_bacteria 8047710418 8047717755 117
249 iso_pu_bacteria 8054913762 8054918450 117
250 iso_pu_bacteria 8054920844 8054926309 117
251 iso_pu_bacteria 8055157932 8055160622 117
252 iso_pu_bacteria 8057568493 8057570075 117
253 3300003579 Ga0007429J51699_1098508 Ga0007429J51699_10985081 118
254 3300004801 Ga0058860_10229221 Ga0058860_102292211 118
255 3300005456 Ga0070678_101138709 Ga0070678_1011387091 118
256 3300006353 Ga0075370_10088385 Ga0075370_100883854 118
257 3300009174 Ga0105241_10796030 Ga0105241_107960301 118
258 3300025934 Ga0207686_10589347 Ga0207686_105893472 118
259 3300025937 Ga0207669_10278193 Ga0207669_102781932 118
260 3300044694 Ga0466963_0143823 Ga0466963_0143823_417_797 118
261 3300044842 Ga0466957_0297570 Ga0466957_0297570_514_894 118
262 3300045976 Ga0466967_0841565 Ga0466967_0841565_52_432 118
263 3300046460 Ga0495638_0105562 Ga0495638_0105562_1115_1495 118
264 3300046463 Ga0495653_0828413 Ga0495653_0828413_149_526 118
265 3300046675 Ga0495657_0866061 Ga0495657_0866061_20_400 118
266 3300046684 Ga0495669_0047578 Ga0495669_0047578_661_1038 118
267 3300049576 Ga0501040_0860682 Ga0501040_0860682_60_434 118
268 3300049577 Ga0501041_0642533 Ga0501041_0642533_271_645 118
269 3300049582 Ga0501048_0669896 Ga0501048_0669896_164_535 118
270 3300050490 nmdc:mga03n38_275355_c1 nmdc:mga03n38_275355_c1_195_575 118
271 3300050496 nmdc:mga07m45_20663_c1 nmdc:mga07m45_20663_c1_919_1299 118
272 3300053083 Ga0495655_0063403 Ga0495655_0063403_247_627 118
273 3300054114 Ga0501084_0443129 Ga0501084_0443129_483_857 118
274 3300060353 Ga0501082_0109969 Ga0501082_0109969_1609_1983 118
275 3300061734 Ga0530510_0060320 Ga0530510_0060320_611_985 118
276 3300003354 JGI25160J50197_1013781 JGI25160J50197_10137813 119
277 3300003354 JGI25160J50197_1026569 JGI25160J50197_10265692 119
278 3300003575 Ga0007409J51694_1027373 Ga0007409J51694_10273731 119
279 3300003579 Ga0007429J51699_1077728 Ga0007429J51699_10777282 119
280 3300005435 Ga0070714_101424383 Ga0070714_1014243832 119
281 3300005458 Ga0070681_10448711 Ga0070681_104487112 119
282 3300005614 Ga0068856_102522922 Ga0068856_1025229221 119
283 3300006028 Ga0070717_10294088 Ga0070717_102940883 119
284 3300006175 Ga0070712_100506623 Ga0070712_1005066232 119
285 3300006847 Ga0075431_100657837 Ga0075431_1006578372 119
286 3300006880 Ga0075429_100140830 Ga0075429_1001408304 119
287 3300014497 Ga0182008_10354699 Ga0182008_103546991 119
288 3300014969 Ga0157376_10865869 Ga0157376_108658692 119
289 3300021388 Ga0213875_10001257 Ga0213875_1000125713 119
290 3300025297 Ga0209758_1000870 Ga0209758_100087047 119
291 3300025302 Ga0207426_1005272 Ga0207426_10052726 119
292 3300025302 Ga0207426_1012521 Ga0207426_10125213 119
293 3300025302 Ga0207426_1061190 Ga0207426_10611901 119
294 3300025303 Ga0209051_1121767 Ga0209051_11217672 119
295 3300025906 Ga0207699_10275966 Ga0207699_102759662 119
296 3300025912 Ga0207707_10241686 Ga0207707_102416862 119
297 3300025915 Ga0207693_10451024 Ga0207693_104510242 119
298 3300031616 Ga0307508_10000924 Ga0307508_1000092419 119
299 3300035725 Ga0373947_0204412 Ga0373947_0204412_177_557 119
300 3300037068 Ga0373925_0106577 Ga0373925_0106577_809_1189 119
301 3300037853 Ga0436364_0010700 Ga0436364_0010700_82913_83293 119
302 3300045049 Ga0466959_0743902 Ga0466959_0743902_118_498 119
303 3300045836 Ga0466958_0849536 Ga0466958_0849536_57_437 119
304 3300045976 Ga0466967_0075222 Ga0466967_0075222_336_716 119
305 3300045976 Ga0466967_0188862 Ga0466967_0188862_157_537 119
306 3300046454 Ga0495592_0002384 Ga0495592_0002384_7128_7508 119
307 3300046459 Ga0495629_0037614 Ga0495629_0037614_143_523 119
308 3300046459 Ga0495629_0498077 Ga0495629_0498077_70_450 119
309 3300046462 Ga0495651_0002063 Ga0495651_0002063_12568_12948 119
310 3300046463 Ga0495653_0023969 Ga0495653_0023969_1962_2342 119
311 3300046472 Ga0495580_0005827 Ga0495580_0005827_1093_1473 119
312 3300046476 Ga0495662_0002247 Ga0495662_0002247_3499_3879 119
313 3300046476 Ga0495662_0190885 Ga0495662_0190885_286_666 119
314 3300046477 Ga0495664_0002322 Ga0495664_0002322_655_1035 119
315 3300046511 Ga0495608_0014048 Ga0495608_0014048_2190_2570 119
316 3300046516 Ga0495628_0007000 Ga0495628_0007000_6007_6387 119
317 3300046517 Ga0495630_0015711 Ga0495630_0015711_3507_3887 119
318 3300046526 Ga0495666_0000307 Ga0495666_0000307_17642_18022 119
319 3300046529 Ga0495652_0030154 Ga0495652_0030154_2747_3127 119
320 3300046531 Ga0495665_0013217 Ga0495665_0013217_1506_1886 119
321 3300046533 Ga0495640_0027443 Ga0495640_0027443_969_1349 119
322 3300046535 Ga0495586_0065641 Ga0495586_0065641_730_1110 119
323 3300046536 Ga0495587_0139260 Ga0495587_0139260_752_1132 119
324 3300046543 Ga0495645_0002261 Ga0495645_0002261_12064_12444 119
325 3300046543 Ga0495645_0300633 Ga0495645_0300633_141_521 119
326 3300046559 Ga0495667_0034555 Ga0495667_0034555_2747_3127 119
327 3300046559 Ga0495667_0837715 Ga0495667_0837715_153_533 119
328 3300046642 Ga0495634_0044010 Ga0495634_0044010_1052_1432 119
329 3300046663 Ga0495635_0067659 Ga0495635_0067659_966_1346 119
330 3300046663 Ga0495635_0613993 Ga0495635_0613993_110_490 119
331 3300046675 Ga0495657_0024880 Ga0495657_0024880_3495_3875 119
332 3300046678 Ga0495599_0031629 Ga0495599_0031629_2190_2570 119
333 3300046679 Ga0495623_0030831 Ga0495623_0030831_2318_2698 119
334 3300046680 Ga0495646_0061524 Ga0495646_0061524_752_1132 119
335 3300046689 Ga0495613_0037419 Ga0495613_0037419_969_1349 119
336 3300046689 Ga0495613_0675840 Ga0495613_0675840_21_401 119
337 3300046809 Ga0495600_0068521 Ga0495600_0068521_976_1356 119
338 3300047315 Ga0495581_0105647 Ga0495581_0105647_562_942 119
339 3300047317 Ga0495604_0000113 Ga0495604_0000113_4334_4714 119
340 3300047319 Ga0495674_0018748 Ga0495674_0018748_3246_3626 119
341 3300047444 Ga0495675_0017801 Ga0495675_0017801_2747_3127 119
342 3300047444 Ga0495675_0487073 Ga0495675_0487073_214_594 119
343 3300047471 Ga0495684_0004072 Ga0495684_0004072_6850_7230 119
344 3300047673 Ga0495593_0054339 Ga0495593_0054339_740_1120 119
345 3300048088 Ga0495602_0014250 Ga0495602_0014250_976_1356 119
346 3300048905 Ga0496102_0000840 Ga0496102_0000840_26381_26761 119
347 3300048905 Ga0496102_0384958 Ga0496102_0384958_634_1014 119
348 3300048906 Ga0496103_0042936 Ga0496103_0042936_1043_1423 119
349 3300048907 Ga0496104_0877151 Ga0496104_0877151_86_466 119
350 3300048911 Ga0496108_0048893 Ga0496108_0048893_1682_2062 119
351 3300048913 Ga0496110_0216609 Ga0496110_0216609_500_880 119
352 3300048916 Ga0496113_1329193 Ga0496113_1329193_112_492 119
353 3300048917 Ga0496114_0317906 Ga0496114_0317906_431_811 119
354 3300048929 Ga0496126_0231208 Ga0496126_0231208_670_1050 119
355 3300050508 nmdc:mga09592_70174_c1 nmdc:mga09592_70174_c1_1360_1740 119
356 3300053077 Ga0495601_0019194 Ga0495601_0019194_1025_1405 119
357 3300053078 Ga0495612_0114248 Ga0495612_0114248_518_898 119
358 3300053085 Ga0495619_0016029 Ga0495619_0016029_1377_1757 119
359 3300053085 Ga0495619_0239380 Ga0495619_0239380_448_828 119
360 3300053140 Ga0500573_0482656 Ga0500573_0482656_14_394 119
361 3300005331 Ga0070670_100338738 Ga0070670_1003387383 120
362 3300005334 Ga0068869_100018620 Ga0068869_1000186206 120
363 3300005347 Ga0070668_100196908 Ga0070668_1001969082 120
364 3300005354 Ga0070675_100194727 Ga0070675_1001947273 120
365 3300005356 Ga0070674_100077936 Ga0070674_1000779363 120
366 3300005367 Ga0070667_102079642 Ga0070667_1020796421 120
367 3300005438 Ga0070701_10390157 Ga0070701_103901572 120
368 3300005456 Ga0070678_100314920 Ga0070678_1003149202 120
369 3300005618 Ga0068864_101053908 Ga0068864_1010539082 120
370 3300006195 Ga0075366_10481228 Ga0075366_104812282 120
371 3300007265 Ga0099794_10369792 Ga0099794_103697921 120
372 3300009098 Ga0105245_10575897 Ga0105245_105758972 120
373 3300009148 Ga0105243_10162470 Ga0105243_101624702 120
374 3300009148 Ga0105243_10994620 Ga0105243_109946202 120
375 3300009177 Ga0105248_12584018 Ga0105248_125840181 120
376 3300009553 Ga0105249_10687247 Ga0105249_106872471 120
377 3300010375 Ga0105239_12859172 Ga0105239_128591721 120
378 3300013104 Ga0157370_12126253 Ga0157370_121262531 120
379 3300013297 Ga0157378_10490338 Ga0157378_104903383 120
380 3300013297 Ga0157378_11560850 Ga0157378_115608502 120
381 3300014745 Ga0157377_10543637 Ga0157377_105436372 120
382 3300025901 Ga0207688_10041350 Ga0207688_100413503 120
383 3300025909 Ga0207705_10003438 Ga0207705_100034385 120
384 3300025920 Ga0207649_10604024 Ga0207649_106040242 120
385 3300025923 Ga0207681_11787568 Ga0207681_117875681 120
386 3300025924 Ga0207694_11063285 Ga0207694_110632851 120
387 3300025926 Ga0207659_10145326 Ga0207659_101453263 120
388 3300025927 Ga0207687_10380765 Ga0207687_103807651 120
389 3300025940 Ga0207691_10220168 Ga0207691_102201683 120
390 3300025942 Ga0207689_10020564 Ga0207689_100205645 120
391 3300025960 Ga0207651_10189905 Ga0207651_101899053 120
392 3300025961 Ga0207712_10119117 Ga0207712_101191172 120
393 3300025972 Ga0207668_10264527 Ga0207668_102645272 120
394 3300025986 Ga0207658_12136008 Ga0207658_121360081 120
395 3300026023 Ga0207677_11416085 Ga0207677_114160852 120
396 3300026121 Ga0207683_10691384 Ga0207683_106913843 120
397 3300028380 Ga0268265_10373786 Ga0268265_103737863 120
398 3300031727 Ga0316576_10109103 Ga0316576_101091034 120
399 3300031727 Ga0316576_10350768 Ga0316576_103507682 120
400 3300031731 Ga0307405_10309324 Ga0307405_103093241 120
401 3300031733 Ga0316577_10165966 Ga0316577_101659663 120
402 3300031911 Ga0307412_10692764 Ga0307412_106927641 120
403 3300031995 Ga0307409_100651764 Ga0307409_1006517642 120
404 3300032002 Ga0307416_100583936 Ga0307416_1005839362 120
405 3300032126 Ga0307415_100049757 Ga0307415_1000497575 120
406 3300034819 Ga0373958_0132797 Ga0373958_0132797_61_438 120
407 3300035398 Ga0316574_0197315 Ga0316574_0197315_823_1200 120
408 3300035398 Ga0316574_0631025 Ga0316574_0631025_150_527 120
409 3300036647 Ga0316582_0184816 Ga0316582_0184816_459_836 120
410 3300036712 Ga0316584_0038993 Ga0316584_0038993_2051_2428 120
411 3300041496 Ga0451839_0534569 Ga0451839_0534569_729_1106 120
412 3300041512 Ga0451853_1319955 Ga0451853_1319955_1247_1624 120
413 3300041512 Ga0451853_1446781 Ga0451853_1446781_184_561 120
414 3300046461 Ga0495641_0474423 Ga0495641_0474423_154_531 120
415 3300046511 Ga0495608_0465813 Ga0495608_0465813_113_490 120
416 3300047322 Ga0495680_0551908 Ga0495680_0551908_251_628 120
417 3300048907 Ga0496104_0761824 Ga0496104_0761824_426_803 120
418 3300048908 Ga0496105_0672910 Ga0496105_0672910_284_661 120
419 3300048914 Ga0496111_0402489 Ga0496111_0402489_70_447 120
420 3300048917 Ga0496114_0183723 Ga0496114_0183723_1123_1500 120
421 3300049161 Ga0501305_066565 Ga0501305_066565_51_428 120
422 3300049527 Ga0501311_078820 Ga0501311_078820_32_409 120
423 3300049532 Ga0501316_026425 Ga0501316_026425_335_712 120
424 3300049533 Ga0501317_027117 Ga0501317_027117_262_639 120
425 3300049537 Ga0501321_005600 Ga0501321_005600_457_834 120
426 3300049541 Ga0501325_009559 Ga0501325_009559_369_746 120
427 3300049568 Ga0501031_0223452 Ga0501031_0223452_226_603 120
428 3300049569 Ga0501032_0002622 Ga0501032_0002622_9096_9473 120
429 3300049570 Ga0501033_0215801 Ga0501033_0215801_322_699 120
430 3300049570 Ga0501033_0498729 Ga0501033_0498729_353_730 120
431 3300049571 Ga0501034_0039901 Ga0501034_0039901_624_1001 120
432 3300049571 Ga0501034_0461188 Ga0501034_0461188_394_771 120
433 3300049572 Ga0501036_0193864 Ga0501036_0193864_299_676 120
434 3300049573 Ga0501037_0003123 Ga0501037_0003123_8199_8576 120
435 3300049574 Ga0501038_0031768 Ga0501038_0031768_2846_3223 120
436 3300049575 Ga0501039_0210458 Ga0501039_0210458_915_1292 120
437 3300049579 Ga0501043_0408922 Ga0501043_0408922_46_423 120
438 3300049581 Ga0501047_0087734 Ga0501047_0087734_1987_2364 120
439 3300049584 Ga0501068_0697278 Ga0501068_0697278_167_544 120
440 3300049586 Ga0501070_0025003 Ga0501070_0025003_3069_3446 120
441 3300049586 Ga0501070_0806179 Ga0501070_0806179_30_407 120
442 3300049588 Ga0501072_0589979 Ga0501072_0589979_419_796 120
443 3300049590 Ga0501074_0026050 Ga0501074_0026050_1053_1430 120
444 3300049742 Ga0501080_0007063 Ga0501080_0007063_6301_6678 120
445 3300049822 Ga0501035_0062362 Ga0501035_0062362_1843_2220 120
446 3300049823 Ga0501044_0005788 Ga0501044_0005788_12908_13285 120
447 3300050493 nmdc:mga0k408_221211_c1 nmdc:mga0k408_221211_c1_435_812 120
448 3300059624 Ga0587109_094454 Ga0587109_094454_284_661 120
449 3300059655 Ga0587114_060338 Ga0587114_060338_232_609 120
450 3300001989 JGI24739J22299_10012589 JGI24739J22299_100125893 121
451 3300001990 JGI24737J22298_10004109 JGI24737J22298_100041093 121
452 3300002067 JGI24735J21928_10037966 JGI24735J21928_100379662 121
453 3300002075 JGI24738J21930_10009088 JGI24738J21930_100090882 121
454 3300003203 JGI25406J46586_10054419 JGI25406J46586_100544193 121
455 3300003574 Ga0007410J51695_1079086 Ga0007410J51695_10790861 121
456 3300003575 Ga0007409J51694_1095426 Ga0007409J51694_10954262 121
457 3300004785 Ga0058858_1005032 Ga0058858_10050322 121
458 3300004798 Ga0058859_11826058 Ga0058859_118260581 121
459 3300004799 Ga0058863_10169109 Ga0058863_101691091 121
460 3300004799 Ga0058863_11770428 Ga0058863_117704282 121
461 3300004800 Ga0058861_10162069 Ga0058861_101620691 121
462 3300004800 Ga0058861_10186282 Ga0058861_101862821 121
463 3300004800 Ga0058861_11881892 Ga0058861_118818921 121
464 3300004801 Ga0058860_10025829 Ga0058860_100258292 121
465 3300004801 Ga0058860_10028160 Ga0058860_100281602 121
466 3300004801 Ga0058860_10106898 Ga0058860_101068981 121
467 3300004801 Ga0058860_10115660 Ga0058860_101156601 121
468 3300004803 Ga0058862_10191375 Ga0058862_101913751 121
469 3300004803 Ga0058862_12724420 Ga0058862_127244201 121
470 3300005327 Ga0070658_10786068 Ga0070658_107860682 121
471 3300005331 Ga0070670_101097127 Ga0070670_1010971272 121
472 3300005334 Ga0068869_100940981 Ga0068869_1009409811 121
473 3300005338 Ga0068868_100702561 Ga0068868_1007025611 121
474 3300005343 Ga0070687_101127276 Ga0070687_1011272761 121
475 3300005434 Ga0070709_10111103 Ga0070709_101111032 121
476 3300005435 Ga0070714_100182078 Ga0070714_1001820783 121
477 3300005436 Ga0070713_100075640 Ga0070713_1000756403 121
478 3300005437 Ga0070710_10000334 Ga0070710_1000033417 121
479 3300005439 Ga0070711_100127812 Ga0070711_1001278123 121
480 3300005539 Ga0068853_101415438 Ga0068853_1014154381 121
481 3300005547 Ga0070693_101327412 Ga0070693_1013274121 121
482 3300005614 Ga0068856_100081044 Ga0068856_1000810443 121
483 3300005617 Ga0068859_100034160 Ga0068859_1000341604 121
484 3300005617 Ga0068859_100092242 Ga0068859_1000922425 121
485 3300005841 Ga0068863_100001338 Ga0068863_10000133815 121
486 3300005842 Ga0068858_100000010 Ga0068858_100000010154 121
487 3300005842 Ga0068858_100010928 Ga0068858_1000109284 121
488 3300005844 Ga0068862_100000362 Ga0068862_10000036243 121
489 3300005937 Ga0081455_10006542 Ga0081455_1000654223 121
490 3300005983 Ga0081540_1245936 Ga0081540_12459362 121
491 3300005985 Ga0081539_10002050 Ga0081539_100020506 121
492 3300005985 Ga0081539_10021084 Ga0081539_100210844 121
493 3300006042 Ga0075368_10003605 Ga0075368_100036056 121
494 3300006178 Ga0075367_10172232 Ga0075367_101722323 121
495 3300006846 Ga0075430_100325169 Ga0075430_1003251692 121
496 3300006847 Ga0075431_100246785 Ga0075431_1002467852 121
497 3300006931 Ga0097620_100034160 Ga0097620_1000341604 121
498 3300006931 Ga0097620_100092239 Ga0097620_1000922392 121
499 3300006948 Ga0099826_10027493 Ga0099826_100274934 121
500 3300009036 Ga0105244_10100475 Ga0105244_101004752 121
501 3300009093 Ga0105240_10204243 Ga0105240_102042434 121
502 3300009094 Ga0111539_11717097 Ga0111539_117170972 121
503 3300009101 Ga0105247_10000016 Ga0105247_10000016203 121
504 3300009101 Ga0105247_10212251 Ga0105247_102122513 121
505 3300009177 Ga0105248_10000035 Ga0105248_10000035124 121
506 3300009177 Ga0105248_10002899 Ga0105248_100028997 121
507 3300009177 Ga0105248_13437596 Ga0105248_134375962 121
508 3300009553 Ga0105249_10068762 Ga0105249_100687624 121
509 3300010375 Ga0105239_11608217 Ga0105239_116082171 121
510 3300010375 Ga0105239_13205203 Ga0105239_132052031 121
511 3300011119 Ga0105246_10002569 Ga0105246_1000256912 121
512 3300012490 Ga0157322_1013348 Ga0157322_10133481 121
513 3300013059 Ga0154012_109278 Ga0154012_1092781 121
514 3300013062 Ga0154010_148221 Ga0154010_1482211 121
515 3300013296 Ga0157374_10520828 Ga0157374_105208284 121
516 3300013308 Ga0157375_11093622 Ga0157375_110936223 121
517 3300014325 Ga0163163_10010268 Ga0163163_100102684 121
518 3300014325 Ga0163163_12067520 Ga0163163_120675201 121
519 3300014497 Ga0182008_10009535 Ga0182008_100095356 121
520 3300014968 Ga0157379_10009461 Ga0157379_100094613 121
521 3300014968 Ga0157379_10101600 Ga0157379_101016003 121
522 3300014968 Ga0157379_10784670 Ga0157379_107846702 121
523 3300015261 Ga0182006_1012482 Ga0182006_10124825 121
524 3300015262 Ga0182007_10010395 Ga0182007_100103953 121
525 3300015688 Ga0183367_1002 Ga0183367_1002744 121
526 3300020069 Ga0197907_10071147 Ga0197907_100711473 121
527 3300020069 Ga0197907_10456483 Ga0197907_104564835 121
528 3300020069 Ga0197907_10872862 Ga0197907_108728623 121
529 3300020069 Ga0197907_10874185 Ga0197907_108741851 121
530 3300020069 Ga0197907_11028216 Ga0197907_110282162 121
531 3300020070 Ga0206356_10671161 Ga0206356_106711612 121
532 3300020070 Ga0206356_10797342 Ga0206356_107973422 121
533 3300020070 Ga0206356_10946215 Ga0206356_109462154 121
534 3300020071 Ga0206348_113828 Ga0206348_1138282 121
535 3300020075 Ga0206349_1484921 Ga0206349_14849213 121
536 3300020075 Ga0206349_1782543 Ga0206349_17825432 121
537 3300020075 Ga0206349_1815480 Ga0206349_18154802 121
538 3300020076 Ga0206355_1131249 Ga0206355_11312493 121
539 3300020076 Ga0206355_1350876 Ga0206355_13508762 121
540 3300020077 Ga0206351_10013403 Ga0206351_100134032 121
541 3300020077 Ga0206351_10035715 Ga0206351_100357152 121
542 3300020077 Ga0206351_10267213 Ga0206351_102672133 121
543 3300020077 Ga0206351_10945162 Ga0206351_109451623 121
544 3300020078 Ga0206352_10000892 Ga0206352_100008923 121
545 3300020078 Ga0206352_10048704 Ga0206352_100487043 121
546 3300020078 Ga0206352_10486095 Ga0206352_104860952 121
547 3300020078 Ga0206352_10571914 Ga0206352_105719142 121
548 3300020078 Ga0206352_10718751 Ga0206352_107187513 121
549 3300020080 Ga0206350_10201708 Ga0206350_102017082 121
550 3300020080 Ga0206350_10308689 Ga0206350_103086893 121
551 3300020080 Ga0206350_10386703 Ga0206350_103867033 121
552 3300020080 Ga0206350_10762397 Ga0206350_107623971 121
553 3300020080 Ga0206350_11076420 Ga0206350_110764201 121
554 3300020081 Ga0206354_10049783 Ga0206354_100497833 121
555 3300020081 Ga0206354_10458357 Ga0206354_104583573 121
556 3300020081 Ga0206354_10517799 Ga0206354_105177993 121
557 3300020081 Ga0206354_11155240 Ga0206354_111552403 121
558 3300020082 Ga0206353_10186563 Ga0206353_101865632 121
559 3300020082 Ga0206353_10222344 Ga0206353_102223445 121
560 3300020082 Ga0206353_11116048 Ga0206353_111160485 121
561 3300020082 Ga0206353_11628847 Ga0206353_116288472 121
562 3300020610 Ga0154015_1218295 Ga0154015_12182953 121
563 3300020610 Ga0154015_1608521 Ga0154015_16085211 121
564 3300022467 Ga0224712_10000543 Ga0224712_100005437 121
565 3300022467 Ga0224712_10113455 Ga0224712_101134551 121
566 3300022467 Ga0224712_10141630 Ga0224712_101416302 121
567 3300022467 Ga0224712_10182575 Ga0224712_101825752 121
568 3300025728 Ga0207655_1087485 Ga0207655_10874852 121
569 3300025898 Ga0207692_10007633 Ga0207692_100076336 121
570 3300025900 Ga0207710_10000017 Ga0207710_10000017130 121
571 3300025900 Ga0207710_10000048 Ga0207710_1000004810 121
572 3300025901 Ga0207688_10972313 Ga0207688_109723131 121
573 3300025904 Ga0207647_10006322 Ga0207647_100063224 121
574 3300025906 Ga0207699_10027891 Ga0207699_100278914 121
575 3300025909 Ga0207705_10989837 Ga0207705_109898372 121
576 3300025913 Ga0207695_10715601 Ga0207695_107156012 121
577 3300025916 Ga0207663_10047146 Ga0207663_100471462 121
578 3300025918 Ga0207662_10975540 Ga0207662_109755401 121
579 3300025921 Ga0207652_10386953 Ga0207652_103869532 121
580 3300025921 Ga0207652_11042144 Ga0207652_110421441 121
581 3300025926 Ga0207659_11303460 Ga0207659_113034602 121
582 3300025928 Ga0207700_10075738 Ga0207700_100757383 121
583 3300025929 Ga0207664_10003521 Ga0207664_1000352113 121
584 3300025929 Ga0207664_10187099 Ga0207664_101870994 121
585 3300025929 Ga0207664_10823035 Ga0207664_108230351 121
586 3300025933 Ga0207706_10285731 Ga0207706_102857313 121
587 3300025940 Ga0207691_10223984 Ga0207691_102239844 121
588 3300025941 Ga0207711_10000134 Ga0207711_1000013427 121
589 3300025941 Ga0207711_10002995 Ga0207711_100029957 121
590 3300025945 Ga0207679_10912924 Ga0207679_109129242 121
591 3300025961 Ga0207712_10040803 Ga0207712_100408034 121
592 3300025961 Ga0207712_11405517 Ga0207712_114055172 121
593 3300025981 Ga0207640_11328698 Ga0207640_113286981 121
594 3300026023 Ga0207677_11330309 Ga0207677_113303091 121
595 3300026035 Ga0207703_10000002 Ga0207703_10000002117 121
596 3300026035 Ga0207703_10003502 Ga0207703_100035027 121
597 3300026041 Ga0207639_11335699 Ga0207639_113356991 121
598 3300026078 Ga0207702_10123630 Ga0207702_101236302 121
599 3300026078 Ga0207702_10204359 Ga0207702_102043594 121
600 3300026078 Ga0207702_10547570 Ga0207702_105475702 121
601 3300026088 Ga0207641_10002679 Ga0207641_100026797 121
602 3300026116 Ga0207674_10226074 Ga0207674_102260743 121
603 3300027312 Ga0209371_1016429 Ga0209371_10164294 121
604 3300027866 Ga0209813_10004425 Ga0209813_100044253 121
605 3300028380 Ga0268265_10000363 Ga0268265_1000036340 121
606 3300028573 Ga0265334_10003386 Ga0265334_100033864 121
607 3300029282 Ga0311003_147053 Ga0311003_1470532 121
608 3300029285 Ga0310981_1041238 Ga0310981_10412381 121
609 3300030500 Ga0268256_1015007 Ga0268256_10150073 121
610 3300030521 Ga0307511_10100912 Ga0307511_101009123 121
611 3300030731 Ga0316177_1047979 Ga0316177_10479795 121
612 3300030732 Ga0316176_1038867 Ga0316176_10388673 121
613 3300030733 Ga0314311_1019554 Ga0314311_10195543 121
614 3300030733 Ga0314311_1063336 Ga0314311_10633361 121
615 3300030734 Ga0316179_1032206 Ga0316179_10322063 121
616 3300030735 Ga0316178_1099044 Ga0316178_10990442 121
617 3300030736 Ga0316180_1042781 Ga0316180_10427813 121
618 3300030744 Ga0316181_1204309 Ga0316181_12043092 121
619 3300030744 Ga0316181_1229376 Ga0316181_12293761 121
620 3300030745 Ga0316182_1033344 Ga0316182_10333442 121
621 3300030863 Ga0265766_1000574 Ga0265766_10005742 121
622 3300030963 Ga0265768_108547 Ga0265768_1085471 121
623 3300031241 Ga0265325_10040754 Ga0265325_100407544 121
624 3300031247 Ga0265340_10007092 Ga0265340_100070928 121
625 3300031247 Ga0265340_10074702 Ga0265340_100747023 121
626 3300031249 Ga0265339_10047818 Ga0265339_100478184 121
627 3300031344 Ga0265316_10124459 Ga0265316_101244592 121
628 3300031507 Ga0307509_10009247 Ga0307509_1000924716 121
629 3300031548 Ga0307408_102136462 Ga0307408_1021364621 121
630 3300031592 Ga0310117_105392 Ga0310117_1053923 121
631 3300031614 Ga0310103_131967 Ga0310103_1319671 121
632 3300031616 Ga0307508_10031723 Ga0307508_100317237 121
633 3300031616 Ga0307508_10066550 Ga0307508_100665505 121
634 3300031649 Ga0307514_10117565 Ga0307514_101175653 121
635 3300031667 Ga0310111_106844 Ga0310111_1068442 121
636 3300031691 Ga0316579_10000038 Ga0316579_1000003830 121
637 3300031712 Ga0265342_10057885 Ga0265342_100578854 121
638 3300031730 Ga0307516_10034474 Ga0307516_100344742 121
639 3300031731 Ga0307405_10476937 Ga0307405_104769372 121
640 3300031731 Ga0307405_10517444 Ga0307405_105174441 121
641 3300031824 Ga0307413_10556118 Ga0307413_105561181 121
642 3300031824 Ga0307413_11065620 Ga0307413_110656202 121
643 3300031824 Ga0307413_11171584 Ga0307413_111715841 121
644 3300031852 Ga0307410_10137079 Ga0307410_101370792 121
645 3300031901 Ga0307406_10004670 Ga0307406_100046709 121
646 3300031901 Ga0307406_10465426 Ga0307406_104654263 121
647 3300031901 Ga0307406_10754113 Ga0307406_107541132 121
648 3300031901 Ga0307406_11264342 Ga0307406_112643421 121
649 3300031901 Ga0307406_11729656 Ga0307406_117296561 121
650 3300031901 Ga0307406_11867102 Ga0307406_118671021 121
651 3300031903 Ga0307407_10029824 Ga0307407_100298243 121
652 3300031903 Ga0307407_10199153 Ga0307407_101991532 121
653 3300031995 Ga0307409_100330395 Ga0307409_1003303952 121
654 3300031995 Ga0307409_100399841 Ga0307409_1003998412 121
655 3300031995 Ga0307409_100416549 Ga0307409_1004165492 121
656 3300031995 Ga0307409_101081770 Ga0307409_1010817702 121
657 3300031995 Ga0307409_102410040 Ga0307409_1024100401 121
658 3300032002 Ga0307416_100124216 Ga0307416_1001242163 121
659 3300032002 Ga0307416_100721571 Ga0307416_1007215712 121
660 3300032004 Ga0307414_10423502 Ga0307414_104235023 121
661 3300032005 Ga0307411_10148286 Ga0307411_101482864 121
662 3300032005 Ga0307411_10283867 Ga0307411_102838672 121
663 3300032126 Ga0307415_100029200 Ga0307415_1000292007 121
664 3300032126 Ga0307415_100591499 Ga0307415_1005914991 121
665 3300032126 Ga0307415_101146559 Ga0307415_1011465591 121
666 3300033179 Ga0307507_10003799 Ga0307507_100037995 121
667 3300033180 Ga0307510_10229710 Ga0307510_102297103 121
668 3300037312 Ga0395899_0008026 Ga0395899_0008026_3951_4331 121
669 3300037418 Ga0395900_0199314 Ga0395900_0199314_1187_1567 121
670 3300037466 Ga0395898_0026184 Ga0395898_0026184_4602_4982 121
671 3300037466 Ga0395898_0030243 Ga0395898_0030243_4338_4718 121
672 3300038443 Ga0395901_0031729 Ga0395901_0031729_4589_4969 121
673 3300038735 Ga0400485_08169 Ga0400485_08169_21194_21574 121
674 3300038742 Ga0400486_03564 Ga0400486_03564_21184_21564 121
675 3300039437 Ga0436365_0340703 Ga0436365_0340703_988_1368 121
676 3300039450 Ga0436363_0020748 Ga0436363_0020748_120_500 121
677 3300041404 Ga0439436_0003559 Ga0439436_0003559_3241_3621 121
678 3300041404 Ga0439436_0029047 Ga0439436_0029047_900_1280 121
679 3300041406 Ga0439439_0004725 Ga0439439_0004725_1061_1441 121
680 3300041408 Ga0439453_0083764 Ga0439453_0083764_16_396 121
681 3300041410 Ga0439461_0044338 Ga0439461_0044338_301_681 121
682 3300041413 Ga0439465_0069611 Ga0439465_0069611_189_569 121
683 3300041455 Ga0451801_20119 Ga0451801_20119_41_421 121
684 3300041997 Ga0439431_0105579 Ga0439431_0105579_190_570 121
685 3300041999 Ga0439433_0002570 Ga0439433_0002570_3283_3663 121
686 3300041999 Ga0439433_0005893 Ga0439433_0005893_1836_2216 121
687 3300042002 Ga0439442_049219 Ga0439442_049219_302_682 121
688 3300042007 Ga0439449_0009099 Ga0439449_0009099_1047_1427 121
689 3300042007 Ga0439449_0011760 Ga0439449_0011760_700_1080 121
690 3300042008 Ga0439450_071020 Ga0439450_071020_408_788 121
691 3300042011 Ga0439454_012822 Ga0439454_012822_431_811 121
692 3300042012 Ga0439455_0001031 Ga0439455_0001031_2717_3097 121
693 3300042014 Ga0439457_002785 Ga0439457_002785_3645_4025 121
694 3300042014 Ga0439457_068365 Ga0439457_068365_171_551 121
695 3300042015 Ga0439462_0000539 Ga0439462_0000539_927_1307 121
696 3300042127 Ga0450890_006468 Ga0450890_006468_792_1172 121
697 3300042131 Ga0450894_015795 Ga0450894_015795_292_672 121
698 3300042135 Ga0450899_001611 Ga0450899_001611_1200_1580 121
699 3300042136 Ga0450900_015844 Ga0450900_015844_464_844 121
700 3300042138 Ga0450903_000013 Ga0450903_000013_12054_12434 121
701 3300042138 Ga0450903_047020 Ga0450903_047020_66_446 121
702 3300042157 Ga0439458_0000117 Ga0439458_0000117_10314_10694 121
703 3300042157 Ga0439458_0039956 Ga0439458_0039956_399_779 121
704 3300042157 Ga0439458_0083099 Ga0439458_0083099_140_520 121
705 3300042435 Ga0439434_0091373 Ga0439434_0091373_396_776 121
706 3300042435 Ga0439434_0154515 Ga0439434_0154515_322_702 121
707 3300044656 Ga0466969_0024483 Ga0466969_0024483_1142_1567 121
708 3300044656 Ga0466969_0035870 Ga0466969_0035870_2054_2434 121
709 3300044656 Ga0466969_0096611 Ga0466969_0096611_1003_1383 121
710 3300044658 Ga0466972_0004874 Ga0466972_0004874_1911_2291 121
711 3300044658 Ga0466972_0156714 Ga0466972_0156714_375_755 121
712 3300044658 Ga0466972_0272087 Ga0466972_0272087_126_506 121
713 3300044683 Ga0466965_0011265 Ga0466965_0011265_567_947 121
714 3300044684 Ga0466966_0004478 Ga0466966_0004478_4960_5340 121
715 3300044684 Ga0466966_0025877 Ga0466966_0025877_1537_1962 121
716 3300044684 Ga0466966_0038688 Ga0466966_0038688_1082_1462 121
717 3300044693 Ga0466961_0004915 Ga0466961_0004915_4794_5174 121
718 3300044693 Ga0466961_0007268 Ga0466961_0007268_4334_4714 121
719 3300044693 Ga0466961_0139137 Ga0466961_0139137_307_732 121
720 3300044693 Ga0466961_0424699 Ga0466961_0424699_286_666 121
721 3300044693 Ga0466961_0970695 Ga0466961_0970695_107_487 121
722 3300044694 Ga0466963_0097420 Ga0466963_0097420_1001_1381 121
723 3300044694 Ga0466963_0359955 Ga0466963_0359955_457_837 121
724 3300044694 Ga0466963_0464430 Ga0466963_0464430_157_537 121
725 3300044694 Ga0466963_1046536 Ga0466963_1046536_149_529 121
726 3300044706 Ga0466964_0062147 Ga0466964_0062147_347_727 121
727 3300044706 Ga0466964_0390469 Ga0466964_0390469_184_564 121
728 3300044719 Ga0466971_0000019 Ga0466971_0000019_8545_8925 121
729 3300044719 Ga0466971_0007920 Ga0466971_0007920_4002_4382 121
730 3300044719 Ga0466971_0113681 Ga0466971_0113681_47_472 121
731 3300044719 Ga0466971_0365821 Ga0466971_0365821_110_490 121
732 3300044735 Ga0466968_0030937 Ga0466968_0030937_685_1065 121
733 3300044735 Ga0466968_0106395 Ga0466968_0106395_52_432 121
734 3300044735 Ga0466968_0359593 Ga0466968_0359593_92_472 121
735 3300044765 Ga0466970_0039008 Ga0466970_0039008_295_720 121
736 3300044765 Ga0466970_0067568 Ga0466970_0067568_1051_1431 121
737 3300044765 Ga0466970_0158678 Ga0466970_0158678_492_872 121
738 3300044842 Ga0466957_0015619 Ga0466957_0015619_3863_4243 121
739 3300044842 Ga0466957_0045585 Ga0466957_0045585_576_956 121
740 3300044842 Ga0466957_0859709 Ga0466957_0859709_117_497 121
741 3300044842 Ga0466957_1269351 Ga0466957_1269351_95_475 121
742 3300044901 Ga0466960_0005266 Ga0466960_0005266_349_729 121
743 3300044901 Ga0466960_0066960 Ga0466960_0066960_1082_1462 121
744 3300044901 Ga0466960_0103264 Ga0466960_0103264_850_1230 121
745 3300044901 Ga0466960_0294693 Ga0466960_0294693_57_437 121
746 3300044901 Ga0466960_0800708 Ga0466960_0800708_171_551 121
747 3300044901 Ga0466960_0880139 Ga0466960_0880139_43_423 121
748 3300045049 Ga0466959_0004638 Ga0466959_0004638_6676_7056 121
749 3300045049 Ga0466959_0048320 Ga0466959_0048320_596_1021 121
750 3300045049 Ga0466959_0064455 Ga0466959_0064455_1991_2371 121
751 3300045049 Ga0466959_0274074 Ga0466959_0274074_744_1124 121
752 3300045049 Ga0466959_0293401 Ga0466959_0293401_76_456 121
753 3300045049 Ga0466959_0937830 Ga0466959_0937830_94_474 121
754 3300045836 Ga0466958_0000701 Ga0466958_0000701_3875_4255 121
755 3300045836 Ga0466958_0054273 Ga0466958_0054273_1593_1973 121
756 3300045836 Ga0466958_0275195 Ga0466958_0275195_373_753 121
757 3300045976 Ga0466967_0215478 Ga0466967_0215478_337_717 121
758 3300045976 Ga0466967_0308089 Ga0466967_0308089_202_582 121
759 3300045976 Ga0466967_0984587 Ga0466967_0984587_27_407 121
760 3300045976 Ga0466967_1447019 Ga0466967_1447019_68_448 121
761 3300045976 Ga0466967_1623790 Ga0466967_1623790_246_626 121
762 3300046454 Ga0495592_0052602 Ga0495592_0052602_2478_2858 121
763 3300046460 Ga0495638_0024349 Ga0495638_0024349_1664_2044 121
764 3300046462 Ga0495651_0000169 Ga0495651_0000169_33858_34238 121
765 3300046477 Ga0495664_0245293 Ga0495664_0245293_464_844 121
766 3300046491 Ga0495584_0346047 Ga0495584_0346047_215_595 121
767 3300046514 Ga0495618_0347589 Ga0495618_0347589_180_560 121
768 3300046516 Ga0495628_0403214 Ga0495628_0403214_164_544 121
769 3300046522 Ga0495643_0000013 Ga0495643_0000013_64169_64549 121
770 3300046529 Ga0495652_0000728 Ga0495652_0000728_36133_36513 121
771 3300046533 Ga0495640_0237058 Ga0495640_0237058_218_598 121
772 3300046543 Ga0495645_0052372 Ga0495645_0052372_1046_1426 121
773 3300046558 Ga0495633_0327938 Ga0495633_0327938_147_527 121
774 3300046664 Ga0495659_0095751 Ga0495659_0095751_603_983 121
775 3300046678 Ga0495599_0076762 Ga0495599_0076762_1238_1618 121
776 3300046679 Ga0495623_0012719 Ga0495623_0012719_4561_4941 121
777 3300046680 Ga0495646_0021225 Ga0495646_0021225_2034_2414 121
778 3300046694 Ga0495649_0097685 Ga0495649_0097685_788_1168 121
779 3300046809 Ga0495600_0008026 Ga0495600_0008026_3815_4195 121
780 3300047319 Ga0495674_0335241 Ga0495674_0335241_621_1001 121
781 3300048904 Ga0496101_1096877 Ga0496101_1096877_226_606 121
782 3300048905 Ga0496102_1208301 Ga0496102_1208301_107_487 121
783 3300048906 Ga0496103_0690213 Ga0496103_0690213_233_613 121
784 3300048907 Ga0496104_0463699 Ga0496104_0463699_700_1080 121
785 3300048907 Ga0496104_1149751 Ga0496104_1149751_280_660 121
786 3300048907 Ga0496104_1528605 Ga0496104_1528605_115_495 121
787 3300048907 Ga0496104_1723267 Ga0496104_1723267_128_508 121
788 3300048908 Ga0496105_0791532 Ga0496105_0791532_302_682 121
789 3300048908 Ga0496105_0805483 Ga0496105_0805483_58_438 121
790 3300048910 Ga0496107_0126090 Ga0496107_0126090_441_821 121
791 3300048911 Ga0496108_0446455 Ga0496108_0446455_427_807 121
792 3300048916 Ga0496113_0639166 Ga0496113_0639166_155_535 121
793 3300048919 Ga0496116_0001739 Ga0496116_0001739_1307_1687 121
794 3300048920 Ga0496117_0027016 Ga0496117_0027016_1048_1428 121
795 3300048921 Ga0496118_0040681 Ga0496118_0040681_1141_1521 121
796 3300048921 Ga0496118_0046572 Ga0496118_0046572_2752_3132 121
797 3300048921 Ga0496118_0104172 Ga0496118_0104172_332_712 121
798 3300048922 Ga0496119_0000855 Ga0496119_0000855_26461_26841 121
799 3300048922 Ga0496119_0014521 Ga0496119_0014521_1189_1569 121
800 3300048922 Ga0496119_0020106 Ga0496119_0020106_2906_3286 121
801 3300048923 Ga0496120_0000372 Ga0496120_0000372_56902_57282 121
802 3300048923 Ga0496120_0219854 Ga0496120_0219854_306_686 121
803 3300048924 Ga0496121_0013339 Ga0496121_0013339_5403_5783 121
804 3300048924 Ga0496121_0048393 Ga0496121_0048393_1493_1873 121
805 3300049127 Ga0501306_002479 Ga0501306_002479_615_995 121
806 3300049127 Ga0501306_037217 Ga0501306_037217_30_410 121
807 3300049127 Ga0501306_041690 Ga0501306_041690_289_669 121
808 3300049128 Ga0501308_014057 Ga0501308_014057_28_408 121
809 3300049129 Ga0501309_001533 Ga0501309_001533_323_703 121
810 3300049130 Ga0501310_015292 Ga0501310_015292_311_691 121
811 3300049130 Ga0501310_023831 Ga0501310_023831_301_681 121
812 3300049160 Ga0501304_019525 Ga0501304_019525_146_526 121
813 3300049161 Ga0501305_009204 Ga0501305_009204_880_1260 121
814 3300049161 Ga0501305_015320 Ga0501305_015320_237_617 121
815 3300049161 Ga0501305_025799 Ga0501305_025799_212_592 121
816 3300049162 Ga0501307_005481 Ga0501307_005481_692_1072 121
817 3300049162 Ga0501307_009579 Ga0501307_009579_525_905 121
818 3300049527 Ga0501311_029531 Ga0501311_029531_97_477 121
819 3300049528 Ga0501312_001837 Ga0501312_001837_1767_2147 121
820 3300049530 Ga0501314_005184 Ga0501314_005184_54_434 121
821 3300049531 Ga0501315_014041 Ga0501315_014041_327_707 121
822 3300049531 Ga0501315_021352 Ga0501315_021352_342_722 121
823 3300049531 Ga0501315_081123 Ga0501315_081123_18_398 121
824 3300049532 Ga0501316_038014 Ga0501316_038014_40_420 121
825 3300049532 Ga0501316_075151 Ga0501316_075151_78_458 121
826 3300049533 Ga0501317_015074 Ga0501317_015074_315_695 121
827 3300049533 Ga0501317_017825 Ga0501317_017825_323_703 121
828 3300049534 Ga0501318_029316 Ga0501318_029316_25_405 121
829 3300049534 Ga0501318_049585 Ga0501318_049585_94_474 121
830 3300049536 Ga0501320_000186 Ga0501320_000186_782_1162 121
831 3300049536 Ga0501320_004388 Ga0501320_004388_214_594 121
832 3300049537 Ga0501321_002301 Ga0501321_002301_869_1249 121
833 3300049537 Ga0501321_028860 Ga0501321_028860_147_527 121
834 3300049538 Ga0501322_002966 Ga0501322_002966_20_400 121
835 3300049539 Ga0501323_010056 Ga0501323_010056_390_770 121
836 3300049539 Ga0501323_017099 Ga0501323_017099_295_675 121
837 3300049539 Ga0501323_026907 Ga0501323_026907_342_722 121
838 3300049540 Ga0501324_001843 Ga0501324_001843_302_682 121
839 3300049540 Ga0501324_003168 Ga0501324_003168_186_566 121
840 3300049540 Ga0501324_011359 Ga0501324_011359_186_566 121
841 3300049540 Ga0501324_017437 Ga0501324_017437_316_696 121
842 3300049568 Ga0501031_0010894 Ga0501031_0010894_4908_5288 121
843 3300049568 Ga0501031_0213047 Ga0501031_0213047_681_1061 121
844 3300049569 Ga0501032_0001347 Ga0501032_0001347_15244_15624 121
845 3300049569 Ga0501032_0021244 Ga0501032_0021244_187_567 121
846 3300049569 Ga0501032_0194673 Ga0501032_0194673_447_827 121
847 3300049570 Ga0501033_0053340 Ga0501033_0053340_2184_2564 121
848 3300049570 Ga0501033_0055262 Ga0501033_0055262_953_1333 121
849 3300049570 Ga0501033_0157907 Ga0501033_0157907_495_875 121
850 3300049571 Ga0501034_0011858 Ga0501034_0011858_4734_5114 121
851 3300049571 Ga0501034_0017758 Ga0501034_0017758_6186_6566 121
852 3300049571 Ga0501034_0147492 Ga0501034_0147492_598_978 121
853 3300049571 Ga0501034_0154851 Ga0501034_0154851_1291_1671 121
854 3300049572 Ga0501036_0005851 Ga0501036_0005851_1381_1761 121
855 3300049572 Ga0501036_0012989 Ga0501036_0012989_4734_5114 121
856 3300049572 Ga0501036_0034382 Ga0501036_0034382_3161_3541 121
857 3300049573 Ga0501037_0018283 Ga0501037_0018283_3891_4271 121
858 3300049573 Ga0501037_0064068 Ga0501037_0064068_808_1188 121
859 3300049574 Ga0501038_0008698 Ga0501038_0008698_3910_4290 121
860 3300049574 Ga0501038_0163095 Ga0501038_0163095_458_838 121
861 3300049575 Ga0501039_0015102 Ga0501039_0015102_3169_3549 121
862 3300049575 Ga0501039_0023714 Ga0501039_0023714_966_1346 121
863 3300049575 Ga0501039_0584517 Ga0501039_0584517_231_611 121
864 3300049575 Ga0501039_0768942 Ga0501039_0768942_32_412 121
865 3300049576 Ga0501040_0008475 Ga0501040_0008475_2184_2564 121
866 3300049577 Ga0501041_0009850 Ga0501041_0009850_4099_4479 121
867 3300049577 Ga0501041_0518724 Ga0501041_0518724_92_472 121
868 3300049578 Ga0501042_0021020 Ga0501042_0021020_3927_4307 121
869 3300049578 Ga0501042_0037805 Ga0501042_0037805_2261_2641 121
870 3300049578 Ga0501042_0320729 Ga0501042_0320729_206_586 121
871 3300049579 Ga0501043_0005651 Ga0501043_0005651_4912_5292 121
872 3300049579 Ga0501043_0178224 Ga0501043_0178224_732_1112 121
873 3300049579 Ga0501043_1100598 Ga0501043_1100598_25_405 121
874 3300049580 Ga0501046_0002011 Ga0501046_0002011_13967_14347 121
875 3300049580 Ga0501046_0124048 Ga0501046_0124048_839_1219 121
876 3300049581 Ga0501047_0000005 Ga0501047_0000005_5108_5488 121
877 3300049581 Ga0501047_0000278 Ga0501047_0000278_42582_42962 121
878 3300049581 Ga0501047_0004445 Ga0501047_0004445_7762_8142 121
879 3300049581 Ga0501047_0281796 Ga0501047_0281796_581_961 121
880 3300049581 Ga0501047_0284524 Ga0501047_0284524_418_798 121
881 3300049582 Ga0501048_0001026 Ga0501048_0001026_16269_16649 121
882 3300049582 Ga0501048_0120527 Ga0501048_0120527_598_978 121
883 3300049582 Ga0501048_0681329 Ga0501048_0681329_124_504 121
884 3300049583 Ga0501067_0000592 Ga0501067_0000592_15015_15395 121
885 3300049583 Ga0501067_0431140 Ga0501067_0431140_215_595 121
886 3300049584 Ga0501068_0001668 Ga0501068_0001668_4866_5246 121
887 3300049584 Ga0501068_0124538 Ga0501068_0124538_566_946 121
888 3300049585 Ga0501069_0003831 Ga0501069_0003831_3274_3654 121
889 3300049586 Ga0501070_0000089 Ga0501070_0000089_61904_62284 121
890 3300049586 Ga0501070_0021842 Ga0501070_0021842_894_1274 121
891 3300049586 Ga0501070_0162235 Ga0501070_0162235_558_938 121
892 3300049586 Ga0501070_0425216 Ga0501070_0425216_405_785 121
893 3300049587 Ga0501071_0008674 Ga0501071_0008674_894_1274 121
894 3300049587 Ga0501071_0011550 Ga0501071_0011550_645_1025 121
895 3300049587 Ga0501071_0718294 Ga0501071_0718294_65_445 121
896 3300049588 Ga0501072_0001152 Ga0501072_0001152_15248_15628 121
897 3300049588 Ga0501072_0609189 Ga0501072_0609189_45_425 121
898 3300049589 Ga0501073_0078941 Ga0501073_0078941_1801_2181 121
899 3300049590 Ga0501074_0005219 Ga0501074_0005219_781_1161 121
900 3300049590 Ga0501074_0011734 Ga0501074_0011734_3390_3770 121
901 3300049590 Ga0501074_0507749 Ga0501074_0507749_70_450 121
902 3300049591 Ga0501075_1549946 Ga0501075_1549946_40_420 121
903 3300049592 Ga0501076_0051723 Ga0501076_0051723_2573_2953 121
904 3300049593 Ga0501077_0087819 Ga0501077_0087819_856_1236 121
905 3300049680 Ga0501250_032907 Ga0501250_032907_106_486 121
906 3300049741 Ga0501079_0023462 Ga0501079_0023462_4116_4496 121
907 3300049741 Ga0501079_0285006 Ga0501079_0285006_843_1223 121
908 3300049742 Ga0501080_0002681 Ga0501080_0002681_255_635 121
909 3300049742 Ga0501080_0004649 Ga0501080_0004649_635_1015 121
910 3300049742 Ga0501080_0094218 Ga0501080_0094218_1970_2350 121
911 3300049742 Ga0501080_0364990 Ga0501080_0364990_706_1086 121
912 3300049743 Ga0501081_0361548 Ga0501081_0361548_589_969 121
913 3300049744 Ga0501083_0004200 Ga0501083_0004200_1830_2210 121
914 3300049822 Ga0501035_0042008 Ga0501035_0042008_472_852 121
915 3300049822 Ga0501035_0045844 Ga0501035_0045844_1332_1712 121
916 3300049822 Ga0501035_0145280 Ga0501035_0145280_597_977 121
917 3300049822 Ga0501035_0500276 Ga0501035_0500276_443_823 121
918 3300049823 Ga0501044_0013601 Ga0501044_0013601_4519_4899 121
919 3300049823 Ga0501044_0064165 Ga0501044_0064165_2925_3305 121
920 3300049823 Ga0501044_1198351 Ga0501044_1198351_17_397 121
921 3300049823 Ga0501044_1642641 Ga0501044_1642641_38_418 121
922 3300049824 Ga0501045_0079425 Ga0501045_0079425_1929_2309 121
923 3300049824 Ga0501045_0282589 Ga0501045_0282589_365_745 121
924 3300050494 nmdc:mga06z11_27935_c1 nmdc:mga06z11_27935_c1_1134_1514 121
925 3300050495 nmdc:mga04h51_1822_c1 nmdc:mga04h51_1822_c1_1172_1552 121
926 3300050508 nmdc:mga09592_535318_c1 nmdc:mga09592_535318_c1_51_431 121
927 3300050509 nmdc:mga0qj67_248168_c1 nmdc:mga0qj67_248168_c1_553_933 121
928 3300050510 nmdc:mga06r32_228853_c1 nmdc:mga06r32_228853_c1_1147_1527 121
929 3300050510 nmdc:mga06r32_328695_c1 nmdc:mga06r32_328695_c1_1070_1450 121
930 3300053077 Ga0495601_0097418 Ga0495601_0097418_1305_1685 121
931 3300053078 Ga0495612_0003894 Ga0495612_0003894_2971_3351 121
932 3300053083 Ga0495655_0097352 Ga0495655_0097352_282_662 121
933 3300053083 Ga0495655_0303268 Ga0495655_0303268_151_531 121
934 3300053085 Ga0495619_0044831 Ga0495619_0044831_2185_2565 121
935 3300053085 Ga0495619_0382459 Ga0495619_0382459_168_548 121
936 3300053092 Ga0500583_0062555 Ga0500583_0062555_219_599 121
937 3300053153 Ga0500616_0063036 Ga0500616_0063036_630_1010 121
938 3300054114 Ga0501084_0001550 Ga0501084_0001550_14477_14857 121
939 3300054114 Ga0501084_0426431 Ga0501084_0426431_708_1088 121
940 3300059477 Ga0587084_020516 Ga0587084_020516_189_569 121
941 3300059477 Ga0587084_040445 Ga0587084_040445_271_651 121
942 3300059477 Ga0587084_047703 Ga0587084_047703_76_456 121
943 3300059492 Ga0587073_0019682 Ga0587073_0019682_564_944 121
944 3300059492 Ga0587073_0117642 Ga0587073_0117642_287_667 121
945 3300059493 Ga0587077_081037 Ga0587077_081037_324_704 121
946 3300059503 Ga0587080_017869 Ga0587080_017869_335_715 121
947 3300059504 Ga0587082_022970 Ga0587082_022970_631_1011 121
948 3300059504 Ga0587082_053755 Ga0587082_053755_213_593 121
949 3300059504 Ga0587082_164409 Ga0587082_164409_22_402 121
950 3300059505 Ga0587083_0090540 Ga0587083_0090540_251_631 121
951 3300059506 Ga0587085_050956 Ga0587085_050956_177_557 121
952 3300059506 Ga0587085_083532 Ga0587085_083532_88_468 121
953 3300059507 Ga0587086_009836 Ga0587086_009836_482_862 121
954 3300059508 Ga0587088_047833 Ga0587088_047833_84_464 121
955 3300059508 Ga0587088_069038 Ga0587088_069038_320_700 121
956 3300059510 Ga0587090_042555 Ga0587090_042555_30_410 121
957 3300059512 Ga0587092_051993 Ga0587092_051993_323_703 121
958 3300059514 Ga0587095_006161 Ga0587095_006161_323_703 121
959 3300059604 Ga0587098_006769 Ga0587098_006769_518_898 121
960 3300059605 Ga0587106_015835 Ga0587106_015835_133_513 121
961 3300059608 Ga0587129_015014 Ga0587129_015014_61_441 121
962 3300059623 Ga0587101_056672 Ga0587101_056672_242_622 121
963 3300059623 Ga0587101_149617 Ga0587101_149617_83_463 121
964 3300059626 Ga0587115_013310 Ga0587115_013310_276_656 121
965 3300059627 Ga0587117_079424 Ga0587117_079424_166_546 121
966 3300059628 Ga0587122_001696 Ga0587122_001696_412_792 121
967 3300059639 Ga0587062_013640 Ga0587062_013640_244_624 121
968 3300059640 Ga0587067_017595 Ga0587067_017595_306_686 121
969 3300059640 Ga0587067_036608 Ga0587067_036608_407_787 121
970 3300059643 Ga0587072_137080 Ga0587072_137080_17_397 121
971 3300059644 Ga0587075_014952 Ga0587075_014952_109_489 121
972 3300059645 Ga0587076_008284 Ga0587076_008284_711_1091 121
973 3300059648 Ga0587100_005415 Ga0587100_005415_315_695 121
974 3300059648 Ga0587100_008942 Ga0587100_008942_25_405 121
975 3300059649 Ga0587102_010002 Ga0587102_010002_29_409 121
976 3300059655 Ga0587114_009440 Ga0587114_009440_736_1116 121
977 3300059658 Ga0587119_017129 Ga0587119_017129_353_733 121
978 3300060344 Ga0587071_008622 Ga0587071_008622_245_625 121
979 3300060344 Ga0587071_023819 Ga0587071_023819_91_471 121
980 3300060346 Ga0587111_0020096 Ga0587111_0020096_713_1093 121
981 3300060346 Ga0587111_0061905 Ga0587111_0061905_430_810 121
982 3300060346 Ga0587111_0076183 Ga0587111_0076183_234_614 121
983 3300060346 Ga0587111_0273527 Ga0587111_0273527_39_419 121
984 3300060353 Ga0501082_0044117 Ga0501082_0044117_970_1350 121
985 3300060353 Ga0501082_0392570 Ga0501082_0392570_429_809 121
986 3300061719 Ga0466962_0000779 Ga0466962_0000779_6143_6523 121
987 3300061719 Ga0466962_0004946 Ga0466962_0004946_1070_1450 121
988 3300061719 Ga0466962_0008164 Ga0466962_0008164_2087_2512 121
989 3300061734 Ga0530510_0925468 Ga0530510_0925468_217_597 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00416

Ribosomal_S13

Ribosomal protein S13/S18

18

124

0.99

Feature Viewer

pLDDT pTM Quality
70.14 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map