F486990

General Info

Members Datasets Scaffolds Average Seq Length
966 461 919 320

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100077656|Ga0070704_1000776563
Length 369
Sequence MVHSAIGAMVEARRGARIMQSSESHPERRGWGAFGAFSLSGDLPWEAPLARIEARIEELCAFAGELSPERLSEVAALRTEWSTGAHRIYSTLKPWETVFVARHPQRPLVTDYIHHIAQDFCELHGDRFFGDDHAMVTGFGTIGDHRVMIVGHNRGKSLNERVACHFGCAHPEGYRKALSKMQLAAKYGRPIVLLIDTPGAFPGMEAEERGIARAIAANLVAMPKLKVPLIAVVIGEGGSGGALGIGISDRMAMLEHSIFSVISPEGCAAILWKTSAQAKEASEALKLRAPDLLRLKLIDEVIPEPLGGAHRNHAETAGSVERFIVKTLDELSGLPVAQLLEQRYTRLRAMGSFYEQVCDEKFPQVRQAS

Samples

Sample ID Description Type Environment
1 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
2 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
3 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
4 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
5 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
6 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
7 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
8 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
9 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
10 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
11 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
12 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
13 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
14 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
15 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
16 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
17 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
18 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
19 2836160341 Unclassified Planctomycetes Bin 134 Isolate Unclassified
20 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
21 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
22 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
23 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
24 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
25 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
26 2865014394 Pantoea sp. R-71966 Isolate Unclassified
27 2876601092 Pantoea endophytica 596 Isolate Unclassified
28 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
29 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
30 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
31 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
32 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
33 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
34 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
35 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
36 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
37 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
38 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
39 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
40 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
41 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
42 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
43 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
44 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
45 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
46 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
47 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
48 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
49 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
50 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
51 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
52 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
54 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
55 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
56 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
57 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
58 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
59 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
60 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
61 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
62 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
63 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
64 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
65 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
66 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
67 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
68 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
69 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
70 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
71 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
72 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
73 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
74 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
75 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
76 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
77 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
78 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
79 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
80 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
81 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
82 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
83 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
84 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
87 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
88 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
89 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
90 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
91 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
92 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
93 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
94 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
95 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
96 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
97 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
98 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
99 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
100 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
101 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
102 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
103 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
104 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
105 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
106 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
107 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
108 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
109 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
110 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
111 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
112 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
113 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
114 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
115 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
116 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
117 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
118 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
119 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
120 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
121 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
123 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
124 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
125 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
126 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
127 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
128 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
129 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
130 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
131 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
133 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
134 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
135 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
136 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
140 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
141 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
142 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
143 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
144 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
145 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
146 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
151 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
152 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
153 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
154 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
155 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
156 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
157 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
158 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
159 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
160 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
161 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
162 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
163 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
164 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
165 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
166 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
167 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
168 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
169 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
170 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
171 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
172 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
173 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
174 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
222 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
232 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
233 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
234 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
235 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
236 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
237 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
238 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
239 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
240 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
241 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
242 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
243 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
244 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
245 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
246 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
247 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
248 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
249 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
250 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
251 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
252 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
253 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
254 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
255 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
256 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
257 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
258 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
259 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
260 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
261 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
262 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
263 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
264 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
265 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
266 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
267 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
268 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
272 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
273 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
274 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
275 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
276 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
277 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
278 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
279 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
280 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
281 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
282 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
283 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
284 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
285 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
286 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
287 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
288 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
289 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
290 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
291 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
292 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
293 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
294 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
295 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
296 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
297 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
298 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
299 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
300 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
301 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
302 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
303 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
304 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
305 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
306 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
307 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
308 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
309 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
310 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
311 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
312 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
313 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
314 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
315 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
316 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
317 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
318 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
319 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
320 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
321 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
322 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
323 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
324 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
325 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
326 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
327 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
328 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
329 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
330 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
331 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
332 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
333 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
334 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
335 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
336 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
337 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
338 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
339 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
340 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
341 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
342 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
343 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
344 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
345 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
346 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
347 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
348 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
349 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
350 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
351 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
352 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
353 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
354 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
355 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
356 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
357 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
358 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
359 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
360 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
361 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
362 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
363 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
364 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
365 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
366 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
367 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
368 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
369 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
370 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
371 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
372 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
373 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
374 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
375 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
376 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
377 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
378 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
379 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
393 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
394 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
395 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
396 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
397 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
398 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
399 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
400 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
401 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
402 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
403 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
404 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
405 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
406 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
407 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
408 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
409 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
410 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
411 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
412 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
413 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
414 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
415 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
416 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
417 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
418 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
419 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
420 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
421 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
422 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
423 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
424 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
425 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
426 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
427 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
428 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
432 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
433 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
434 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
435 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
436 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
437 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
438 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
439 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
440 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
441 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
442 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
443 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
444 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
445 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
446 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
447 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
448 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
449 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
450 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
451 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
452 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
453 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
454 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
455 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
456 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
457 8004592986 Serratia sp. S119 Isolate Unclassified
458 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
459 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
460 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
461 8055092621 Silvania confinis H4N4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.82
Metatranscriptomes 0.31
Isolates 4.87

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 3.62
Nodule 0.1
Rhizoplane 1.97
Rhizosphere 81.57
Stem 0
Stem Tuber 0.1
Unclassified 12.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000196 3300001989 Bacteria 20012
2 JGI24739J22299_10053845 3300001989 Bacteria 1291
3 JGI24744J21845_10002463 3300002077 Bacteria 3774
4 JGI25162J39368_1002234 3300002737 Bacteria 7913
5 JGI25159J45721_1020372 3300002987 Bacteria 1280
6 JGI25151J46595_10000428 3300003187 Bacteria 41859
7 JGI25151J46595_10000467 3300003187 Bacteria 38656
8 rootH2_10009230 3300003320 Bacteria 4967
9 rootH2_10106945 3300003320 Bacteria 3053
10 rootL2_10282228 3300003322 Bacteria 1283
11 rootH1_10055647 3300003323 Bacteria 19770
12 JGI25160J50197_1011072 3300003354 Bacteria 3221
13 JGI25404J52841_10007605 3300003659 Bacteria 2295
14 Ga0058692_1000321 3300003856 Bacteria 23846
15 Ga0058692_1000737 3300003856 Bacteria 13214
16 Ga0058692_1000823 3300003856 Bacteria 12324
17 Ga0058692_1006137 3300003856 Bacteria 3336
18 Ga0058692_1006713 3300003856 Bacteria 3126
19 Ga0065704_10008623 3300005289 Bacteria 3918
20 Ga0065704_10187406 3300005289 Viruses 1184
21 Ga0065712_10159252 3300005290 Bacteria 1314
22 Ga0065715_10177365 3300005293 Unclassified 1501
23 Ga0065707_10017383 3300005295 Bacteria 2405
24 Ga0070658_10002816 3300005327 Bacteria 14453
25 Ga0070658_10008528 3300005327 Bacteria 8239
26 Ga0070658_10049246 3300005327 Bacteria 3413
27 Ga0070658_10056074 3300005327 Bacteria 3202
28 Ga0070676_10045003 3300005328 Bacteria 2570
29 Ga0070690_100000072 3300005330 Bacteria 48578
30 Ga0070690_100000083 3300005330 Bacteria 46348
31 Ga0070690_100068722 3300005330 Bacteria 2298
32 Ga0070690_100111421 3300005330 Bacteria 1827
33 Ga0070670_100001144 3300005331 Bacteria 21043
34 Ga0070670_100007453 3300005331 Bacteria 9293
35 Ga0070670_100170660 3300005331 Bacteria 1886
36 Ga0068869_100001752 3300005334 Bacteria 12971
37 Ga0068869_100088281 3300005334 Bacteria 2327
38 Ga0070666_10006936 3300005335 Bacteria 6981
39 Ga0070666_10020030 3300005335 Bacteria 4322
40 Ga0070680_100033369 3300005336 Bacteria 4149
41 Ga0070680_100088535 3300005336 Bacteria 2561
42 Ga0070680_100247826 3300005336 Bacteria 1506
43 Ga0068868_100009540 3300005338 Bacteria 6994
44 Ga0070660_100120010 3300005339 Bacteria 2098
45 Ga0070689_100000039 3300005340 Bacteria 81597
46 Ga0070689_100016476 3300005340 Bacteria 5409
47 Ga0070689_100149209 3300005340 Bacteria 1885
48 Ga0070689_100205513 3300005340 Unclassified 1610
49 Ga0070691_10042325 3300005341 Bacteria 2155
50 Ga0070687_100040253 3300005343 Bacteria 2354
51 Ga0070668_100004124 3300005347 Bacteria 10760
52 Ga0070668_100004559 3300005347 Bacteria 10275
53 Ga0070669_100012637 3300005353 Bacteria 5992
54 Ga0070675_100014013 3300005354 Bacteria 6313
55 Ga0070675_100228339 3300005354 Bacteria 1623
56 Ga0070671_100002526 3300005355 Bacteria 14170
57 Ga0070671_100011089 3300005355 Bacteria 7237
58 Ga0070673_100008936 3300005364 Bacteria 6699
59 Ga0070673_100030712 3300005364 Bacteria 4026
60 Ga0070688_100000087 3300005365 Bacteria 46867
61 Ga0070688_100040974 3300005365 Unclassified 2841
62 Ga0070667_100008810 3300005367 Bacteria 8358
63 Ga0070713_100011838 3300005436 Bacteria 6374
64 Ga0070710_10055948 3300005437 Bacteria 2231
65 Ga0070701_10000043 3300005438 Bacteria 32096
66 Ga0070701_10001604 3300005438 Bacteria 8425
67 Ga0070711_100218808 3300005439 Bacteria 1479
68 Ga0070705_100082127 3300005440 Bacteria 1982
69 Ga0070700_100000798 3300005441 Bacteria 15440
70 Ga0070700_100016511 3300005441 Bacteria 4206
71 Ga0070694_100019785 3300005444 Bacteria 4285
72 Ga0070694_100111983 3300005444 Bacteria 1946
73 Ga0070708_100448779 3300005445 Bacteria 1217
74 Ga0070662_100063266 3300005457 Bacteria 2706
75 Ga0070662_100102984 3300005457 Bacteria 2164
76 Ga0070681_10009249 3300005458 Bacteria 9686
77 Ga0068867_100000100 3300005459 Bacteria 55007
78 Ga0068867_100017689 3300005459 Bacteria 5061
79 Ga0068867_100031719 3300005459 Bacteria 3817
80 Ga0070685_10000211 3300005466 Bacteria 38855
81 Ga0070685_10228166 3300005466 Bacteria 1223
82 Ga0070706_100000543 3300005467 Bacteria 43757
83 Ga0070706_100001219 3300005467 Bacteria 27538
84 Ga0070706_100003351 3300005467 Bacteria 15806
85 Ga0070706_100090718 3300005467 Bacteria 2834
86 Ga0070706_100424697 3300005467 Bacteria 1237
87 Ga0070707_100000266 3300005468 Bacteria 51948
88 Ga0070707_100087471 3300005468 Bacteria 3014
89 Ga0070707_100116013 3300005468 Bacteria 2599
90 Ga0070707_100151945 3300005468 Bacteria 2255
91 Ga0070698_100001369 3300005471 Bacteria 27100
92 Ga0070698_100009691 3300005471 Bacteria 10299
93 Ga0070698_100035064 3300005471 Bacteria 5189
94 Ga0070698_100063704 3300005471 Bacteria 3718
95 Ga0070698_100125902 3300005471 Bacteria 2519
96 Ga0070698_100151432 3300005471 Bacteria 2267
97 Ga0070698_100234152 3300005471 Bacteria 1770
98 Ga0070699_100001124 3300005518 Bacteria 24927
99 Ga0070699_100002417 3300005518 Bacteria 16760
100 Ga0070699_100009142 3300005518 Bacteria 8592
101 Ga0070684_100231026 3300005535 Bacteria 1689
102 Ga0070697_100001376 3300005536 Bacteria 18418
103 Ga0070697_100005432 3300005536 Bacteria 9821
104 Ga0070697_100007588 3300005536 Bacteria 8442
105 Ga0070697_100097252 3300005536 Unclassified 2442
106 Ga0068853_100000003 3300005539 Bacteria 434636
107 Ga0068853_100079807 3300005539 Bacteria 2862
108 Ga0070686_100000802 3300005544 Bacteria 18174
109 Ga0070686_100011454 3300005544 Bacteria 5031
110 Ga0070686_100031552 3300005544 Bacteria 3241
111 Ga0070686_100032925 3300005544 Bacteria 3182
112 Ga0070695_100015417 3300005545 Bacteria 4616
113 Ga0070693_100056394 3300005547 Bacteria 2267
114 Ga0070665_100047552 3300005548 Bacteria 4306
115 Ga0070665_100186352 3300005548 Bacteria 2076
116 Ga0070704_100000053 3300005549 Bacteria 37727
117 Ga0070704_100012505 3300005549 Bacteria 5241
118 Ga0070704_100077656 3300005549 Bacteria 2433
119 Ga0070704_100188669 3300005549 Bacteria 1655
120 Ga0068855_100004254 3300005563 Bacteria 17482
121 Ga0068855_100270877 3300005563 Bacteria 1888
122 Ga0070664_100009295 3300005564 Bacteria 7976
123 Ga0070664_100156022 3300005564 Unclassified 2017
124 Ga0068856_100000079 3300005614 Bacteria 92486
125 Ga0068856_100169177 3300005614 Bacteria 2197
126 Ga0070702_100000787 3300005615 Bacteria 12063
127 Ga0068859_100000257 3300005617 Bacteria 52795
128 Ga0068859_100005776 3300005617 Bacteria 12570
129 Ga0068859_100009362 3300005617 Bacteria 9890
130 Ga0068859_100106009 3300005617 Bacteria 2870
131 Ga0068866_10003043 3300005718 Bacteria 6919
132 Ga0068861_100000337 3300005719 Bacteria 26619
133 Ga0068861_100051239 3300005719 Bacteria 3133
134 Ga0068863_100010338 3300005841 Bacteria 9064
135 Ga0068863_100029359 3300005841 Bacteria 5249
136 Ga0068858_100018973 3300005842 Bacteria 6435
137 Ga0068858_100024309 3300005842 Bacteria 5646
138 Ga0068858_100204480 3300005842 Bacteria 1868
139 Ga0068858_100428084 3300005842 Bacteria 1273
140 Ga0068860_100001778 3300005843 Bacteria 22944
141 Ga0068860_100109160 3300005843 Bacteria 2644
142 Ga0068860_100501931 3300005843 Bacteria 1211
143 Ga0068862_100100950 3300005844 Bacteria 2524
144 Ga0068862_100157066 3300005844 Bacteria 2028
145 Ga0068862_100239540 3300005844 Bacteria 1649
146 Ga0068862_100412442 3300005844 Bacteria 1266
147 Ga0081455_10015579 3300005937 Bacteria 7378
148 Ga0081455_10071713 3300005937 Bacteria 2870
149 Ga0081455_10094308 3300005937 Unclassified 2418
150 Ga0081455_10162916 3300005937 Bacteria 1707
151 Ga0081540_1026720 3300005983 Bacteria 3287
152 Ga0081540_1052893 3300005983 Bacteria 1995
153 Ga0075363_100005177 3300006048 Bacteria 5771
154 Ga0075364_10012273 3300006051 Bacteria 5238
155 Ga0075364_10027091 3300006051 Bacteria 3659
156 Ga0070716_100114370 3300006173 Bacteria 1678
157 Ga0070712_100182649 3300006175 Unclassified 1636
158 Ga0070712_100271808 3300006175 Bacteria 1362
159 Ga0075362_10000420 3300006177 Bacteria 12200
160 Ga0075369_10149521 3300006186 Bacteria 1067
161 Ga0075366_10033316 3300006195 Unclassified 3034
162 Ga0075366_10034291 3300006195 Bacteria 2988
163 Ga0097621_100000938 3300006237 Bacteria 20423
164 Ga0097621_100006163 3300006237 Bacteria 8498
165 Ga0097621_100034170 3300006237 Bacteria 4054
166 Ga0097621_100154109 3300006237 Unclassified 1971
167 Ga0075370_10023550 3300006353 Unclassified 3392
168 Ga0068871_100004323 3300006358 Bacteria 9867
169 Ga0068871_100006362 3300006358 Bacteria 8347
170 Ga0068871_100142906 3300006358 Unclassified 2036
171 Ga0068871_100146059 3300006358 Bacteria 2014
172 Ga0075428_100001470 3300006844 Bacteria 25215
173 Ga0075428_100070032 3300006844 Bacteria 3834
174 Ga0075428_100127495 3300006844 Bacteria 2769
175 Ga0075428_100201590 3300006844 Bacteria 2151
176 Ga0075428_100473838 3300006844 Bacteria 1340
177 Ga0075430_100004102 3300006846 Bacteria 12285
178 Ga0075430_100069410 3300006846 Bacteria 2956
179 Ga0075431_100025254 3300006847 Bacteria 6091
180 Ga0075431_100062828 3300006847 Bacteria 3832
181 Ga0075431_100085835 3300006847 Unclassified 3249
182 Ga0075431_100150561 3300006847 Bacteria 2396
183 Ga0075431_100179523 3300006847 Bacteria 2173
184 Ga0075433_10007874 3300006852 Bacteria 8475
185 Ga0075433_10091104 3300006852 Bacteria 2695
186 Ga0075433_10319739 3300006852 Unclassified 1373
187 Ga0075434_100058694 3300006871 Bacteria 3824
188 Ga0075434_100064083 3300006871 Bacteria 3659
189 Ga0075434_100587481 3300006871 Bacteria 1133
190 Ga0075429_100000196 3300006880 Bacteria 40118
191 Ga0075429_100006813 3300006880 Bacteria 9916
192 Ga0075429_100481327 3300006880 Bacteria 1088
193 Ga0068865_100014361 3300006881 Bacteria 5031
194 Ga0068865_100096128 3300006881 Unclassified 2159
195 Ga0097620_100000257 3300006931 Bacteria 52795
196 Ga0097620_100005776 3300006931 Bacteria 12570
197 Ga0097620_100009362 3300006931 Bacteria 9890
198 Ga0097620_100106016 3300006931 Bacteria 2870
199 Ga0099794_10000046 3300007265 Bacteria 49155
200 Ga0105251_10000763 3300009011 Bacteria 29288
201 Ga0105251_10008784 3300009011 Bacteria 6058
202 Ga0105251_10025124 3300009011 Bacteria 3051
203 Ga0105251_10025830 3300009011 Bacteria 2998
204 Ga0105244_10004443 3300009036 Bacteria 9636
205 Ga0105244_10005668 3300009036 Bacteria 8246
206 Ga0105244_10100578 3300009036 Bacteria 1414
207 Ga0105240_10005451 3300009093 Bacteria 18958
208 Ga0105240_10018190 3300009093 Bacteria 9448
209 Ga0111539_10039279 3300009094 Bacteria 5706
210 Ga0111539_10185370 3300009094 Bacteria 2430
211 Ga0105245_10000968 3300009098 Bacteria 26187
212 Ga0114129_10003886 3300009147 Bacteria 21079
213 Ga0105243_10000166 3300009148 Bacteria 75434
214 Ga0105241_10000012 3300009174 Bacteria 221790
215 Ga0105242_10002223 3300009176 Bacteria 15309
216 Ga0105242_10045477 3300009176 Bacteria 3558
217 Ga0105242_10148466 3300009176 Bacteria 2042
218 Ga0105248_10000428 3300009177 Bacteria 47662
219 Ga0105248_10067003 3300009177 Bacteria 4031
220 Ga0105248_10398683 3300009177 Bacteria 1549
221 Ga0105237_10016911 3300009545 Bacteria 7568
222 Ga0105237_10033518 3300009545 Bacteria 5203
223 Ga0105238_10295058 3300009551 Bacteria 1604
224 Ga0105249_10015794 3300009553 Bacteria 6688
225 Ga0099796_10035969 3300010159 Bacteria 1646
226 Ga0105246_10016359 3300011119 Bacteria 4697
227 Ga0105246_10062853 3300011119 Bacteria 2587
228 Ga0105246_10073241 3300011119 Bacteria 2418
229 Ga0157373_10001791 3300013100 Bacteria 16334
230 Ga0157373_10002278 3300013100 Bacteria 14542
231 Ga0157371_10003028 3300013102 Bacteria 15611
232 Ga0157370_10002510 3300013104 Bacteria 22097
233 Ga0157370_10005749 3300013104 Bacteria 13871
234 Ga0157369_10042060 3300013105 Bacteria 4985
235 Ga0157369_10340287 3300013105 Bacteria 1558
236 Ga0157374_10009685 3300013296 Bacteria 8274
237 Ga0157374_10050077 3300013296 Bacteria 3881
238 Ga0157374_10176258 3300013296 Bacteria 2087
239 Ga0157378_10001738 3300013297 Bacteria 19541
240 Ga0157378_10033775 3300013297 Bacteria 4524
241 Ga0157378_10382510 3300013297 Bacteria 1382
242 Ga0163162_10091992 3300013306 Bacteria 3116
243 Ga0163162_10097271 3300013306 Bacteria 3032
244 Ga0163162_10377084 3300013306 Bacteria 1551
245 Ga0157372_10015433 3300013307 Bacteria 8186
246 Ga0157375_10000284 3300013308 Bacteria 46158
247 Ga0157375_10046506 3300013308 Bacteria 4232
248 Ga0157375_10154310 3300013308 Bacteria 2434
249 Ga0157375_10336765 3300013308 Bacteria 1674
250 Ga0163163_10001353 3300014325 Bacteria 20684
251 Ga0163163_10259275 3300014325 Unclassified 1789
252 Ga0157380_10002830 3300014326 Bacteria 11795
253 Ga0157380_10021950 3300014326 Bacteria 4795
254 Ga0157380_10050355 3300014326 Bacteria 3290
255 Ga0182008_10003015 3300014497 Bacteria 10349
256 Ga0157379_10041434 3300014968 Bacteria 4111
257 Ga0157376_10028435 3300014969 Bacteria 4443
258 Ga0157376_10165961 3300014969 Bacteria 2006
259 Ga0157376_10463625 3300014969 Bacteria 1238
260 Ga0182006_1004923 3300015261 Bacteria 6464
261 Ga0182005_1001737 3300015265 Bacteria 8396
262 Ga0163161_10013454 3300017792 Bacteria 5695
263 Ga0213872_10000168 3300021361 Bacteria 59182
264 Ga0213872_10010883 3300021361 Bacteria 4317
265 Ga0213872_10012875 3300021361 Bacteria 3924
266 Ga0213872_10046718 3300021361 Unclassified 1969
267 Ga0213872_10094138 3300021361 Bacteria 1338
268 Ga0213876_10003351 3300021384 Bacteria 9167
269 Ga0213876_10003657 3300021384 Bacteria 8741
270 Ga0213876_10007869 3300021384 Bacteria 5782
271 Ga0213876_10008273 3300021384 Bacteria 5628
272 Ga0213876_10011138 3300021384 Bacteria 4810
273 Ga0213871_10022332 3300021441 Bacteria 1585
274 Ga0209760_104198 3300025207 Bacteria 1245
275 Ga0209437_100063 3300025233 Bacteria 335477
276 Ga0209130_1000490 3300025284 Bacteria 40620
277 Ga0209025_1000138 3300025294 Bacteria 189551
278 Ga0209758_1014951 3300025297 Bacteria 4067
279 Ga0207426_1000281 3300025302 Bacteria 104133
280 Ga0207697_10001318 3300025315 Bacteria 13647
281 Ga0207696_1000387 3300025711 Bacteria 42108
282 Ga0207696_1056604 3300025711 Bacteria 1110
283 Ga0207655_1000024 3300025728 Bacteria 459774
284 Ga0207655_1001132 3300025728 Bacteria 26007
285 Ga0207655_1004658 3300025728 Bacteria 9620
286 Ga0207655_1011411 3300025728 Bacteria 5294
287 Ga0207655_1020279 3300025728 Bacteria 3423
288 Ga0207713_1000007 3300025735 Bacteria 564979
289 Ga0207713_1000054 3300025735 Bacteria 222042
290 Ga0207713_1008116 3300025735 Bacteria 6088
291 Ga0207713_1022317 3300025735 Bacteria 3008
292 Ga0207682_10013720 3300025893 Bacteria 3155
293 Ga0207692_10015276 3300025898 Bacteria 3375
294 Ga0207642_10003168 3300025899 Bacteria 5162
295 Ga0207688_10002677 3300025901 Bacteria 9644
296 Ga0207680_10071252 3300025903 Bacteria 2154
297 Ga0207645_10047281 3300025907 Bacteria 2748
298 Ga0207705_10001931 3300025909 Bacteria 16187
299 Ga0207705_10074788 3300025909 Bacteria 2460
300 Ga0207705_10222627 3300025909 Bacteria 1434
301 Ga0207684_10001744 3300025910 Bacteria 22999
302 Ga0207684_10002729 3300025910 Bacteria 17609
303 Ga0207684_10006584 3300025910 Bacteria 10569
304 Ga0207684_10060966 3300025910 Bacteria 3204
305 Ga0207654_10000015 3300025911 Bacteria 221799
306 Ga0207707_10007189 3300025912 Bacteria 9695
307 Ga0207695_10043992 3300025913 Bacteria 4754
308 Ga0207695_10045908 3300025913 Bacteria 4633
309 Ga0207693_10179914 3300025915 Unclassified 1664
310 Ga0207693_10223788 3300025915 Bacteria 1478
311 Ga0207663_10000627 3300025916 Bacteria 15650
312 Ga0207660_10026020 3300025917 Bacteria 3980
313 Ga0207662_10056548 3300025918 Bacteria 2343
314 Ga0207649_10003506 3300025920 Bacteria 8575
315 Ga0207646_10002204 3300025922 Bacteria 23196
316 Ga0207646_10014296 3300025922 Bacteria 7546
317 Ga0207646_10075355 3300025922 Bacteria 3015
318 Ga0207646_10177824 3300025922 Bacteria 1922
319 Ga0207646_10248545 3300025922 Bacteria 1606
320 Ga0207646_10272099 3300025922 Bacteria 1531
321 Ga0207681_10107865 3300025923 Bacteria 2020
322 Ga0207650_10021941 3300025925 Unclassified 4518
323 Ga0207650_10045942 3300025925 Bacteria 3214
324 Ga0207650_10087895 3300025925 Bacteria 2369
325 Ga0207687_10005298 3300025927 Bacteria 8547
326 Ga0207687_10033247 3300025927 Bacteria 3497
327 Ga0207687_10044175 3300025927 Bacteria 3073
328 Ga0207700_10009145 3300025928 Bacteria 6171
329 Ga0207700_10135487 3300025928 Bacteria 2017
330 Ga0207644_10004324 3300025931 Bacteria 9210
331 Ga0207706_10102448 3300025933 Bacteria 2518
332 Ga0207706_10109708 3300025933 Unclassified 2428
333 Ga0207686_10004503 3300025934 Bacteria 7465
334 Ga0207686_10010907 3300025934 Bacteria 4958
335 Ga0207686_10011766 3300025934 Bacteria 4800
336 Ga0207709_10000095 3300025935 Bacteria 137828
337 Ga0207709_10020921 3300025935 Bacteria 3697
338 Ga0207670_10000035 3300025936 Bacteria 107909
339 Ga0207670_10008675 3300025936 Bacteria 5754
340 Ga0207670_10144099 3300025936 Bacteria 1760
341 Ga0207670_10314286 3300025936 Bacteria 1231
342 Ga0207669_10023783 3300025937 Bacteria 3279
343 Ga0207669_10097439 3300025937 Bacteria 1934
344 Ga0207704_10066275 3300025938 Unclassified 2265
345 Ga0207704_10148168 3300025938 Bacteria 1652
346 Ga0207665_10217079 3300025939 Bacteria 1400
347 Ga0207691_10026709 3300025940 Bacteria 5417
348 Ga0207711_10003450 3300025941 Bacteria 13680
349 Ga0207711_10075951 3300025941 Bacteria 2925
350 Ga0207689_10000197 3300025942 Bacteria 53057
351 Ga0207689_10098716 3300025942 Bacteria 2399
352 Ga0207679_10006669 3300025945 Bacteria 7308
353 Ga0207667_10020003 3300025949 Bacteria 7457
354 Ga0207667_10049823 3300025949 Bacteria 4421
355 Ga0207651_10034295 3300025960 Bacteria 3285
356 Ga0207712_10013341 3300025961 Bacteria 5267
357 Ga0207703_10200750 3300026035 Bacteria 1772
358 Ga0207639_10000002 3300026041 Bacteria 903066
359 Ga0207639_10068010 3300026041 Bacteria 2774
360 Ga0207639_10354826 3300026041 Bacteria 1311
361 Ga0207708_10000422 3300026075 Bacteria 33057
362 Ga0207708_10001043 3300026075 Bacteria 20754
363 Ga0207702_10003680 3300026078 Bacteria 13877
364 Ga0207702_10089225 3300026078 Bacteria 2696
365 Ga0207641_10007461 3300026088 Bacteria 9097
366 Ga0207641_10084706 3300026088 Unclassified 2760
367 Ga0207648_10000285 3300026089 Bacteria 55006
368 Ga0207648_10000365 3300026089 Bacteria 49615
369 Ga0207648_10003664 3300026089 Bacteria 16079
370 Ga0207648_10008033 3300026089 Bacteria 10280
371 Ga0207675_100000226 3300026118 Bacteria 53141
372 Ga0207675_100001229 3300026118 Bacteria 25569
373 Ga0207675_100066640 3300026118 Bacteria 3366
374 Ga0207675_100651455 3300026118 Bacteria 1059
375 Ga0209281_1000092 3300027111 Bacteria 241437
376 Ga0209371_1000053 3300027312 Bacteria 264616
377 Ga0209371_1000096 3300027312 Bacteria 160552
378 Ga0209371_1000497 3300027312 Bacteria 38227
379 Ga0209371_1000691 3300027312 Bacteria 28756
380 Ga0209371_1000756 3300027312 Bacteria 26926
381 Ga0209371_1000875 3300027312 Bacteria 24191
382 Ga0209371_1001111 3300027312 Bacteria 19921
383 Ga0209371_1001791 3300027312 Bacteria 13437
384 Ga0209968_1002487 3300027526 Bacteria 2784
385 Ga0209970_1009678 3300027614 Bacteria 1575
386 Ga0209983_1002490 3300027665 Bacteria 4027
387 Ga0209588_1000022 3300027671 Bacteria 92210
388 Ga0209974_10000161 3300027876 Bacteria 20444
389 Ga0209974_10003828 3300027876 Bacteria 5391
390 Ga0209974_10044593 3300027876 Bacteria 1480
391 Ga0268266_10000123 3300028379 Bacteria 153496
392 Ga0268266_10048387 3300028379 Bacteria 3644
393 Ga0268266_10069726 3300028379 Bacteria 3047
394 Ga0268265_10100123 3300028380 Bacteria 2338
395 Ga0268265_10121868 3300028380 Bacteria 2150
396 Ga0268264_10001024 3300028381 Bacteria 28109
397 Ga0265337_1000067 3300028556 Bacteria 48544
398 Ga0265337_1002043 3300028556 Bacteria 9567
399 Ga0265337_1005710 3300028556 Bacteria 4892
400 Ga0265337_1006807 3300028556 Bacteria 4350
401 Ga0265337_1010214 3300028556 Bacteria 3301
402 Ga0265319_1002755 3300028563 Bacteria 9429
403 Ga0265319_1003156 3300028563 Bacteria 8683
404 Ga0265319_1009112 3300028563 Bacteria 4265
405 Ga0265319_1012057 3300028563 Bacteria 3510
406 Ga0265319_1015788 3300028563 Bacteria 2913
407 Ga0265334_10000014 3300028573 Bacteria 154345
408 Ga0265318_10002219 3300028577 Bacteria 10482
409 Ga0265318_10002412 3300028577 Bacteria 9998
410 Ga0265318_10009904 3300028577 Bacteria 4174
411 Ga0265318_10014317 3300028577 Bacteria 3333
412 Ga0265336_10019439 3300028666 Bacteria 2191
413 Ga0265336_10028010 3300028666 Bacteria 1761
414 Ga0307515_10066435 3300028794 Bacteria 4997
415 Ga0265338_10000619 3300028800 Bacteria 61997
416 Ga0265338_10001160 3300028800 Bacteria 43556
417 Ga0265338_10004415 3300028800 Bacteria 19017
418 Ga0265338_10006692 3300028800 Bacteria 14569
419 Ga0265338_10008324 3300028800 Bacteria 12617
420 Ga0265338_10009263 3300028800 Bacteria 11778
421 Ga0265338_10032580 3300028800 Bacteria 5077
422 Ga0265338_10060691 3300028800 Bacteria 3319
423 Ga0265338_10060795 3300028800 Bacteria 3315
424 Ga0265338_10062273 3300028800 Bacteria 3262
425 Ga0265338_10067496 3300028800 Bacteria 3089
426 Ga0265324_10001228 3300029957 Bacteria 15185
427 Ga0265324_10001725 3300029957 Bacteria 12018
428 Ga0265324_10005920 3300029957 Bacteria 5187
429 Ga0265324_10011811 3300029957 Bacteria 3316
430 Ga0268256_1000053 3300030500 Bacteria 264616
431 Ga0268256_1000086 3300030500 Bacteria 160533
432 Ga0268256_1000657 3300030500 Bacteria 26305
433 Ga0268256_1001242 3300030500 Bacteria 15974
434 Ga0268256_1001562 3300030500 Bacteria 13437
435 Ga0268256_1041009 3300030500 Bacteria 1036
436 Ga0316183_1199272 3300030742 Bacteria 1978
437 Ga0265330_10001762 3300031235 Bacteria 12160
438 Ga0265332_10000222 3300031238 Bacteria 45648
439 Ga0265332_10011334 3300031238 Bacteria 3964
440 Ga0265328_10046049 3300031239 Bacteria 1604
441 Ga0265320_10000394 3300031240 Bacteria 35351
442 Ga0265320_10001703 3300031240 Bacteria 15624
443 Ga0265320_10001761 3300031240 Bacteria 15347
444 Ga0265320_10031286 3300031240 Bacteria 2735
445 Ga0265320_10036494 3300031240 Bacteria 2483
446 Ga0265320_10043394 3300031240 Bacteria 2223
447 Ga0265320_10078604 3300031240 Bacteria 1543
448 Ga0265325_10000270 3300031241 Bacteria 36987
449 Ga0265325_10003245 3300031241 Bacteria 10700
450 Ga0265325_10009806 3300031241 Bacteria 5575
451 Ga0265325_10031615 3300031241 Bacteria 2831
452 Ga0265340_10008405 3300031247 Bacteria 5577
453 Ga0265340_10024826 3300031247 Bacteria 3040
454 Ga0265339_10016898 3300031249 Bacteria 4335
455 Ga0265339_10066197 3300031249 Bacteria 1935
456 Ga0265339_10098555 3300031249 Bacteria 1524
457 Ga0265331_10001800 3300031250 Bacteria 15227
458 Ga0265327_10000014 3300031251 Bacteria 506288
459 Ga0265327_10000460 3300031251 Bacteria 73013
460 Ga0265327_10001286 3300031251 Bacteria 32988
461 Ga0265327_10002819 3300031251 Bacteria 17551
462 Ga0265327_10009964 3300031251 Bacteria 6763
463 Ga0265327_10042399 3300031251 Bacteria 2443
464 Ga0265316_10000084 3300031344 Bacteria 99744
465 Ga0265316_10000107 3300031344 Bacteria 89406
466 Ga0265316_10002363 3300031344 Bacteria 19648
467 Ga0265316_10024451 3300031344 Bacteria 5062
468 Ga0265316_10025535 3300031344 Bacteria 4928
469 Ga0265316_10036809 3300031344 Bacteria 3956
470 Ga0265316_10038928 3300031344 Bacteria 3824
471 Ga0265316_10054395 3300031344 Bacteria 3134
472 Ga0265316_10068061 3300031344 Bacteria 2752
473 Ga0265316_10111741 3300031344 Bacteria 2069
474 Ga0265316_10277157 3300031344 Bacteria 1226
475 Ga0307408_100000110 3300031548 Bacteria 91157
476 Ga0307408_100000216 3300031548 Bacteria 61491
477 Ga0307408_100003420 3300031548 Bacteria 10883
478 Ga0307408_100082149 3300031548 Bacteria 2411
479 Ga0265313_10000294 3300031595 Bacteria 54470
480 Ga0265313_10002132 3300031595 Bacteria 17585
481 Ga0265313_10003273 3300031595 Bacteria 13305
482 Ga0265313_10014538 3300031595 Bacteria 4644
483 Ga0265313_10016629 3300031595 Bacteria 4221
484 Ga0307508_10000129 3300031616 Bacteria 89267
485 Ga0316579_10103425 3300031691 Bacteria 1365
486 Ga0265314_10000076 3300031711 Bacteria 146266
487 Ga0265314_10000444 3300031711 Bacteria 55347
488 Ga0265314_10002029 3300031711 Bacteria 21461
489 Ga0265314_10008024 3300031711 Bacteria 9100
490 Ga0265314_10027223 3300031711 Bacteria 4283
491 Ga0265314_10050561 3300031711 Bacteria 2901
492 Ga0265314_10057477 3300031711 Bacteria 2671
493 Ga0265342_10000147 3300031712 Bacteria 79849
494 Ga0265342_10014381 3300031712 Bacteria 5255
495 Ga0265342_10023804 3300031712 Bacteria 3870
496 Ga0265342_10049845 3300031712 Bacteria 2503
497 Ga0265342_10099761 3300031712 Bacteria 1656
498 Ga0265342_10101738 3300031712 Bacteria 1636
499 Ga0316576_10002208 3300031727 Bacteria 10990
500 Ga0316576_10003580 3300031727 Bacteria 9153
501 Ga0316576_10160663 3300031727 Bacteria 1695
502 Ga0316578_10053606 3300031728 Bacteria 2363
503 Ga0307405_10029614 3300031731 Bacteria 3201
504 Ga0316577_10029430 3300031733 Bacteria 3065
505 Ga0307413_10009859 3300031824 Bacteria 4596
506 Ga0307406_10004940 3300031901 Bacteria 7265
507 Ga0307406_10048889 3300031901 Bacteria 2674
508 Ga0307406_10057683 3300031901 Bacteria 2491
509 Ga0307412_10000040 3300031911 Bacteria 182923
510 Ga0307409_100084283 3300031995 Bacteria 2580
511 Ga0307409_100215949 3300031995 Bacteria 1727
512 Ga0307416_100008182 3300032002 Bacteria 6723
513 Ga0307416_100117904 3300032002 Bacteria 2358
514 Ga0307416_100480431 3300032002 Bacteria 1302
515 Ga0307414_10000033 3300032004 Bacteria 183814
516 Ga0307414_10034977 3300032004 Bacteria 3338
517 Ga0307414_10293063 3300032004 Bacteria 1372
518 Ga0307411_10006743 3300032005 Bacteria 5775
519 Ga0316593_10000238 3300032168 Bacteria 8912
520 Ga0316592_1017191 3300033524 Bacteria 1516
521 Ga0316596_1001161 3300033541 Bacteria 5163
522 Ga0373959_0028439 3300034820 Bacteria 1116
523 Ga0373928_0001007 3300035084 Bacteria 5529
524 Ga0373929_0000917 3300035085 Bacteria 5739
525 Ga0373934_0058420 3300035086 Bacteria 1535
526 Ga0373944_0001890 3300035089 Bacteria 5298
527 Ga0373949_0003389 3300035090 Bacteria 3818
528 Ga0373951_0003990 3300035091 Bacteria 3544
529 Ga0373932_0000001 3300035112 Bacteria 1459067
530 Ga0373953_0071189 3300035117 Bacteria 1435
531 Ga0373962_0000105 3300035242 Bacteria 18388
532 Ga0316574_0008677 3300035398 Bacteria 5655
533 Ga0316574_0022953 3300035398 Bacteria 3721
534 Ga0316574_0023426 3300035398 Bacteria 3686
535 Ga0316574_0056394 3300035398 Bacteria 2458
536 Ga0373931_0000004 3300035691 Bacteria 535140
537 Ga0373927_0086683 3300035695 Bacteria 2032
538 Ga0373933_0051150 3300035724 Bacteria 2469
539 Ga0373933_0091264 3300035724 Bacteria 1880
540 Ga0373933_0143532 3300035724 Bacteria 1509
541 Ga0373933_0164649 3300035724 Bacteria 1409
542 Ga0373947_0055394 3300035725 Bacteria 2395
543 Ga0373947_0104930 3300035725 Bacteria 1780
544 Ga0373937_0014534 3300036401 Bacteria 6952
545 Ga0373937_0084693 3300036401 Bacteria 2933
546 Ga0373937_0095980 3300036401 Bacteria 2749
547 Ga0373937_0252425 3300036401 Bacteria 1663
548 Ga0316582_0020906 3300036647 Bacteria 3857
549 Ga0316582_0122925 3300036647 Bacteria 1738
550 Ga0316582_0157013 3300036647 Bacteria 1540
551 Ga0316584_0014329 3300036712 Bacteria 5639
552 Ga0373925_0000572 3300037068 Bacteria 35958
553 Ga0373925_0096861 3300037068 Bacteria 2262
554 Ga0373925_0169611 3300037068 Bacteria 1723
555 Ga0395899_0292065 3300037312 Bacteria 1106
556 Ga0395898_0005822 3300037466 Bacteria 13261
557 Ga0395905_0261452 3300037471 Bacteria 1616
558 Ga0436364_1107980 3300037853 Bacteria 1905
559 Ga0436364_1265238 3300037853 Bacteria 2075
560 Ga0436364_1284200 3300037853 Bacteria 100206
561 Ga0436364_1512261 3300037853 Bacteria 7242
562 Ga0400484_14496 3300038725 Bacteria 5886
563 Ga0400484_22999 3300038725 Bacteria 40826
564 Ga0400484_30145 3300038725 Bacteria 11884
565 Ga0400484_31956 3300038725 Bacteria 6692
566 Ga0400484_39820 3300038725 Bacteria 7657
567 Ga0400490_03296 3300038726 Bacteria 55719
568 Ga0400490_09621 3300038726 Bacteria 42351
569 Ga0400490_35547 3300038726 Bacteria 10188
570 Ga0400490_55744 3300038726 Bacteria 86921
571 Ga0400491_10338 3300038727 Bacteria 16726
572 Ga0400491_21040 3300038727 Bacteria 2014
573 Ga0400491_26211 3300038727 Bacteria 1616
574 Ga0400485_11431 3300038735 Bacteria 142174
575 Ga0400485_16362 3300038735 Bacteria 13397
576 Ga0400488_31697 3300038741 Bacteria 2561
577 Ga0400488_42417 3300038741 Bacteria 2419
578 Ga0400488_48423 3300038741 Bacteria 3035
579 Ga0400488_48558 3300038741 Bacteria 11558
580 Ga0400488_50866 3300038741 Bacteria 2816
581 Ga0400486_09395 3300038742 Bacteria 13370
582 Ga0400486_10900 3300038742 Bacteria 16663
583 Ga0400486_18012 3300038742 Bacteria 99609
584 Ga0400483_011961 3300039062 Bacteria 13335
585 Ga0400483_016449 3300039062 Bacteria 3195
586 Ga0400483_038707 3300039062 Bacteria 14414
587 Ga0400483_102324 3300039062 Bacteria 3766
588 Ga0400483_105883 3300039062 Bacteria 2605
589 Ga0400483_124202 3300039062 Bacteria 2070
590 Ga0400483_125458 3300039062 Bacteria 7664
591 Ga0400483_141525 3300039062 Bacteria 6126
592 Ga0400483_184941 3300039062 Bacteria 5618
593 Ga0400483_196695 3300039062 Bacteria 7136
594 Ga0400483_200917 3300039062 Bacteria 14675
595 Ga0400483_202172 3300039062 Bacteria 8691
596 Ga0400483_241723 3300039062 Bacteria 19398
597 Ga0400487_03473 3300039110 Bacteria 4700
598 Ga0400487_03760 3300039110 Bacteria 1899
599 Ga0400487_23026 3300039110 Bacteria 1316
600 Ga0400487_29515 3300039110 Bacteria 15083
601 Ga0400487_54961 3300039110 Bacteria 48611
602 Ga0400487_56221 3300039110 Bacteria 43693
603 Ga0400487_58246 3300039110 Bacteria 34164
604 Ga0436365_0449926 3300039437 Bacteria 19026
605 Ga0436365_0704006 3300039437 Unclassified 2365
606 Ga0436365_0779500 3300039437 Bacteria 1115
607 Ga0436365_1112867 3300039437 Bacteria 50005
608 Ga0436365_1225281 3300039437 Bacteria 1809
609 Ga0436365_1457951 3300039437 Bacteria 43070
610 Ga0436365_1621097 3300039437 Bacteria 6312
611 Ga0436360_0023805 3300039438 Unclassified 1906
612 Ga0436360_0091975 3300039438 Bacteria 6533
613 Ga0436360_0166959 3300039438 Bacteria 1586
614 Ga0436360_0264857 3300039438 Bacteria 1122
615 Ga0436360_0598392 3300039438 Unclassified 908
616 Ga0436360_0748890 3300039438 Unclassified 2445
617 Ga0436360_0806145 3300039438 Bacteria 2724
618 Ga0436361_0005955 3300039447 Bacteria 1618
619 Ga0436361_0155125 3300039447 Bacteria 10559
620 Ga0436361_0169046 3300039447 Bacteria 26611
621 Ga0436361_0473752 3300039447 Bacteria 7583
622 Ga0436361_0594389 3300039447 Unclassified 2427
623 Ga0436361_0595657 3300039447 Bacteria 4720
624 Ga0436361_0799034 3300039447 Bacteria 1127
625 Ga0436361_0807183 3300039447 Bacteria 94852
626 Ga0436361_1195567 3300039447 Bacteria 1470
627 Ga0436363_0803061 3300039450 Bacteria 15961
628 Ga0436363_0848729 3300039450 Bacteria 11384
629 Ga0436362_0510036 3300039453 Bacteria 2205
630 Ga0436362_1180629 3300039453 Bacteria 3254
631 Ga0439438_020528 3300041405 Bacteria 1854
632 Ga0439438_027431 3300041405 Bacteria 1536
633 Ga0439453_0000817 3300041408 Bacteria 3670
634 Ga0439461_0002848 3300041410 Bacteria 2800
635 Ga0439466_0000161 3300041411 Bacteria 26751
636 Ga0439466_0008650 3300041411 Bacteria 3836
637 Ga0451791_0673990 3300041451 Bacteria 1154
638 Ga0439431_0016283 3300041997 Bacteria 1739
639 Ga0439433_0020198 3300041999 Bacteria 1487
640 Ga0439432_004728 3300042006 Bacteria 4954
641 Ga0439432_004893 3300042006 Bacteria 4859
642 Ga0439452_000004 3300042010 Bacteria 764268
643 Ga0450890_000016 3300042127 Bacteria 51368
644 Ga0450891_003102 3300042129 Bacteria 1627
645 Ga0450892_000519 3300042130 Bacteria 4437
646 Ga0450907_001326 3300042146 Bacteria 5505
647 Ga0439446_0021820 3300042156 Bacteria 1811
648 Ga0451577_0004341 3300042876 Bacteria 15032
649 Ga0451577_0244702 3300042876 Bacteria 1623
650 Ga0451577_0348461 3300042876 Bacteria 1343
651 Ga0453683_0023991 3300044673 Bacteria 3884
652 Ga0466965_0015192 3300044683 Bacteria 3657
653 Ga0453684_0011696 3300044712 Bacteria 14637
654 Ga0453684_0243718 3300044712 Bacteria 2068
655 Ga0466971_0000023 3300044719 Bacteria 67799
656 Ga0466957_0023002 3300044842 Bacteria 3679
657 Ga0451576_0001488 3300045051 Bacteria 39603
658 Ga0451576_0004916 3300045051 Bacteria 17053
659 Ga0451576_0011870 3300045051 Bacteria 9857
660 Ga0451576_0028305 3300045051 Bacteria 6005
661 Ga0451576_0075350 3300045051 Bacteria 3511
662 Ga0466967_0175447 3300045976 Bacteria 2019
663 Ga0495591_000024 3300046458 Bacteria 191134
664 Ga0495591_001549 3300046458 Bacteria 14060
665 Ga0495629_0069106 3300046459 Unclassified 2465
666 Ga0495650_0000377 3300046471 Bacteria 77543
667 Ga0495584_0011509 3300046491 Bacteria 4532
668 Ga0495594_0026368 3300046499 Bacteria 3126
669 Ga0495594_0044293 3300046499 Bacteria 2441
670 Ga0495596_0015033 3300046500 Bacteria 3251
671 Ga0495607_0056632 3300046501 Bacteria 2250
672 Ga0495606_0004074 3300046507 Bacteria 14872
673 Ga0495630_0000171 3300046517 Bacteria 50810
674 Ga0495630_0024658 3300046517 Bacteria 4445
675 Ga0495644_0003920 3300046523 Bacteria 5854
676 Ga0495654_0000061 3300046530 Bacteria 130939
677 Ga0495654_0000163 3300046530 Bacteria 65805
678 Ga0495586_0000157 3300046535 Bacteria 43987
679 Ga0495586_0007676 3300046535 Bacteria 5750
680 Ga0495586_0179240 3300046535 Bacteria 1198
681 Ga0495634_0014669 3300046642 Bacteria 5642
682 Ga0495613_0051685 3300046689 Bacteria 3028
683 Ga0495671_0005382 3300046692 Bacteria 7502
684 Ga0495660_0000158 3300046810 Bacteria 73369
685 Ga0495660_0075408 3300046810 Bacteria 1779
686 Ga0495674_0000893 3300047319 Bacteria 28550
687 Ga0495672_0000029 3300047320 Bacteria 305231
688 Ga0495672_0000054 3300047320 Bacteria 230777
689 Ga0495676_0009765 3300047321 Bacteria 8718
690 Ga0495673_0000092 3300047469 Bacteria 187963
691 Ga0496101_0001295 3300048904 Bacteria 14951
692 Ga0496103_0112862 3300048906 Bacteria 1727
693 Ga0496104_0302815 3300048907 Bacteria 1511
694 Ga0496105_0000139 3300048908 Bacteria 48427
695 Ga0496108_0008867 3300048911 Bacteria 8150
696 Ga0496109_0001851 3300048912 Bacteria 17521
697 Ga0496109_0251261 3300048912 Bacteria 1665
698 Ga0496109_0383401 3300048912 Bacteria 1328
699 Ga0496109_0449158 3300048912 Bacteria 1218
700 Ga0496111_0002711 3300048914 Bacteria 10754
701 Ga0496112_0009493 3300048915 Bacteria 8771
702 Ga0496112_0113156 3300048915 Bacteria 2685
703 Ga0496113_0016580 3300048916 Bacteria 5092
704 Ga0496113_0064403 3300048916 Bacteria 2772
705 Ga0496115_0008240 3300048918 Bacteria 7702
706 Ga0496116_0001816 3300048919 Bacteria 23120
707 Ga0496116_0001830 3300048919 Bacteria 23023
708 Ga0496116_0042783 3300048919 Bacteria 3092
709 Ga0496116_0067103 3300048919 Bacteria 2292
710 Ga0496117_0000350 3300048920 Bacteria 81439
711 Ga0496117_0000895 3300048920 Bacteria 45877
712 Ga0496117_0001186 3300048920 Bacteria 39159
713 Ga0496118_0001869 3300048921 Bacteria 30129
714 Ga0496118_0004714 3300048921 Bacteria 15966
715 Ga0496118_0006706 3300048921 Bacteria 12544
716 Ga0496119_0001006 3300048922 Bacteria 36126
717 Ga0496119_0003121 3300048922 Bacteria 17465
718 Ga0496119_0012337 3300048922 Bacteria 6949
719 Ga0496119_0138580 3300048922 Bacteria 1316
720 Ga0496120_0000090 3300048923 Bacteria 150551
721 Ga0496120_0000616 3300048923 Bacteria 53766
722 Ga0496120_0002035 3300048923 Bacteria 21933
723 Ga0496120_0002689 3300048923 Bacteria 17465
724 Ga0496120_0126219 3300048923 Bacteria 1316
725 Ga0496121_0001624 3300048924 Bacteria 37256
726 Ga0496121_0167199 3300048924 Bacteria 1601
727 Ga0496122_0022775 3300048925 Bacteria 5556
728 Ga0496123_0007402 3300048926 Bacteria 10360
729 Ga0496123_0010305 3300048926 Bacteria 8291
730 Ga0496124_0000452 3300048927 Bacteria 72015
731 Ga0496124_0002279 3300048927 Bacteria 25388
732 Ga0496124_0024644 3300048927 Bacteria 5464
733 Ga0496124_0228876 3300048927 Bacteria 1391
734 Ga0496124_0251727 3300048927 Bacteria 1306
735 Ga0496125_0000147 3300048928 Bacteria 154731
736 Ga0496125_0157301 3300048928 Bacteria 1550
737 Ga0496125_0267196 3300048928 Bacteria 1068
738 Ga0496126_0074114 3300048929 Bacteria 3023
739 Ga0495678_001808 3300049459 Bacteria 15743
740 Ga0495682_0000003 3300049460 Bacteria 515787
741 Ga0501290_003773 3300049513 Bacteria 1897
742 Ga0501291_006924 3300049514 Bacteria 1523
743 Ga0501295_000044 3300049518 Bacteria 12479
744 Ga0501296_000008 3300049519 Bacteria 24240
745 Ga0501297_000240 3300049520 Bacteria 5608
746 Ga0501298_000041 3300049521 Bacteria 13233
747 Ga0501299_000082 3300049522 Bacteria 10607
748 Ga0501031_0003827 3300049568 Bacteria 9681
749 Ga0501031_0027787 3300049568 Bacteria 3688
750 Ga0501031_0177707 3300049568 Bacteria 1391
751 Ga0501032_0001360 3300049569 Bacteria 19452
752 Ga0501032_0018401 3300049569 Bacteria 4896
753 Ga0501032_0137672 3300049569 Bacteria 1609
754 Ga0501032_0217104 3300049569 Bacteria 1245
755 Ga0501032_0266215 3300049569 Bacteria 1111
756 Ga0501033_0000127 3300049570 Bacteria 73521
757 Ga0501033_0020015 3300049570 Bacteria 5058
758 Ga0501033_0044104 3300049570 Bacteria 3320
759 Ga0501033_0248328 3300049570 Bacteria 1262
760 Ga0501033_0290849 3300049570 Bacteria 1152
761 Ga0501034_0000078 3300049571 Bacteria 171437
762 Ga0501034_0001344 3300049571 Bacteria 33205
763 Ga0501034_0006529 3300049571 Bacteria 12537
764 Ga0501034_0049978 3300049571 Bacteria 4218
765 Ga0501034_0108846 3300049571 Bacteria 2762
766 Ga0501034_0142665 3300049571 Bacteria 2374
767 Ga0501034_0269718 3300049571 Bacteria 1643
768 Ga0501036_0029587 3300049572 Bacteria 4626
769 Ga0501036_0132707 3300049572 Bacteria 2102
770 Ga0501036_0196001 3300049572 Bacteria 1699
771 Ga0501036_0370093 3300049572 Bacteria 1196
772 Ga0501037_0000020 3300049573 Bacteria 155468
773 Ga0501037_0019718 3300049573 Bacteria 4974
774 Ga0501037_0069512 3300049573 Bacteria 2563
775 Ga0501038_0009853 3300049574 Bacteria 8745
776 Ga0501038_0154538 3300049574 Bacteria 1869
777 Ga0501038_0173209 3300049574 Bacteria 1745
778 Ga0501038_0303623 3300049574 Bacteria 1252
779 Ga0501039_0264449 3300049575 Bacteria 1352
780 Ga0501042_0039154 3300049578 Bacteria 3368
781 Ga0501042_0235038 3300049578 Bacteria 1322
782 Ga0501043_0000156 3300049579 Bacteria 62295
783 Ga0501043_0001277 3300049579 Bacteria 22097
784 Ga0501043_0020811 3300049579 Bacteria 5145
785 Ga0501043_0094529 3300049579 Bacteria 2350
786 Ga0501043_0138992 3300049579 Bacteria 1903
787 Ga0501046_0000216 3300049580 Bacteria 60174
788 Ga0501046_0002988 3300049580 Bacteria 15633
789 Ga0501046_0009370 3300049580 Bacteria 8467
790 Ga0501046_0016796 3300049580 Bacteria 6119
791 Ga0501046_0019992 3300049580 Bacteria 5544
792 Ga0501046_0035288 3300049580 Bacteria 4031
793 Ga0501046_0041590 3300049580 Bacteria 3667
794 Ga0501046_0054137 3300049580 Bacteria 3158
795 Ga0501047_0002610 3300049581 Bacteria 17160
796 Ga0501047_0008802 3300049581 Bacteria 9522
797 Ga0501047_0009498 3300049581 Bacteria 9190
798 Ga0501047_0025015 3300049581 Bacteria 5735
799 Ga0501047_0080459 3300049581 Bacteria 3131
800 Ga0501047_0402137 3300049581 Bacteria 1202
801 Ga0501048_0000706 3300049582 Bacteria 24366
802 Ga0501048_0070920 3300049582 Bacteria 2460
803 Ga0501048_0130577 3300049582 Bacteria 1776
804 Ga0501068_0002884 3300049584 Bacteria 9147
805 Ga0501068_0044839 3300049584 Bacteria 2664
806 Ga0501068_0051275 3300049584 Bacteria 2496
807 Ga0501068_0088441 3300049584 Bacteria 1909
808 Ga0501068_0140346 3300049584 Bacteria 1515
809 Ga0501069_0004113 3300049585 Bacteria 7507
810 Ga0501069_0020529 3300049585 Bacteria 3580
811 Ga0501070_0001390 3300049586 Bacteria 21673
812 Ga0501070_0011429 3300049586 Bacteria 7500
813 Ga0501070_0091041 3300049586 Bacteria 2524
814 Ga0501070_0187498 3300049586 Bacteria 1701
815 Ga0501071_0001077 3300049587 Bacteria 15145
816 Ga0501071_0047816 3300049587 Bacteria 3074
817 Ga0501072_0040812 3300049588 Bacteria 3644
818 Ga0501072_0041212 3300049588 Bacteria 3626
819 Ga0501072_0079584 3300049588 Bacteria 2595
820 Ga0501073_0009536 3300049589 Bacteria 7163
821 Ga0501073_0026271 3300049589 Bacteria 4171
822 Ga0501073_0058326 3300049589 Bacteria 2698
823 Ga0501074_0003495 3300049590 Bacteria 11156
824 Ga0501074_0101507 3300049590 Bacteria 2059
825 Ga0501075_0034269 3300049591 Bacteria 3780
826 Ga0501075_0121054 3300049591 Bacteria 1992
827 Ga0501076_0169192 3300049592 Bacteria 1781
828 Ga0501076_0181924 3300049592 Bacteria 1714
829 Ga0501076_0408712 3300049592 Bacteria 1116
830 Ga0501077_0012120 3300049593 Bacteria 5397
831 Ga0501077_0118291 3300049593 Bacteria 1679
832 Ga0501202_000045 3300049652 Bacteria 12529
833 Ga0501223_002816 3300049663 Bacteria 3815
834 Ga0501227_005037 3300049665 Bacteria 2837
835 Ga0501227_010789 3300049665 Bacteria 1983
836 Ga0501233_000379 3300049668 Bacteria 7041
837 Ga0501235_004776 3300049669 Bacteria 2934
838 Ga0501236_003327 3300049670 Bacteria 1867
839 Ga0501239_003429 3300049672 Bacteria 1506
840 Ga0501243_003633 3300049675 Bacteria 2298
841 Ga0501253_002498 3300049683 Bacteria 2078
842 Ga0501256_000076 3300049685 Bacteria 5126
843 Ga0501261_000321 3300049690 Bacteria 6488
844 Ga0501221_000807 3300049704 Bacteria 5086
845 Ga0501225_0000560 3300049705 Bacteria 11628
846 Ga0501245_018659 3300049708 Bacteria 1068
847 Ga0501079_0141297 3300049741 Bacteria 1875
848 Ga0501080_0020766 3300049742 Bacteria 6080
849 Ga0501080_0044560 3300049742 Bacteria 4130
850 Ga0501080_0086801 3300049742 Bacteria 2908
851 Ga0501080_0152160 3300049742 Bacteria 2138
852 Ga0501080_0348140 3300049742 Bacteria 1338
853 Ga0501081_0123165 3300049743 Bacteria 1848
854 Ga0501083_0000094 3300049744 Bacteria 60217
855 Ga0501083_0049514 3300049744 Bacteria 2831
856 Ga0501264_002502 3300049761 Bacteria 1708
857 Ga0501268_006910 3300049765 Bacteria 1680
858 Ga0501269_001756 3300049766 Bacteria 2761
859 Ga0501274_000796 3300049771 Bacteria 2321
860 Ga0501278_000954 3300049774 Bacteria 2095
861 Ga0501279_000829 3300049775 Bacteria 4068
862 Ga0501282_003159 3300049778 Bacteria 1780
863 Ga0501283_000910 3300049779 Bacteria 3922
864 Ga0501035_0000002 3300049822 Bacteria 585447
865 Ga0501035_0000932 3300049822 Bacteria 30968
866 Ga0501035_0016573 3300049822 Bacteria 6795
867 Ga0501035_0026719 3300049822 Bacteria 5280
868 Ga0501035_0031663 3300049822 Bacteria 4817
869 Ga0501035_0064397 3300049822 Bacteria 3258
870 Ga0501035_0161104 3300049822 Bacteria 1942
871 Ga0501035_0205991 3300049822 Bacteria 1685
872 Ga0501035_0232430 3300049822 Bacteria 1571
873 Ga0501044_0000095 3300049823 Bacteria 109588
874 Ga0501044_0000371 3300049823 Bacteria 56211
875 Ga0501044_0008189 3300049823 Bacteria 11471
876 Ga0501044_0110147 3300049823 Bacteria 2762
877 Ga0501044_0333158 3300049823 Bacteria 1440
878 Ga0501045_0162577 3300049824 Bacteria 1662
879 Ga0501045_0266921 3300049824 Bacteria 1274
880 Ga0501204_000515 3300049850 Bacteria 3360
881 Ga0501226_005391 3300049853 Bacteria 1460
882 nmdc:mga03683_2929_c1 3300050489 Bacteria 5390
883 nmdc:mga00v17_4279_c1 3300050491 Bacteria 7412
884 nmdc:mga0k408_422_c1 3300050493 Bacteria 23140
885 nmdc:mga0k408_519_c1 3300050493 Bacteria 21203
886 nmdc:mga07m45_22744_c1 3300050496 Unclassified 3424
887 nmdc:mga05p37_342413_c1 3300050507 Bacteria 1763
888 nmdc:mga09592_1330_c1 3300050508 Bacteria 19792
889 nmdc:mga09592_333454_c1 3300050508 Bacteria 1313
890 nmdc:mga0qj67_243101_c1 3300050509 Bacteria 1460
891 nmdc:mga0qj67_35397_c1 3300050509 Bacteria 3903
892 nmdc:mga06r32_491449_c1 3300050510 Bacteria 1205
893 nmdc:mga06r32_61343_c1 3300050510 Bacteria 3132
894 nmdc:mga08y16_14483_c1 3300050511 Bacteria 8296
895 nmdc:mga08y16_291697_c1 3300050511 Bacteria 1682
896 nmdc:mga0n895_34642_c1 3300050512 Bacteria 4862
897 nmdc:mga0n895_71872_c1 3300050512 Bacteria 3431
898 nmdc:mga08x19_250391_c1 3300050514 Bacteria 1223
899 nmdc:mga0a205_16924_c1 3300050515 Bacteria 6826
900 nmdc:mga0a205_216833_c1 3300050515 Bacteria 1800
901 nmdc:mga0a205_314959_c1 3300050515 Unclassified 1436
902 nmdc:mga0a205_322316_c1 3300050515 Bacteria 1416
903 nmdc:mga0sz30_77771_c1 3300050516 Bacteria 1433
904 Ga0500555_000022 3300053103 Bacteria 157445
905 Ga0500555_000378 3300053103 Bacteria 18755
906 Ga0500555_028150 3300053103 Bacteria 1602
907 Ga0500556_0000453 3300053104 Bacteria 29167
908 Ga0500556_0008287 3300053104 Bacteria 2995
909 Ga0500621_000006 3300053126 Bacteria 245480
910 Ga0500642_0003869 3300053130 Bacteria 4601
911 Ga0500559_0000600 3300053136 Bacteria 24530
912 Ga0500616_0002666 3300053153 Bacteria 14516
913 Ga0500645_075198 3300053730 Unclassified 967
914 Ga0501084_0121882 3300054114 Bacteria 2192
915 Ga0501084_0130132 3300054114 Bacteria 2119
916 Ga0590071_006726 3300059421 Bacteria 2728
917 Ga0501082_0006480 3300060353 Bacteria 10150
918 Ga0501082_0014004 3300060353 Bacteria 6897
919 Ga0466962_0000993 3300061719 Bacteria 12947

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0029587 Ga0501036_0029587_3738_4589 260
2 3300049743 Ga0501081_0123165 Ga0501081_0123165_981_1832 260
3 3300041411 Ga0439466_0008650 Ga0439466_0008650_22_858 270
4 3300039437 Ga0436365_1225281 Ga0436365_1225281_758_1582 272
5 3300006186 Ga0075369_10149521 Ga0075369_101495212 274
6 3300050516 nmdc:mga0sz30_77771_c1 nmdc:mga0sz30_77771_c1_88_918 274
7 3300025938 Ga0207704_10066275 Ga0207704_100662751 277
8 3300039438 Ga0436360_0598392 Ga0436360_0598392_49_891 277
9 3300048928 Ga0496125_0157301 Ga0496125_0157301_692_1534 277
10 3300039447 Ga0436361_0005955 Ga0436361_0005955_345_1388 279
11 3300005467 Ga0070706_100090718 Ga0070706_1000907183 281
12 3300005467 Ga0070706_100424697 Ga0070706_1004246971 283
13 3300005468 Ga0070707_100151945 Ga0070707_1001519452 283
14 3300005471 Ga0070698_100001369 Ga0070698_1000013699 283
15 3300005471 Ga0070698_100035064 Ga0070698_1000350645 283
16 3300005518 Ga0070699_100009142 Ga0070699_1000091424 283
17 3300005536 Ga0070697_100005432 Ga0070697_1000054322 283
18 3300005536 Ga0070697_100007588 Ga0070697_1000075881 283
19 3300005536 Ga0070697_100097252 Ga0070697_1000972523 283
20 3300006175 Ga0070712_100182649 Ga0070712_1001826492 283
21 3300010159 Ga0099796_10035969 Ga0099796_100359692 283
22 3300025910 Ga0207684_10060966 Ga0207684_100609662 283
23 3300025915 Ga0207693_10179914 Ga0207693_101799142 283
24 3300025922 Ga0207646_10014296 Ga0207646_100142963 283
25 3300025922 Ga0207646_10177824 Ga0207646_101778242 283
26 3300005937 Ga0081455_10162916 Ga0081455_101629161 287
27 3300015265 Ga0182005_1001737 Ga0182005_10017375 288
28 3300039438 Ga0436360_0166959 Ga0436360_0166959_452_1330 289
29 3300021361 Ga0213872_10012875 Ga0213872_100128754 292
30 3300039447 Ga0436361_0595657 Ga0436361_0595657_3251_4210 292
31 3300042876 Ga0451577_0244702 Ga0451577_0244702_251_1216 292
32 3300005467 Ga0070706_100001219 Ga0070706_10000121927 293
33 3300021384 Ga0213876_10007869 Ga0213876_100078693 293
34 3300025910 Ga0207684_10006584 Ga0207684_1000658411 293
35 3300037853 Ga0436364_1512261 Ga0436364_1512261_3146_4105 293
36 3300039437 Ga0436365_0449926 Ga0436365_0449926_10456_11415 293
37 3300039438 Ga0436360_0023805 Ga0436360_0023805_889_1848 293
38 3300005549 Ga0070704_100188669 Ga0070704_1001886691 296
39 3300005841 Ga0068863_100029359 Ga0068863_1000293596 297
40 3300006844 Ga0075428_100127495 Ga0075428_1001274952 297
41 3300021361 Ga0213872_10010883 Ga0213872_100108832 297
42 3300025916 Ga0207663_10000627 Ga0207663_1000062718 297
43 3300026088 Ga0207641_10084706 Ga0207641_100847061 297
44 3300028556 Ga0265337_1000067 Ga0265337_10000678 297
45 3300028556 Ga0265337_1005710 Ga0265337_10057105 297
46 3300028666 Ga0265336_10019439 Ga0265336_100194391 297
47 3300028666 Ga0265336_10028010 Ga0265336_100280102 297
48 3300028800 Ga0265338_10060795 Ga0265338_100607952 297
49 3300031247 Ga0265340_10008405 Ga0265340_100084051 297
50 3300031247 Ga0265340_10024826 Ga0265340_100248262 297
51 3300031712 Ga0265342_10099761 Ga0265342_100997611 297
52 3300031712 Ga0265342_10101738 Ga0265342_101017381 297
53 3300035724 Ga0373933_0143532 Ga0373933_0143532_456_1415 297
54 3300039437 Ga0436365_1621097 Ga0436365_1621097_1123_2085 297
55 3300039438 Ga0436360_0264857 Ga0436360_0264857_152_1111 297
56 3300039447 Ga0436361_0155125 Ga0436361_0155125_8813_9772 297
57 3300039453 Ga0436362_1180629 Ga0436362_1180629_840_1799 297
58 3300050509 nmdc:mga0qj67_243101_c1 nmdc:mga0qj67_243101_c1_23_1003 297
59 3300050510 nmdc:mga06r32_61343_c1 nmdc:mga06r32_61343_c1_1580_2557 297
60 3300053730 Ga0500645_075198 Ga0500645_075198_38_943 297
61 3300006175 Ga0070712_100271808 Ga0070712_1002718082 298
62 3300006358 Ga0068871_100146059 Ga0068871_1001460592 298
63 3300006844 Ga0075428_100001470 Ga0075428_1000014704 298
64 3300025915 Ga0207693_10223788 Ga0207693_102237881 298
65 3300050511 nmdc:mga08y16_14483_c1 nmdc:mga08y16_14483_c1_5318_6310 298
66 3300028800 Ga0265338_10067496 Ga0265338_100674962 299
67 3300031251 Ga0265327_10042399 Ga0265327_100423992 299
68 3300035084 Ga0373928_0001007 Ga0373928_0001007_3981_4997 299
69 3300035085 Ga0373929_0000917 Ga0373929_0000917_3961_4977 299
70 3300035089 Ga0373944_0001890 Ga0373944_0001890_3968_4984 299
71 3300035090 Ga0373949_0003389 Ga0373949_0003389_984_2000 299
72 3300035091 Ga0373951_0003990 Ga0373951_0003990_1072_2088 299
73 3300035112 Ga0373932_0000001 Ga0373932_0000001_281313_282329 299
74 3300035242 Ga0373962_0000105 Ga0373962_0000105_3175_4191 299
75 3300035691 Ga0373931_0000004 Ga0373931_0000004_281322_282338 299
76 3300035695 Ga0373927_0086683 Ga0373927_0086683_545_1561 299
77 3300035725 Ga0373947_0055394 Ga0373947_0055394_1154_2170 299
78 3300037068 Ga0373925_0000572 Ga0373925_0000572_5293_6309 299
79 3300039447 Ga0436361_0799034 Ga0436361_0799034_13_1056 299
80 3300049569 Ga0501032_0217104 Ga0501032_0217104_225_1193 299
81 3300049570 Ga0501033_0248328 Ga0501033_0248328_148_1116 299
82 3300049574 Ga0501038_0173209 Ga0501038_0173209_343_1311 299
83 3300049579 Ga0501043_0094529 Ga0501043_0094529_72_1040 299
84 3300049580 Ga0501046_0035288 Ga0501046_0035288_1669_2637 299
85 3300049584 Ga0501068_0051275 Ga0501068_0051275_262_1230 299
86 3300049593 Ga0501077_0118291 Ga0501077_0118291_53_1021 299
87 3300049824 Ga0501045_0162577 Ga0501045_0162577_25_993 299
88 3300054114 Ga0501084_0121882 Ga0501084_0121882_879_1847 299
89 3300005518 Ga0070699_100001124 Ga0070699_10000112410 300
90 3300009094 Ga0111539_10039279 Ga0111539_100392793 300
91 3300044712 Ga0453684_0243718 Ga0453684_0243718_636_1634 300
92 3300005468 Ga0070707_100000266 Ga0070707_10000026619 301
93 3300005471 Ga0070698_100151432 Ga0070698_1001514322 301
94 3300005549 Ga0070704_100000053 Ga0070704_10000005342 301
95 3300005617 Ga0068859_100009362 Ga0068859_1000093622 301
96 3300006931 Ga0097620_100009362 Ga0097620_1000093622 301
97 3300025922 Ga0207646_10002204 Ga0207646_100022047 301
98 3300029957 Ga0265324_10001228 Ga0265324_100012281 301
99 3300031241 Ga0265325_10009806 Ga0265325_100098062 301
100 3300031344 Ga0265316_10277157 Ga0265316_102771571 301
101 3300031733 Ga0316577_10029430 Ga0316577_100294302 301
102 3300037853 Ga0436364_1265238 Ga0436364_1265238_479_1423 301
103 3300005289 Ga0065704_10187406 Ga0065704_101874062 302
104 3300006195 Ga0075366_10033316 Ga0075366_100333163 302
105 3300006353 Ga0075370_10023550 Ga0075370_100235504 302
106 3300025945 Ga0207679_10006669 Ga0207679_100066692 302
107 3300031824 Ga0307413_10009859 Ga0307413_100098594 302
108 3300031995 Ga0307409_100084283 Ga0307409_1000842832 302
109 3300032004 Ga0307414_10034977 Ga0307414_100349773 302
110 3300032005 Ga0307411_10006743 Ga0307411_100067436 302
111 3300034820 Ga0373959_0028439 Ga0373959_0028439_19_987 302
112 3300045051 Ga0451576_0011870 Ga0451576_0011870_6008_6976 302
113 3300049742 Ga0501080_0086801 Ga0501080_0086801_675_1640 302
114 3300050493 nmdc:mga0k408_422_c1 nmdc:mga0k408_422_c1_2114_3121 302
115 3300050496 nmdc:mga07m45_22744_c1 nmdc:mga07m45_22744_c1_839_1846 302
116 3300050512 nmdc:mga0n895_71872_c1 nmdc:mga0n895_71872_c1_95_1072 302
117 3300005293 Ga0065715_10177365 Ga0065715_101773652 303
118 3300006852 Ga0075433_10319739 Ga0075433_103197391 303
119 3300006871 Ga0075434_100064083 Ga0075434_1000640832 303
120 3300013297 Ga0157378_10033775 Ga0157378_100337753 303
121 3300039438 Ga0436360_0091975 Ga0436360_0091975_4670_5680 303
122 3300048916 Ga0496113_0064403 Ga0496113_0064403_1359_2336 303
123 3300049571 Ga0501034_0001344 Ga0501034_0001344_21159_22127 303
124 3300049588 Ga0501072_0079584 Ga0501072_0079584_953_1921 303
125 3300050515 nmdc:mga0a205_314959_c1 nmdc:mga0a205_314959_c1_98_1075 303
126 3300025925 Ga0207650_10021941 Ga0207650_100219416 304
127 3300049571 Ga0501034_0049978 Ga0501034_0049978_70_1035 304
128 3300049584 Ga0501068_0002884 Ga0501068_0002884_2703_3668 304
129 3300049585 Ga0501069_0004113 Ga0501069_0004113_6241_7206 304
130 3300049586 Ga0501070_0091041 Ga0501070_0091041_1474_2439 304
131 3300049587 Ga0501071_0001077 Ga0501071_0001077_6270_7235 304
132 3300049588 Ga0501072_0041212 Ga0501072_0041212_2534_3499 304
133 3300049589 Ga0501073_0026271 Ga0501073_0026271_1733_2698 304
134 3300049590 Ga0501074_0003495 Ga0501074_0003495_1674_2639 304
135 3300049742 Ga0501080_0020766 Ga0501080_0020766_3448_4413 304
136 3300049744 Ga0501083_0049514 Ga0501083_0049514_116_1081 304
137 3300060353 Ga0501082_0006480 Ga0501082_0006480_6056_7021 304
138 3300053103 Ga0500555_000378 Ga0500555_000378_3852_4859 305
139 3300053104 Ga0500556_0000453 Ga0500556_0000453_15225_16232 305
140 3300053130 Ga0500642_0003869 Ga0500642_0003869_720_1727 305
141 3300006173 Ga0070716_100114370 Ga0070716_1001143701 306
142 3300025939 Ga0207665_10217079 Ga0207665_102170791 306
143 3300006195 Ga0075366_10034291 Ga0075366_100342913 307
144 3300006871 Ga0075434_100058694 Ga0075434_1000586942 307
145 3300006871 Ga0075434_100587481 Ga0075434_1005874811 307
146 3300025922 Ga0207646_10248545 Ga0207646_102485451 307
147 3300049571 Ga0501034_0000078 Ga0501034_0000078_50888_51871 307
148 3300050493 nmdc:mga0k408_519_c1 nmdc:mga0k408_519_c1_13898_14905 307
149 3300050512 nmdc:mga0n895_34642_c1 nmdc:mga0n895_34642_c1_988_1950 307
150 3300021361 Ga0213872_10094138 Ga0213872_100941382 308
151 3300021384 Ga0213876_10003351 Ga0213876_100033515 308
152 3300027614 Ga0209970_1009678 Ga0209970_10096783 308
153 3300027665 Ga0209983_1002490 Ga0209983_10024902 308
154 3300027876 Ga0209974_10003828 Ga0209974_100038284 308
155 3300039437 Ga0436365_1112867 Ga0436365_1112867_3216_4184 308
156 3300039438 Ga0436360_0748890 Ga0436360_0748890_570_1529 308
157 3300039447 Ga0436361_1195567 Ga0436361_1195567_43_1002 308
158 3300049823 Ga0501044_0008189 Ga0501044_0008189_1633_2619 308
159 3300049588 Ga0501072_0040812 Ga0501072_0040812_1828_2793 309
160 3300049589 Ga0501073_0009536 Ga0501073_0009536_58_1023 309
161 3300049741 Ga0501079_0141297 Ga0501079_0141297_717_1682 309
162 3300060353 Ga0501082_0014004 Ga0501082_0014004_150_1115 309
163 iso_pu_bacteria 2511231221 2512034398 309
164 iso_pu_bacteria 2597490356 2599105182 309
165 iso_pu_bacteria 2821443989 2821451006 309
166 iso_pu_bacteria 2844533157 2844538642 309
167 iso_pu_bacteria 2846952575 2846955139 309
168 iso_pu_bacteria 2848858292 2848858567 309
169 iso_pu_bacteria 2897803580 2897803897 309
170 iso_pu_bacteria 2939669807 2939674504 309
171 iso_pu_bacteria 8054002106 8054004125 309
172 3300049582 Ga0501048_0130577 Ga0501048_0130577_445_1605 310
173 3300048915 Ga0496112_0113156 Ga0496112_0113156_1475_2434 311
174 iso_pu_bacteria 2738541276 2738715438 311
175 3300005330 Ga0070690_100000072 Ga0070690_10000007215 312
176 3300005336 Ga0070680_100247826 Ga0070680_1002478262 312
177 3300005340 Ga0070689_100000039 Ga0070689_10000003919 312
178 3300005343 Ga0070687_100040253 Ga0070687_1000402532 312
179 3300005365 Ga0070688_100000087 Ga0070688_1000000876 312
180 3300005438 Ga0070701_10000043 Ga0070701_1000004316 312
181 3300005441 Ga0070700_100000798 Ga0070700_10000079812 312
182 3300005459 Ga0068867_100017689 Ga0068867_1000176894 312
183 3300005466 Ga0070685_10000211 Ga0070685_1000021119 312
184 3300005544 Ga0070686_100000802 Ga0070686_1000008029 312
185 3300005617 Ga0068859_100000257 Ga0068859_1000002575 312
186 3300005719 Ga0068861_100051239 Ga0068861_1000512392 312
187 3300006931 Ga0097620_100000257 Ga0097620_1000002575 312
188 3300009176 Ga0105242_10002223 Ga0105242_100022234 312
189 3300009176 Ga0105242_10148466 Ga0105242_101484662 312
190 3300009177 Ga0105248_10000428 Ga0105248_1000042825 312
191 3300009551 Ga0105238_10295058 Ga0105238_102950582 312
192 3300013308 Ga0157375_10336765 Ga0157375_103367652 312
193 3300014326 Ga0157380_10050355 Ga0157380_100503552 312
194 3300021361 Ga0213872_10000168 Ga0213872_1000016842 312
195 3300025918 Ga0207662_10056548 Ga0207662_100565482 312
196 3300025934 Ga0207686_10011766 Ga0207686_100117662 312
197 3300025936 Ga0207670_10000035 Ga0207670_1000003540 312
198 3300025941 Ga0207711_10003450 Ga0207711_100034504 312
199 3300026075 Ga0207708_10001043 Ga0207708_1000104317 312
200 3300026089 Ga0207648_10003664 Ga0207648_100036645 312
201 3300026118 Ga0207675_100066640 Ga0207675_1000666402 312
202 3300031251 Ga0265327_10000460 Ga0265327_100004606 312
203 3300039447 Ga0436361_0807183 Ga0436361_0807183_76595_77548 312
204 3300053103 Ga0500555_028150 Ga0500555_028150_82_1041 312
205 3300059421 Ga0590071_006726 Ga0590071_006726_1486_2439 312
206 iso_pu_bacteria 2687453341 2688394609 312
207 iso_pu_bacteria 2786546548 2787507541 312
208 iso_pu_bacteria 2836160341 2836162118 312
209 iso_pu_bacteria 2919493220 2919496701 312
210 iso_pu_bacteria 2919543075 2919546860 312
211 iso_pu_bacteria 2923525760 2923529513 312
212 3300001989 JGI24739J22299_10053845 JGI24739J22299_100538452 313
213 3300002987 JGI25159J45721_1020372 JGI25159J45721_10203721 313
214 3300003187 JGI25151J46595_10000428 JGI25151J46595_1000042837 313
215 3300003187 JGI25151J46595_10000467 JGI25151J46595_1000046713 313
216 3300003354 JGI25160J50197_1011072 JGI25160J50197_10110722 313
217 3300005471 Ga0070698_100125902 Ga0070698_1001259023 313
218 3300005535 Ga0070684_100231026 Ga0070684_1002310262 313
219 3300005983 Ga0081540_1052893 Ga0081540_10528933 313
220 3300014325 Ga0163163_10001353 Ga0163163_1000135310 313
221 3300025284 Ga0209130_1000490 Ga0209130_100049012 313
222 3300025294 Ga0209025_1000138 Ga0209025_1000138186 313
223 3300025297 Ga0209758_1014951 Ga0209758_10149513 313
224 3300025302 Ga0207426_1000281 Ga0207426_10002813 313
225 3300025928 Ga0207700_10135487 Ga0207700_101354874 313
226 3300025934 Ga0207686_10010907 Ga0207686_100109072 313
227 3300035725 Ga0373947_0104930 Ga0373947_0104930_199_1152 313
228 3300037068 Ga0373925_0169611 Ga0373925_0169611_242_1195 313
229 3300037466 Ga0395898_0005822 Ga0395898_0005822_7014_7967 313
230 3300037853 Ga0436364_1284200 Ga0436364_1284200_90174_91142 313
231 3300039437 Ga0436365_0779500 Ga0436365_0779500_11_970 313
232 3300048908 Ga0496105_0000139 Ga0496105_0000139_6186_7139 313
233 3300048911 Ga0496108_0008867 Ga0496108_0008867_6071_7024 313
234 3300048912 Ga0496109_0001851 Ga0496109_0001851_14457_15410 313
235 3300048914 Ga0496111_0002711 Ga0496111_0002711_2783_3736 313
236 3300048915 Ga0496112_0009493 Ga0496112_0009493_6184_7137 313
237 3300048916 Ga0496113_0016580 Ga0496113_0016580_3172_4125 313
238 3300048918 Ga0496115_0008240 Ga0496115_0008240_5906_6859 313
239 3300048925 Ga0496122_0022775 Ga0496122_0022775_2029_2985 313
240 3300049568 Ga0501031_0027787 Ga0501031_0027787_2245_3204 313
241 3300049571 Ga0501034_0269718 Ga0501034_0269718_450_1403 313
242 3300049578 Ga0501042_0039154 Ga0501042_0039154_1922_2881 313
243 3300049685 Ga0501256_000076 Ga0501256_000076_1237_2202 313
244 3300053153 Ga0500616_0002666 Ga0500616_0002666_11333_12334 313
245 3300002077 JGI24744J21845_10002463 JGI24744J21845_100024632 314
246 3300005289 Ga0065704_10008623 Ga0065704_100086232 314
247 3300005290 Ga0065712_10159252 Ga0065712_101592521 314
248 3300005295 Ga0065707_10017383 Ga0065707_100173832 314
249 3300005327 Ga0070658_10002816 Ga0070658_1000281612 314
250 3300005330 Ga0070690_100068722 Ga0070690_1000687222 314
251 3300005336 Ga0070680_100033369 Ga0070680_1000333692 314
252 3300005340 Ga0070689_100149209 Ga0070689_1001492092 314
253 3300005437 Ga0070710_10055948 Ga0070710_100559482 314
254 3300005444 Ga0070694_100111983 Ga0070694_1001119832 314
255 3300005458 Ga0070681_10009249 Ga0070681_100092492 314
256 3300005459 Ga0068867_100000100 Ga0068867_10000010038 314
257 3300005466 Ga0070685_10228166 Ga0070685_102281661 314
258 3300005467 Ga0070706_100000543 Ga0070706_10000054311 314
259 3300005471 Ga0070698_100234152 Ga0070698_1002341522 314
260 3300005536 Ga0070697_100001376 Ga0070697_10000137612 314
261 3300005544 Ga0070686_100031552 Ga0070686_1000315522 314
262 3300005544 Ga0070686_100032925 Ga0070686_1000329252 314
263 3300005549 Ga0070704_100012505 Ga0070704_1000125052 314
264 3300005564 Ga0070664_100009295 Ga0070664_1000092955 314
265 3300005617 Ga0068859_100106009 Ga0068859_1001060092 314
266 3300005841 Ga0068863_100010338 Ga0068863_1000103382 314
267 3300005844 Ga0068862_100239540 Ga0068862_1002395403 314
268 3300005937 Ga0081455_10015579 Ga0081455_100155793 314
269 3300005937 Ga0081455_10071713 Ga0081455_100717132 314
270 3300006237 Ga0097621_100006163 Ga0097621_1000061635 314
271 3300006844 Ga0075428_100070032 Ga0075428_1000700322 314
272 3300006846 Ga0075430_100004102 Ga0075430_1000041029 314
273 3300006846 Ga0075430_100069410 Ga0075430_1000694103 314
274 3300006847 Ga0075431_100150561 Ga0075431_1001505612 314
275 3300006847 Ga0075431_100179523 Ga0075431_1001795231 314
276 3300006852 Ga0075433_10007874 Ga0075433_100078745 314
277 3300006852 Ga0075433_10091104 Ga0075433_100911042 314
278 3300006880 Ga0075429_100006813 Ga0075429_1000068134 314
279 3300006931 Ga0097620_100106016 Ga0097620_1001060163 314
280 3300009093 Ga0105240_10005451 Ga0105240_100054515 314
281 3300009147 Ga0114129_10003886 Ga0114129_1000388612 314
282 3300009148 Ga0105243_10000166 Ga0105243_1000016616 314
283 3300009176 Ga0105242_10045477 Ga0105242_100454772 314
284 3300009177 Ga0105248_10398683 Ga0105248_103986831 314
285 3300011119 Ga0105246_10073241 Ga0105246_100732413 314
286 3300013100 Ga0157373_10001791 Ga0157373_1000179115 314
287 3300013104 Ga0157370_10005749 Ga0157370_1000574912 314
288 3300013296 Ga0157374_10176258 Ga0157374_101762582 314
289 3300013297 Ga0157378_10382510 Ga0157378_103825102 314
290 3300013308 Ga0157375_10046506 Ga0157375_100465061 314
291 3300014326 Ga0157380_10021950 Ga0157380_100219502 314
292 3300014969 Ga0157376_10028435 Ga0157376_100284352 314
293 3300014969 Ga0157376_10463625 Ga0157376_104636251 314
294 3300025898 Ga0207692_10015276 Ga0207692_100152762 314
295 3300025909 Ga0207705_10001931 Ga0207705_100019315 314
296 3300025910 Ga0207684_10001744 Ga0207684_1000174415 314
297 3300025912 Ga0207707_10007189 Ga0207707_100071892 314
298 3300025913 Ga0207695_10043992 Ga0207695_100439925 314
299 3300025920 Ga0207649_10003506 Ga0207649_100035066 314
300 3300025927 Ga0207687_10033247 Ga0207687_100332474 314
301 3300025935 Ga0207709_10000095 Ga0207709_1000009565 314
302 3300025936 Ga0207670_10144099 Ga0207670_101440992 314
303 3300026088 Ga0207641_10007461 Ga0207641_100074612 314
304 3300026089 Ga0207648_10000285 Ga0207648_1000028516 314
305 3300027526 Ga0209968_1002487 Ga0209968_10024872 314
306 3300027876 Ga0209974_10000161 Ga0209974_100001618 314
307 3300027876 Ga0209974_10044593 Ga0209974_100445931 314
308 3300028379 Ga0268266_10000123 Ga0268266_10000123156 314
309 3300028380 Ga0268265_10121868 Ga0268265_101218682 314
310 3300031251 Ga0265327_10002819 Ga0265327_1000281912 314
311 3300031344 Ga0265316_10000107 Ga0265316_100001076 314
312 3300031548 Ga0307408_100000110 Ga0307408_10000011081 314
313 3300031548 Ga0307408_100003420 Ga0307408_10000342011 314
314 3300031731 Ga0307405_10029614 Ga0307405_100296142 314
315 3300031901 Ga0307406_10004940 Ga0307406_100049406 314
316 3300031901 Ga0307406_10057683 Ga0307406_100576832 314
317 3300031911 Ga0307412_10000040 Ga0307412_10000040157 314
318 3300031995 Ga0307409_100215949 Ga0307409_1002159492 314
319 3300032002 Ga0307416_100117904 Ga0307416_1001179043 314
320 3300032002 Ga0307416_100480431 Ga0307416_1004804312 314
321 3300032004 Ga0307414_10000033 Ga0307414_1000003313 314
322 3300032004 Ga0307414_10293063 Ga0307414_102930631 314
323 3300035086 Ga0373934_0058420 Ga0373934_0058420_392_1357 314
324 3300035117 Ga0373953_0071189 Ga0373953_0071189_248_1213 314
325 3300035724 Ga0373933_0164649 Ga0373933_0164649_363_1331 314
326 3300036401 Ga0373937_0084693 Ga0373937_0084693_852_1817 314
327 3300036401 Ga0373937_0095980 Ga0373937_0095980_1694_2662 314
328 3300041405 Ga0439438_020528 Ga0439438_020528_843_1811 314
329 3300041408 Ga0439453_0000817 Ga0439453_0000817_16_969 314
330 3300041410 Ga0439461_0002848 Ga0439461_0002848_417_1385 314
331 3300041997 Ga0439431_0016283 Ga0439431_0016283_732_1700 314
332 3300041999 Ga0439433_0020198 Ga0439433_0020198_353_1321 314
333 3300042006 Ga0439432_004728 Ga0439432_004728_3561_4529 314
334 3300042127 Ga0450890_000016 Ga0450890_000016_34106_35059 314
335 3300042129 Ga0450891_003102 Ga0450891_003102_97_1050 314
336 3300042130 Ga0450892_000519 Ga0450892_000519_1576_2529 314
337 3300042156 Ga0439446_0021820 Ga0439446_0021820_744_1712 314
338 3300046499 Ga0495594_0026368 Ga0495594_0026368_82_1050 314
339 3300046499 Ga0495594_0044293 Ga0495594_0044293_686_1654 314
340 3300048924 Ga0496121_0167199 Ga0496121_0167199_234_1187 314
341 3300049513 Ga0501290_003773 Ga0501290_003773_445_1413 314
342 3300049514 Ga0501291_006924 Ga0501291_006924_531_1499 314
343 3300049518 Ga0501295_000044 Ga0501295_000044_7530_8498 314
344 3300049519 Ga0501296_000008 Ga0501296_000008_1309_2277 314
345 3300049520 Ga0501297_000240 Ga0501297_000240_502_1470 314
346 3300049521 Ga0501298_000041 Ga0501298_000041_11638_12606 314
347 3300049522 Ga0501299_000082 Ga0501299_000082_2681_3649 314
348 3300049568 Ga0501031_0177707 Ga0501031_0177707_101_1069 314
349 3300049569 Ga0501032_0018401 Ga0501032_0018401_805_1758 314
350 3300049569 Ga0501032_0137672 Ga0501032_0137672_351_1319 314
351 3300049569 Ga0501032_0266215 Ga0501032_0266215_85_1053 314
352 3300049572 Ga0501036_0132707 Ga0501036_0132707_221_1189 314
353 3300049572 Ga0501036_0196001 Ga0501036_0196001_130_1098 314
354 3300049574 Ga0501038_0009853 Ga0501038_0009853_6371_7339 314
355 3300049578 Ga0501042_0235038 Ga0501042_0235038_284_1252 314
356 3300049579 Ga0501043_0138992 Ga0501043_0138992_892_1860 314
357 3300049580 Ga0501046_0019992 Ga0501046_0019992_3287_4255 314
358 3300049582 Ga0501048_0070920 Ga0501048_0070920_365_1333 314
359 3300049584 Ga0501068_0044839 Ga0501068_0044839_1463_2431 314
360 3300049584 Ga0501068_0088441 Ga0501068_0088441_127_1185 314
361 3300049585 Ga0501069_0020529 Ga0501069_0020529_1681_2649 314
362 3300049586 Ga0501070_0187498 Ga0501070_0187498_547_1500 314
363 3300049591 Ga0501075_0121054 Ga0501075_0121054_52_1017 314
364 3300049652 Ga0501202_000045 Ga0501202_000045_6942_7910 314
365 3300049663 Ga0501223_002816 Ga0501223_002816_203_1156 314
366 3300049665 Ga0501227_005037 Ga0501227_005037_257_1225 314
367 3300049665 Ga0501227_010789 Ga0501227_010789_375_1328 314
368 3300049668 Ga0501233_000379 Ga0501233_000379_3364_4332 314
369 3300049669 Ga0501235_004776 Ga0501235_004776_1337_2305 314
370 3300049670 Ga0501236_003327 Ga0501236_003327_699_1667 314
371 3300049672 Ga0501239_003429 Ga0501239_003429_185_1153 314
372 3300049675 Ga0501243_003633 Ga0501243_003633_870_1838 314
373 3300049683 Ga0501253_002498 Ga0501253_002498_1022_1990 314
374 3300049690 Ga0501261_000321 Ga0501261_000321_361_1329 314
375 3300049704 Ga0501221_000807 Ga0501221_000807_3375_4343 314
376 3300049705 Ga0501225_0000560 Ga0501225_0000560_6473_7441 314
377 3300049708 Ga0501245_018659 Ga0501245_018659_71_1039 314
378 3300049742 Ga0501080_0348140 Ga0501080_0348140_133_1101 314
379 3300049761 Ga0501264_002502 Ga0501264_002502_245_1213 314
380 3300049765 Ga0501268_006910 Ga0501268_006910_137_1105 314
381 3300049766 Ga0501269_001756 Ga0501269_001756_815_1783 314
382 3300049771 Ga0501274_000796 Ga0501274_000796_501_1469 314
383 3300049774 Ga0501278_000954 Ga0501278_000954_244_1212 314
384 3300049775 Ga0501279_000829 Ga0501279_000829_589_1557 314
385 3300049778 Ga0501282_003159 Ga0501282_003159_347_1315 314
386 3300049779 Ga0501283_000910 Ga0501283_000910_598_1566 314
387 3300049822 Ga0501035_0064397 Ga0501035_0064397_1886_2854 314
388 3300049822 Ga0501035_0161104 Ga0501035_0161104_153_1121 314
389 3300049822 Ga0501035_0232430 Ga0501035_0232430_187_1155 314
390 3300049850 Ga0501204_000515 Ga0501204_000515_57_1025 314
391 3300049853 Ga0501226_005391 Ga0501226_005391_354_1322 314
392 3300050507 nmdc:mga05p37_342413_c1 nmdc:mga05p37_342413_c1_467_1435 314
393 3300050509 nmdc:mga0qj67_35397_c1 nmdc:mga0qj67_35397_c1_1408_2376 314
394 3300050510 nmdc:mga06r32_491449_c1 nmdc:mga06r32_491449_c1_159_1127 314
395 3300050514 nmdc:mga08x19_250391_c1 nmdc:mga08x19_250391_c1_153_1121 314
396 3300050515 nmdc:mga0a205_16924_c1 nmdc:mga0a205_16924_c1_4821_5789 314
397 3300050515 nmdc:mga0a205_322316_c1 nmdc:mga0a205_322316_c1_128_1096 314
398 3300053103 Ga0500555_000022 Ga0500555_000022_46559_47560 314
399 3300053136 Ga0500559_0000600 Ga0500559_0000600_4897_5850 314
400 iso_pu_bacteria 2511231025 2511381753 314
401 iso_pu_bacteria 2511231035 2511437722 314
402 iso_pu_bacteria 2565956521 2566035587 314
403 iso_pu_bacteria 2599185299 2599928300 314
404 iso_pu_bacteria 2608642108 2608670362 314
405 iso_pu_bacteria 2648501241 2649121633 314
406 iso_pu_bacteria 2648501693 2650900043 314
407 iso_pu_bacteria 2651869818 2652973988 314
408 iso_pu_bacteria 2684622997 2686354282 314
409 iso_pu_bacteria 2791354903 2791924396 314
410 iso_pu_bacteria 2808606414 2809124429 314
411 iso_pu_bacteria 2844528606 2844532437 314
412 iso_pu_bacteria 2847797336 2847801132 314
413 iso_pu_bacteria 2854601825 2854605416 314
414 iso_pu_bacteria 2865014394 2865018446 314
415 iso_pu_bacteria 2876601092 2876605579 314
416 iso_pu_bacteria 2881609920 2881612711 314
417 iso_pu_bacteria 2888373701 2888376944 314
418 iso_pu_bacteria 2908669403 2908673310 314
419 iso_pu_bacteria 2939602548 2939605306 314
420 iso_pu_bacteria 2945951305 2945954165 314
421 iso_pu_bacteria 2978975091 2978976647 314
422 iso_pu_bacteria 2984494565 2984497959 314
423 iso_pu_bacteria 2990261002 2990264525 314
424 iso_pu_bacteria 8004592986 8004593190 314
425 iso_pu_bacteria 8015394850 8015396936 314
426 iso_pu_bacteria 8019499862 8019502315 314
427 iso_pu_bacteria 8055092621 8055093650 314
428 3300003320 rootH2_10009230 rootH2_100092303 315
429 3300003320 rootH2_10106945 rootH2_101069452 315
430 3300003323 rootH1_10055647 rootH1_100556474 315
431 3300005340 Ga0070689_100205513 Ga0070689_1002055131 315
432 3300005354 Ga0070675_100228339 Ga0070675_1002283392 315
433 3300005439 Ga0070711_100218808 Ga0070711_1002188082 315
434 3300005468 Ga0070707_100116013 Ga0070707_1001160132 315
435 3300005614 Ga0068856_100000079 Ga0068856_10000007927 315
436 3300005614 Ga0068856_100169177 Ga0068856_1001691772 315
437 3300005842 Ga0068858_100428084 Ga0068858_1004280842 315
438 3300006847 Ga0075431_100025254 Ga0075431_1000252542 315
439 3300009094 Ga0111539_10185370 Ga0111539_101853702 315
440 3300014325 Ga0163163_10259275 Ga0163163_102592752 315
441 3300025922 Ga0207646_10272099 Ga0207646_102720993 315
442 3300025925 Ga0207650_10087895 Ga0207650_100878952 315
443 3300025927 Ga0207687_10044175 Ga0207687_100441752 315
444 3300025936 Ga0207670_10314286 Ga0207670_103142862 315
445 3300025949 Ga0207667_10049823 Ga0207667_100498234 315
446 3300026078 Ga0207702_10003680 Ga0207702_1000368012 315
447 3300026078 Ga0207702_10089225 Ga0207702_100892252 315
448 3300026118 Ga0207675_100001229 Ga0207675_1000012295 315
449 3300028556 Ga0265337_1010214 Ga0265337_10102145 315
450 3300028563 Ga0265319_1012057 Ga0265319_10120572 315
451 3300028800 Ga0265338_10001160 Ga0265338_100011603 315
452 3300028800 Ga0265338_10004415 Ga0265338_100044157 315
453 3300028800 Ga0265338_10006692 Ga0265338_100066921 315
454 3300028800 Ga0265338_10008324 Ga0265338_100083243 315
455 3300028800 Ga0265338_10032580 Ga0265338_100325806 315
456 3300028800 Ga0265338_10060691 Ga0265338_100606914 315
457 3300028800 Ga0265338_10062273 Ga0265338_100622732 315
458 3300029957 Ga0265324_10011811 Ga0265324_100118112 315
459 3300031238 Ga0265332_10011334 Ga0265332_100113341 315
460 3300031239 Ga0265328_10046049 Ga0265328_100460491 315
461 3300031240 Ga0265320_10043394 Ga0265320_100433943 315
462 3300031241 Ga0265325_10003245 Ga0265325_100032458 315
463 3300031249 Ga0265339_10016898 Ga0265339_100168984 315
464 3300031249 Ga0265339_10066197 Ga0265339_100661972 315
465 3300031249 Ga0265339_10098555 Ga0265339_100985552 315
466 3300031250 Ga0265331_10001800 Ga0265331_1000180013 315
467 3300031251 Ga0265327_10001286 Ga0265327_1000128616 315
468 3300031344 Ga0265316_10002363 Ga0265316_100023631 315
469 3300031344 Ga0265316_10036809 Ga0265316_100368092 315
470 3300031344 Ga0265316_10038928 Ga0265316_100389281 315
471 3300031344 Ga0265316_10054395 Ga0265316_100543953 315
472 3300031344 Ga0265316_10111741 Ga0265316_101117412 315
473 3300031548 Ga0307408_100000216 Ga0307408_10000021653 315
474 3300031595 Ga0265313_10016629 Ga0265313_100166294 315
475 3300031711 Ga0265314_10000444 Ga0265314_1000044413 315
476 3300031711 Ga0265314_10002029 Ga0265314_100020293 315
477 3300031711 Ga0265314_10057477 Ga0265314_100574772 315
478 3300031712 Ga0265342_10023804 Ga0265342_100238042 315
479 3300036401 Ga0373937_0014534 Ga0373937_0014534_2596_3636 315
480 3300037312 Ga0395899_0292065 Ga0395899_0292065_68_1060 315
481 3300041451 Ga0451791_0673990 Ga0451791_0673990_152_1129 315
482 3300042876 Ga0451577_0004341 Ga0451577_0004341_5810_6790 315
483 3300042876 Ga0451577_0348461 Ga0451577_0348461_180_1178 315
484 3300044712 Ga0453684_0011696 Ga0453684_0011696_4225_5190 315
485 3300045051 Ga0451576_0028305 Ga0451576_0028305_4832_5797 315
486 3300045051 Ga0451576_0075350 Ga0451576_0075350_791_1771 315
487 3300046459 Ga0495629_0069106 Ga0495629_0069106_837_1895 315
488 3300046517 Ga0495630_0000171 Ga0495630_0000171_11340_12398 315
489 3300046517 Ga0495630_0024658 Ga0495630_0024658_499_1503 315
490 3300046535 Ga0495586_0000157 Ga0495586_0000157_42612_43670 315
491 3300046535 Ga0495586_0007676 Ga0495586_0007676_2471_3511 315
492 3300046535 Ga0495586_0179240 Ga0495586_0179240_65_1069 315
493 3300046642 Ga0495634_0014669 Ga0495634_0014669_2376_3416 315
494 3300046689 Ga0495613_0051685 Ga0495613_0051685_70_1110 315
495 3300047319 Ga0495674_0000893 Ga0495674_0000893_11340_12398 315
496 3300047321 Ga0495676_0009765 Ga0495676_0009765_50_1108 315
497 3300048907 Ga0496104_0302815 Ga0496104_0302815_429_1469 315
498 3300048912 Ga0496109_0383401 Ga0496109_0383401_236_1207 315
499 3300049570 Ga0501033_0044104 Ga0501033_0044104_509_1486 315
500 3300049571 Ga0501034_0006529 Ga0501034_0006529_259_1239 315
501 3300049571 Ga0501034_0108846 Ga0501034_0108846_375_1361 315
502 3300049571 Ga0501034_0142665 Ga0501034_0142665_545_1546 315
503 3300049572 Ga0501036_0370093 Ga0501036_0370093_40_1026 315
504 3300049573 Ga0501037_0019718 Ga0501037_0019718_60_1040 315
505 3300049575 Ga0501039_0264449 Ga0501039_0264449_143_1150 315
506 3300049579 Ga0501043_0001277 Ga0501043_0001277_3689_4672 315
507 3300049579 Ga0501043_0020811 Ga0501043_0020811_936_1940 315
508 3300049580 Ga0501046_0000216 Ga0501046_0000216_56056_57039 315
509 3300049580 Ga0501046_0009370 Ga0501046_0009370_1616_2620 315
510 3300049580 Ga0501046_0016796 Ga0501046_0016796_88_1074 315
511 3300049581 Ga0501047_0009498 Ga0501047_0009498_5071_6054 315
512 3300049581 Ga0501047_0080459 Ga0501047_0080459_476_1480 315
513 3300049582 Ga0501048_0000706 Ga0501048_0000706_21395_22378 315
514 3300049586 Ga0501070_0011429 Ga0501070_0011429_6279_7283 315
515 3300049589 Ga0501073_0058326 Ga0501073_0058326_944_1930 315
516 3300049591 Ga0501075_0034269 Ga0501075_0034269_1532_2503 315
517 3300049592 Ga0501076_0181924 Ga0501076_0181924_471_1478 315
518 3300049592 Ga0501076_0408712 Ga0501076_0408712_99_1070 315
519 3300049742 Ga0501080_0152160 Ga0501080_0152160_369_1373 315
520 3300049744 Ga0501083_0000094 Ga0501083_0000094_56056_57039 315
521 3300049822 Ga0501035_0016573 Ga0501035_0016573_3456_4439 315
522 3300049822 Ga0501035_0026719 Ga0501035_0026719_2623_3639 315
523 3300050511 nmdc:mga08y16_291697_c1 nmdc:mga08y16_291697_c1_459_1442 315
524 iso_pu_bacteria 2687453257 2688068131 315
525 iso_pu_bacteria 2889415604 2889420471 315
526 iso_pu_bacteria 2920107658 2920113223 315
527 3300003322 rootL2_10282228 rootL2_102822281 316
528 3300003659 JGI25404J52841_10007605 JGI25404J52841_100076052 316
529 3300005327 Ga0070658_10008528 Ga0070658_100085282 316
530 3300005327 Ga0070658_10049246 Ga0070658_100492462 316
531 3300005327 Ga0070658_10056074 Ga0070658_100560743 316
532 3300005328 Ga0070676_10045003 Ga0070676_100450032 316
533 3300005330 Ga0070690_100000083 Ga0070690_10000008340 316
534 3300005330 Ga0070690_100111421 Ga0070690_1001114212 316
535 3300005331 Ga0070670_100001144 Ga0070670_10000114417 316
536 3300005331 Ga0070670_100007453 Ga0070670_1000074534 316
537 3300005331 Ga0070670_100170660 Ga0070670_1001706601 316
538 3300005334 Ga0068869_100001752 Ga0068869_10000175211 316
539 3300005334 Ga0068869_100088281 Ga0068869_1000882812 316
540 3300005335 Ga0070666_10006936 Ga0070666_100069365 316
541 3300005335 Ga0070666_10020030 Ga0070666_100200302 316
542 3300005336 Ga0070680_100088535 Ga0070680_1000885352 316
543 3300005338 Ga0068868_100009540 Ga0068868_1000095402 316
544 3300005339 Ga0070660_100120010 Ga0070660_1001200102 316
545 3300005340 Ga0070689_100016476 Ga0070689_1000164763 316
546 3300005341 Ga0070691_10042325 Ga0070691_100423253 316
547 3300005347 Ga0070668_100004124 Ga0070668_1000041245 316
548 3300005353 Ga0070669_100012637 Ga0070669_1000126375 316
549 3300005354 Ga0070675_100014013 Ga0070675_1000140133 316
550 3300005355 Ga0070671_100002526 Ga0070671_1000025266 316
551 3300005355 Ga0070671_100011089 Ga0070671_1000110891 316
552 3300005364 Ga0070673_100008936 Ga0070673_1000089362 316
553 3300005364 Ga0070673_100030712 Ga0070673_1000307124 316
554 3300005365 Ga0070688_100040974 Ga0070688_1000409742 316
555 3300005367 Ga0070667_100008810 Ga0070667_1000088106 316
556 3300005436 Ga0070713_100011838 Ga0070713_1000118387 316
557 3300005438 Ga0070701_10001604 Ga0070701_100016045 316
558 3300005440 Ga0070705_100082127 Ga0070705_1000821272 316
559 3300005441 Ga0070700_100016511 Ga0070700_1000165112 316
560 3300005444 Ga0070694_100019785 Ga0070694_1000197852 316
561 3300005445 Ga0070708_100448779 Ga0070708_1004487792 316
562 3300005457 Ga0070662_100102984 Ga0070662_1001029842 316
563 3300005459 Ga0068867_100031719 Ga0068867_1000317192 316
564 3300005467 Ga0070706_100003351 Ga0070706_10000335111 316
565 3300005468 Ga0070707_100087471 Ga0070707_1000874712 316
566 3300005471 Ga0070698_100009691 Ga0070698_1000096912 316
567 3300005471 Ga0070698_100063704 Ga0070698_1000637043 316
568 3300005518 Ga0070699_100002417 Ga0070699_1000024172 316
569 3300005539 Ga0068853_100000003 Ga0068853_100000003249 316
570 3300005539 Ga0068853_100079807 Ga0068853_1000798073 316
571 3300005544 Ga0070686_100011454 Ga0070686_1000114543 316
572 3300005545 Ga0070695_100015417 Ga0070695_1000154174 316
573 3300005547 Ga0070693_100056394 Ga0070693_1000563943 316
574 3300005548 Ga0070665_100047552 Ga0070665_1000475523 316
575 3300005548 Ga0070665_100186352 Ga0070665_1001863522 316
576 3300005549 Ga0070704_100077656 Ga0070704_1000776563 316
577 3300005563 Ga0068855_100004254 Ga0068855_1000042549 316
578 3300005563 Ga0068855_100270877 Ga0068855_1002708772 316
579 3300005564 Ga0070664_100156022 Ga0070664_1001560222 316
580 3300005615 Ga0070702_100000787 Ga0070702_1000007874 316
581 3300005617 Ga0068859_100005776 Ga0068859_1000057768 316
582 3300005718 Ga0068866_10003043 Ga0068866_100030435 316
583 3300005719 Ga0068861_100000337 Ga0068861_10000033719 316
584 3300005842 Ga0068858_100018973 Ga0068858_1000189735 316
585 3300005842 Ga0068858_100024309 Ga0068858_1000243094 316
586 3300005842 Ga0068858_100204480 Ga0068858_1002044802 316
587 3300005843 Ga0068860_100001778 Ga0068860_1000017789 316
588 3300005843 Ga0068860_100109160 Ga0068860_1001091603 316
589 3300005843 Ga0068860_100501931 Ga0068860_1005019312 316
590 3300005844 Ga0068862_100100950 Ga0068862_1001009503 316
591 3300005844 Ga0068862_100157066 Ga0068862_1001570663 316
592 3300005844 Ga0068862_100412442 Ga0068862_1004124422 316
593 3300005937 Ga0081455_10094308 Ga0081455_100943082 316
594 3300005983 Ga0081540_1026720 Ga0081540_10267204 316
595 3300006048 Ga0075363_100005177 Ga0075363_1000051776 316
596 3300006177 Ga0075362_10000420 Ga0075362_1000042010 316
597 3300006237 Ga0097621_100000938 Ga0097621_10000093812 316
598 3300006237 Ga0097621_100034170 Ga0097621_1000341704 316
599 3300006237 Ga0097621_100154109 Ga0097621_1001541092 316
600 3300006358 Ga0068871_100004323 Ga0068871_1000043235 316
601 3300006358 Ga0068871_100006362 Ga0068871_1000063624 316
602 3300006358 Ga0068871_100142906 Ga0068871_1001429062 316
603 3300006844 Ga0075428_100201590 Ga0075428_1002015902 316
604 3300006844 Ga0075428_100473838 Ga0075428_1004738381 316
605 3300006847 Ga0075431_100062828 Ga0075431_1000628282 316
606 3300006847 Ga0075431_100085835 Ga0075431_1000858352 316
607 3300006880 Ga0075429_100000196 Ga0075429_10000019642 316
608 3300006880 Ga0075429_100481327 Ga0075429_1004813271 316
609 3300006881 Ga0068865_100014361 Ga0068865_1000143613 316
610 3300006881 Ga0068865_100096128 Ga0068865_1000961282 316
611 3300006931 Ga0097620_100005776 Ga0097620_1000057768 316
612 3300007265 Ga0099794_10000046 Ga0099794_1000004627 316
613 3300009093 Ga0105240_10018190 Ga0105240_100181903 316
614 3300009098 Ga0105245_10000968 Ga0105245_100009688 316
615 3300009177 Ga0105248_10067003 Ga0105248_100670034 316
616 3300009545 Ga0105237_10016911 Ga0105237_100169115 316
617 3300009553 Ga0105249_10015794 Ga0105249_100157943 316
618 3300011119 Ga0105246_10062853 Ga0105246_100628532 316
619 3300013105 Ga0157369_10340287 Ga0157369_103402872 316
620 3300013296 Ga0157374_10009685 Ga0157374_100096853 316
621 3300013296 Ga0157374_10050077 Ga0157374_100500772 316
622 3300013297 Ga0157378_10001738 Ga0157378_1000173814 316
623 3300013306 Ga0163162_10091992 Ga0163162_100919923 316
624 3300013306 Ga0163162_10377084 Ga0163162_103770842 316
625 3300013308 Ga0157375_10000284 Ga0157375_1000028410 316
626 3300014326 Ga0157380_10002830 Ga0157380_100028305 316
627 3300014968 Ga0157379_10041434 Ga0157379_100414343 316
628 3300014969 Ga0157376_10165961 Ga0157376_101659613 316
629 3300021361 Ga0213872_10046718 Ga0213872_100467181 316
630 3300021384 Ga0213876_10003657 Ga0213876_100036572 316
631 3300021384 Ga0213876_10008273 Ga0213876_100082732 316
632 3300021384 Ga0213876_10011138 Ga0213876_100111382 316
633 3300025315 Ga0207697_10001318 Ga0207697_100013189 316
634 3300025893 Ga0207682_10013720 Ga0207682_100137203 316
635 3300025899 Ga0207642_10003168 Ga0207642_100031682 316
636 3300025901 Ga0207688_10002677 Ga0207688_100026776 316
637 3300025903 Ga0207680_10071252 Ga0207680_100712522 316
638 3300025907 Ga0207645_10047281 Ga0207645_100472813 316
639 3300025909 Ga0207705_10074788 Ga0207705_100747883 316
640 3300025909 Ga0207705_10222627 Ga0207705_102226272 316
641 3300025910 Ga0207684_10002729 Ga0207684_1000272912 316
642 3300025913 Ga0207695_10045908 Ga0207695_100459082 316
643 3300025917 Ga0207660_10026020 Ga0207660_100260203 316
644 3300025922 Ga0207646_10075355 Ga0207646_100753552 316
645 3300025923 Ga0207681_10107865 Ga0207681_101078652 316
646 3300025925 Ga0207650_10045942 Ga0207650_100459423 316
647 3300025927 Ga0207687_10005298 Ga0207687_100052985 316
648 3300025928 Ga0207700_10009145 Ga0207700_100091457 316
649 3300025931 Ga0207644_10004324 Ga0207644_100043246 316
650 3300025933 Ga0207706_10109708 Ga0207706_101097082 316
651 3300025934 Ga0207686_10004503 Ga0207686_100045035 316
652 3300025935 Ga0207709_10020921 Ga0207709_100209214 316
653 3300025936 Ga0207670_10008675 Ga0207670_100086755 316
654 3300025937 Ga0207669_10023783 Ga0207669_100237832 316
655 3300025937 Ga0207669_10097439 Ga0207669_100974392 316
656 3300025938 Ga0207704_10148168 Ga0207704_101481681 316
657 3300025940 Ga0207691_10026709 Ga0207691_100267092 316
658 3300025941 Ga0207711_10075951 Ga0207711_100759514 316
659 3300025942 Ga0207689_10000197 Ga0207689_1000019743 316
660 3300025942 Ga0207689_10098716 Ga0207689_100987162 316
661 3300025949 Ga0207667_10020003 Ga0207667_100200038 316
662 3300025960 Ga0207651_10034295 Ga0207651_100342952 316
663 3300025961 Ga0207712_10013341 Ga0207712_100133414 316
664 3300026035 Ga0207703_10200750 Ga0207703_102007502 316
665 3300026041 Ga0207639_10000002 Ga0207639_10000002615 316
666 3300026041 Ga0207639_10068010 Ga0207639_100680103 316
667 3300026041 Ga0207639_10354826 Ga0207639_103548262 316
668 3300026075 Ga0207708_10000422 Ga0207708_1000042225 316
669 3300026089 Ga0207648_10000365 Ga0207648_1000036543 316
670 3300026089 Ga0207648_10008033 Ga0207648_100080336 316
671 3300026118 Ga0207675_100000226 Ga0207675_1000002268 316
672 3300026118 Ga0207675_100651455 Ga0207675_1006514551 316
673 3300027671 Ga0209588_1000022 Ga0209588_100002228 316
674 3300028379 Ga0268266_10048387 Ga0268266_100483875 316
675 3300028379 Ga0268266_10069726 Ga0268266_100697262 316
676 3300028380 Ga0268265_10100123 Ga0268265_101001233 316
677 3300028381 Ga0268264_10001024 Ga0268264_1000102411 316
678 3300028556 Ga0265337_1002043 Ga0265337_10020438 316
679 3300028556 Ga0265337_1006807 Ga0265337_10068074 316
680 3300028563 Ga0265319_1002755 Ga0265319_10027555 316
681 3300028563 Ga0265319_1003156 Ga0265319_10031566 316
682 3300028563 Ga0265319_1009112 Ga0265319_10091122 316
683 3300028563 Ga0265319_1015788 Ga0265319_10157883 316
684 3300028573 Ga0265334_10000014 Ga0265334_1000001494 316
685 3300028577 Ga0265318_10002219 Ga0265318_100022195 316
686 3300028577 Ga0265318_10002412 Ga0265318_100024122 316
687 3300028577 Ga0265318_10009904 Ga0265318_100099043 316
688 3300028577 Ga0265318_10014317 Ga0265318_100143174 316
689 3300028794 Ga0307515_10066435 Ga0307515_100664355 316
690 3300028800 Ga0265338_10000619 Ga0265338_1000061951 316
691 3300028800 Ga0265338_10009263 Ga0265338_100092634 316
692 3300029957 Ga0265324_10001725 Ga0265324_100017254 316
693 3300029957 Ga0265324_10005920 Ga0265324_100059204 316
694 3300031235 Ga0265330_10001762 Ga0265330_100017625 316
695 3300031238 Ga0265332_10000222 Ga0265332_1000022254 316
696 3300031240 Ga0265320_10000394 Ga0265320_100003942 316
697 3300031240 Ga0265320_10001703 Ga0265320_100017036 316
698 3300031240 Ga0265320_10001761 Ga0265320_100017619 316
699 3300031240 Ga0265320_10031286 Ga0265320_100312862 316
700 3300031240 Ga0265320_10036494 Ga0265320_100364942 316
701 3300031240 Ga0265320_10078604 Ga0265320_100786042 316
702 3300031241 Ga0265325_10000270 Ga0265325_1000027035 316
703 3300031241 Ga0265325_10031615 Ga0265325_100316153 316
704 3300031251 Ga0265327_10009964 Ga0265327_100099642 316
705 3300031344 Ga0265316_10000084 Ga0265316_1000008475 316
706 3300031344 Ga0265316_10024451 Ga0265316_100244514 316
707 3300031344 Ga0265316_10025535 Ga0265316_100255357 316
708 3300031344 Ga0265316_10068061 Ga0265316_100680612 316
709 3300031548 Ga0307408_100082149 Ga0307408_1000821492 316
710 3300031595 Ga0265313_10000294 Ga0265313_100002946 316
711 3300031595 Ga0265313_10002132 Ga0265313_1000213215 316
712 3300031595 Ga0265313_10003273 Ga0265313_100032736 316
713 3300031595 Ga0265313_10014538 Ga0265313_100145383 316
714 3300031616 Ga0307508_10000129 Ga0307508_1000012943 316
715 3300031691 Ga0316579_10103425 Ga0316579_101034252 316
716 3300031711 Ga0265314_10000076 Ga0265314_1000007686 316
717 3300031711 Ga0265314_10008024 Ga0265314_100080243 316
718 3300031711 Ga0265314_10027223 Ga0265314_100272232 316
719 3300031711 Ga0265314_10050561 Ga0265314_100505612 316
720 3300031712 Ga0265342_10000147 Ga0265342_100001479 316
721 3300031712 Ga0265342_10014381 Ga0265342_100143813 316
722 3300031712 Ga0265342_10049845 Ga0265342_100498453 316
723 3300031727 Ga0316576_10002208 Ga0316576_100022086 316
724 3300031727 Ga0316576_10003580 Ga0316576_100035802 316
725 3300031727 Ga0316576_10160663 Ga0316576_101606632 316
726 3300031728 Ga0316578_10053606 Ga0316578_100536062 316
727 3300031901 Ga0307406_10048889 Ga0307406_100488892 316
728 3300032002 Ga0307416_100008182 Ga0307416_1000081826 316
729 3300032168 Ga0316593_10000238 Ga0316593_100002383 316
730 3300033524 Ga0316592_1017191 Ga0316592_10171912 316
731 3300033541 Ga0316596_1001161 Ga0316596_10011613 316
732 3300035398 Ga0316574_0008677 Ga0316574_0008677_3454_4410 316
733 3300035398 Ga0316574_0022953 Ga0316574_0022953_253_1209 316
734 3300035398 Ga0316574_0023426 Ga0316574_0023426_1006_1962 316
735 3300035398 Ga0316574_0056394 Ga0316574_0056394_103_1059 316
736 3300035724 Ga0373933_0051150 Ga0373933_0051150_598_1560 316
737 3300035724 Ga0373933_0091264 Ga0373933_0091264_564_1544 316
738 3300036401 Ga0373937_0252425 Ga0373937_0252425_236_1213 316
739 3300036647 Ga0316582_0020906 Ga0316582_0020906_1551_2510 316
740 3300036647 Ga0316582_0122925 Ga0316582_0122925_232_1194 316
741 3300036647 Ga0316582_0157013 Ga0316582_0157013_274_1233 316
742 3300036712 Ga0316584_0014329 Ga0316584_0014329_3326_4288 316
743 3300037068 Ga0373925_0096861 Ga0373925_0096861_1097_2080 316
744 3300037471 Ga0395905_0261452 Ga0395905_0261452_361_1320 316
745 3300037853 Ga0436364_1107980 Ga0436364_1107980_666_1622 316
746 3300038725 Ga0400484_14496 Ga0400484_14496_1396_2355 316
747 3300038725 Ga0400484_22999 Ga0400484_22999_34702_35664 316
748 3300038725 Ga0400484_30145 Ga0400484_30145_8373_9332 316
749 3300038725 Ga0400484_31956 Ga0400484_31956_2451_3410 316
750 3300038725 Ga0400484_39820 Ga0400484_39820_2541_3500 316
751 3300038726 Ga0400490_03296 Ga0400490_03296_54395_55354 316
752 3300038726 Ga0400490_09621 Ga0400490_09621_13327_14286 316
753 3300038726 Ga0400490_35547 Ga0400490_35547_4258_5217 316
754 3300038726 Ga0400490_55744 Ga0400490_55744_34492_35451 316
755 3300038727 Ga0400491_10338 Ga0400491_10338_8048_9007 316
756 3300038727 Ga0400491_21040 Ga0400491_21040_506_1465 316
757 3300038727 Ga0400491_26211 Ga0400491_26211_264_1223 316
758 3300038735 Ga0400485_11431 Ga0400485_11431_125372_126334 316
759 3300038735 Ga0400485_16362 Ga0400485_16362_4210_5169 316
760 3300038741 Ga0400488_31697 Ga0400488_31697_875_1834 316
761 3300038741 Ga0400488_42417 Ga0400488_42417_1430_2389 316
762 3300038741 Ga0400488_48423 Ga0400488_48423_2035_2994 316
763 3300038741 Ga0400488_48558 Ga0400488_48558_8760_9749 316
764 3300038741 Ga0400488_50866 Ga0400488_50866_1586_2545 316
765 3300038742 Ga0400486_09395 Ga0400486_09395_4227_5186 316
766 3300038742 Ga0400486_10900 Ga0400486_10900_11983_12942 316
767 3300038742 Ga0400486_18012 Ga0400486_18012_15882_16844 316
768 3300039062 Ga0400483_011961 Ga0400483_011961_10999_11958 316
769 3300039062 Ga0400483_016449 Ga0400483_016449_267_1226 316
770 3300039062 Ga0400483_038707 Ga0400483_038707_295_1254 316
771 3300039062 Ga0400483_102324 Ga0400483_102324_1573_2529 316
772 3300039062 Ga0400483_105883 Ga0400483_105883_88_1044 316
773 3300039062 Ga0400483_124202 Ga0400483_124202_422_1411 316
774 3300039062 Ga0400483_125458 Ga0400483_125458_6495_7454 316
775 3300039062 Ga0400483_141525 Ga0400483_141525_3549_4505 316
776 3300039062 Ga0400483_184941 Ga0400483_184941_3786_4742 316
777 3300039062 Ga0400483_196695 Ga0400483_196695_4157_5116 316
778 3300039062 Ga0400483_200917 Ga0400483_200917_275_1234 316
779 3300039062 Ga0400483_202172 Ga0400483_202172_4313_5272 316
780 3300039110 Ga0400487_03473 Ga0400487_03473_3705_4664 316
781 3300039110 Ga0400487_03760 Ga0400487_03760_697_1656 316
782 3300039110 Ga0400487_23026 Ga0400487_23026_179_1138 316
783 3300039110 Ga0400487_29515 Ga0400487_29515_10082_11041 316
784 3300039110 Ga0400487_54961 Ga0400487_54961_42054_43013 316
785 3300039110 Ga0400487_56221 Ga0400487_56221_6992_7951 316
786 3300039110 Ga0400487_58246 Ga0400487_58246_15880_16842 316
787 3300039437 Ga0436365_0704006 Ga0436365_0704006_205_1197 316
788 3300039437 Ga0436365_1457951 Ga0436365_1457951_1707_2675 316
789 3300039447 Ga0436361_0169046 Ga0436361_0169046_4374_5333 316
790 3300039447 Ga0436361_0594389 Ga0436361_0594389_983_1990 316
791 3300039450 Ga0436363_0803061 Ga0436363_0803061_3230_4192 316
792 3300039450 Ga0436363_0848729 Ga0436363_0848729_8372_9331 316
793 3300044673 Ga0453683_0023991 Ga0453683_0023991_115_1095 316
794 3300044683 Ga0466965_0015192 Ga0466965_0015192_2430_3392 316
795 3300044719 Ga0466971_0000023 Ga0466971_0000023_27013_27975 316
796 3300044842 Ga0466957_0023002 Ga0466957_0023002_2284_3246 316
797 3300045051 Ga0451576_0001488 Ga0451576_0001488_37211_38179 316
798 3300045051 Ga0451576_0004916 Ga0451576_0004916_13528_14481 316
799 3300045976 Ga0466967_0175447 Ga0466967_0175447_380_1342 316
800 3300048912 Ga0496109_0251261 Ga0496109_0251261_505_1482 316
801 3300048912 Ga0496109_0449158 Ga0496109_0449158_41_1018 316
802 3300048928 Ga0496125_0000147 Ga0496125_0000147_59756_60712 316
803 3300048928 Ga0496125_0267196 Ga0496125_0267196_67_1023 316
804 3300049568 Ga0501031_0003827 Ga0501031_0003827_364_1323 316
805 3300049569 Ga0501032_0001360 Ga0501032_0001360_3725_4705 316
806 3300049570 Ga0501033_0000127 Ga0501033_0000127_38177_39136 316
807 3300049570 Ga0501033_0020015 Ga0501033_0020015_3164_4144 316
808 3300049573 Ga0501037_0000020 Ga0501037_0000020_146814_147776 316
809 3300049573 Ga0501037_0069512 Ga0501037_0069512_77_1057 316
810 3300049574 Ga0501038_0154538 Ga0501038_0154538_791_1771 316
811 3300049574 Ga0501038_0303623 Ga0501038_0303623_234_1193 316
812 3300049579 Ga0501043_0000156 Ga0501043_0000156_46852_47814 316
813 3300049580 Ga0501046_0002988 Ga0501046_0002988_8066_9046 316
814 3300049580 Ga0501046_0041590 Ga0501046_0041590_2445_3425 316
815 3300049580 Ga0501046_0054137 Ga0501046_0054137_286_1278 316
816 3300049581 Ga0501047_0002610 Ga0501047_0002610_8122_9081 316
817 3300049581 Ga0501047_0008802 Ga0501047_0008802_3721_4701 316
818 3300049581 Ga0501047_0025015 Ga0501047_0025015_3624_4604 316
819 3300049581 Ga0501047_0402137 Ga0501047_0402137_194_1174 316
820 3300049584 Ga0501068_0140346 Ga0501068_0140346_481_1440 316
821 3300049586 Ga0501070_0001390 Ga0501070_0001390_11832_12791 316
822 3300049587 Ga0501071_0047816 Ga0501071_0047816_1899_2858 316
823 3300049590 Ga0501074_0101507 Ga0501074_0101507_651_1643 316
824 3300049592 Ga0501076_0169192 Ga0501076_0169192_294_1256 316
825 3300049593 Ga0501077_0012120 Ga0501077_0012120_3864_4826 316
826 3300049742 Ga0501080_0044560 Ga0501080_0044560_2312_3304 316
827 3300049822 Ga0501035_0000002 Ga0501035_0000002_508131_509090 316
828 3300049822 Ga0501035_0000932 Ga0501035_0000932_3700_4680 316
829 3300049822 Ga0501035_0031663 Ga0501035_0031663_1734_2726 316
830 3300049823 Ga0501044_0000095 Ga0501044_0000095_23208_24170 316
831 3300049823 Ga0501044_0000371 Ga0501044_0000371_51535_52515 316
832 3300049823 Ga0501044_0110147 Ga0501044_0110147_669_1661 316
833 3300049824 Ga0501045_0266921 Ga0501045_0266921_103_1065 316
834 3300050489 nmdc:mga03683_2929_c1 nmdc:mga03683_2929_c1_3347_4354 316
835 3300050508 nmdc:mga09592_1330_c1 nmdc:mga09592_1330_c1_8124_9086 316
836 3300050508 nmdc:mga09592_333454_c1 nmdc:mga09592_333454_c1_228_1190 316
837 3300050515 nmdc:mga0a205_216833_c1 nmdc:mga0a205_216833_c1_94_1155 316
838 3300053104 Ga0500556_0008287 Ga0500556_0008287_1692_2651 316
839 3300054114 Ga0501084_0130132 Ga0501084_0130132_145_1107 316
840 3300061719 Ga0466962_0000993 Ga0466962_0000993_7000_7962 316
841 3300031251 Ga0265327_10000014 Ga0265327_10000014477 317
842 3300049570 Ga0501033_0290849 Ga0501033_0290849_38_1042 317
843 3300001989 JGI24739J22299_10000196 JGI24739J22299_100001967 318
844 3300002737 JGI25162J39368_1002234 JGI25162J39368_10022343 318
845 3300003856 Ga0058692_1000321 Ga0058692_100032117 318
846 3300003856 Ga0058692_1000737 Ga0058692_10007371 318
847 3300003856 Ga0058692_1000823 Ga0058692_100082311 318
848 3300003856 Ga0058692_1006137 Ga0058692_10061371 318
849 3300003856 Ga0058692_1006713 Ga0058692_10067131 318
850 3300005347 Ga0070668_100004559 Ga0070668_1000045598 318
851 3300005457 Ga0070662_100063266 Ga0070662_1000632662 318
852 3300006051 Ga0075364_10012273 Ga0075364_100122734 318
853 3300006051 Ga0075364_10027091 Ga0075364_100270913 318
854 3300009011 Ga0105251_10000763 Ga0105251_100007636 318
855 3300009011 Ga0105251_10008784 Ga0105251_100087842 318
856 3300009011 Ga0105251_10025124 Ga0105251_100251241 318
857 3300009011 Ga0105251_10025830 Ga0105251_100258302 318
858 3300009036 Ga0105244_10004443 Ga0105244_100044432 318
859 3300009036 Ga0105244_10005668 Ga0105244_100056685 318
860 3300009036 Ga0105244_10100578 Ga0105244_101005781 318
861 3300009174 Ga0105241_10000012 Ga0105241_1000001223 318
862 3300009545 Ga0105237_10033518 Ga0105237_100335182 318
863 3300011119 Ga0105246_10016359 Ga0105246_100163592 318
864 3300013100 Ga0157373_10002278 Ga0157373_100022782 318
865 3300013102 Ga0157371_10003028 Ga0157371_100030282 318
866 3300013104 Ga0157370_10002510 Ga0157370_1000251017 318
867 3300013105 Ga0157369_10042060 Ga0157369_100420604 318
868 3300013306 Ga0163162_10097271 Ga0163162_100972711 318
869 3300013307 Ga0157372_10015433 Ga0157372_100154331 318
870 3300013308 Ga0157375_10154310 Ga0157375_101543102 318
871 3300014497 Ga0182008_10003015 Ga0182008_100030157 318
872 3300015261 Ga0182006_1004923 Ga0182006_10049232 318
873 3300017792 Ga0163161_10013454 Ga0163161_100134542 318
874 3300021441 Ga0213871_10022332 Ga0213871_100223321 318
875 3300025207 Ga0209760_104198 Ga0209760_1041981 318
876 3300025233 Ga0209437_100063 Ga0209437_100063294 318
877 3300025711 Ga0207696_1000387 Ga0207696_100038726 318
878 3300025711 Ga0207696_1056604 Ga0207696_10566041 318
879 3300025728 Ga0207655_1000024 Ga0207655_100002415 318
880 3300025728 Ga0207655_1001132 Ga0207655_10011323 318
881 3300025728 Ga0207655_1004658 Ga0207655_10046584 318
882 3300025728 Ga0207655_1011411 Ga0207655_10114111 318
883 3300025728 Ga0207655_1020279 Ga0207655_10202792 318
884 3300025735 Ga0207713_1000007 Ga0207713_100000715 318
885 3300025735 Ga0207713_1000054 Ga0207713_100005423 318
886 3300025735 Ga0207713_1008116 Ga0207713_10081165 318
887 3300025735 Ga0207713_1022317 Ga0207713_10223172 318
888 3300025911 Ga0207654_10000015 Ga0207654_1000001523 318
889 3300025933 Ga0207706_10102448 Ga0207706_101024482 318
890 3300027111 Ga0209281_1000092 Ga0209281_100009223 318
891 3300027312 Ga0209371_1000053 Ga0209371_100005316 318
892 3300027312 Ga0209371_1000096 Ga0209371_100009615 318
893 3300027312 Ga0209371_1000497 Ga0209371_100049733 318
894 3300027312 Ga0209371_1000691 Ga0209371_100069124 318
895 3300027312 Ga0209371_1000756 Ga0209371_100075613 318
896 3300027312 Ga0209371_1000875 Ga0209371_100087515 318
897 3300027312 Ga0209371_1001111 Ga0209371_100111114 318
898 3300027312 Ga0209371_1001791 Ga0209371_10017911 318
899 3300030500 Ga0268256_1000053 Ga0268256_1000053219 318
900 3300030500 Ga0268256_1000086 Ga0268256_100008615 318
901 3300030500 Ga0268256_1000657 Ga0268256_100065715 318
902 3300030500 Ga0268256_1001242 Ga0268256_100124214 318
903 3300030500 Ga0268256_1001562 Ga0268256_10015621 318
904 3300030500 Ga0268256_1041009 Ga0268256_10410091 318
905 3300030742 Ga0316183_1199272 Ga0316183_11992722 318
906 3300039062 Ga0400483_241723 Ga0400483_241723_5759_6718 318
907 3300039438 Ga0436360_0806145 Ga0436360_0806145_1105_2124 318
908 3300039447 Ga0436361_0473752 Ga0436361_0473752_6217_7236 318
909 3300039453 Ga0436362_0510036 Ga0436362_0510036_140_1159 318
910 3300041405 Ga0439438_027431 Ga0439438_027431_568_1524 318
911 3300041411 Ga0439466_0000161 Ga0439466_0000161_20280_21236 318
912 3300042006 Ga0439432_004893 Ga0439432_004893_2569_3525 318
913 3300042010 Ga0439452_000004 Ga0439452_000004_751227_752183 318
914 3300042146 Ga0450907_001326 Ga0450907_001326_2004_2960 318
915 3300046458 Ga0495591_000024 Ga0495591_000024_12515_13474 318
916 3300046458 Ga0495591_001549 Ga0495591_001549_1457_2416 318
917 3300046471 Ga0495650_0000377 Ga0495650_0000377_12430_13389 318
918 3300046491 Ga0495584_0011509 Ga0495584_0011509_1270_2229 318
919 3300046500 Ga0495596_0015033 Ga0495596_0015033_1860_2816 318
920 3300046501 Ga0495607_0056632 Ga0495607_0056632_1097_2056 318
921 3300046507 Ga0495606_0004074 Ga0495606_0004074_1484_2443 318
922 3300046523 Ga0495644_0003920 Ga0495644_0003920_3231_4190 318
923 3300046530 Ga0495654_0000061 Ga0495654_0000061_5944_6903 318
924 3300046530 Ga0495654_0000163 Ga0495654_0000163_12302_13261 318
925 3300046692 Ga0495671_0005382 Ga0495671_0005382_2687_3646 318
926 3300046810 Ga0495660_0000158 Ga0495660_0000158_59981_60940 318
927 3300046810 Ga0495660_0075408 Ga0495660_0075408_13_969 318
928 3300047320 Ga0495672_0000029 Ga0495672_0000029_291836_292795 318
929 3300047320 Ga0495672_0000054 Ga0495672_0000054_217406_218362 318
930 3300047469 Ga0495673_0000092 Ga0495673_0000092_12555_13514 318
931 3300048904 Ga0496101_0001295 Ga0496101_0001295_12404_13363 318
932 3300048906 Ga0496103_0112862 Ga0496103_0112862_168_1124 318
933 3300048919 Ga0496116_0001816 Ga0496116_0001816_12169_13128 318
934 3300048919 Ga0496116_0001830 Ga0496116_0001830_9855_10811 318
935 3300048919 Ga0496116_0042783 Ga0496116_0042783_417_1373 318
936 3300048919 Ga0496116_0067103 Ga0496116_0067103_642_1598 318
937 3300048920 Ga0496117_0000350 Ga0496117_0000350_68080_69036 318
938 3300048920 Ga0496117_0000895 Ga0496117_0000895_12370_13326 318
939 3300048920 Ga0496117_0001186 Ga0496117_0001186_26117_27073 318
940 3300048921 Ga0496118_0001869 Ga0496118_0001869_12404_13360 318
941 3300048921 Ga0496118_0004714 Ga0496118_0004714_12370_13326 318
942 3300048921 Ga0496118_0006706 Ga0496118_0006706_562_1518 318
943 3300048922 Ga0496119_0001006 Ga0496119_0001006_11612_12568 318
944 3300048922 Ga0496119_0003121 Ga0496119_0003121_4222_5178 318
945 3300048922 Ga0496119_0012337 Ga0496119_0012337_46_1005 318
946 3300048922 Ga0496119_0138580 Ga0496119_0138580_190_1149 318
947 3300048923 Ga0496120_0000090 Ga0496120_0000090_137324_138283 318
948 3300048923 Ga0496120_0000616 Ga0496120_0000616_7512_8468 318
949 3300048923 Ga0496120_0002035 Ga0496120_0002035_10857_11816 318
950 3300048923 Ga0496120_0002689 Ga0496120_0002689_4222_5178 318
951 3300048923 Ga0496120_0126219 Ga0496120_0126219_168_1127 318
952 3300048924 Ga0496121_0001624 Ga0496121_0001624_12278_13234 318
953 3300048926 Ga0496123_0007402 Ga0496123_0007402_2701_3657 318
954 3300048926 Ga0496123_0010305 Ga0496123_0010305_6876_7835 318
955 3300048927 Ga0496124_0000452 Ga0496124_0000452_12278_13234 318
956 3300048927 Ga0496124_0002279 Ga0496124_0002279_12175_13134 318
957 3300048927 Ga0496124_0024644 Ga0496124_0024644_4227_5183 318
958 3300048927 Ga0496124_0228876 Ga0496124_0228876_193_1149 318
959 3300048927 Ga0496124_0251727 Ga0496124_0251727_291_1250 318
960 3300048929 Ga0496126_0074114 Ga0496126_0074114_1368_2324 318
961 3300049459 Ga0495678_001808 Ga0495678_001808_2316_3275 318
962 3300049460 Ga0495682_0000003 Ga0495682_0000003_12430_13389 318
963 3300049822 Ga0501035_0205991 Ga0501035_0205991_538_1569 318
964 3300049823 Ga0501044_0333158 Ga0501044_0333158_132_1151 318
965 3300050491 nmdc:mga00v17_4279_c1 nmdc:mga00v17_4279_c1_5570_6526 318
966 3300053126 Ga0500621_000006 Ga0500621_000006_12430_13389 318

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03255

ACCA

Acetyl co-enzyme A carboxylase carboxyltransferase-like

42

351

0.99

PF01039

Carboxyl_trans

Carboxyl transferase domain

101

323

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9y-assembly1.cif.gz_A-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.9758 4 318
2f9y-assembly1.cif.gz_A-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.9726 4 318
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9488 5 318
5kdr-assembly1.cif.gz_A-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.943 6 318
2f9i-assembly1.cif.gz_A crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9426 5 318
ID Description Score Start End Superfamily
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9485 5 318 3.90.226.10
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9452 56 313 3.90.226.10
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9398 5 318 3.90.226.10
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9237 56 313 3.90.226.10
af_A0A1D6HPV4_261_342_1.20.58.860 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8688 8 55 1.20.58.860
ID Description Score Start End GO Terms
AF-A0A080K7Q6-F1-model_v4 deleted 0.9953 193 283
AF-A0A8B4PGA1-F1-model_v4 deleted 0.9949 133 318
AF-A0A3S4IKJ5-F1-model_v4 acetyl-CoA carboxytransferase (EC 2.1.3.15) 0.9943 113 299 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A2N4YQW4-F1-model_v4 acetyl-CoA carboxytransferase (EC 2.1.3.15) 0.9939 165 318 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A2S6DHJ7-F1-model_v4 deleted 0.9931 135 254

Feature Viewer

pLDDT pTM Quality
94.1 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map