F486450
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 946 | 458 | 946 | 45 |
Family's Representative Sequence
| Representative Sequence | 3300006237|Ga0097621_102270138|Ga0097621_1022701382 |
| Length | 54 |
| Sequence | LPAFSGALLTMKRTYQPSKLRRKRTHGFRARMATKNGRKVLARRRSKGRKKLIP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 6 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 127 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 129 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 130 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 131 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 132 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 133 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 203 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 204 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 208 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 209 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 212 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 213 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 214 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 217 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 218 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 219 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 221 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 222 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 223 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 224 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 226 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 227 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 228 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 229 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 230 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 239 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 243 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 246 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 247 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 248 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 250 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 254 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 257 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 258 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 259 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 260 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 261 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 262 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 263 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 264 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 265 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 266 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 267 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 268 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 269 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 270 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 271 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 278 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 279 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 280 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 281 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 282 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 283 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 284 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 285 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 286 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 287 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 288 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 289 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 290 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 291 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 292 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 293 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 294 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 295 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 296 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 297 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 298 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 299 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 300 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 301 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 302 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 303 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 304 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 305 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 306 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 307 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 308 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 309 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 310 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 311 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 312 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 313 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 314 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 315 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 316 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 317 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 318 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 319 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 320 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 343 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 344 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 345 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 346 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 347 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 350 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 351 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 352 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 353 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 354 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 355 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 356 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 357 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 358 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 359 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 360 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 361 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 362 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 363 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 364 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 365 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 397 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 398 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 399 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 400 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 407 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 411 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 413 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 414 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 415 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 416 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 417 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 418 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 419 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 420 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 421 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 422 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 423 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 424 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 425 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 426 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 427 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 428 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 429 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 430 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 431 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 432 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 433 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 434 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 435 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 436 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 437 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 438 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 439 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 440 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 441 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 458 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.57 |
| Metatranscriptomes | 2.43 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.66 |
| Nodule | 0 |
| Rhizoplane | 3.81 |
| Rhizosphere | 83.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10046276 | 3300003187 | Bacteria | 1526 |
| 2 | JGI25406J46586_10015769 | 3300003203 | Bacteria | 3174 |
| 3 | rootH1_10118379 | 3300003323 | Bacteria | 1250 |
| 4 | Ga0055538_1000206 | 3300003751 | Bacteria | 35313 |
| 5 | Ga0055538_1000658 | 3300003751 | Bacteria | 10939 |
| 6 | Ga0055536_1041917 | 3300003781 | Bacteria | 1075 |
| 7 | Ga0055536_1066973 | 3300003781 | Bacteria | 722 |
| 8 | Ga0055536_1089251 | 3300003781 | Bacteria | 570 |
| 9 | JGI25405J52794_10027349 | 3300003911 | Bacteria | 1174 |
| 10 | Ga0065712_10248897 | 3300005290 | Unclassified | 965 |
| 11 | Ga0070658_10935262 | 3300005327 | Unclassified | 754 |
| 12 | Ga0070676_10156234 | 3300005328 | Bacteria | 1464 |
| 13 | Ga0070676_11394173 | 3300005328 | Bacteria | 537 |
| 14 | Ga0070676_11502862 | 3300005328 | Unclassified | 519 |
| 15 | Ga0070683_100054413 | 3300005329 | Bacteria | 3711 |
| 16 | Ga0070683_100192791 | 3300005329 | Unclassified | 1935 |
| 17 | Ga0070690_100003231 | 3300005330 | Bacteria | 8892 |
| 18 | Ga0070690_100009245 | 3300005330 | Bacteria | 5704 |
| 19 | Ga0070670_100067271 | 3300005331 | Bacteria | 3074 |
| 20 | Ga0070670_100320063 | 3300005331 | Bacteria | 1359 |
| 21 | Ga0070670_100992146 | 3300005331 | Unclassified | 764 |
| 22 | Ga0070677_10143081 | 3300005333 | Bacteria | 1105 |
| 23 | Ga0070666_10845613 | 3300005335 | Unclassified | 675 |
| 24 | Ga0070680_100025820 | 3300005336 | Bacteria | 4697 |
| 25 | Ga0070680_100093099 | 3300005336 | Bacteria | 2496 |
| 26 | Ga0070680_100879634 | 3300005336 | Bacteria | 773 |
| 27 | Ga0070680_101699098 | 3300005336 | Bacteria | 547 |
| 28 | Ga0070682_101551654 | 3300005337 | Unclassified | 571 |
| 29 | Ga0068868_100931770 | 3300005338 | Bacteria | 791 |
| 30 | Ga0070689_100010982 | 3300005340 | Bacteria | 6472 |
| 31 | Ga0070689_101638495 | 3300005340 | Unclassified | 585 |
| 32 | Ga0070691_10140828 | 3300005341 | Bacteria | 1229 |
| 33 | Ga0070687_100447103 | 3300005343 | Unclassified | 859 |
| 34 | Ga0070661_100000183 | 3300005344 | Bacteria | 51585 |
| 35 | Ga0070661_100376717 | 3300005344 | Unclassified | 1118 |
| 36 | Ga0070661_100455303 | 3300005344 | Unclassified | 1018 |
| 37 | Ga0070661_100562570 | 3300005344 | Bacteria | 919 |
| 38 | Ga0070692_10898304 | 3300005345 | Bacteria | 612 |
| 39 | Ga0070668_100235981 | 3300005347 | Bacteria | 1513 |
| 40 | Ga0070668_100636238 | 3300005347 | Bacteria | 936 |
| 41 | Ga0070669_100512739 | 3300005353 | Bacteria | 996 |
| 42 | Ga0070669_100998965 | 3300005353 | Unclassified | 718 |
| 43 | Ga0070675_100111925 | 3300005354 | Bacteria | 2311 |
| 44 | Ga0070671_100058258 | 3300005355 | Bacteria | 3216 |
| 45 | Ga0070671_101094650 | 3300005355 | Unclassified | 700 |
| 46 | Ga0070671_101398364 | 3300005355 | Unclassified | 618 |
| 47 | Ga0070671_102056739 | 3300005355 | Bacteria | 509 |
| 48 | Ga0070674_100016413 | 3300005356 | Bacteria | 4640 |
| 49 | Ga0070673_100049769 | 3300005364 | Bacteria | 3273 |
| 50 | Ga0070673_100099806 | 3300005364 | Bacteria | 2389 |
| 51 | Ga0070673_101111246 | 3300005364 | Bacteria | 739 |
| 52 | Ga0070673_101504916 | 3300005364 | Unclassified | 635 |
| 53 | Ga0070688_100039439 | 3300005365 | Bacteria | 2890 |
| 54 | Ga0070688_100164909 | 3300005365 | Bacteria | 1525 |
| 55 | Ga0070659_100114447 | 3300005366 | Bacteria | 2179 |
| 56 | Ga0070659_101567723 | 3300005366 | Unclassified | 588 |
| 57 | Ga0070709_10002110 | 3300005434 | Bacteria | 10759 |
| 58 | Ga0070709_10025676 | 3300005434 | Bacteria | 3483 |
| 59 | Ga0070709_10345689 | 3300005434 | Unclassified | 1098 |
| 60 | Ga0070714_100026296 | 3300005435 | Bacteria | 4809 |
| 61 | Ga0070714_100118183 | 3300005435 | Bacteria | 2355 |
| 62 | Ga0070714_100201334 | 3300005435 | Bacteria | 1821 |
| 63 | Ga0070714_102395599 | 3300005435 | Unclassified | 513 |
| 64 | Ga0070713_100032340 | 3300005436 | Bacteria | 4177 |
| 65 | Ga0070713_100095748 | 3300005436 | Bacteria | 2562 |
| 66 | Ga0070713_100272792 | 3300005436 | Bacteria | 1549 |
| 67 | Ga0070713_101228603 | 3300005436 | Unclassified | 725 |
| 68 | Ga0070710_10074514 | 3300005437 | Bacteria | 1965 |
| 69 | Ga0070710_10138473 | 3300005437 | Bacteria | 1490 |
| 70 | Ga0070710_10474736 | 3300005437 | Bacteria | 852 |
| 71 | Ga0070710_10543033 | 3300005437 | Unclassified | 802 |
| 72 | Ga0070710_10580617 | 3300005437 | Bacteria | 778 |
| 73 | Ga0070701_10044575 | 3300005438 | Bacteria | 2272 |
| 74 | Ga0070701_10114596 | 3300005438 | Bacteria | 1511 |
| 75 | Ga0070701_10119681 | 3300005438 | Bacteria | 1482 |
| 76 | Ga0070701_10200321 | 3300005438 | Bacteria | 1180 |
| 77 | Ga0070701_10354570 | 3300005438 | Bacteria | 917 |
| 78 | Ga0070711_100016582 | 3300005439 | Bacteria | 4679 |
| 79 | Ga0070711_100049836 | 3300005439 | Bacteria | 2868 |
| 80 | Ga0070711_100054931 | 3300005439 | Bacteria | 2750 |
| 81 | Ga0070711_100116010 | 3300005439 | Bacteria | 1973 |
| 82 | Ga0070711_101179453 | 3300005439 | Bacteria | 662 |
| 83 | Ga0070705_100019745 | 3300005440 | Bacteria | 3552 |
| 84 | Ga0070705_101265511 | 3300005440 | Bacteria | 610 |
| 85 | Ga0070700_100054830 | 3300005441 | Bacteria | 2493 |
| 86 | Ga0070694_100254155 | 3300005444 | Bacteria | 1330 |
| 87 | Ga0070708_100923735 | 3300005445 | Bacteria | 819 |
| 88 | Ga0070663_100341735 | 3300005455 | Bacteria | 1210 |
| 89 | Ga0070678_100117275 | 3300005456 | Bacteria | 2093 |
| 90 | Ga0070678_100798040 | 3300005456 | Unclassified | 857 |
| 91 | Ga0070662_100317973 | 3300005457 | Bacteria | 1269 |
| 92 | Ga0070662_100568302 | 3300005457 | Bacteria | 951 |
| 93 | Ga0070681_10003033 | 3300005458 | Bacteria | 15561 |
| 94 | Ga0070681_10019166 | 3300005458 | Bacteria | 6847 |
| 95 | Ga0070681_10034405 | 3300005458 | Bacteria | 5087 |
| 96 | Ga0070681_10034982 | 3300005458 | Bacteria | 5045 |
| 97 | Ga0070681_10061388 | 3300005458 | Bacteria | 3734 |
| 98 | Ga0068867_101271684 | 3300005459 | Bacteria | 678 |
| 99 | Ga0070685_10101524 | 3300005466 | Bacteria | 1757 |
| 100 | Ga0070685_10449132 | 3300005466 | Unclassified | 903 |
| 101 | Ga0070707_101680682 | 3300005468 | Bacteria | 602 |
| 102 | Ga0070699_100041632 | 3300005518 | Bacteria | 3976 |
| 103 | Ga0070679_100007660 | 3300005530 | Bacteria | 10108 |
| 104 | Ga0070679_100029196 | 3300005530 | Bacteria | 5440 |
| 105 | Ga0070679_100037832 | 3300005530 | Bacteria | 4795 |
| 106 | Ga0070679_100059089 | 3300005530 | Bacteria | 3822 |
| 107 | Ga0070679_100602641 | 3300005530 | Unclassified | 1042 |
| 108 | Ga0070684_100041728 | 3300005535 | Bacteria | 3958 |
| 109 | Ga0070684_100367116 | 3300005535 | Bacteria | 1325 |
| 110 | Ga0070684_100919822 | 3300005535 | Bacteria | 820 |
| 111 | Ga0070684_101424555 | 3300005535 | Unclassified | 653 |
| 112 | Ga0070697_101333618 | 3300005536 | Bacteria | 640 |
| 113 | Ga0068853_100033553 | 3300005539 | Bacteria | 4356 |
| 114 | Ga0068853_100252784 | 3300005539 | Bacteria | 1618 |
| 115 | Ga0068853_101373932 | 3300005539 | Bacteria | 683 |
| 116 | Ga0068853_102262481 | 3300005539 | Unclassified | 527 |
| 117 | Ga0070672_100030659 | 3300005543 | Bacteria | 4042 |
| 118 | Ga0070672_100061996 | 3300005543 | Bacteria | 2950 |
| 119 | Ga0070672_100102000 | 3300005543 | Bacteria | 2328 |
| 120 | Ga0070672_101458839 | 3300005543 | Unclassified | 613 |
| 121 | Ga0070672_101652855 | 3300005543 | Bacteria | 575 |
| 122 | Ga0070686_100525269 | 3300005544 | Bacteria | 922 |
| 123 | Ga0070695_100021853 | 3300005545 | Bacteria | 3920 |
| 124 | Ga0070695_100390108 | 3300005545 | Bacteria | 1053 |
| 125 | Ga0070696_100094393 | 3300005546 | Bacteria | 2135 |
| 126 | Ga0070693_100054417 | 3300005547 | Bacteria | 2302 |
| 127 | Ga0070693_100302233 | 3300005547 | Bacteria | 1079 |
| 128 | Ga0070693_101564081 | 3300005547 | Bacteria | 517 |
| 129 | Ga0070665_100009741 | 3300005548 | Bacteria | 9715 |
| 130 | Ga0070665_100344014 | 3300005548 | Unclassified | 1496 |
| 131 | Ga0070665_100483203 | 3300005548 | Bacteria | 1249 |
| 132 | Ga0070665_101156760 | 3300005548 | Unclassified | 785 |
| 133 | Ga0070665_101766514 | 3300005548 | Unclassified | 625 |
| 134 | Ga0070704_100106234 | 3300005549 | Bacteria | 2127 |
| 135 | Ga0068855_100000188 | 3300005563 | Bacteria | 79535 |
| 136 | Ga0068855_100004121 | 3300005563 | Bacteria | 17722 |
| 137 | Ga0068855_100033609 | 3300005563 | Bacteria | 6119 |
| 138 | Ga0068855_100343487 | 3300005563 | Bacteria | 1645 |
| 139 | Ga0068855_102078530 | 3300005563 | Bacteria | 572 |
| 140 | Ga0068855_102190585 | 3300005563 | Unclassified | 555 |
| 141 | Ga0070664_101588348 | 3300005564 | Unclassified | 619 |
| 142 | Ga0068857_100350725 | 3300005577 | Bacteria | 1366 |
| 143 | Ga0068857_101124729 | 3300005577 | Bacteria | 759 |
| 144 | Ga0068854_100062432 | 3300005578 | Bacteria | 2701 |
| 145 | Ga0068854_100659430 | 3300005578 | Bacteria | 899 |
| 146 | Ga0068856_100108527 | 3300005614 | Bacteria | 2772 |
| 147 | Ga0068856_100213608 | 3300005614 | Bacteria | 1944 |
| 148 | Ga0070702_100011240 | 3300005615 | Bacteria | 4446 |
| 149 | Ga0068852_100025840 | 3300005616 | Bacteria | 4764 |
| 150 | Ga0068852_100762310 | 3300005616 | Bacteria | 980 |
| 151 | Ga0068852_101077044 | 3300005616 | Bacteria | 824 |
| 152 | Ga0068859_100026672 | 3300005617 | Bacteria | 5794 |
| 153 | Ga0068859_100203345 | 3300005617 | Bacteria | 2065 |
| 154 | Ga0068859_100456496 | 3300005617 | Bacteria | 1374 |
| 155 | Ga0068859_101375822 | 3300005617 | Unclassified | 778 |
| 156 | Ga0068864_101069930 | 3300005618 | Unclassified | 802 |
| 157 | Ga0068866_10201315 | 3300005718 | Bacteria | 1190 |
| 158 | Ga0068861_100033657 | 3300005719 | Bacteria | 3783 |
| 159 | Ga0068861_100055843 | 3300005719 | Bacteria | 3012 |
| 160 | Ga0068861_100079169 | 3300005719 | Bacteria | 2568 |
| 161 | Ga0068861_100129233 | 3300005719 | Bacteria | 2048 |
| 162 | Ga0068861_100242654 | 3300005719 | Bacteria | 1533 |
| 163 | Ga0068861_100418873 | 3300005719 | Bacteria | 1193 |
| 164 | Ga0068861_100912097 | 3300005719 | Bacteria | 833 |
| 165 | Ga0068851_10000624 | 3300005834 | Bacteria | 15079 |
| 166 | Ga0068870_10019332 | 3300005840 | Bacteria | 3303 |
| 167 | Ga0068870_10030584 | 3300005840 | Bacteria | 2722 |
| 168 | Ga0068863_100025727 | 3300005841 | Bacteria | 5613 |
| 169 | Ga0068863_100031365 | 3300005841 | Bacteria | 5072 |
| 170 | Ga0068863_100414435 | 3300005841 | Unclassified | 1319 |
| 171 | Ga0068858_100268235 | 3300005842 | Bacteria | 1624 |
| 172 | Ga0068858_100415704 | 3300005842 | Bacteria | 1293 |
| 173 | Ga0068860_100286937 | 3300005843 | Bacteria | 1609 |
| 174 | Ga0068860_100774913 | 3300005843 | Bacteria | 972 |
| 175 | Ga0068862_100043148 | 3300005844 | Bacteria | 3844 |
| 176 | Ga0068862_100138133 | 3300005844 | Bacteria | 2161 |
| 177 | Ga0068862_100180570 | 3300005844 | Bacteria | 1894 |
| 178 | Ga0068862_100273738 | 3300005844 | Unclassified | 1545 |
| 179 | Ga0068862_100305677 | 3300005844 | Bacteria | 1464 |
| 180 | Ga0068862_100362944 | 3300005844 | Unclassified | 1346 |
| 181 | Ga0068862_100583577 | 3300005844 | Bacteria | 1071 |
| 182 | Ga0081455_10003146 | 3300005937 | Bacteria | 19189 |
| 183 | Ga0081455_10009144 | 3300005937 | Bacteria | 10217 |
| 184 | Ga0081455_10183503 | 3300005937 | Unclassified | 1582 |
| 185 | Ga0081455_11011973 | 3300005937 | Bacteria | 514 |
| 186 | Ga0081539_10000007 | 3300005985 | Bacteria | 532790 |
| 187 | Ga0081539_10265733 | 3300005985 | Bacteria | 754 |
| 188 | Ga0070717_10036645 | 3300006028 | Bacteria | 3979 |
| 189 | Ga0075364_10205878 | 3300006051 | Bacteria | 1334 |
| 190 | Ga0070715_10077091 | 3300006163 | Bacteria | 1504 |
| 191 | Ga0070715_10241849 | 3300006163 | Bacteria | 939 |
| 192 | Ga0070716_100019529 | 3300006173 | Bacteria | 3543 |
| 193 | Ga0070716_100047162 | 3300006173 | Bacteria | 2429 |
| 194 | Ga0070716_101512196 | 3300006173 | Bacteria | 549 |
| 195 | Ga0070712_100040536 | 3300006175 | Bacteria | 3193 |
| 196 | Ga0070712_100583070 | 3300006175 | Bacteria | 945 |
| 197 | Ga0075369_10358224 | 3300006186 | Bacteria | 685 |
| 198 | Ga0075366_10397780 | 3300006195 | Bacteria | 848 |
| 199 | Ga0075366_11065825 | 3300006195 | Unclassified | 505 |
| 200 | Ga0097621_100172832 | 3300006237 | Bacteria | 1863 |
| 201 | Ga0097621_100234457 | 3300006237 | Bacteria | 1603 |
| 202 | Ga0097621_100328057 | 3300006237 | Bacteria | 1357 |
| 203 | Ga0097621_100471259 | 3300006237 | Bacteria | 1134 |
| 204 | Ga0097621_101085435 | 3300006237 | Bacteria | 751 |
| 205 | Ga0097621_102270138 | 3300006237 | Bacteria | 519 |
| 206 | Ga0075370_10095999 | 3300006353 | Bacteria | 1713 |
| 207 | Ga0075370_10103459 | 3300006353 | Bacteria | 1650 |
| 208 | Ga0068871_100075785 | 3300006358 | Bacteria | 2777 |
| 209 | Ga0068871_100146619 | 3300006358 | Bacteria | 2010 |
| 210 | Ga0068871_100205879 | 3300006358 | Bacteria | 1700 |
| 211 | Ga0068871_100467226 | 3300006358 | Bacteria | 1133 |
| 212 | Ga0068871_100967190 | 3300006358 | Bacteria | 792 |
| 213 | Ga0075428_100002697 | 3300006844 | Bacteria | 19313 |
| 214 | Ga0075428_100741808 | 3300006844 | Bacteria | 1045 |
| 215 | Ga0075430_100224532 | 3300006846 | Bacteria | 1558 |
| 216 | Ga0075430_100471331 | 3300006846 | Bacteria | 1036 |
| 217 | Ga0075434_100246605 | 3300006871 | Unclassified | 1806 |
| 218 | Ga0068865_100056081 | 3300006881 | Unclassified | 2744 |
| 219 | Ga0068865_100507923 | 3300006881 | Bacteria | 1006 |
| 220 | Ga0068865_100543380 | 3300006881 | Unclassified | 975 |
| 221 | Ga0068865_100647878 | 3300006881 | Bacteria | 897 |
| 222 | Ga0075436_100145267 | 3300006914 | Bacteria | 1668 |
| 223 | Ga0097620_100026672 | 3300006931 | Bacteria | 5794 |
| 224 | Ga0097620_100203345 | 3300006931 | Bacteria | 2065 |
| 225 | Ga0097620_100456474 | 3300006931 | Bacteria | 1374 |
| 226 | Ga0097620_101375339 | 3300006931 | Unclassified | 778 |
| 227 | Ga0075435_100143865 | 3300007076 | Unclassified | 2002 |
| 228 | Ga0099795_10000282 | 3300007788 | Bacteria | 9108 |
| 229 | Ga0105240_10005799 | 3300009093 | Bacteria | 18318 |
| 230 | Ga0105240_10051665 | 3300009093 | Bacteria | 5171 |
| 231 | Ga0105240_10174910 | 3300009093 | Unclassified | 2539 |
| 232 | Ga0105240_10235256 | 3300009093 | Bacteria | 2126 |
| 233 | Ga0105240_12676154 | 3300009093 | Unclassified | 515 |
| 234 | Ga0111539_10207184 | 3300009094 | Bacteria | 2285 |
| 235 | Ga0111539_10255994 | 3300009094 | Bacteria | 2038 |
| 236 | Ga0111539_11533508 | 3300009094 | Bacteria | 773 |
| 237 | Ga0105245_10374606 | 3300009098 | Bacteria | 1416 |
| 238 | Ga0105245_11119519 | 3300009098 | Unclassified | 834 |
| 239 | Ga0105245_11842389 | 3300009098 | Bacteria | 658 |
| 240 | Ga0114129_10012058 | 3300009147 | Bacteria | 12298 |
| 241 | Ga0105243_11137592 | 3300009148 | Bacteria | 791 |
| 242 | Ga0105241_11803145 | 3300009174 | Bacteria | 597 |
| 243 | Ga0105241_11940069 | 3300009174 | Bacteria | 578 |
| 244 | Ga0105242_10470967 | 3300009176 | Bacteria | 1188 |
| 245 | Ga0105242_10760987 | 3300009176 | Unclassified | 955 |
| 246 | Ga0105242_11176334 | 3300009176 | Unclassified | 785 |
| 247 | Ga0105248_10136603 | 3300009177 | Bacteria | 2766 |
| 248 | Ga0105237_10294384 | 3300009545 | Bacteria | 1626 |
| 249 | Ga0105237_10448494 | 3300009545 | Bacteria | 1296 |
| 250 | Ga0105237_10655183 | 3300009545 | Bacteria | 1057 |
| 251 | Ga0105237_11057173 | 3300009545 | Unclassified | 819 |
| 252 | Ga0105237_11600214 | 3300009545 | Bacteria | 658 |
| 253 | Ga0105238_10036079 | 3300009551 | Bacteria | 5026 |
| 254 | Ga0105238_10062041 | 3300009551 | Bacteria | 3740 |
| 255 | Ga0105238_10124228 | 3300009551 | Unclassified | 2560 |
| 256 | Ga0105238_10685246 | 3300009551 | Bacteria | 1036 |
| 257 | Ga0105238_12940494 | 3300009551 | Bacteria | 512 |
| 258 | Ga0105249_10431405 | 3300009553 | Bacteria | 1354 |
| 259 | Ga0105249_11076291 | 3300009553 | Unclassified | 874 |
| 260 | Ga0099796_10000351 | 3300010159 | Bacteria | 7483 |
| 261 | Ga0105239_10005674 | 3300010375 | Bacteria | 14585 |
| 262 | Ga0105239_10011221 | 3300010375 | Bacteria | 9999 |
| 263 | Ga0105239_10239173 | 3300010375 | Bacteria | 2038 |
| 264 | Ga0105239_10578061 | 3300010375 | Unclassified | 1281 |
| 265 | Ga0105239_12274522 | 3300010375 | Unclassified | 631 |
| 266 | Ga0105246_11333597 | 3300011119 | Unclassified | 666 |
| 267 | Ga0105246_12147077 | 3300011119 | Unclassified | 542 |
| 268 | Ga0157373_10872349 | 3300013100 | Bacteria | 666 |
| 269 | Ga0157370_10024850 | 3300013104 | Bacteria | 5933 |
| 270 | Ga0157370_10053986 | 3300013104 | Bacteria | 3831 |
| 271 | Ga0157370_10276958 | 3300013104 | Bacteria | 1550 |
| 272 | Ga0157370_11348601 | 3300013104 | Bacteria | 642 |
| 273 | Ga0157369_10008652 | 3300013105 | Bacteria | 11675 |
| 274 | Ga0157369_10027891 | 3300013105 | Bacteria | 6255 |
| 275 | Ga0157369_10042967 | 3300013105 | Bacteria | 4928 |
| 276 | Ga0157369_10043594 | 3300013105 | Bacteria | 4889 |
| 277 | Ga0157369_10218110 | 3300013105 | Bacteria | 1998 |
| 278 | Ga0157374_10174061 | 3300013296 | Unclassified | 2101 |
| 279 | Ga0157374_10259725 | 3300013296 | Bacteria | 1710 |
| 280 | Ga0157374_12649916 | 3300013296 | Unclassified | 529 |
| 281 | Ga0157378_10056476 | 3300013297 | Bacteria | 3498 |
| 282 | Ga0157378_10115932 | 3300013297 | Bacteria | 2463 |
| 283 | Ga0157378_11645549 | 3300013297 | Bacteria | 688 |
| 284 | Ga0157378_12058916 | 3300013297 | Bacteria | 621 |
| 285 | Ga0163162_13232927 | 3300013306 | Unclassified | 523 |
| 286 | Ga0157372_10108989 | 3300013307 | Bacteria | 3171 |
| 287 | Ga0157372_10340299 | 3300013307 | Bacteria | 1747 |
| 288 | Ga0157375_10549287 | 3300013308 | Bacteria | 1317 |
| 289 | Ga0157375_10774259 | 3300013308 | Unclassified | 1110 |
| 290 | Ga0163163_10437165 | 3300014325 | Bacteria | 1368 |
| 291 | Ga0163163_13105034 | 3300014325 | Bacteria | 518 |
| 292 | Ga0157380_10012927 | 3300014326 | Bacteria | 6068 |
| 293 | Ga0157380_10015948 | 3300014326 | Bacteria | 5531 |
| 294 | Ga0157380_10452107 | 3300014326 | Bacteria | 1234 |
| 295 | Ga0157377_10449587 | 3300014745 | Unclassified | 889 |
| 296 | Ga0157379_10970303 | 3300014968 | Unclassified | 809 |
| 297 | Ga0157379_12353362 | 3300014968 | Bacteria | 531 |
| 298 | Ga0157376_10150997 | 3300014969 | Bacteria | 2095 |
| 299 | Ga0157376_11489396 | 3300014969 | Unclassified | 709 |
| 300 | Ga0157376_12399733 | 3300014969 | Unclassified | 567 |
| 301 | Ga0157376_12857424 | 3300014969 | Bacteria | 523 |
| 302 | Ga0163161_11059262 | 3300017792 | Bacteria | 695 |
| 303 | Ga0206356_11774328 | 3300020070 | Bacteria | 1233 |
| 304 | Ga0206355_1088868 | 3300020076 | Bacteria | 601 |
| 305 | Ga0206353_11331178 | 3300020082 | Unclassified | 709 |
| 306 | Ga0213873_10019840 | 3300021358 | Bacteria | 1564 |
| 307 | Ga0213874_10005856 | 3300021377 | Bacteria | 2885 |
| 308 | Ga0213874_10172082 | 3300021377 | Unclassified | 766 |
| 309 | Ga0213876_10206594 | 3300021384 | Bacteria | 1044 |
| 310 | Ga0213876_10235677 | 3300021384 | Bacteria | 973 |
| 311 | Ga0213875_10119915 | 3300021388 | Bacteria | 1229 |
| 312 | Ga0213871_10057376 | 3300021441 | Bacteria | 1078 |
| 313 | Ga0213871_10072548 | 3300021441 | Bacteria | 975 |
| 314 | Ga0213871_10129833 | 3300021441 | Unclassified | 756 |
| 315 | Ga0224712_10431233 | 3300022467 | Bacteria | 631 |
| 316 | Ga0207656_10000370 | 3300025321 | Bacteria | 15063 |
| 317 | Ga0207682_10152043 | 3300025893 | Bacteria | 1044 |
| 318 | Ga0207682_10532343 | 3300025893 | Unclassified | 556 |
| 319 | Ga0207692_10069210 | 3300025898 | Bacteria | 1854 |
| 320 | Ga0207692_10211770 | 3300025898 | Bacteria | 1145 |
| 321 | Ga0207692_10835598 | 3300025898 | Unclassified | 604 |
| 322 | Ga0207692_10840439 | 3300025898 | Bacteria | 602 |
| 323 | Ga0207642_10823791 | 3300025899 | Bacteria | 591 |
| 324 | Ga0207688_10625688 | 3300025901 | Bacteria | 679 |
| 325 | Ga0207680_10684593 | 3300025903 | Bacteria | 735 |
| 326 | Ga0207647_10431481 | 3300025904 | Bacteria | 740 |
| 327 | Ga0207685_10068339 | 3300025905 | Bacteria | 1431 |
| 328 | Ga0207685_10082343 | 3300025905 | Bacteria | 1335 |
| 329 | Ga0207699_10001988 | 3300025906 | Bacteria | 9665 |
| 330 | Ga0207699_10036146 | 3300025906 | Bacteria | 2814 |
| 331 | Ga0207699_10545610 | 3300025906 | Bacteria | 840 |
| 332 | Ga0207645_10021794 | 3300025907 | Bacteria | 4174 |
| 333 | Ga0207645_10047720 | 3300025907 | Bacteria | 2734 |
| 334 | Ga0207645_10316290 | 3300025907 | Bacteria | 1041 |
| 335 | Ga0207643_10082801 | 3300025908 | Bacteria | 1861 |
| 336 | Ga0207643_10095420 | 3300025908 | Bacteria | 1738 |
| 337 | Ga0207705_11229801 | 3300025909 | Unclassified | 574 |
| 338 | Ga0207654_10068226 | 3300025911 | Bacteria | 2103 |
| 339 | Ga0207707_10000213 | 3300025912 | Bacteria | 61986 |
| 340 | Ga0207707_10007306 | 3300025912 | Bacteria | 9618 |
| 341 | Ga0207707_10014745 | 3300025912 | Bacteria | 6811 |
| 342 | Ga0207707_10020379 | 3300025912 | Bacteria | 5790 |
| 343 | Ga0207707_10060237 | 3300025912 | Bacteria | 3303 |
| 344 | Ga0207707_10112937 | 3300025912 | Bacteria | 2375 |
| 345 | Ga0207707_10168475 | 3300025912 | Unclassified | 1914 |
| 346 | Ga0207707_10327100 | 3300025912 | Bacteria | 1323 |
| 347 | Ga0207695_10014424 | 3300025913 | Bacteria | 9361 |
| 348 | Ga0207695_10014685 | 3300025913 | Bacteria | 9260 |
| 349 | Ga0207695_10091957 | 3300025913 | Bacteria | 3046 |
| 350 | Ga0207695_10124464 | 3300025913 | Unclassified | 2542 |
| 351 | Ga0207671_10064212 | 3300025914 | Bacteria | 2729 |
| 352 | Ga0207671_10194204 | 3300025914 | Bacteria | 1583 |
| 353 | Ga0207671_10624564 | 3300025914 | Bacteria | 858 |
| 354 | Ga0207671_10651393 | 3300025914 | Bacteria | 839 |
| 355 | Ga0207671_10679451 | 3300025914 | Unclassified | 819 |
| 356 | Ga0207693_10045072 | 3300025915 | Bacteria | 3466 |
| 357 | Ga0207693_10133955 | 3300025915 | Unclassified | 1948 |
| 358 | Ga0207693_10745490 | 3300025915 | Bacteria | 757 |
| 359 | Ga0207663_10082654 | 3300025916 | Bacteria | 2107 |
| 360 | Ga0207663_10182166 | 3300025916 | Unclassified | 1501 |
| 361 | Ga0207663_10194963 | 3300025916 | Bacteria | 1457 |
| 362 | Ga0207663_10224888 | 3300025916 | Bacteria | 1367 |
| 363 | Ga0207660_10012076 | 3300025917 | Bacteria | 5644 |
| 364 | Ga0207660_10021999 | 3300025917 | Bacteria | 4293 |
| 365 | Ga0207660_10026451 | 3300025917 | Bacteria | 3952 |
| 366 | Ga0207662_10245185 | 3300025918 | Unclassified | 1174 |
| 367 | Ga0207649_10002528 | 3300025920 | Bacteria | 10190 |
| 368 | Ga0207649_11145062 | 3300025920 | Unclassified | 614 |
| 369 | Ga0207652_10006162 | 3300025921 | Bacteria | 9696 |
| 370 | Ga0207652_10044577 | 3300025921 | Bacteria | 3779 |
| 371 | Ga0207652_10085557 | 3300025921 | Bacteria | 2763 |
| 372 | Ga0207652_10231148 | 3300025921 | Bacteria | 1667 |
| 373 | Ga0207681_10071969 | 3300025923 | Bacteria | 2413 |
| 374 | Ga0207681_10744961 | 3300025923 | Unclassified | 816 |
| 375 | Ga0207694_10071649 | 3300025924 | Bacteria | 2708 |
| 376 | Ga0207694_10134634 | 3300025924 | Unclassified | 1983 |
| 377 | Ga0207694_10164325 | 3300025924 | Bacteria | 1794 |
| 378 | Ga0207694_10193405 | 3300025924 | Bacteria | 1653 |
| 379 | Ga0207694_11391148 | 3300025924 | Unclassified | 593 |
| 380 | Ga0207659_10087563 | 3300025926 | Bacteria | 2318 |
| 381 | Ga0207687_10401748 | 3300025927 | Bacteria | 1127 |
| 382 | Ga0207700_10091906 | 3300025928 | Bacteria | 2398 |
| 383 | Ga0207700_10112405 | 3300025928 | Bacteria | 2194 |
| 384 | Ga0207700_10236793 | 3300025928 | Bacteria | 1554 |
| 385 | Ga0207664_10020147 | 3300025929 | Bacteria | 4938 |
| 386 | Ga0207664_10217220 | 3300025929 | Bacteria | 1656 |
| 387 | Ga0207664_10277403 | 3300025929 | Bacteria | 1470 |
| 388 | Ga0207664_10752809 | 3300025929 | Bacteria | 876 |
| 389 | Ga0207644_10617315 | 3300025931 | Bacteria | 901 |
| 390 | Ga0207690_11135952 | 3300025932 | Bacteria | 652 |
| 391 | Ga0207706_10120388 | 3300025933 | Bacteria | 2308 |
| 392 | Ga0207706_10382206 | 3300025933 | Bacteria | 1222 |
| 393 | Ga0207686_10043481 | 3300025934 | Bacteria | 2752 |
| 394 | Ga0207686_10284565 | 3300025934 | Bacteria | 1222 |
| 395 | Ga0207686_10399330 | 3300025934 | Bacteria | 1047 |
| 396 | Ga0207686_11180846 | 3300025934 | Unclassified | 626 |
| 397 | Ga0207670_10086237 | 3300025936 | Bacteria | 2208 |
| 398 | Ga0207670_11087621 | 3300025936 | Unclassified | 675 |
| 399 | Ga0207669_10115986 | 3300025937 | Bacteria | 1806 |
| 400 | Ga0207669_10606015 | 3300025937 | Bacteria | 891 |
| 401 | Ga0207669_10840680 | 3300025937 | Bacteria | 763 |
| 402 | Ga0207704_10185268 | 3300025938 | Bacteria | 1508 |
| 403 | Ga0207704_10362282 | 3300025938 | Bacteria | 1132 |
| 404 | Ga0207704_11442475 | 3300025938 | Bacteria | 590 |
| 405 | Ga0207665_10064341 | 3300025939 | Bacteria | 2492 |
| 406 | Ga0207665_10068196 | 3300025939 | Bacteria | 2423 |
| 407 | Ga0207665_11095268 | 3300025939 | Bacteria | 635 |
| 408 | Ga0207691_10017268 | 3300025940 | Bacteria | 6845 |
| 409 | Ga0207691_10018434 | 3300025940 | Bacteria | 6616 |
| 410 | Ga0207691_10097535 | 3300025940 | Bacteria | 2627 |
| 411 | Ga0207661_10057652 | 3300025944 | Bacteria | 3124 |
| 412 | Ga0207661_10227524 | 3300025944 | Unclassified | 1650 |
| 413 | Ga0207679_10396417 | 3300025945 | Bacteria | 1213 |
| 414 | Ga0207667_10000417 | 3300025949 | Bacteria | 57396 |
| 415 | Ga0207667_10004450 | 3300025949 | Bacteria | 17159 |
| 416 | Ga0207667_10016797 | 3300025949 | Bacteria | 8256 |
| 417 | Ga0207667_10244877 | 3300025949 | Bacteria | 1834 |
| 418 | Ga0207667_11529482 | 3300025949 | Bacteria | 638 |
| 419 | Ga0207667_12089198 | 3300025949 | Bacteria | 525 |
| 420 | Ga0207651_10057790 | 3300025960 | Bacteria | 2677 |
| 421 | Ga0207651_10076087 | 3300025960 | Bacteria | 2398 |
| 422 | Ga0207651_10317734 | 3300025960 | Bacteria | 1301 |
| 423 | Ga0207712_10128936 | 3300025961 | Bacteria | 1924 |
| 424 | Ga0207668_10402796 | 3300025972 | Bacteria | 1157 |
| 425 | Ga0207668_11109914 | 3300025972 | Bacteria | 709 |
| 426 | Ga0207640_10017150 | 3300025981 | Bacteria | 4230 |
| 427 | Ga0207640_10745333 | 3300025981 | Bacteria | 844 |
| 428 | Ga0207658_12017914 | 3300025986 | Bacteria | 525 |
| 429 | Ga0207677_10602364 | 3300026023 | Bacteria | 964 |
| 430 | Ga0207703_10137721 | 3300026035 | Bacteria | 2115 |
| 431 | Ga0207703_11046202 | 3300026035 | Unclassified | 784 |
| 432 | Ga0207639_10001042 | 3300026041 | Bacteria | 18826 |
| 433 | Ga0207639_10387857 | 3300026041 | Bacteria | 1256 |
| 434 | Ga0207639_11856794 | 3300026041 | Bacteria | 563 |
| 435 | Ga0207708_11861019 | 3300026075 | Unclassified | 528 |
| 436 | Ga0207702_10079829 | 3300026078 | Bacteria | 2837 |
| 437 | Ga0207702_10092220 | 3300026078 | Bacteria | 2654 |
| 438 | Ga0207702_11326402 | 3300026078 | Bacteria | 714 |
| 439 | Ga0207641_10029602 | 3300026088 | Bacteria | 4530 |
| 440 | Ga0207648_10038337 | 3300026089 | Bacteria | 4217 |
| 441 | Ga0207648_10353672 | 3300026089 | Bacteria | 1325 |
| 442 | Ga0207648_11167679 | 3300026089 | Bacteria | 723 |
| 443 | Ga0207676_10312610 | 3300026095 | Bacteria | 1439 |
| 444 | Ga0207676_10815221 | 3300026095 | Unclassified | 911 |
| 445 | Ga0207674_10147374 | 3300026116 | Bacteria | 2312 |
| 446 | Ga0207674_10313032 | 3300026116 | Bacteria | 1519 |
| 447 | Ga0207675_100074665 | 3300026118 | Bacteria | 3173 |
| 448 | Ga0207675_100084724 | 3300026118 | Bacteria | 2974 |
| 449 | Ga0207675_100244191 | 3300026118 | Bacteria | 1736 |
| 450 | Ga0207675_100253596 | 3300026118 | Bacteria | 1703 |
| 451 | Ga0207675_100541373 | 3300026118 | Bacteria | 1163 |
| 452 | Ga0207675_100608281 | 3300026118 | Bacteria | 1096 |
| 453 | Ga0207675_100618658 | 3300026118 | Bacteria | 1087 |
| 454 | Ga0207675_100844461 | 3300026118 | Bacteria | 930 |
| 455 | Ga0207683_10278448 | 3300026121 | Bacteria | 1529 |
| 456 | Ga0207683_11651289 | 3300026121 | Unclassified | 590 |
| 457 | Ga0207698_10004240 | 3300026142 | Bacteria | 8724 |
| 458 | Ga0207698_10640694 | 3300026142 | Bacteria | 1052 |
| 459 | Ga0207698_11043519 | 3300026142 | Bacteria | 829 |
| 460 | Ga0207698_11738529 | 3300026142 | Bacteria | 639 |
| 461 | Ga0209996_1026242 | 3300027395 | Bacteria | 835 |
| 462 | Ga0210000_1062558 | 3300027462 | Bacteria | 603 |
| 463 | Ga0209179_1000011 | 3300027512 | Bacteria | 66977 |
| 464 | Ga0209970_1014213 | 3300027614 | Bacteria | 1322 |
| 465 | Ga0210002_1042785 | 3300027617 | Bacteria | 771 |
| 466 | Ga0209983_1025191 | 3300027665 | Bacteria | 1254 |
| 467 | Ga0209971_1003831 | 3300027682 | Bacteria | 3557 |
| 468 | Ga0207428_10073761 | 3300027907 | Bacteria | 2677 |
| 469 | Ga0268266_10008271 | 3300028379 | Bacteria | 9271 |
| 470 | Ga0268266_10019127 | 3300028379 | Bacteria | 5832 |
| 471 | Ga0268266_10285364 | 3300028379 | Bacteria | 1536 |
| 472 | Ga0268266_10289921 | 3300028379 | Unclassified | 1524 |
| 473 | Ga0268266_11337733 | 3300028379 | Unclassified | 692 |
| 474 | Ga0268266_12335084 | 3300028379 | Unclassified | 506 |
| 475 | Ga0268265_10049380 | 3300028380 | Bacteria | 3164 |
| 476 | Ga0268265_10162718 | 3300028380 | Unclassified | 1898 |
| 477 | Ga0268265_10187412 | 3300028380 | Bacteria | 1783 |
| 478 | Ga0268265_10273390 | 3300028380 | Bacteria | 1508 |
| 479 | Ga0268265_10598796 | 3300028380 | Bacteria | 1053 |
| 480 | Ga0268265_11729258 | 3300028380 | Unclassified | 631 |
| 481 | Ga0268264_10234722 | 3300028381 | Bacteria | 1695 |
| 482 | Ga0268264_12282993 | 3300028381 | Bacteria | 548 |
| 483 | Ga0307517_10628206 | 3300028786 | Unclassified | 525 |
| 484 | Ga0307515_10448584 | 3300028794 | Bacteria | 906 |
| 485 | Ga0265760_10132502 | 3300031090 | Bacteria | 807 |
| 486 | Ga0265330_10003651 | 3300031235 | Bacteria | 7999 |
| 487 | Ga0265332_10013547 | 3300031238 | Bacteria | 3612 |
| 488 | Ga0265325_10052553 | 3300031241 | Bacteria | 2091 |
| 489 | Ga0265340_10000356 | 3300031247 | Bacteria | 24392 |
| 490 | Ga0265340_10002297 | 3300031247 | Bacteria | 10933 |
| 491 | Ga0265340_10026230 | 3300031247 | Bacteria | 2947 |
| 492 | Ga0265331_10010679 | 3300031250 | Bacteria | 5064 |
| 493 | Ga0265331_10053274 | 3300031250 | Bacteria | 1930 |
| 494 | Ga0265316_10000146 | 3300031344 | Bacteria | 77550 |
| 495 | Ga0265316_10005304 | 3300031344 | Bacteria | 12575 |
| 496 | Ga0265316_10019427 | 3300031344 | Bacteria | 5813 |
| 497 | Ga0265316_10143604 | 3300031344 | Bacteria | 1791 |
| 498 | Ga0307513_10860728 | 3300031456 | Bacteria | 613 |
| 499 | Ga0307509_10391286 | 3300031507 | Bacteria | 1100 |
| 500 | Ga0307408_100014096 | 3300031548 | Bacteria | 5311 |
| 501 | Ga0307408_100199178 | 3300031548 | Bacteria | 1619 |
| 502 | Ga0307408_100243515 | 3300031548 | Bacteria | 1479 |
| 503 | Ga0265313_10011164 | 3300031595 | Bacteria | 5600 |
| 504 | Ga0265314_10018561 | 3300031711 | Bacteria | 5421 |
| 505 | Ga0265314_10020776 | 3300031711 | Bacteria | 5064 |
| 506 | Ga0265314_10034849 | 3300031711 | Bacteria | 3673 |
| 507 | Ga0265342_10009625 | 3300031712 | Bacteria | 6783 |
| 508 | Ga0316578_10056067 | 3300031728 | Bacteria | 2314 |
| 509 | Ga0307516_10027775 | 3300031730 | Bacteria | 5735 |
| 510 | Ga0307405_10003677 | 3300031731 | Bacteria | 7108 |
| 511 | Ga0307405_10100758 | 3300031731 | Bacteria | 1936 |
| 512 | Ga0307405_10343032 | 3300031731 | Bacteria | 1149 |
| 513 | Ga0307413_10099863 | 3300031824 | Bacteria | 1914 |
| 514 | Ga0307413_11325960 | 3300031824 | Bacteria | 630 |
| 515 | Ga0307410_10087072 | 3300031852 | Bacteria | 2208 |
| 516 | Ga0307410_10147680 | 3300031852 | Bacteria | 1746 |
| 517 | Ga0307410_10249791 | 3300031852 | Bacteria | 1378 |
| 518 | Ga0307406_10008451 | 3300031901 | Bacteria | 5744 |
| 519 | Ga0307406_10127370 | 3300031901 | Bacteria | 1781 |
| 520 | Ga0307407_10071208 | 3300031903 | Bacteria | 2069 |
| 521 | Ga0307407_10484863 | 3300031903 | Bacteria | 903 |
| 522 | Ga0307412_10865391 | 3300031911 | Bacteria | 789 |
| 523 | Ga0307409_100089593 | 3300031995 | Bacteria | 2515 |
| 524 | Ga0307409_100180885 | 3300031995 | Bacteria | 1866 |
| 525 | Ga0307409_100339220 | 3300031995 | Bacteria | 1413 |
| 526 | Ga0307409_101444270 | 3300031995 | Bacteria | 715 |
| 527 | Ga0307416_100017839 | 3300032002 | Bacteria | 4980 |
| 528 | Ga0307416_100056976 | 3300032002 | Bacteria | 3158 |
| 529 | Ga0307416_100787918 | 3300032002 | Bacteria | 1045 |
| 530 | Ga0307414_10416850 | 3300032004 | Bacteria | 1170 |
| 531 | Ga0307414_10704840 | 3300032004 | Bacteria | 914 |
| 532 | Ga0307414_10879792 | 3300032004 | Bacteria | 820 |
| 533 | Ga0307411_10010900 | 3300032005 | Bacteria | 4873 |
| 534 | Ga0307411_10231863 | 3300032005 | Bacteria | 1439 |
| 535 | Ga0307411_10551300 | 3300032005 | Bacteria | 983 |
| 536 | Ga0307415_100010480 | 3300032126 | Bacteria | 5252 |
| 537 | Ga0307415_100044945 | 3300032126 | Bacteria | 2957 |
| 538 | Ga0307415_100559809 | 3300032126 | Bacteria | 1010 |
| 539 | Ga0307415_101853842 | 3300032126 | Bacteria | 585 |
| 540 | Ga0316593_10013972 | 3300032168 | Bacteria | 2386 |
| 541 | Ga0316593_10050031 | 3300032168 | Bacteria | 1409 |
| 542 | Ga0373934_0028694 | 3300035086 | Bacteria | 2171 |
| 543 | Ga0373923_0217042 | 3300035111 | Bacteria | 888 |
| 544 | Ga0373936_0305206 | 3300035113 | Bacteria | 719 |
| 545 | Ga0373945_0159125 | 3300035116 | Bacteria | 920 |
| 546 | Ga0373953_0131990 | 3300035117 | Bacteria | 1065 |
| 547 | Ga0373953_0292554 | 3300035117 | Unclassified | 710 |
| 548 | Ga0373954_0011589 | 3300035118 | Bacteria | 3910 |
| 549 | Ga0373956_0068388 | 3300035119 | Unclassified | 1618 |
| 550 | Ga0373956_0103361 | 3300035119 | Bacteria | 1323 |
| 551 | Ga0373957_0087056 | 3300035120 | Unclassified | 1238 |
| 552 | Ga0373946_0037368 | 3300035171 | Bacteria | 1973 |
| 553 | Ga0373946_0084106 | 3300035171 | Bacteria | 1399 |
| 554 | Ga0373955_0363998 | 3300035172 | Unclassified | 877 |
| 555 | Ga0373961_0327814 | 3300035241 | Bacteria | 573 |
| 556 | Ga0316574_0125189 | 3300035398 | Bacteria | 1652 |
| 557 | Ga0316574_0872616 | 3300035398 | Unclassified | 545 |
| 558 | Ga0373931_1084408 | 3300035691 | Unclassified | 545 |
| 559 | Ga0373935_0113584 | 3300035692 | Bacteria | 1801 |
| 560 | Ga0373927_0293847 | 3300035695 | Bacteria | 1069 |
| 561 | Ga0373927_0745948 | 3300035695 | Bacteria | 647 |
| 562 | Ga0373933_0013068 | 3300035724 | Bacteria | 4597 |
| 563 | Ga0373933_0302952 | 3300035724 | Bacteria | 1035 |
| 564 | Ga0373947_0106191 | 3300035725 | Bacteria | 1770 |
| 565 | Ga0373947_0532529 | 3300035725 | Bacteria | 799 |
| 566 | Ga0373937_0003538 | 3300036401 | Bacteria | 13152 |
| 567 | Ga0373937_0158586 | 3300036401 | Unclassified | 2121 |
| 568 | Ga0373937_0373072 | 3300036401 | Bacteria | 1353 |
| 569 | Ga0373937_1472491 | 3300036401 | Bacteria | 628 |
| 570 | Ga0373937_1869959 | 3300036401 | Unclassified | 547 |
| 571 | Ga0316582_0054406 | 3300036647 | Bacteria | 2548 |
| 572 | Ga0316582_0648356 | 3300036647 | Bacteria | 726 |
| 573 | Ga0395899_0593172 | 3300037312 | Bacteria | 707 |
| 574 | Ga0395900_0062660 | 3300037418 | Bacteria | 3823 |
| 575 | Ga0395900_0233243 | 3300037418 | Unclassified | 1850 |
| 576 | Ga0395898_0034073 | 3300037466 | Bacteria | 5078 |
| 577 | Ga0395898_0163271 | 3300037466 | Unclassified | 2131 |
| 578 | Ga0395898_0584594 | 3300037466 | Bacteria | 1059 |
| 579 | Ga0395905_0379781 | 3300037471 | Bacteria | 1307 |
| 580 | Ga0436364_0422126 | 3300037853 | Unclassified | 645 |
| 581 | Ga0436364_0507816 | 3300037853 | Bacteria | 1215 |
| 582 | Ga0395901_0235546 | 3300038443 | Bacteria | 1911 |
| 583 | Ga0395901_1035192 | 3300038443 | Bacteria | 795 |
| 584 | Ga0395901_1495614 | 3300038443 | Bacteria | 631 |
| 585 | Ga0400490_27866 | 3300038726 | Bacteria | 31976 |
| 586 | Ga0400488_14628 | 3300038741 | Bacteria | 3102 |
| 587 | Ga0400488_36631 | 3300038741 | Bacteria | 4314 |
| 588 | Ga0400488_39676 | 3300038741 | Bacteria | 3344 |
| 589 | Ga0400488_62698 | 3300038741 | Bacteria | 1767 |
| 590 | Ga0400486_29232 | 3300038742 | Bacteria | 2077 |
| 591 | Ga0400483_007661 | 3300039062 | Bacteria | 20710 |
| 592 | Ga0400483_031605 | 3300039062 | Bacteria | 1730 |
| 593 | Ga0400483_059913 | 3300039062 | Bacteria | 1635 |
| 594 | Ga0400483_091647 | 3300039062 | Bacteria | 12066 |
| 595 | Ga0400483_122739 | 3300039062 | Bacteria | 23925 |
| 596 | Ga0400483_165155 | 3300039062 | Bacteria | 5784 |
| 597 | Ga0400483_167560 | 3300039062 | Bacteria | 1117 |
| 598 | Ga0400483_269614 | 3300039062 | Bacteria | 133457 |
| 599 | Ga0400483_286327 | 3300039062 | Bacteria | 16786 |
| 600 | Ga0400487_51472 | 3300039110 | Bacteria | 14864 |
| 601 | Ga0436365_0990718 | 3300039437 | Bacteria | 3933 |
| 602 | Ga0436365_1123454 | 3300039437 | Bacteria | 655 |
| 603 | Ga0436365_1829985 | 3300039437 | Bacteria | 1098 |
| 604 | Ga0436360_0230968 | 3300039438 | Bacteria | 1453 |
| 605 | Ga0436360_0249274 | 3300039438 | Bacteria | 2033 |
| 606 | Ga0436360_0846674 | 3300039438 | Bacteria | 3043 |
| 607 | Ga0436360_0887930 | 3300039438 | Unclassified | 788 |
| 608 | Ga0436360_1157685 | 3300039438 | Bacteria | 10179 |
| 609 | Ga0436361_0275763 | 3300039447 | Bacteria | 508 |
| 610 | Ga0436363_0040943 | 3300039450 | Bacteria | 1347 |
| 611 | Ga0436363_0073651 | 3300039450 | Bacteria | 2120 |
| 612 | Ga0436363_0117506 | 3300039450 | Bacteria | 7799 |
| 613 | Ga0436363_0382304 | 3300039450 | Bacteria | 893 |
| 614 | Ga0436363_0553853 | 3300039450 | Bacteria | 531 |
| 615 | Ga0436362_0751592 | 3300039453 | Bacteria | 4345 |
| 616 | Ga0436362_1213266 | 3300039453 | Bacteria | 512 |
| 617 | Ga0439439_0027133 | 3300041406 | Bacteria | 1446 |
| 618 | Ga0439453_0006516 | 3300041408 | Bacteria | 1820 |
| 619 | Ga0439461_0002922 | 3300041410 | Bacteria | 2773 |
| 620 | Ga0439461_0143519 | 3300041410 | Bacteria | 612 |
| 621 | Ga0439466_0162554 | 3300041411 | Bacteria | 683 |
| 622 | Ga0439465_0042626 | 3300041413 | Bacteria | 1471 |
| 623 | Ga0439465_0051976 | 3300041413 | Bacteria | 1344 |
| 624 | Ga0439465_0052220 | 3300041413 | Bacteria | 1341 |
| 625 | Ga0451791_0349922 | 3300041451 | Bacteria | 561 |
| 626 | Ga0451793_1904977 | 3300041452 | Bacteria | 521 |
| 627 | Ga0451795_0207582 | 3300041456 | Bacteria | 510 |
| 628 | Ga0451798_0531086 | 3300041458 | Bacteria | 557 |
| 629 | Ga0451804_0349009 | 3300041463 | Bacteria | 529 |
| 630 | Ga0451807_1912619 | 3300041486 | Unclassified | 568 |
| 631 | Ga0451839_1253933 | 3300041496 | Bacteria | 610 |
| 632 | Ga0451839_1368483 | 3300041496 | Bacteria | 605 |
| 633 | Ga0451855_0421856 | 3300041511 | Bacteria | 752 |
| 634 | Ga0451853_2078235 | 3300041512 | Bacteria | 762 |
| 635 | Ga0451853_3356625 | 3300041512 | Bacteria | 520 |
| 636 | Ga0439431_0132112 | 3300041997 | Bacteria | 701 |
| 637 | Ga0439431_0265471 | 3300041997 | Bacteria | 512 |
| 638 | Ga0439433_0020103 | 3300041999 | Bacteria | 1490 |
| 639 | Ga0439441_004293 | 3300042001 | Bacteria | 2151 |
| 640 | Ga0439443_002580 | 3300042003 | Bacteria | 2181 |
| 641 | Ga0439445_0189597 | 3300042004 | Bacteria | 605 |
| 642 | Ga0439445_0201043 | 3300042004 | Bacteria | 588 |
| 643 | Ga0439449_0315167 | 3300042007 | Bacteria | 591 |
| 644 | Ga0439451_039226 | 3300042009 | Bacteria | 951 |
| 645 | Ga0439451_093501 | 3300042009 | Unclassified | 606 |
| 646 | Ga0439454_060004 | 3300042011 | Bacteria | 658 |
| 647 | Ga0439456_006559 | 3300042013 | Bacteria | 2380 |
| 648 | Ga0450920_002594 | 3300042122 | Bacteria | 3085 |
| 649 | Ga0450923_068802 | 3300042125 | Bacteria | 782 |
| 650 | Ga0450888_036244 | 3300042126 | Unclassified | 674 |
| 651 | Ga0450890_083627 | 3300042127 | Unclassified | 523 |
| 652 | Ga0450896_012716 | 3300042133 | Bacteria | 1192 |
| 653 | Ga0450906_012735 | 3300042145 | Bacteria | 1557 |
| 654 | Ga0439446_0000175 | 3300042156 | Bacteria | 11262 |
| 655 | Ga0450908_015155 | 3300042184 | Bacteria | 1381 |
| 656 | Ga0439434_0012351 | 3300042435 | Bacteria | 2527 |
| 657 | Ga0439435_0006278 | 3300042436 | Bacteria | 2664 |
| 658 | Ga0439444_0005437 | 3300042437 | Bacteria | 1889 |
| 659 | Ga0439459_0102331 | 3300042438 | Unclassified | 702 |
| 660 | Ga0439460_0004358 | 3300042461 | Bacteria | 3452 |
| 661 | Ga0451577_0090855 | 3300042876 | Bacteria | 2725 |
| 662 | Ga0451577_0098888 | 3300042876 | Bacteria | 2606 |
| 663 | Ga0451577_0104390 | 3300042876 | Bacteria | 2533 |
| 664 | Ga0451577_1196362 | 3300042876 | Bacteria | 678 |
| 665 | Ga0451577_1795478 | 3300042876 | Bacteria | 538 |
| 666 | Ga0466969_0007341 | 3300044656 | Bacteria | 5859 |
| 667 | Ga0466969_0024727 | 3300044656 | Bacteria | 3089 |
| 668 | Ga0466972_0020775 | 3300044658 | Bacteria | 3279 |
| 669 | Ga0453683_0484486 | 3300044673 | Bacteria | 802 |
| 670 | Ga0466965_0191666 | 3300044683 | Bacteria | 1081 |
| 671 | Ga0466966_0000557 | 3300044684 | Bacteria | 23782 |
| 672 | Ga0466961_0001702 | 3300044693 | Bacteria | 13703 |
| 673 | Ga0466963_0476448 | 3300044694 | Bacteria | 881 |
| 674 | Ga0466964_0000388 | 3300044706 | Bacteria | 13356 |
| 675 | Ga0453684_0634960 | 3300044712 | Bacteria | 1167 |
| 676 | Ga0453684_1247006 | 3300044712 | Bacteria | 778 |
| 677 | Ga0453684_1476662 | 3300044712 | Bacteria | 702 |
| 678 | Ga0466971_0003199 | 3300044719 | Bacteria | 6981 |
| 679 | Ga0466968_0041783 | 3300044735 | Bacteria | 1937 |
| 680 | Ga0466968_0159575 | 3300044735 | Bacteria | 1040 |
| 681 | Ga0466970_0001729 | 3300044765 | Bacteria | 10524 |
| 682 | Ga0466957_0053853 | 3300044842 | Bacteria | 2454 |
| 683 | Ga0466957_0187747 | 3300044842 | Bacteria | 1352 |
| 684 | Ga0466960_0407238 | 3300044901 | Bacteria | 784 |
| 685 | Ga0466960_0909614 | 3300044901 | Bacteria | 537 |
| 686 | Ga0466959_0008813 | 3300045049 | Bacteria | 7147 |
| 687 | Ga0466959_0055230 | 3300045049 | Bacteria | 2900 |
| 688 | Ga0451576_0002405 | 3300045051 | Bacteria | 28072 |
| 689 | Ga0451576_0367046 | 3300045051 | Unclassified | 1508 |
| 690 | Ga0451576_0686299 | 3300045051 | Bacteria | 1076 |
| 691 | Ga0451576_0728125 | 3300045051 | Bacteria | 1042 |
| 692 | Ga0466967_1252470 | 3300045976 | Bacteria | 739 |
| 693 | Ga0495617_166210 | 3300046452 | Unclassified | 698 |
| 694 | Ga0495638_0358370 | 3300046460 | Bacteria | 768 |
| 695 | Ga0495580_0019287 | 3300046472 | Bacteria | 5067 |
| 696 | Ga0495584_0594405 | 3300046491 | Bacteria | 564 |
| 697 | Ga0495596_0335844 | 3300046500 | Unclassified | 588 |
| 698 | Ga0495616_0217093 | 3300046513 | Bacteria | 834 |
| 699 | Ga0495587_0156491 | 3300046536 | Unclassified | 1298 |
| 700 | Ga0495645_0271530 | 3300046543 | Bacteria | 1119 |
| 701 | Ga0495625_0906652 | 3300046660 | Bacteria | 505 |
| 702 | Ga0495623_0338001 | 3300046679 | Bacteria | 823 |
| 703 | Ga0495658_0900844 | 3300046683 | Bacteria | 565 |
| 704 | Ga0495670_0732512 | 3300046691 | Bacteria | 539 |
| 705 | Ga0495671_0111247 | 3300046692 | Bacteria | 1337 |
| 706 | Ga0495600_0326181 | 3300046809 | Unclassified | 965 |
| 707 | Ga0495600_0558619 | 3300046809 | Unclassified | 699 |
| 708 | Ga0495604_0585522 | 3300047317 | Bacteria | 717 |
| 709 | Ga0495604_0731825 | 3300047317 | Bacteria | 627 |
| 710 | Ga0495674_0515779 | 3300047319 | Bacteria | 955 |
| 711 | Ga0495675_0263904 | 3300047444 | Bacteria | 1031 |
| 712 | Ga0495673_0157680 | 3300047469 | Bacteria | 873 |
| 713 | Ga0495686_0064522 | 3300047472 | Bacteria | 2266 |
| 714 | Ga0495686_0212396 | 3300047472 | Bacteria | 1105 |
| 715 | Ga0495602_0655096 | 3300048088 | Bacteria | 717 |
| 716 | Ga0496100_1063393 | 3300048903 | Bacteria | 637 |
| 717 | Ga0496101_0073290 | 3300048904 | Bacteria | 2515 |
| 718 | Ga0496101_0332802 | 3300048904 | Bacteria | 1192 |
| 719 | Ga0496101_1549729 | 3300048904 | Bacteria | 515 |
| 720 | Ga0496102_0046953 | 3300048905 | Bacteria | 3923 |
| 721 | Ga0496104_0014145 | 3300048907 | Bacteria | 7202 |
| 722 | Ga0496104_0202644 | 3300048907 | Bacteria | 1896 |
| 723 | Ga0496104_0775416 | 3300048907 | Unclassified | 865 |
| 724 | Ga0496105_0016438 | 3300048908 | Bacteria | 5909 |
| 725 | Ga0496105_0364564 | 3300048908 | Bacteria | 1152 |
| 726 | Ga0496106_0061455 | 3300048909 | Bacteria | 2850 |
| 727 | Ga0496106_0150760 | 3300048909 | Bacteria | 1834 |
| 728 | Ga0496107_0102183 | 3300048910 | Bacteria | 2102 |
| 729 | Ga0496107_0385291 | 3300048910 | Bacteria | 1043 |
| 730 | Ga0496108_0026214 | 3300048911 | Bacteria | 4807 |
| 731 | Ga0496108_0287555 | 3300048911 | Bacteria | 1431 |
| 732 | Ga0496108_0846070 | 3300048911 | Bacteria | 787 |
| 733 | Ga0496109_0419264 | 3300048912 | Bacteria | 1264 |
| 734 | Ga0496109_1909461 | 3300048912 | Unclassified | 526 |
| 735 | Ga0496110_0002929 | 3300048913 | Bacteria | 12922 |
| 736 | Ga0496110_0009323 | 3300048913 | Bacteria | 7941 |
| 737 | Ga0496111_0198764 | 3300048914 | Bacteria | 1490 |
| 738 | Ga0496111_1175382 | 3300048914 | Bacteria | 544 |
| 739 | Ga0496112_0166803 | 3300048915 | Bacteria | 2168 |
| 740 | Ga0496112_0876384 | 3300048915 | Bacteria | 820 |
| 741 | Ga0496113_0074417 | 3300048916 | Bacteria | 2590 |
| 742 | Ga0496114_0065909 | 3300048917 | Bacteria | 3035 |
| 743 | Ga0496114_0255873 | 3300048917 | Bacteria | 1541 |
| 744 | Ga0496114_1060247 | 3300048917 | Unclassified | 695 |
| 745 | Ga0496115_0655405 | 3300048918 | Bacteria | 829 |
| 746 | Ga0496116_0037032 | 3300048919 | Bacteria | 3407 |
| 747 | Ga0496117_0008275 | 3300048920 | Bacteria | 9900 |
| 748 | Ga0496117_0416497 | 3300048920 | Bacteria | 673 |
| 749 | Ga0496118_0009209 | 3300048921 | Bacteria | 10030 |
| 750 | Ga0496118_0131646 | 3300048921 | Bacteria | 1605 |
| 751 | Ga0496119_0001089 | 3300048922 | Bacteria | 34251 |
| 752 | Ga0496119_0136119 | 3300048922 | Bacteria | 1332 |
| 753 | Ga0496121_0000246 | 3300048924 | Bacteria | 114919 |
| 754 | Ga0496121_0067412 | 3300048924 | Bacteria | 2901 |
| 755 | Ga0496121_0358467 | 3300048924 | Bacteria | 969 |
| 756 | Ga0496122_0021783 | 3300048925 | Bacteria | 5720 |
| 757 | Ga0496122_0056325 | 3300048925 | Bacteria | 2931 |
| 758 | Ga0496123_0009931 | 3300048926 | Bacteria | 8490 |
| 759 | Ga0496123_0022057 | 3300048926 | Bacteria | 4924 |
| 760 | Ga0496124_0307293 | 3300048927 | Bacteria | 1142 |
| 761 | Ga0496125_0054673 | 3300048928 | Bacteria | 3260 |
| 762 | Ga0496126_0021917 | 3300048929 | Bacteria | 6231 |
| 763 | Ga0496126_0562605 | 3300048929 | Bacteria | 903 |
| 764 | Ga0501032_0499105 | 3300049569 | Bacteria | 778 |
| 765 | Ga0501032_0565924 | 3300049569 | Unclassified | 724 |
| 766 | Ga0501034_0005650 | 3300049571 | Bacteria | 13607 |
| 767 | Ga0501034_0082117 | 3300049571 | Bacteria | 3225 |
| 768 | Ga0501034_0194858 | 3300049571 | Bacteria | 1987 |
| 769 | Ga0501034_0535765 | 3300049571 | Bacteria | 1081 |
| 770 | Ga0501034_1455585 | 3300049571 | Unclassified | 559 |
| 771 | Ga0501036_0323630 | 3300049572 | Bacteria | 1288 |
| 772 | Ga0501036_0525192 | 3300049572 | Bacteria | 984 |
| 773 | Ga0501037_0471717 | 3300049573 | Bacteria | 854 |
| 774 | Ga0501037_0644236 | 3300049573 | Bacteria | 709 |
| 775 | Ga0501038_0527902 | 3300049574 | Bacteria | 900 |
| 776 | Ga0501038_0642748 | 3300049574 | Unclassified | 799 |
| 777 | Ga0501039_0109497 | 3300049575 | Bacteria | 2159 |
| 778 | Ga0501039_1505163 | 3300049575 | Bacteria | 517 |
| 779 | Ga0501040_0001085 | 3300049576 | Bacteria | 17202 |
| 780 | Ga0501040_0394066 | 3300049576 | Bacteria | 994 |
| 781 | Ga0501040_0495195 | 3300049576 | Bacteria | 881 |
| 782 | Ga0501040_0952130 | 3300049576 | Bacteria | 622 |
| 783 | Ga0501041_0079903 | 3300049577 | Bacteria | 2013 |
| 784 | Ga0501041_0646736 | 3300049577 | Bacteria | 676 |
| 785 | Ga0501042_0039134 | 3300049578 | Bacteria | 3369 |
| 786 | Ga0501042_0051340 | 3300049578 | Bacteria | 2941 |
| 787 | Ga0501042_0079004 | 3300049578 | Bacteria | 2356 |
| 788 | Ga0501042_0484295 | 3300049578 | Bacteria | 898 |
| 789 | Ga0501043_0410074 | 3300049579 | Bacteria | 1023 |
| 790 | Ga0501046_1119961 | 3300049580 | Bacteria | 543 |
| 791 | Ga0501047_0196075 | 3300049581 | Bacteria | 1882 |
| 792 | Ga0501047_0428432 | 3300049581 | Bacteria | 1154 |
| 793 | Ga0501048_0513547 | 3300049582 | Bacteria | 859 |
| 794 | Ga0501067_0023609 | 3300049583 | Bacteria | 3408 |
| 795 | Ga0501068_0023531 | 3300049584 | Bacteria | 3610 |
| 796 | Ga0501068_0299546 | 3300049584 | Bacteria | 1029 |
| 797 | Ga0501068_0536066 | 3300049584 | Bacteria | 760 |
| 798 | Ga0501069_0029799 | 3300049585 | Bacteria | 2996 |
| 799 | Ga0501070_0719371 | 3300049586 | Unclassified | 789 |
| 800 | Ga0501070_0833247 | 3300049586 | Bacteria | 723 |
| 801 | Ga0501071_0007964 | 3300049587 | Bacteria | 6991 |
| 802 | Ga0501071_0497418 | 3300049587 | Bacteria | 935 |
| 803 | Ga0501071_0736179 | 3300049587 | Bacteria | 760 |
| 804 | Ga0501071_1010208 | 3300049587 | Bacteria | 642 |
| 805 | Ga0501072_0030078 | 3300049588 | Bacteria | 4245 |
| 806 | Ga0501072_0236854 | 3300049588 | Bacteria | 1454 |
| 807 | Ga0501072_0527385 | 3300049588 | Bacteria | 933 |
| 808 | Ga0501072_0562762 | 3300049588 | Bacteria | 900 |
| 809 | Ga0501073_0002828 | 3300049589 | Bacteria | 13003 |
| 810 | Ga0501073_0069437 | 3300049589 | Bacteria | 2455 |
| 811 | Ga0501073_0178446 | 3300049589 | Bacteria | 1470 |
| 812 | Ga0501073_0930978 | 3300049589 | Bacteria | 598 |
| 813 | Ga0501073_1071818 | 3300049589 | Bacteria | 554 |
| 814 | Ga0501074_0000646 | 3300049590 | Bacteria | 21639 |
| 815 | Ga0501074_0210573 | 3300049590 | Bacteria | 1385 |
| 816 | Ga0501074_0464069 | 3300049590 | Bacteria | 897 |
| 817 | Ga0501074_0637863 | 3300049590 | Bacteria | 753 |
| 818 | Ga0501074_0658354 | 3300049590 | Bacteria | 740 |
| 819 | Ga0501075_0079029 | 3300049591 | Unclassified | 2490 |
| 820 | Ga0501075_0131325 | 3300049591 | Bacteria | 1908 |
| 821 | Ga0501076_0020771 | 3300049592 | Bacteria | 5028 |
| 822 | Ga0501076_0054945 | 3300049592 | Bacteria | 3157 |
| 823 | Ga0501076_0109716 | 3300049592 | Bacteria | 2230 |
| 824 | Ga0501076_0332817 | 3300049592 | Bacteria | 1246 |
| 825 | Ga0501076_0485682 | 3300049592 | Bacteria | 1018 |
| 826 | Ga0501076_0601048 | 3300049592 | Bacteria | 907 |
| 827 | Ga0501076_1327821 | 3300049592 | Bacteria | 591 |
| 828 | Ga0501077_0019747 | 3300049593 | Bacteria | 4262 |
| 829 | Ga0501077_0123178 | 3300049593 | Bacteria | 1643 |
| 830 | Ga0501079_0026230 | 3300049741 | Bacteria | 4466 |
| 831 | Ga0501079_0062681 | 3300049741 | Bacteria | 2867 |
| 832 | Ga0501079_1244395 | 3300049741 | Bacteria | 586 |
| 833 | Ga0501080_0005283 | 3300049742 | Bacteria | 11501 |
| 834 | Ga0501080_0131776 | 3300049742 | Bacteria | 2315 |
| 835 | Ga0501080_0636451 | 3300049742 | Bacteria | 944 |
| 836 | Ga0501081_0002762 | 3300049743 | Bacteria | 11123 |
| 837 | Ga0501081_0286176 | 3300049743 | Bacteria | 1207 |
| 838 | Ga0501081_0634303 | 3300049743 | Bacteria | 801 |
| 839 | Ga0501081_0756212 | 3300049743 | Bacteria | 730 |
| 840 | Ga0501081_1137776 | 3300049743 | Unclassified | 591 |
| 841 | Ga0501083_0222212 | 3300049744 | Bacteria | 1230 |
| 842 | Ga0501083_0263413 | 3300049744 | Bacteria | 1121 |
| 843 | Ga0501035_0130925 | 3300049822 | Bacteria | 2187 |
| 844 | Ga0501044_0126154 | 3300049823 | Bacteria | 2557 |
| 845 | Ga0501044_0258868 | 3300049823 | Bacteria | 1679 |
| 846 | Ga0501044_0287534 | 3300049823 | Bacteria | 1576 |
| 847 | Ga0501044_0944226 | 3300049823 | Bacteria | 736 |
| 848 | Ga0501045_0380757 | 3300049824 | Bacteria | 1050 |
| 849 | Ga0501045_0594073 | 3300049824 | Bacteria | 820 |
| 850 | Ga0501045_0750882 | 3300049824 | Bacteria | 719 |
| 851 | Ga0501045_1423634 | 3300049824 | Unclassified | 503 |
| 852 | nmdc:mga03683_345695_c1 | 3300050489 | Bacteria | 703 |
| 853 | nmdc:mga00v17_482375_c1 | 3300050491 | Bacteria | 804 |
| 854 | nmdc:mga00v17_733365_c1 | 3300050491 | Unclassified | 632 |
| 855 | nmdc:mga0k408_694415_c1 | 3300050493 | Unclassified | 596 |
| 856 | nmdc:mga07m45_526252_c1 | 3300050496 | Bacteria | 684 |
| 857 | nmdc:mga07m45_567688_c1 | 3300050496 | Bacteria | 656 |
| 858 | nmdc:mga07m45_682052_c1 | 3300050496 | Bacteria | 591 |
| 859 | nmdc:mga05p37_63902_c1 | 3300050507 | Bacteria | 4530 |
| 860 | nmdc:mga0qj67_165290_c1 | 3300050509 | Bacteria | 1796 |
| 861 | nmdc:mga0qj67_535010_c1 | 3300050509 | Bacteria | 940 |
| 862 | nmdc:mga08y16_11753_c1 | 3300050511 | Bacteria | 9197 |
| 863 | nmdc:mga08y16_123582_c1 | 3300050511 | Bacteria | 2693 |
| 864 | nmdc:mga08y16_1470419_c1 | 3300050511 | Unclassified | 643 |
| 865 | nmdc:mga08y16_515024_c1 | 3300050511 | Bacteria | 1214 |
| 866 | nmdc:mga0n895_255548_c1 | 3300050512 | Unclassified | 1778 |
| 867 | nmdc:mga0rr50_118408_c1 | 3300050513 | Unclassified | 2104 |
| 868 | nmdc:mga08x19_265181_c1 | 3300050514 | Bacteria | 1188 |
| 869 | nmdc:mga0sz30_144664_c2 | 3300050516 | Bacteria | 695 |
| 870 | nmdc:mga0sz30_222956_c1 | 3300050516 | Bacteria | 838 |
| 871 | Ga0495612_0082790 | 3300053078 | Bacteria | 1350 |
| 872 | Ga0495595_0392205 | 3300053084 | Bacteria | 703 |
| 873 | Ga0495619_0295000 | 3300053085 | Bacteria | 1123 |
| 874 | Ga0500643_006566 | 3300053087 | Bacteria | 4842 |
| 875 | Ga0500643_179186 | 3300053087 | Bacteria | 568 |
| 876 | Ga0500644_0118743 | 3300053088 | Bacteria | 1028 |
| 877 | Ga0500583_0001730 | 3300053092 | Bacteria | 6381 |
| 878 | Ga0500583_0003168 | 3300053092 | Bacteria | 5113 |
| 879 | Ga0500651_0457249 | 3300053093 | Unclassified | 709 |
| 880 | Ga0500641_0018311 | 3300053096 | Bacteria | 2633 |
| 881 | Ga0500641_0170442 | 3300053096 | Unclassified | 937 |
| 882 | Ga0500556_0000033 | 3300053104 | Bacteria | 147801 |
| 883 | Ga0500556_0000549 | 3300053104 | Bacteria | 25200 |
| 884 | Ga0500556_0016484 | 3300053104 | Bacteria | 2298 |
| 885 | Ga0500557_158173 | 3300053105 | Unclassified | 744 |
| 886 | Ga0500562_000202 | 3300053108 | Bacteria | 16162 |
| 887 | Ga0500562_035872 | 3300053108 | Bacteria | 1314 |
| 888 | Ga0500562_145305 | 3300053108 | Bacteria | 646 |
| 889 | Ga0500594_0024949 | 3300053118 | Bacteria | 1528 |
| 890 | Ga0500594_0122285 | 3300053118 | Unclassified | 818 |
| 891 | Ga0500595_034889 | 3300053119 | Bacteria | 1660 |
| 892 | Ga0500597_174709 | 3300053120 | Bacteria | 914 |
| 893 | Ga0500617_107312 | 3300053124 | Bacteria | 1172 |
| 894 | Ga0500642_0034856 | 3300053130 | Bacteria | 2133 |
| 895 | Ga0500652_079453 | 3300053131 | Bacteria | 1365 |
| 896 | Ga0500658_0045506 | 3300053134 | Bacteria | 1774 |
| 897 | Ga0500559_0432702 | 3300053136 | Bacteria | 610 |
| 898 | Ga0500561_0028843 | 3300053137 | Bacteria | 1381 |
| 899 | Ga0500568_0007280 | 3300053139 | Bacteria | 5447 |
| 900 | Ga0500568_0051166 | 3300053139 | Bacteria | 1626 |
| 901 | Ga0500568_0087516 | 3300053139 | Bacteria | 1177 |
| 902 | Ga0500568_0124194 | 3300053139 | Unclassified | 961 |
| 903 | Ga0500577_0472368 | 3300053142 | Bacteria | 548 |
| 904 | Ga0500588_0001229 | 3300053146 | Bacteria | 4753 |
| 905 | Ga0500589_188077 | 3300053147 | Unclassified | 805 |
| 906 | Ga0500604_0105037 | 3300053151 | Unclassified | 934 |
| 907 | Ga0500616_0000074 | 3300053153 | Bacteria | 222910 |
| 908 | Ga0500627_0226470 | 3300053158 | Bacteria | 833 |
| 909 | Ga0500633_0125810 | 3300053160 | Unclassified | 955 |
| 910 | Ga0500636_0252685 | 3300053177 | Bacteria | 898 |
| 911 | Ga0500637_0000804 | 3300053178 | Bacteria | 12521 |
| 912 | Ga0500645_004392 | 3300053730 | Bacteria | 5421 |
| 913 | Ga0500656_003331 | 3300053732 | Bacteria | 1498 |
| 914 | Ga0500552_056537 | 3300053733 | Bacteria | 677 |
| 915 | Ga0500596_107189 | 3300053735 | Bacteria | 507 |
| 916 | Ga0501084_0005783 | 3300054114 | Bacteria | 10170 |
| 917 | Ga0501084_0008467 | 3300054114 | Bacteria | 8506 |
| 918 | Ga0501084_1333813 | 3300054114 | Bacteria | 601 |
| 919 | Ga0587073_0242058 | 3300059492 | Bacteria | 562 |
| 920 | Ga0587080_081482 | 3300059503 | Bacteria | 665 |
| 921 | Ga0587083_0171740 | 3300059505 | Bacteria | 601 |
| 922 | Ga0587083_0226268 | 3300059505 | Unclassified | 546 |
| 923 | Ga0587088_084173 | 3300059508 | Bacteria | 686 |
| 924 | Ga0587089_086309 | 3300059509 | Bacteria | 553 |
| 925 | Ga0587090_079888 | 3300059510 | Bacteria | 653 |
| 926 | Ga0587125_032488 | 3300059607 | Bacteria | 673 |
| 927 | Ga0587128_020797 | 3300059630 | Bacteria | 1006 |
| 928 | Ga0587067_091641 | 3300059640 | Bacteria | 690 |
| 929 | Ga0587072_114274 | 3300059643 | Bacteria | 619 |
| 930 | Ga0587076_064033 | 3300059645 | Bacteria | 748 |
| 931 | Ga0587079_145504 | 3300059647 | Bacteria | 608 |
| 932 | Ga0587107_037040 | 3300059652 | Bacteria | 771 |
| 933 | Ga0587111_0061349 | 3300060346 | Bacteria | 856 |
| 934 | Ga0587111_0115460 | 3300060346 | Bacteria | 685 |
| 935 | Ga0501082_0005773 | 3300060353 | Bacteria | 10741 |
| 936 | Ga0501082_0077802 | 3300060353 | Bacteria | 2860 |
| 937 | Ga0501082_0438602 | 3300060353 | Bacteria | 1141 |
| 938 | Ga0501082_1126860 | 3300060353 | Bacteria | 686 |
| 939 | Ga0501082_1255458 | 3300060353 | Bacteria | 647 |
| 940 | Ga0501082_1418253 | 3300060353 | Bacteria | 606 |
| 941 | Ga0466962_0000690 | 3300061719 | Bacteria | 15026 |
| 942 | Ga0466962_0182138 | 3300061719 | Bacteria | 1024 |
| 943 | Ga0530510_0447788 | 3300061734 | Bacteria | 976 |
| 944 | Ga0530510_0578340 | 3300061734 | Bacteria | 854 |
| 945 | Ga0530510_1076071 | 3300061734 | Bacteria | 616 |
| 946 | Ga0530510_1162525 | 3300061734 | Unclassified | 591 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049572 | Ga0501036_0323630 | Ga0501036_0323630_611_763 | 38 |
| 2 | 3300049572 | Ga0501036_0525192 | Ga0501036_0525192_612_764 | 38 |
| 3 | 3300049573 | Ga0501037_0471717 | Ga0501037_0471717_366_518 | 38 |
| 4 | 3300049574 | Ga0501038_0527902 | Ga0501038_0527902_108_260 | 38 |
| 5 | 3300049575 | Ga0501039_0109497 | Ga0501039_0109497_1937_2089 | 38 |
| 6 | 3300049576 | Ga0501040_0495195 | Ga0501040_0495195_208_360 | 38 |
| 7 | 3300049577 | Ga0501041_0079903 | Ga0501041_0079903_842_994 | 38 |
| 8 | 3300049578 | Ga0501042_0039134 | Ga0501042_0039134_2090_2242 | 38 |
| 9 | 3300049578 | Ga0501042_0484295 | Ga0501042_0484295_41_193 | 38 |
| 10 | 3300049579 | Ga0501043_0410074 | Ga0501043_0410074_93_245 | 38 |
| 11 | 3300049580 | Ga0501046_1119961 | Ga0501046_1119961_350_502 | 38 |
| 12 | 3300049582 | Ga0501048_0513547 | Ga0501048_0513547_189_341 | 38 |
| 13 | 3300049587 | Ga0501071_1010208 | Ga0501071_1010208_444_596 | 38 |
| 14 | 3300049588 | Ga0501072_0236854 | Ga0501072_0236854_1169_1321 | 38 |
| 15 | 3300049588 | Ga0501072_0562762 | Ga0501072_0562762_74_226 | 38 |
| 16 | 3300049589 | Ga0501073_0178446 | Ga0501073_0178446_1073_1225 | 38 |
| 17 | 3300049591 | Ga0501075_0131325 | Ga0501075_0131325_983_1135 | 38 |
| 18 | 3300049592 | Ga0501076_0054945 | Ga0501076_0054945_614_766 | 38 |
| 19 | 3300049592 | Ga0501076_0601048 | Ga0501076_0601048_654_806 | 38 |
| 20 | 3300049592 | Ga0501076_1327821 | Ga0501076_1327821_405_557 | 38 |
| 21 | 3300049743 | Ga0501081_0286176 | Ga0501081_0286176_787_939 | 38 |
| 22 | 3300049824 | Ga0501045_0380757 | Ga0501045_0380757_28_180 | 38 |
| 23 | 3300060353 | Ga0501082_1418253 | Ga0501082_1418253_274_426 | 38 |
| 24 | 3300003187 | JGI25151J46595_10046276 | JGI25151J46595_100462762 | 44 |
| 25 | 3300003203 | JGI25406J46586_10015769 | JGI25406J46586_100157692 | 44 |
| 26 | 3300003323 | rootH1_10118379 | rootH1_101183793 | 44 |
| 27 | 3300003751 | Ga0055538_1000206 | Ga0055538_10002063 | 44 |
| 28 | 3300003751 | Ga0055538_1000658 | Ga0055538_100065812 | 44 |
| 29 | 3300003781 | Ga0055536_1041917 | Ga0055536_10419171 | 44 |
| 30 | 3300003781 | Ga0055536_1066973 | Ga0055536_10669731 | 44 |
| 31 | 3300003781 | Ga0055536_1089251 | Ga0055536_10892511 | 44 |
| 32 | 3300003911 | JGI25405J52794_10027349 | JGI25405J52794_100273492 | 44 |
| 33 | 3300005290 | Ga0065712_10248897 | Ga0065712_102488972 | 44 |
| 34 | 3300005327 | Ga0070658_10935262 | Ga0070658_109352622 | 44 |
| 35 | 3300005328 | Ga0070676_10156234 | Ga0070676_101562344 | 44 |
| 36 | 3300005328 | Ga0070676_11394173 | Ga0070676_113941731 | 44 |
| 37 | 3300005328 | Ga0070676_11502862 | Ga0070676_115028622 | 44 |
| 38 | 3300005329 | Ga0070683_100054413 | Ga0070683_1000544132 | 44 |
| 39 | 3300005329 | Ga0070683_100192791 | Ga0070683_1001927913 | 44 |
| 40 | 3300005330 | Ga0070690_100003231 | Ga0070690_10000323110 | 44 |
| 41 | 3300005330 | Ga0070690_100009245 | Ga0070690_1000092455 | 44 |
| 42 | 3300005331 | Ga0070670_100067271 | Ga0070670_1000672713 | 44 |
| 43 | 3300005331 | Ga0070670_100320063 | Ga0070670_1003200631 | 44 |
| 44 | 3300005331 | Ga0070670_100992146 | Ga0070670_1009921462 | 44 |
| 45 | 3300005333 | Ga0070677_10143081 | Ga0070677_101430812 | 44 |
| 46 | 3300005335 | Ga0070666_10845613 | Ga0070666_108456131 | 44 |
| 47 | 3300005336 | Ga0070680_100025820 | Ga0070680_1000258205 | 44 |
| 48 | 3300005336 | Ga0070680_100093099 | Ga0070680_1000930993 | 44 |
| 49 | 3300005336 | Ga0070680_100879634 | Ga0070680_1008796342 | 44 |
| 50 | 3300005336 | Ga0070680_101699098 | Ga0070680_1016990981 | 44 |
| 51 | 3300005337 | Ga0070682_101551654 | Ga0070682_1015516542 | 44 |
| 52 | 3300005338 | Ga0068868_100931770 | Ga0068868_1009317701 | 44 |
| 53 | 3300005340 | Ga0070689_100010982 | Ga0070689_1000109824 | 44 |
| 54 | 3300005340 | Ga0070689_101638495 | Ga0070689_1016384951 | 44 |
| 55 | 3300005341 | Ga0070691_10140828 | Ga0070691_101408282 | 44 |
| 56 | 3300005343 | Ga0070687_100447103 | Ga0070687_1004471032 | 44 |
| 57 | 3300005344 | Ga0070661_100000183 | Ga0070661_10000018332 | 44 |
| 58 | 3300005344 | Ga0070661_100376717 | Ga0070661_1003767172 | 44 |
| 59 | 3300005344 | Ga0070661_100455303 | Ga0070661_1004553032 | 44 |
| 60 | 3300005344 | Ga0070661_100562570 | Ga0070661_1005625702 | 44 |
| 61 | 3300005345 | Ga0070692_10898304 | Ga0070692_108983042 | 44 |
| 62 | 3300005347 | Ga0070668_100235981 | Ga0070668_1002359812 | 44 |
| 63 | 3300005347 | Ga0070668_100636238 | Ga0070668_1006362382 | 44 |
| 64 | 3300005353 | Ga0070669_100512739 | Ga0070669_1005127391 | 44 |
| 65 | 3300005353 | Ga0070669_100998965 | Ga0070669_1009989652 | 44 |
| 66 | 3300005354 | Ga0070675_100111925 | Ga0070675_1001119252 | 44 |
| 67 | 3300005355 | Ga0070671_100058258 | Ga0070671_1000582583 | 44 |
| 68 | 3300005355 | Ga0070671_101094650 | Ga0070671_1010946502 | 44 |
| 69 | 3300005355 | Ga0070671_101398364 | Ga0070671_1013983641 | 44 |
| 70 | 3300005355 | Ga0070671_102056739 | Ga0070671_1020567392 | 44 |
| 71 | 3300005356 | Ga0070674_100016413 | Ga0070674_1000164133 | 44 |
| 72 | 3300005364 | Ga0070673_100049769 | Ga0070673_1000497693 | 44 |
| 73 | 3300005364 | Ga0070673_100099806 | Ga0070673_1000998062 | 44 |
| 74 | 3300005364 | Ga0070673_101111246 | Ga0070673_1011112461 | 44 |
| 75 | 3300005364 | Ga0070673_101504916 | Ga0070673_1015049162 | 44 |
| 76 | 3300005365 | Ga0070688_100039439 | Ga0070688_1000394392 | 44 |
| 77 | 3300005365 | Ga0070688_100164909 | Ga0070688_1001649092 | 44 |
| 78 | 3300005366 | Ga0070659_100114447 | Ga0070659_1001144472 | 44 |
| 79 | 3300005366 | Ga0070659_101567723 | Ga0070659_1015677231 | 44 |
| 80 | 3300005434 | Ga0070709_10002110 | Ga0070709_100021107 | 44 |
| 81 | 3300005434 | Ga0070709_10025676 | Ga0070709_100256763 | 44 |
| 82 | 3300005434 | Ga0070709_10345689 | Ga0070709_103456892 | 44 |
| 83 | 3300005435 | Ga0070714_100026296 | Ga0070714_1000262962 | 44 |
| 84 | 3300005435 | Ga0070714_100118183 | Ga0070714_1001181832 | 44 |
| 85 | 3300005435 | Ga0070714_100201334 | Ga0070714_1002013342 | 44 |
| 86 | 3300005435 | Ga0070714_102395599 | Ga0070714_1023955991 | 44 |
| 87 | 3300005436 | Ga0070713_100032340 | Ga0070713_1000323404 | 44 |
| 88 | 3300005436 | Ga0070713_100095748 | Ga0070713_1000957483 | 44 |
| 89 | 3300005436 | Ga0070713_100272792 | Ga0070713_1002727922 | 44 |
| 90 | 3300005436 | Ga0070713_101228603 | Ga0070713_1012286031 | 44 |
| 91 | 3300005437 | Ga0070710_10074514 | Ga0070710_100745144 | 44 |
| 92 | 3300005437 | Ga0070710_10138473 | Ga0070710_101384732 | 44 |
| 93 | 3300005437 | Ga0070710_10474736 | Ga0070710_104747362 | 44 |
| 94 | 3300005437 | Ga0070710_10543033 | Ga0070710_105430331 | 44 |
| 95 | 3300005437 | Ga0070710_10580617 | Ga0070710_105806172 | 44 |
| 96 | 3300005438 | Ga0070701_10044575 | Ga0070701_100445752 | 44 |
| 97 | 3300005438 | Ga0070701_10114596 | Ga0070701_101145962 | 44 |
| 98 | 3300005438 | Ga0070701_10119681 | Ga0070701_101196814 | 44 |
| 99 | 3300005438 | Ga0070701_10200321 | Ga0070701_102003213 | 44 |
| 100 | 3300005438 | Ga0070701_10354570 | Ga0070701_103545703 | 44 |
| 101 | 3300005439 | Ga0070711_100016582 | Ga0070711_1000165824 | 44 |
| 102 | 3300005439 | Ga0070711_100049836 | Ga0070711_1000498362 | 44 |
| 103 | 3300005439 | Ga0070711_100054931 | Ga0070711_1000549314 | 44 |
| 104 | 3300005439 | Ga0070711_100116010 | Ga0070711_1001160102 | 44 |
| 105 | 3300005439 | Ga0070711_101179453 | Ga0070711_1011794532 | 44 |
| 106 | 3300005440 | Ga0070705_100019745 | Ga0070705_1000197455 | 44 |
| 107 | 3300005440 | Ga0070705_101265511 | Ga0070705_1012655111 | 44 |
| 108 | 3300005441 | Ga0070700_100054830 | Ga0070700_1000548301 | 44 |
| 109 | 3300005444 | Ga0070694_100254155 | Ga0070694_1002541554 | 44 |
| 110 | 3300005445 | Ga0070708_100923735 | Ga0070708_1009237352 | 44 |
| 111 | 3300005455 | Ga0070663_100341735 | Ga0070663_1003417352 | 44 |
| 112 | 3300005456 | Ga0070678_100117275 | Ga0070678_1001172753 | 44 |
| 113 | 3300005456 | Ga0070678_100798040 | Ga0070678_1007980402 | 44 |
| 114 | 3300005457 | Ga0070662_100317973 | Ga0070662_1003179733 | 44 |
| 115 | 3300005457 | Ga0070662_100568302 | Ga0070662_1005683021 | 44 |
| 116 | 3300005458 | Ga0070681_10003033 | Ga0070681_100030339 | 44 |
| 117 | 3300005458 | Ga0070681_10019166 | Ga0070681_100191664 | 44 |
| 118 | 3300005458 | Ga0070681_10034405 | Ga0070681_100344054 | 44 |
| 119 | 3300005458 | Ga0070681_10034982 | Ga0070681_100349824 | 44 |
| 120 | 3300005458 | Ga0070681_10061388 | Ga0070681_100613882 | 44 |
| 121 | 3300005459 | Ga0068867_101271684 | Ga0068867_1012716842 | 44 |
| 122 | 3300005466 | Ga0070685_10101524 | Ga0070685_101015241 | 44 |
| 123 | 3300005466 | Ga0070685_10449132 | Ga0070685_104491322 | 44 |
| 124 | 3300005468 | Ga0070707_101680682 | Ga0070707_1016806822 | 44 |
| 125 | 3300005518 | Ga0070699_100041632 | Ga0070699_1000416324 | 44 |
| 126 | 3300005530 | Ga0070679_100007660 | Ga0070679_1000076601 | 44 |
| 127 | 3300005530 | Ga0070679_100029196 | Ga0070679_1000291964 | 44 |
| 128 | 3300005530 | Ga0070679_100037832 | Ga0070679_1000378325 | 44 |
| 129 | 3300005530 | Ga0070679_100059089 | Ga0070679_1000590892 | 44 |
| 130 | 3300005530 | Ga0070679_100602641 | Ga0070679_1006026412 | 44 |
| 131 | 3300005535 | Ga0070684_100041728 | Ga0070684_1000417282 | 44 |
| 132 | 3300005535 | Ga0070684_100367116 | Ga0070684_1003671162 | 44 |
| 133 | 3300005535 | Ga0070684_100919822 | Ga0070684_1009198221 | 44 |
| 134 | 3300005535 | Ga0070684_101424555 | Ga0070684_1014245551 | 44 |
| 135 | 3300005536 | Ga0070697_101333618 | Ga0070697_1013336182 | 44 |
| 136 | 3300005539 | Ga0068853_100033553 | Ga0068853_1000335533 | 44 |
| 137 | 3300005539 | Ga0068853_100252784 | Ga0068853_1002527842 | 44 |
| 138 | 3300005539 | Ga0068853_101373932 | Ga0068853_1013739321 | 44 |
| 139 | 3300005539 | Ga0068853_102262481 | Ga0068853_1022624811 | 44 |
| 140 | 3300005543 | Ga0070672_100030659 | Ga0070672_1000306592 | 44 |
| 141 | 3300005543 | Ga0070672_100061996 | Ga0070672_1000619963 | 44 |
| 142 | 3300005543 | Ga0070672_100102000 | Ga0070672_1001020002 | 44 |
| 143 | 3300005543 | Ga0070672_101458839 | Ga0070672_1014588391 | 44 |
| 144 | 3300005543 | Ga0070672_101652855 | Ga0070672_1016528552 | 44 |
| 145 | 3300005544 | Ga0070686_100525269 | Ga0070686_1005252693 | 44 |
| 146 | 3300005545 | Ga0070695_100021853 | Ga0070695_1000218534 | 44 |
| 147 | 3300005545 | Ga0070695_100390108 | Ga0070695_1003901081 | 44 |
| 148 | 3300005546 | Ga0070696_100094393 | Ga0070696_1000943932 | 44 |
| 149 | 3300005547 | Ga0070693_100054417 | Ga0070693_1000544171 | 44 |
| 150 | 3300005547 | Ga0070693_100302233 | Ga0070693_1003022332 | 44 |
| 151 | 3300005547 | Ga0070693_101564081 | Ga0070693_1015640811 | 44 |
| 152 | 3300005548 | Ga0070665_100009741 | Ga0070665_1000097417 | 44 |
| 153 | 3300005548 | Ga0070665_100344014 | Ga0070665_1003440141 | 44 |
| 154 | 3300005548 | Ga0070665_100483203 | Ga0070665_1004832033 | 44 |
| 155 | 3300005548 | Ga0070665_101156760 | Ga0070665_1011567602 | 44 |
| 156 | 3300005548 | Ga0070665_101766514 | Ga0070665_1017665142 | 44 |
| 157 | 3300005549 | Ga0070704_100106234 | Ga0070704_1001062344 | 44 |
| 158 | 3300005563 | Ga0068855_100000188 | Ga0068855_10000018825 | 44 |
| 159 | 3300005563 | Ga0068855_100004121 | Ga0068855_1000041211 | 44 |
| 160 | 3300005563 | Ga0068855_100033609 | Ga0068855_1000336097 | 44 |
| 161 | 3300005563 | Ga0068855_100343487 | Ga0068855_1003434873 | 44 |
| 162 | 3300005563 | Ga0068855_102078530 | Ga0068855_1020785302 | 44 |
| 163 | 3300005563 | Ga0068855_102190585 | Ga0068855_1021905852 | 44 |
| 164 | 3300005564 | Ga0070664_101588348 | Ga0070664_1015883482 | 44 |
| 165 | 3300005577 | Ga0068857_100350725 | Ga0068857_1003507252 | 44 |
| 166 | 3300005577 | Ga0068857_101124729 | Ga0068857_1011247292 | 44 |
| 167 | 3300005578 | Ga0068854_100062432 | Ga0068854_1000624322 | 44 |
| 168 | 3300005578 | Ga0068854_100659430 | Ga0068854_1006594302 | 44 |
| 169 | 3300005614 | Ga0068856_100108527 | Ga0068856_1001085272 | 44 |
| 170 | 3300005614 | Ga0068856_100213608 | Ga0068856_1002136082 | 44 |
| 171 | 3300005615 | Ga0070702_100011240 | Ga0070702_1000112405 | 44 |
| 172 | 3300005616 | Ga0068852_100025840 | Ga0068852_1000258406 | 44 |
| 173 | 3300005616 | Ga0068852_100762310 | Ga0068852_1007623103 | 44 |
| 174 | 3300005616 | Ga0068852_101077044 | Ga0068852_1010770442 | 44 |
| 175 | 3300005617 | Ga0068859_100026672 | Ga0068859_1000266722 | 44 |
| 176 | 3300005617 | Ga0068859_100203345 | Ga0068859_1002033452 | 44 |
| 177 | 3300005617 | Ga0068859_100456496 | Ga0068859_1004564962 | 44 |
| 178 | 3300005617 | Ga0068859_101375822 | Ga0068859_1013758222 | 44 |
| 179 | 3300005618 | Ga0068864_101069930 | Ga0068864_1010699301 | 44 |
| 180 | 3300005718 | Ga0068866_10201315 | Ga0068866_102013153 | 44 |
| 181 | 3300005719 | Ga0068861_100033657 | Ga0068861_1000336573 | 44 |
| 182 | 3300005719 | Ga0068861_100055843 | Ga0068861_1000558434 | 44 |
| 183 | 3300005719 | Ga0068861_100079169 | Ga0068861_1000791692 | 44 |
| 184 | 3300005719 | Ga0068861_100129233 | Ga0068861_1001292332 | 44 |
| 185 | 3300005719 | Ga0068861_100242654 | Ga0068861_1002426542 | 44 |
| 186 | 3300005719 | Ga0068861_100418873 | Ga0068861_1004188732 | 44 |
| 187 | 3300005719 | Ga0068861_100912097 | Ga0068861_1009120971 | 44 |
| 188 | 3300005834 | Ga0068851_10000624 | Ga0068851_1000062417 | 44 |
| 189 | 3300005840 | Ga0068870_10019332 | Ga0068870_100193322 | 44 |
| 190 | 3300005840 | Ga0068870_10030584 | Ga0068870_100305841 | 44 |
| 191 | 3300005841 | Ga0068863_100025727 | Ga0068863_1000257274 | 44 |
| 192 | 3300005841 | Ga0068863_100031365 | Ga0068863_1000313655 | 44 |
| 193 | 3300005841 | Ga0068863_100414435 | Ga0068863_1004144352 | 44 |
| 194 | 3300005842 | Ga0068858_100268235 | Ga0068858_1002682354 | 44 |
| 195 | 3300005842 | Ga0068858_100415704 | Ga0068858_1004157043 | 44 |
| 196 | 3300005843 | Ga0068860_100286937 | Ga0068860_1002869372 | 44 |
| 197 | 3300005843 | Ga0068860_100774913 | Ga0068860_1007749132 | 44 |
| 198 | 3300005844 | Ga0068862_100043148 | Ga0068862_1000431485 | 44 |
| 199 | 3300005844 | Ga0068862_100138133 | Ga0068862_1001381334 | 44 |
| 200 | 3300005844 | Ga0068862_100180570 | Ga0068862_1001805702 | 44 |
| 201 | 3300005844 | Ga0068862_100273738 | Ga0068862_1002737384 | 44 |
| 202 | 3300005844 | Ga0068862_100305677 | Ga0068862_1003056773 | 44 |
| 203 | 3300005844 | Ga0068862_100362944 | Ga0068862_1003629444 | 44 |
| 204 | 3300005844 | Ga0068862_100583577 | Ga0068862_1005835772 | 44 |
| 205 | 3300005937 | Ga0081455_10003146 | Ga0081455_100031467 | 44 |
| 206 | 3300005937 | Ga0081455_10009144 | Ga0081455_100091447 | 44 |
| 207 | 3300005937 | Ga0081455_10183503 | Ga0081455_101835034 | 44 |
| 208 | 3300005937 | Ga0081455_11011973 | Ga0081455_110119732 | 44 |
| 209 | 3300005985 | Ga0081539_10000007 | Ga0081539_10000007112 | 44 |
| 210 | 3300005985 | Ga0081539_10265733 | Ga0081539_102657332 | 44 |
| 211 | 3300006028 | Ga0070717_10036645 | Ga0070717_100366455 | 44 |
| 212 | 3300006051 | Ga0075364_10205878 | Ga0075364_102058782 | 44 |
| 213 | 3300006163 | Ga0070715_10077091 | Ga0070715_100770912 | 44 |
| 214 | 3300006163 | Ga0070715_10241849 | Ga0070715_102418492 | 44 |
| 215 | 3300006173 | Ga0070716_100019529 | Ga0070716_1000195295 | 44 |
| 216 | 3300006173 | Ga0070716_100047162 | Ga0070716_1000471624 | 44 |
| 217 | 3300006173 | Ga0070716_101512196 | Ga0070716_1015121962 | 44 |
| 218 | 3300006175 | Ga0070712_100040536 | Ga0070712_1000405364 | 44 |
| 219 | 3300006175 | Ga0070712_100583070 | Ga0070712_1005830701 | 44 |
| 220 | 3300006186 | Ga0075369_10358224 | Ga0075369_103582242 | 44 |
| 221 | 3300006195 | Ga0075366_10397780 | Ga0075366_103977802 | 44 |
| 222 | 3300006195 | Ga0075366_11065825 | Ga0075366_110658252 | 44 |
| 223 | 3300006237 | Ga0097621_100172832 | Ga0097621_1001728322 | 44 |
| 224 | 3300006237 | Ga0097621_100234457 | Ga0097621_1002344575 | 44 |
| 225 | 3300006237 | Ga0097621_100328057 | Ga0097621_1003280572 | 44 |
| 226 | 3300006237 | Ga0097621_100471259 | Ga0097621_1004712594 | 44 |
| 227 | 3300006237 | Ga0097621_101085435 | Ga0097621_1010854352 | 44 |
| 228 | 3300006237 | Ga0097621_102270138 | Ga0097621_1022701382 | 44 |
| 229 | 3300006353 | Ga0075370_10095999 | Ga0075370_100959991 | 44 |
| 230 | 3300006353 | Ga0075370_10103459 | Ga0075370_101034592 | 44 |
| 231 | 3300006358 | Ga0068871_100075785 | Ga0068871_1000757852 | 44 |
| 232 | 3300006358 | Ga0068871_100146619 | Ga0068871_1001466193 | 44 |
| 233 | 3300006358 | Ga0068871_100205879 | Ga0068871_1002058792 | 44 |
| 234 | 3300006358 | Ga0068871_100467226 | Ga0068871_1004672263 | 44 |
| 235 | 3300006358 | Ga0068871_100967190 | Ga0068871_1009671901 | 44 |
| 236 | 3300006844 | Ga0075428_100002697 | Ga0075428_10000269718 | 44 |
| 237 | 3300006844 | Ga0075428_100741808 | Ga0075428_1007418084 | 44 |
| 238 | 3300006846 | Ga0075430_100224532 | Ga0075430_1002245322 | 44 |
| 239 | 3300006846 | Ga0075430_100471331 | Ga0075430_1004713314 | 44 |
| 240 | 3300006871 | Ga0075434_100246605 | Ga0075434_1002466054 | 44 |
| 241 | 3300006881 | Ga0068865_100056081 | Ga0068865_1000560814 | 44 |
| 242 | 3300006881 | Ga0068865_100507923 | Ga0068865_1005079232 | 44 |
| 243 | 3300006881 | Ga0068865_100543380 | Ga0068865_1005433803 | 44 |
| 244 | 3300006881 | Ga0068865_100647878 | Ga0068865_1006478782 | 44 |
| 245 | 3300006914 | Ga0075436_100145267 | Ga0075436_1001452672 | 44 |
| 246 | 3300006931 | Ga0097620_100026672 | Ga0097620_1000266722 | 44 |
| 247 | 3300006931 | Ga0097620_100203345 | Ga0097620_1002033452 | 44 |
| 248 | 3300006931 | Ga0097620_100456474 | Ga0097620_1004564744 | 44 |
| 249 | 3300006931 | Ga0097620_101375339 | Ga0097620_1013753391 | 44 |
| 250 | 3300007076 | Ga0075435_100143865 | Ga0075435_1001438654 | 44 |
| 251 | 3300007788 | Ga0099795_10000282 | Ga0099795_100002825 | 44 |
| 252 | 3300009093 | Ga0105240_10005799 | Ga0105240_100057993 | 44 |
| 253 | 3300009093 | Ga0105240_10051665 | Ga0105240_100516651 | 44 |
| 254 | 3300009093 | Ga0105240_10174910 | Ga0105240_101749101 | 44 |
| 255 | 3300009093 | Ga0105240_10235256 | Ga0105240_102352563 | 44 |
| 256 | 3300009093 | Ga0105240_12676154 | Ga0105240_126761541 | 44 |
| 257 | 3300009094 | Ga0111539_10207184 | Ga0111539_102071844 | 44 |
| 258 | 3300009094 | Ga0111539_10255994 | Ga0111539_102559944 | 44 |
| 259 | 3300009094 | Ga0111539_11533508 | Ga0111539_115335082 | 44 |
| 260 | 3300009098 | Ga0105245_10374606 | Ga0105245_103746062 | 44 |
| 261 | 3300009098 | Ga0105245_11119519 | Ga0105245_111195193 | 44 |
| 262 | 3300009098 | Ga0105245_11842389 | Ga0105245_118423891 | 44 |
| 263 | 3300009147 | Ga0114129_10012058 | Ga0114129_100120584 | 44 |
| 264 | 3300009148 | Ga0105243_11137592 | Ga0105243_111375922 | 44 |
| 265 | 3300009174 | Ga0105241_11803145 | Ga0105241_118031452 | 44 |
| 266 | 3300009174 | Ga0105241_11940069 | Ga0105241_119400692 | 44 |
| 267 | 3300009176 | Ga0105242_10470967 | Ga0105242_104709672 | 44 |
| 268 | 3300009176 | Ga0105242_10760987 | Ga0105242_107609873 | 44 |
| 269 | 3300009176 | Ga0105242_11176334 | Ga0105242_111763342 | 44 |
| 270 | 3300009177 | Ga0105248_10136603 | Ga0105248_101366034 | 44 |
| 271 | 3300009545 | Ga0105237_10294384 | Ga0105237_102943841 | 44 |
| 272 | 3300009545 | Ga0105237_10448494 | Ga0105237_104484942 | 44 |
| 273 | 3300009545 | Ga0105237_10655183 | Ga0105237_106551833 | 44 |
| 274 | 3300009545 | Ga0105237_11057173 | Ga0105237_110571732 | 44 |
| 275 | 3300009545 | Ga0105237_11600214 | Ga0105237_116002141 | 44 |
| 276 | 3300009551 | Ga0105238_10036079 | Ga0105238_100360793 | 44 |
| 277 | 3300009551 | Ga0105238_10062041 | Ga0105238_100620411 | 44 |
| 278 | 3300009551 | Ga0105238_10124228 | Ga0105238_101242281 | 44 |
| 279 | 3300009551 | Ga0105238_10685246 | Ga0105238_106852462 | 44 |
| 280 | 3300009551 | Ga0105238_12940494 | Ga0105238_129404941 | 44 |
| 281 | 3300009553 | Ga0105249_10431405 | Ga0105249_104314053 | 44 |
| 282 | 3300009553 | Ga0105249_11076291 | Ga0105249_110762912 | 44 |
| 283 | 3300010159 | Ga0099796_10000351 | Ga0099796_100003514 | 44 |
| 284 | 3300010375 | Ga0105239_10005674 | Ga0105239_1000567412 | 44 |
| 285 | 3300010375 | Ga0105239_10011221 | Ga0105239_100112214 | 44 |
| 286 | 3300010375 | Ga0105239_10239173 | Ga0105239_102391731 | 44 |
| 287 | 3300010375 | Ga0105239_10578061 | Ga0105239_105780613 | 44 |
| 288 | 3300010375 | Ga0105239_12274522 | Ga0105239_122745221 | 44 |
| 289 | 3300011119 | Ga0105246_11333597 | Ga0105246_113335972 | 44 |
| 290 | 3300011119 | Ga0105246_12147077 | Ga0105246_121470772 | 44 |
| 291 | 3300013100 | Ga0157373_10872349 | Ga0157373_108723491 | 44 |
| 292 | 3300013104 | Ga0157370_10024850 | Ga0157370_100248503 | 44 |
| 293 | 3300013104 | Ga0157370_10053986 | Ga0157370_100539863 | 44 |
| 294 | 3300013104 | Ga0157370_10276958 | Ga0157370_102769583 | 44 |
| 295 | 3300013104 | Ga0157370_11348601 | Ga0157370_113486011 | 44 |
| 296 | 3300013105 | Ga0157369_10008652 | Ga0157369_100086528 | 44 |
| 297 | 3300013105 | Ga0157369_10027891 | Ga0157369_100278912 | 44 |
| 298 | 3300013105 | Ga0157369_10042967 | Ga0157369_100429674 | 44 |
| 299 | 3300013105 | Ga0157369_10043594 | Ga0157369_100435941 | 44 |
| 300 | 3300013105 | Ga0157369_10218110 | Ga0157369_102181102 | 44 |
| 301 | 3300013296 | Ga0157374_10174061 | Ga0157374_101740612 | 44 |
| 302 | 3300013296 | Ga0157374_10259725 | Ga0157374_102597252 | 44 |
| 303 | 3300013296 | Ga0157374_12649916 | Ga0157374_126499161 | 44 |
| 304 | 3300013297 | Ga0157378_10056476 | Ga0157378_100564763 | 44 |
| 305 | 3300013297 | Ga0157378_10115932 | Ga0157378_101159323 | 44 |
| 306 | 3300013297 | Ga0157378_11645549 | Ga0157378_116455492 | 44 |
| 307 | 3300013297 | Ga0157378_12058916 | Ga0157378_120589162 | 44 |
| 308 | 3300013306 | Ga0163162_13232927 | Ga0163162_132329272 | 44 |
| 309 | 3300013307 | Ga0157372_10108989 | Ga0157372_101089893 | 44 |
| 310 | 3300013307 | Ga0157372_10340299 | Ga0157372_103402992 | 44 |
| 311 | 3300013308 | Ga0157375_10549287 | Ga0157375_105492871 | 44 |
| 312 | 3300013308 | Ga0157375_10774259 | Ga0157375_107742591 | 44 |
| 313 | 3300014325 | Ga0163163_10437165 | Ga0163163_104371653 | 44 |
| 314 | 3300014325 | Ga0163163_13105034 | Ga0163163_131050341 | 44 |
| 315 | 3300014326 | Ga0157380_10012927 | Ga0157380_100129274 | 44 |
| 316 | 3300014326 | Ga0157380_10015948 | Ga0157380_100159482 | 44 |
| 317 | 3300014326 | Ga0157380_10452107 | Ga0157380_104521072 | 44 |
| 318 | 3300014745 | Ga0157377_10449587 | Ga0157377_104495872 | 44 |
| 319 | 3300014968 | Ga0157379_10970303 | Ga0157379_109703032 | 44 |
| 320 | 3300014968 | Ga0157379_12353362 | Ga0157379_123533622 | 44 |
| 321 | 3300014969 | Ga0157376_10150997 | Ga0157376_101509972 | 44 |
| 322 | 3300014969 | Ga0157376_11489396 | Ga0157376_114893962 | 44 |
| 323 | 3300014969 | Ga0157376_12399733 | Ga0157376_123997332 | 44 |
| 324 | 3300014969 | Ga0157376_12857424 | Ga0157376_128574241 | 44 |
| 325 | 3300017792 | Ga0163161_11059262 | Ga0163161_110592622 | 44 |
| 326 | 3300020070 | Ga0206356_11774328 | Ga0206356_117743282 | 44 |
| 327 | 3300020076 | Ga0206355_1088868 | Ga0206355_10888682 | 44 |
| 328 | 3300020082 | Ga0206353_11331178 | Ga0206353_113311781 | 44 |
| 329 | 3300021358 | Ga0213873_10019840 | Ga0213873_100198402 | 44 |
| 330 | 3300021377 | Ga0213874_10005856 | Ga0213874_100058563 | 44 |
| 331 | 3300021377 | Ga0213874_10172082 | Ga0213874_101720822 | 44 |
| 332 | 3300021384 | Ga0213876_10206594 | Ga0213876_102065941 | 44 |
| 333 | 3300021384 | Ga0213876_10235677 | Ga0213876_102356772 | 44 |
| 334 | 3300021388 | Ga0213875_10119915 | Ga0213875_101199152 | 44 |
| 335 | 3300021441 | Ga0213871_10057376 | Ga0213871_100573762 | 44 |
| 336 | 3300021441 | Ga0213871_10072548 | Ga0213871_100725483 | 44 |
| 337 | 3300021441 | Ga0213871_10129833 | Ga0213871_101298331 | 44 |
| 338 | 3300022467 | Ga0224712_10431233 | Ga0224712_104312332 | 44 |
| 339 | 3300025321 | Ga0207656_10000370 | Ga0207656_100003704 | 44 |
| 340 | 3300025893 | Ga0207682_10152043 | Ga0207682_101520432 | 44 |
| 341 | 3300025893 | Ga0207682_10532343 | Ga0207682_105323432 | 44 |
| 342 | 3300025898 | Ga0207692_10069210 | Ga0207692_100692102 | 44 |
| 343 | 3300025898 | Ga0207692_10211770 | Ga0207692_102117702 | 44 |
| 344 | 3300025898 | Ga0207692_10835598 | Ga0207692_108355981 | 44 |
| 345 | 3300025898 | Ga0207692_10840439 | Ga0207692_108404393 | 44 |
| 346 | 3300025899 | Ga0207642_10823791 | Ga0207642_108237912 | 44 |
| 347 | 3300025901 | Ga0207688_10625688 | Ga0207688_106256881 | 44 |
| 348 | 3300025903 | Ga0207680_10684593 | Ga0207680_106845932 | 44 |
| 349 | 3300025904 | Ga0207647_10431481 | Ga0207647_104314812 | 44 |
| 350 | 3300025905 | Ga0207685_10068339 | Ga0207685_100683393 | 44 |
| 351 | 3300025905 | Ga0207685_10082343 | Ga0207685_100823434 | 44 |
| 352 | 3300025906 | Ga0207699_10001988 | Ga0207699_100019886 | 44 |
| 353 | 3300025906 | Ga0207699_10036146 | Ga0207699_100361463 | 44 |
| 354 | 3300025906 | Ga0207699_10545610 | Ga0207699_105456102 | 44 |
| 355 | 3300025907 | Ga0207645_10021794 | Ga0207645_100217944 | 44 |
| 356 | 3300025907 | Ga0207645_10047720 | Ga0207645_100477204 | 44 |
| 357 | 3300025907 | Ga0207645_10316290 | Ga0207645_103162902 | 44 |
| 358 | 3300025908 | Ga0207643_10082801 | Ga0207643_100828012 | 44 |
| 359 | 3300025908 | Ga0207643_10095420 | Ga0207643_100954204 | 44 |
| 360 | 3300025909 | Ga0207705_11229801 | Ga0207705_112298012 | 44 |
| 361 | 3300025911 | Ga0207654_10068226 | Ga0207654_100682263 | 44 |
| 362 | 3300025912 | Ga0207707_10000213 | Ga0207707_1000021330 | 44 |
| 363 | 3300025912 | Ga0207707_10007306 | Ga0207707_1000730610 | 44 |
| 364 | 3300025912 | Ga0207707_10014745 | Ga0207707_100147452 | 44 |
| 365 | 3300025912 | Ga0207707_10020379 | Ga0207707_100203793 | 44 |
| 366 | 3300025912 | Ga0207707_10060237 | Ga0207707_100602373 | 44 |
| 367 | 3300025912 | Ga0207707_10112937 | Ga0207707_101129371 | 44 |
| 368 | 3300025912 | Ga0207707_10168475 | Ga0207707_101684754 | 44 |
| 369 | 3300025912 | Ga0207707_10327100 | Ga0207707_103271003 | 44 |
| 370 | 3300025913 | Ga0207695_10014424 | Ga0207695_100144244 | 44 |
| 371 | 3300025913 | Ga0207695_10014685 | Ga0207695_100146851 | 44 |
| 372 | 3300025913 | Ga0207695_10091957 | Ga0207695_100919572 | 44 |
| 373 | 3300025913 | Ga0207695_10124464 | Ga0207695_101244641 | 44 |
| 374 | 3300025914 | Ga0207671_10064212 | Ga0207671_100642123 | 44 |
| 375 | 3300025914 | Ga0207671_10194204 | Ga0207671_101942043 | 44 |
| 376 | 3300025914 | Ga0207671_10624564 | Ga0207671_106245642 | 44 |
| 377 | 3300025914 | Ga0207671_10651393 | Ga0207671_106513933 | 44 |
| 378 | 3300025914 | Ga0207671_10679451 | Ga0207671_106794512 | 44 |
| 379 | 3300025915 | Ga0207693_10045072 | Ga0207693_100450722 | 44 |
| 380 | 3300025915 | Ga0207693_10133955 | Ga0207693_101339551 | 44 |
| 381 | 3300025915 | Ga0207693_10745490 | Ga0207693_107454902 | 44 |
| 382 | 3300025916 | Ga0207663_10082654 | Ga0207663_100826543 | 44 |
| 383 | 3300025916 | Ga0207663_10182166 | Ga0207663_101821664 | 44 |
| 384 | 3300025916 | Ga0207663_10194963 | Ga0207663_101949633 | 44 |
| 385 | 3300025916 | Ga0207663_10224888 | Ga0207663_102248883 | 44 |
| 386 | 3300025917 | Ga0207660_10012076 | Ga0207660_100120764 | 44 |
| 387 | 3300025917 | Ga0207660_10021999 | Ga0207660_100219991 | 44 |
| 388 | 3300025917 | Ga0207660_10026451 | Ga0207660_100264511 | 44 |
| 389 | 3300025918 | Ga0207662_10245185 | Ga0207662_102451852 | 44 |
| 390 | 3300025920 | Ga0207649_10002528 | Ga0207649_100025283 | 44 |
| 391 | 3300025920 | Ga0207649_11145062 | Ga0207649_111450622 | 44 |
| 392 | 3300025921 | Ga0207652_10006162 | Ga0207652_100061624 | 44 |
| 393 | 3300025921 | Ga0207652_10044577 | Ga0207652_100445774 | 44 |
| 394 | 3300025921 | Ga0207652_10085557 | Ga0207652_100855571 | 44 |
| 395 | 3300025921 | Ga0207652_10231148 | Ga0207652_102311483 | 44 |
| 396 | 3300025923 | Ga0207681_10071969 | Ga0207681_100719694 | 44 |
| 397 | 3300025923 | Ga0207681_10744961 | Ga0207681_107449612 | 44 |
| 398 | 3300025924 | Ga0207694_10071649 | Ga0207694_100716492 | 44 |
| 399 | 3300025924 | Ga0207694_10134634 | Ga0207694_101346343 | 44 |
| 400 | 3300025924 | Ga0207694_10164325 | Ga0207694_101643252 | 44 |
| 401 | 3300025924 | Ga0207694_10193405 | Ga0207694_101934051 | 44 |
| 402 | 3300025924 | Ga0207694_11391148 | Ga0207694_113911482 | 44 |
| 403 | 3300025926 | Ga0207659_10087563 | Ga0207659_100875633 | 44 |
| 404 | 3300025927 | Ga0207687_10401748 | Ga0207687_104017482 | 44 |
| 405 | 3300025928 | Ga0207700_10091906 | Ga0207700_100919062 | 44 |
| 406 | 3300025928 | Ga0207700_10112405 | Ga0207700_101124053 | 44 |
| 407 | 3300025928 | Ga0207700_10236793 | Ga0207700_102367932 | 44 |
| 408 | 3300025929 | Ga0207664_10020147 | Ga0207664_100201474 | 44 |
| 409 | 3300025929 | Ga0207664_10217220 | Ga0207664_102172201 | 44 |
| 410 | 3300025929 | Ga0207664_10277403 | Ga0207664_102774033 | 44 |
| 411 | 3300025929 | Ga0207664_10752809 | Ga0207664_107528093 | 44 |
| 412 | 3300025931 | Ga0207644_10617315 | Ga0207644_106173151 | 44 |
| 413 | 3300025932 | Ga0207690_11135952 | Ga0207690_111359521 | 44 |
| 414 | 3300025933 | Ga0207706_10120388 | Ga0207706_101203883 | 44 |
| 415 | 3300025933 | Ga0207706_10382206 | Ga0207706_103822062 | 44 |
| 416 | 3300025934 | Ga0207686_10043481 | Ga0207686_100434814 | 44 |
| 417 | 3300025934 | Ga0207686_10284565 | Ga0207686_102845653 | 44 |
| 418 | 3300025934 | Ga0207686_10399330 | Ga0207686_103993301 | 44 |
| 419 | 3300025934 | Ga0207686_11180846 | Ga0207686_111808462 | 44 |
| 420 | 3300025936 | Ga0207670_10086237 | Ga0207670_100862372 | 44 |
| 421 | 3300025936 | Ga0207670_11087621 | Ga0207670_110876212 | 44 |
| 422 | 3300025937 | Ga0207669_10115986 | Ga0207669_101159862 | 44 |
| 423 | 3300025937 | Ga0207669_10606015 | Ga0207669_106060152 | 44 |
| 424 | 3300025937 | Ga0207669_10840680 | Ga0207669_108406802 | 44 |
| 425 | 3300025938 | Ga0207704_10185268 | Ga0207704_101852682 | 44 |
| 426 | 3300025938 | Ga0207704_10362282 | Ga0207704_103622822 | 44 |
| 427 | 3300025938 | Ga0207704_11442475 | Ga0207704_114424751 | 44 |
| 428 | 3300025939 | Ga0207665_10064341 | Ga0207665_100643412 | 44 |
| 429 | 3300025939 | Ga0207665_10068196 | Ga0207665_100681963 | 44 |
| 430 | 3300025939 | Ga0207665_11095268 | Ga0207665_110952682 | 44 |
| 431 | 3300025940 | Ga0207691_10017268 | Ga0207691_100172684 | 44 |
| 432 | 3300025940 | Ga0207691_10018434 | Ga0207691_100184344 | 44 |
| 433 | 3300025940 | Ga0207691_10097535 | Ga0207691_100975354 | 44 |
| 434 | 3300025944 | Ga0207661_10057652 | Ga0207661_100576522 | 44 |
| 435 | 3300025944 | Ga0207661_10227524 | Ga0207661_102275242 | 44 |
| 436 | 3300025945 | Ga0207679_10396417 | Ga0207679_103964174 | 44 |
| 437 | 3300025949 | Ga0207667_10000417 | Ga0207667_100004178 | 44 |
| 438 | 3300025949 | Ga0207667_10004450 | Ga0207667_100044507 | 44 |
| 439 | 3300025949 | Ga0207667_10016797 | Ga0207667_100167977 | 44 |
| 440 | 3300025949 | Ga0207667_10244877 | Ga0207667_102448774 | 44 |
| 441 | 3300025949 | Ga0207667_11529482 | Ga0207667_115294821 | 44 |
| 442 | 3300025949 | Ga0207667_12089198 | Ga0207667_120891982 | 44 |
| 443 | 3300025960 | Ga0207651_10057790 | Ga0207651_100577903 | 44 |
| 444 | 3300025960 | Ga0207651_10076087 | Ga0207651_100760872 | 44 |
| 445 | 3300025960 | Ga0207651_10317734 | Ga0207651_103177344 | 44 |
| 446 | 3300025961 | Ga0207712_10128936 | Ga0207712_101289364 | 44 |
| 447 | 3300025972 | Ga0207668_10402796 | Ga0207668_104027963 | 44 |
| 448 | 3300025972 | Ga0207668_11109914 | Ga0207668_111099141 | 44 |
| 449 | 3300025981 | Ga0207640_10017150 | Ga0207640_100171502 | 44 |
| 450 | 3300025981 | Ga0207640_10745333 | Ga0207640_107453332 | 44 |
| 451 | 3300025986 | Ga0207658_12017914 | Ga0207658_120179142 | 44 |
| 452 | 3300026023 | Ga0207677_10602364 | Ga0207677_106023643 | 44 |
| 453 | 3300026035 | Ga0207703_10137721 | Ga0207703_101377212 | 44 |
| 454 | 3300026035 | Ga0207703_11046202 | Ga0207703_110462021 | 44 |
| 455 | 3300026041 | Ga0207639_10001042 | Ga0207639_100010423 | 44 |
| 456 | 3300026041 | Ga0207639_10387857 | Ga0207639_103878571 | 44 |
| 457 | 3300026041 | Ga0207639_11856794 | Ga0207639_118567941 | 44 |
| 458 | 3300026075 | Ga0207708_11861019 | Ga0207708_118610192 | 44 |
| 459 | 3300026078 | Ga0207702_10079829 | Ga0207702_100798292 | 44 |
| 460 | 3300026078 | Ga0207702_10092220 | Ga0207702_100922202 | 44 |
| 461 | 3300026078 | Ga0207702_11326402 | Ga0207702_113264022 | 44 |
| 462 | 3300026088 | Ga0207641_10029602 | Ga0207641_100296024 | 44 |
| 463 | 3300026089 | Ga0207648_10038337 | Ga0207648_100383376 | 44 |
| 464 | 3300026089 | Ga0207648_10353672 | Ga0207648_103536722 | 44 |
| 465 | 3300026089 | Ga0207648_11167679 | Ga0207648_111676792 | 44 |
| 466 | 3300026095 | Ga0207676_10312610 | Ga0207676_103126102 | 44 |
| 467 | 3300026095 | Ga0207676_10815221 | Ga0207676_108152212 | 44 |
| 468 | 3300026116 | Ga0207674_10147374 | Ga0207674_101473743 | 44 |
| 469 | 3300026116 | Ga0207674_10313032 | Ga0207674_103130324 | 44 |
| 470 | 3300026118 | Ga0207675_100074665 | Ga0207675_1000746654 | 44 |
| 471 | 3300026118 | Ga0207675_100084724 | Ga0207675_1000847242 | 44 |
| 472 | 3300026118 | Ga0207675_100244191 | Ga0207675_1002441912 | 44 |
| 473 | 3300026118 | Ga0207675_100253596 | Ga0207675_1002535962 | 44 |
| 474 | 3300026118 | Ga0207675_100541373 | Ga0207675_1005413732 | 44 |
| 475 | 3300026118 | Ga0207675_100608281 | Ga0207675_1006082812 | 44 |
| 476 | 3300026118 | Ga0207675_100618658 | Ga0207675_1006186582 | 44 |
| 477 | 3300026118 | Ga0207675_100844461 | Ga0207675_1008444612 | 44 |
| 478 | 3300026121 | Ga0207683_10278448 | Ga0207683_102784483 | 44 |
| 479 | 3300026121 | Ga0207683_11651289 | Ga0207683_116512891 | 44 |
| 480 | 3300026142 | Ga0207698_10004240 | Ga0207698_100042408 | 44 |
| 481 | 3300026142 | Ga0207698_10640694 | Ga0207698_106406942 | 44 |
| 482 | 3300026142 | Ga0207698_11043519 | Ga0207698_110435192 | 44 |
| 483 | 3300026142 | Ga0207698_11738529 | Ga0207698_117385292 | 44 |
| 484 | 3300027395 | Ga0209996_1026242 | Ga0209996_10262422 | 44 |
| 485 | 3300027462 | Ga0210000_1062558 | Ga0210000_10625581 | 44 |
| 486 | 3300027512 | Ga0209179_1000011 | Ga0209179_100001112 | 44 |
| 487 | 3300027614 | Ga0209970_1014213 | Ga0209970_10142132 | 44 |
| 488 | 3300027617 | Ga0210002_1042785 | Ga0210002_10427852 | 44 |
| 489 | 3300027665 | Ga0209983_1025191 | Ga0209983_10251912 | 44 |
| 490 | 3300027682 | Ga0209971_1003831 | Ga0209971_10038312 | 44 |
| 491 | 3300027907 | Ga0207428_10073761 | Ga0207428_100737612 | 44 |
| 492 | 3300028379 | Ga0268266_10008271 | Ga0268266_100082713 | 44 |
| 493 | 3300028379 | Ga0268266_10019127 | Ga0268266_100191274 | 44 |
| 494 | 3300028379 | Ga0268266_10285364 | Ga0268266_102853642 | 44 |
| 495 | 3300028379 | Ga0268266_10289921 | Ga0268266_102899213 | 44 |
| 496 | 3300028379 | Ga0268266_11337733 | Ga0268266_113377332 | 44 |
| 497 | 3300028379 | Ga0268266_12335084 | Ga0268266_123350841 | 44 |
| 498 | 3300028380 | Ga0268265_10049380 | Ga0268265_100493804 | 44 |
| 499 | 3300028380 | Ga0268265_10162718 | Ga0268265_101627182 | 44 |
| 500 | 3300028380 | Ga0268265_10187412 | Ga0268265_101874124 | 44 |
| 501 | 3300028380 | Ga0268265_10273390 | Ga0268265_102733902 | 44 |
| 502 | 3300028380 | Ga0268265_10598796 | Ga0268265_105987962 | 44 |
| 503 | 3300028380 | Ga0268265_11729258 | Ga0268265_117292582 | 44 |
| 504 | 3300028381 | Ga0268264_10234722 | Ga0268264_102347224 | 44 |
| 505 | 3300028381 | Ga0268264_12282993 | Ga0268264_122829931 | 44 |
| 506 | 3300028786 | Ga0307517_10628206 | Ga0307517_106282061 | 44 |
| 507 | 3300028794 | Ga0307515_10448584 | Ga0307515_104485842 | 44 |
| 508 | 3300031090 | Ga0265760_10132502 | Ga0265760_101325022 | 44 |
| 509 | 3300031235 | Ga0265330_10003651 | Ga0265330_100036512 | 44 |
| 510 | 3300031238 | Ga0265332_10013547 | Ga0265332_100135474 | 44 |
| 511 | 3300031241 | Ga0265325_10052553 | Ga0265325_100525534 | 44 |
| 512 | 3300031247 | Ga0265340_10000356 | Ga0265340_100003569 | 44 |
| 513 | 3300031247 | Ga0265340_10002297 | Ga0265340_100022976 | 44 |
| 514 | 3300031247 | Ga0265340_10026230 | Ga0265340_100262302 | 44 |
| 515 | 3300031250 | Ga0265331_10010679 | Ga0265331_100106792 | 44 |
| 516 | 3300031250 | Ga0265331_10053274 | Ga0265331_100532742 | 44 |
| 517 | 3300031344 | Ga0265316_10000146 | Ga0265316_1000014645 | 44 |
| 518 | 3300031344 | Ga0265316_10005304 | Ga0265316_100053044 | 44 |
| 519 | 3300031344 | Ga0265316_10019427 | Ga0265316_100194278 | 44 |
| 520 | 3300031344 | Ga0265316_10143604 | Ga0265316_101436044 | 44 |
| 521 | 3300031456 | Ga0307513_10860728 | Ga0307513_108607282 | 44 |
| 522 | 3300031507 | Ga0307509_10391286 | Ga0307509_103912862 | 44 |
| 523 | 3300031548 | Ga0307408_100014096 | Ga0307408_1000140966 | 44 |
| 524 | 3300031548 | Ga0307408_100199178 | Ga0307408_1001991782 | 44 |
| 525 | 3300031548 | Ga0307408_100243515 | Ga0307408_1002435152 | 44 |
| 526 | 3300031595 | Ga0265313_10011164 | Ga0265313_100111647 | 44 |
| 527 | 3300031711 | Ga0265314_10018561 | Ga0265314_100185618 | 44 |
| 528 | 3300031711 | Ga0265314_10020776 | Ga0265314_100207764 | 44 |
| 529 | 3300031711 | Ga0265314_10034849 | Ga0265314_100348492 | 44 |
| 530 | 3300031712 | Ga0265342_10009625 | Ga0265342_100096257 | 44 |
| 531 | 3300031728 | Ga0316578_10056067 | Ga0316578_100560673 | 44 |
| 532 | 3300031730 | Ga0307516_10027775 | Ga0307516_100277754 | 44 |
| 533 | 3300031731 | Ga0307405_10003677 | Ga0307405_100036772 | 44 |
| 534 | 3300031731 | Ga0307405_10100758 | Ga0307405_101007582 | 44 |
| 535 | 3300031731 | Ga0307405_10343032 | Ga0307405_103430322 | 44 |
| 536 | 3300031824 | Ga0307413_10099863 | Ga0307413_100998633 | 44 |
| 537 | 3300031824 | Ga0307413_11325960 | Ga0307413_113259601 | 44 |
| 538 | 3300031852 | Ga0307410_10087072 | Ga0307410_100870722 | 44 |
| 539 | 3300031852 | Ga0307410_10147680 | Ga0307410_101476802 | 44 |
| 540 | 3300031852 | Ga0307410_10249791 | Ga0307410_102497912 | 44 |
| 541 | 3300031901 | Ga0307406_10008451 | Ga0307406_100084516 | 44 |
| 542 | 3300031901 | Ga0307406_10127370 | Ga0307406_101273702 | 44 |
| 543 | 3300031903 | Ga0307407_10071208 | Ga0307407_100712082 | 44 |
| 544 | 3300031903 | Ga0307407_10484863 | Ga0307407_104848632 | 44 |
| 545 | 3300031911 | Ga0307412_10865391 | Ga0307412_108653912 | 44 |
| 546 | 3300031995 | Ga0307409_100089593 | Ga0307409_1000895932 | 44 |
| 547 | 3300031995 | Ga0307409_100180885 | Ga0307409_1001808852 | 44 |
| 548 | 3300031995 | Ga0307409_100339220 | Ga0307409_1003392202 | 44 |
| 549 | 3300031995 | Ga0307409_101444270 | Ga0307409_1014442702 | 44 |
| 550 | 3300032002 | Ga0307416_100017839 | Ga0307416_1000178392 | 44 |
| 551 | 3300032002 | Ga0307416_100056976 | Ga0307416_1000569762 | 44 |
| 552 | 3300032002 | Ga0307416_100787918 | Ga0307416_1007879182 | 44 |
| 553 | 3300032004 | Ga0307414_10416850 | Ga0307414_104168502 | 44 |
| 554 | 3300032004 | Ga0307414_10704840 | Ga0307414_107048401 | 44 |
| 555 | 3300032004 | Ga0307414_10879792 | Ga0307414_108797922 | 44 |
| 556 | 3300032005 | Ga0307411_10010900 | Ga0307411_100109002 | 44 |
| 557 | 3300032005 | Ga0307411_10231863 | Ga0307411_102318632 | 44 |
| 558 | 3300032005 | Ga0307411_10551300 | Ga0307411_105513001 | 44 |
| 559 | 3300032126 | Ga0307415_100010480 | Ga0307415_1000104803 | 44 |
| 560 | 3300032126 | Ga0307415_100044945 | Ga0307415_1000449454 | 44 |
| 561 | 3300032126 | Ga0307415_100559809 | Ga0307415_1005598092 | 44 |
| 562 | 3300032126 | Ga0307415_101853842 | Ga0307415_1018538422 | 44 |
| 563 | 3300032168 | Ga0316593_10013972 | Ga0316593_100139723 | 44 |
| 564 | 3300032168 | Ga0316593_10050031 | Ga0316593_100500313 | 44 |
| 565 | 3300035086 | Ga0373934_0028694 | Ga0373934_0028694_1038_1172 | 44 |
| 566 | 3300035111 | Ga0373923_0217042 | Ga0373923_0217042_83_217 | 44 |
| 567 | 3300035113 | Ga0373936_0305206 | Ga0373936_0305206_185_319 | 44 |
| 568 | 3300035116 | Ga0373945_0159125 | Ga0373945_0159125_32_166 | 44 |
| 569 | 3300035117 | Ga0373953_0131990 | Ga0373953_0131990_40_174 | 44 |
| 570 | 3300035117 | Ga0373953_0292554 | Ga0373953_0292554_268_402 | 44 |
| 571 | 3300035118 | Ga0373954_0011589 | Ga0373954_0011589_990_1124 | 44 |
| 572 | 3300035119 | Ga0373956_0068388 | Ga0373956_0068388_347_481 | 44 |
| 573 | 3300035119 | Ga0373956_0103361 | Ga0373956_0103361_1104_1238 | 44 |
| 574 | 3300035120 | Ga0373957_0087056 | Ga0373957_0087056_440_574 | 44 |
| 575 | 3300035171 | Ga0373946_0037368 | Ga0373946_0037368_1164_1298 | 44 |
| 576 | 3300035171 | Ga0373946_0084106 | Ga0373946_0084106_199_333 | 44 |
| 577 | 3300035172 | Ga0373955_0363998 | Ga0373955_0363998_50_184 | 44 |
| 578 | 3300035241 | Ga0373961_0327814 | Ga0373961_0327814_96_230 | 44 |
| 579 | 3300035398 | Ga0316574_0125189 | Ga0316574_0125189_631_786 | 44 |
| 580 | 3300035398 | Ga0316574_0872616 | Ga0316574_0872616_329_463 | 44 |
| 581 | 3300035691 | Ga0373931_1084408 | Ga0373931_1084408_116_250 | 44 |
| 582 | 3300035692 | Ga0373935_0113584 | Ga0373935_0113584_1328_1462 | 44 |
| 583 | 3300035695 | Ga0373927_0293847 | Ga0373927_0293847_423_557 | 44 |
| 584 | 3300035695 | Ga0373927_0745948 | Ga0373927_0745948_111_245 | 44 |
| 585 | 3300035724 | Ga0373933_0013068 | Ga0373933_0013068_3160_3294 | 44 |
| 586 | 3300035724 | Ga0373933_0302952 | Ga0373933_0302952_645_779 | 44 |
| 587 | 3300035725 | Ga0373947_0106191 | Ga0373947_0106191_143_277 | 44 |
| 588 | 3300035725 | Ga0373947_0532529 | Ga0373947_0532529_565_699 | 44 |
| 589 | 3300036401 | Ga0373937_0003538 | Ga0373937_0003538_1048_1182 | 44 |
| 590 | 3300036401 | Ga0373937_0158586 | Ga0373937_0158586_1389_1523 | 44 |
| 591 | 3300036401 | Ga0373937_0373072 | Ga0373937_0373072_294_428 | 44 |
| 592 | 3300036401 | Ga0373937_1472491 | Ga0373937_1472491_464_598 | 44 |
| 593 | 3300036401 | Ga0373937_1869959 | Ga0373937_1869959_142_276 | 44 |
| 594 | 3300036647 | Ga0316582_0054406 | Ga0316582_0054406_2188_2322 | 44 |
| 595 | 3300036647 | Ga0316582_0648356 | Ga0316582_0648356_474_608 | 44 |
| 596 | 3300037312 | Ga0395899_0593172 | Ga0395899_0593172_127_261 | 44 |
| 597 | 3300037418 | Ga0395900_0062660 | Ga0395900_0062660_536_670 | 44 |
| 598 | 3300037418 | Ga0395900_0233243 | Ga0395900_0233243_1025_1159 | 44 |
| 599 | 3300037466 | Ga0395898_0034073 | Ga0395898_0034073_99_233 | 44 |
| 600 | 3300037466 | Ga0395898_0163271 | Ga0395898_0163271_1267_1401 | 44 |
| 601 | 3300037466 | Ga0395898_0584594 | Ga0395898_0584594_92_226 | 44 |
| 602 | 3300037471 | Ga0395905_0379781 | Ga0395905_0379781_762_896 | 44 |
| 603 | 3300037853 | Ga0436364_0422126 | Ga0436364_0422126_124_258 | 44 |
| 604 | 3300037853 | Ga0436364_0507816 | Ga0436364_0507816_378_512 | 44 |
| 605 | 3300038443 | Ga0395901_0235546 | Ga0395901_0235546_659_793 | 44 |
| 606 | 3300038443 | Ga0395901_1035192 | Ga0395901_1035192_224_358 | 44 |
| 607 | 3300038443 | Ga0395901_1495614 | Ga0395901_1495614_417_551 | 44 |
| 608 | 3300038726 | Ga0400490_27866 | Ga0400490_27866_25731_25865 | 44 |
| 609 | 3300038741 | Ga0400488_14628 | Ga0400488_14628_2943_3077 | 44 |
| 610 | 3300038741 | Ga0400488_36631 | Ga0400488_36631_13_147 | 44 |
| 611 | 3300038741 | Ga0400488_39676 | Ga0400488_39676_2977_3111 | 44 |
| 612 | 3300038741 | Ga0400488_62698 | Ga0400488_62698_826_960 | 44 |
| 613 | 3300038742 | Ga0400486_29232 | Ga0400486_29232_278_412 | 44 |
| 614 | 3300039062 | Ga0400483_007661 | Ga0400483_007661_8097_8231 | 44 |
| 615 | 3300039062 | Ga0400483_031605 | Ga0400483_031605_1127_1261 | 44 |
| 616 | 3300039062 | Ga0400483_059913 | Ga0400483_059913_1180_1314 | 44 |
| 617 | 3300039062 | Ga0400483_091647 | Ga0400483_091647_5143_5277 | 44 |
| 618 | 3300039062 | Ga0400483_122739 | Ga0400483_122739_21490_21624 | 44 |
| 619 | 3300039062 | Ga0400483_165155 | Ga0400483_165155_3434_3568 | 44 |
| 620 | 3300039062 | Ga0400483_167560 | Ga0400483_167560_390_524 | 44 |
| 621 | 3300039062 | Ga0400483_269614 | Ga0400483_269614_7403_7537 | 44 |
| 622 | 3300039062 | Ga0400483_286327 | Ga0400483_286327_12534_12668 | 44 |
| 623 | 3300039110 | Ga0400487_51472 | Ga0400487_51472_3605_3739 | 44 |
| 624 | 3300039437 | Ga0436365_0990718 | Ga0436365_0990718_204_338 | 44 |
| 625 | 3300039437 | Ga0436365_1123454 | Ga0436365_1123454_193_327 | 44 |
| 626 | 3300039437 | Ga0436365_1829985 | Ga0436365_1829985_638_772 | 44 |
| 627 | 3300039438 | Ga0436360_0230968 | Ga0436360_0230968_496_630 | 44 |
| 628 | 3300039438 | Ga0436360_0249274 | Ga0436360_0249274_387_521 | 44 |
| 629 | 3300039438 | Ga0436360_0846674 | Ga0436360_0846674_344_478 | 44 |
| 630 | 3300039438 | Ga0436360_0887930 | Ga0436360_0887930_436_570 | 44 |
| 631 | 3300039438 | Ga0436360_1157685 | Ga0436360_1157685_7097_7231 | 44 |
| 632 | 3300039447 | Ga0436361_0275763 | Ga0436361_0275763_70_204 | 44 |
| 633 | 3300039450 | Ga0436363_0040943 | Ga0436363_0040943_980_1114 | 44 |
| 634 | 3300039450 | Ga0436363_0073651 | Ga0436363_0073651_1227_1361 | 44 |
| 635 | 3300039450 | Ga0436363_0117506 | Ga0436363_0117506_2623_2757 | 44 |
| 636 | 3300039450 | Ga0436363_0382304 | Ga0436363_0382304_337_471 | 44 |
| 637 | 3300039450 | Ga0436363_0553853 | Ga0436363_0553853_95_229 | 44 |
| 638 | 3300039453 | Ga0436362_0751592 | Ga0436362_0751592_3831_3965 | 44 |
| 639 | 3300039453 | Ga0436362_1213266 | Ga0436362_1213266_163_297 | 44 |
| 640 | 3300041406 | Ga0439439_0027133 | Ga0439439_0027133_414_566 | 44 |
| 641 | 3300041408 | Ga0439453_0006516 | Ga0439453_0006516_144_296 | 44 |
| 642 | 3300041410 | Ga0439461_0002922 | Ga0439461_0002922_1579_1731 | 44 |
| 643 | 3300041410 | Ga0439461_0143519 | Ga0439461_0143519_225_359 | 44 |
| 644 | 3300041411 | Ga0439466_0162554 | Ga0439466_0162554_169_303 | 44 |
| 645 | 3300041413 | Ga0439465_0042626 | Ga0439465_0042626_205_342 | 44 |
| 646 | 3300041413 | Ga0439465_0051976 | Ga0439465_0051976_1057_1194 | 44 |
| 647 | 3300041413 | Ga0439465_0052220 | Ga0439465_0052220_956_1090 | 44 |
| 648 | 3300041451 | Ga0451791_0349922 | Ga0451791_0349922_13_147 | 44 |
| 649 | 3300041452 | Ga0451793_1904977 | Ga0451793_1904977_168_305 | 44 |
| 650 | 3300041456 | Ga0451795_0207582 | Ga0451795_0207582_294_428 | 44 |
| 651 | 3300041458 | Ga0451798_0531086 | Ga0451798_0531086_339_473 | 44 |
| 652 | 3300041463 | Ga0451804_0349009 | Ga0451804_0349009_114_248 | 44 |
| 653 | 3300041486 | Ga0451807_1912619 | Ga0451807_1912619_147_281 | 44 |
| 654 | 3300041496 | Ga0451839_1253933 | Ga0451839_1253933_104_241 | 44 |
| 655 | 3300041496 | Ga0451839_1368483 | Ga0451839_1368483_125_259 | 44 |
| 656 | 3300041511 | Ga0451855_0421856 | Ga0451855_0421856_290_424 | 44 |
| 657 | 3300041512 | Ga0451853_2078235 | Ga0451853_2078235_366_500 | 44 |
| 658 | 3300041512 | Ga0451853_3356625 | Ga0451853_3356625_65_199 | 44 |
| 659 | 3300041997 | Ga0439431_0132112 | Ga0439431_0132112_413_547 | 44 |
| 660 | 3300041997 | Ga0439431_0265471 | Ga0439431_0265471_33_167 | 44 |
| 661 | 3300041999 | Ga0439433_0020103 | Ga0439433_0020103_1324_1476 | 44 |
| 662 | 3300042001 | Ga0439441_004293 | Ga0439441_004293_159_293 | 44 |
| 663 | 3300042003 | Ga0439443_002580 | Ga0439443_002580_977_1129 | 44 |
| 664 | 3300042004 | Ga0439445_0189597 | Ga0439445_0189597_145_297 | 44 |
| 665 | 3300042004 | Ga0439445_0201043 | Ga0439445_0201043_441_575 | 44 |
| 666 | 3300042007 | Ga0439449_0315167 | Ga0439449_0315167_82_219 | 44 |
| 667 | 3300042009 | Ga0439451_039226 | Ga0439451_039226_456_608 | 44 |
| 668 | 3300042009 | Ga0439451_093501 | Ga0439451_093501_20_154 | 44 |
| 669 | 3300042011 | Ga0439454_060004 | Ga0439454_060004_454_606 | 44 |
| 670 | 3300042013 | Ga0439456_006559 | Ga0439456_006559_1499_1651 | 44 |
| 671 | 3300042122 | Ga0450920_002594 | Ga0450920_002594_729_881 | 44 |
| 672 | 3300042125 | Ga0450923_068802 | Ga0450923_068802_565_717 | 44 |
| 673 | 3300042126 | Ga0450888_036244 | Ga0450888_036244_112_261 | 44 |
| 674 | 3300042127 | Ga0450890_083627 | Ga0450890_083627_54_188 | 44 |
| 675 | 3300042133 | Ga0450896_012716 | Ga0450896_012716_648_800 | 44 |
| 676 | 3300042145 | Ga0450906_012735 | Ga0450906_012735_284_436 | 44 |
| 677 | 3300042156 | Ga0439446_0000175 | Ga0439446_0000175_8495_8647 | 44 |
| 678 | 3300042184 | Ga0450908_015155 | Ga0450908_015155_760_912 | 44 |
| 679 | 3300042435 | Ga0439434_0012351 | Ga0439434_0012351_605_757 | 44 |
| 680 | 3300042436 | Ga0439435_0006278 | Ga0439435_0006278_1499_1651 | 44 |
| 681 | 3300042437 | Ga0439444_0005437 | Ga0439444_0005437_693_845 | 44 |
| 682 | 3300042438 | Ga0439459_0102331 | Ga0439459_0102331_300_434 | 44 |
| 683 | 3300042461 | Ga0439460_0004358 | Ga0439460_0004358_1968_2120 | 44 |
| 684 | 3300042876 | Ga0451577_0090855 | Ga0451577_0090855_432_578 | 44 |
| 685 | 3300042876 | Ga0451577_0098888 | Ga0451577_0098888_517_669 | 44 |
| 686 | 3300042876 | Ga0451577_0104390 | Ga0451577_0104390_2121_2255 | 44 |
| 687 | 3300042876 | Ga0451577_1196362 | Ga0451577_1196362_58_213 | 44 |
| 688 | 3300042876 | Ga0451577_1795478 | Ga0451577_1795478_220_354 | 44 |
| 689 | 3300044656 | Ga0466969_0007341 | Ga0466969_0007341_5318_5452 | 44 |
| 690 | 3300044656 | Ga0466969_0024727 | Ga0466969_0024727_2253_2387 | 44 |
| 691 | 3300044658 | Ga0466972_0020775 | Ga0466972_0020775_1812_1946 | 44 |
| 692 | 3300044673 | Ga0453683_0484486 | Ga0453683_0484486_153_287 | 44 |
| 693 | 3300044683 | Ga0466965_0191666 | Ga0466965_0191666_379_516 | 44 |
| 694 | 3300044684 | Ga0466966_0000557 | Ga0466966_0000557_13683_13817 | 44 |
| 695 | 3300044693 | Ga0466961_0001702 | Ga0466961_0001702_1454_1588 | 44 |
| 696 | 3300044694 | Ga0466963_0476448 | Ga0466963_0476448_130_264 | 44 |
| 697 | 3300044706 | Ga0466964_0000388 | Ga0466964_0000388_11815_11949 | 44 |
| 698 | 3300044712 | Ga0453684_0634960 | Ga0453684_0634960_887_1039 | 44 |
| 699 | 3300044712 | Ga0453684_1247006 | Ga0453684_1247006_616_750 | 44 |
| 700 | 3300044712 | Ga0453684_1476662 | Ga0453684_1476662_378_527 | 44 |
| 701 | 3300044719 | Ga0466971_0003199 | Ga0466971_0003199_6027_6161 | 44 |
| 702 | 3300044735 | Ga0466968_0041783 | Ga0466968_0041783_318_452 | 44 |
| 703 | 3300044735 | Ga0466968_0159575 | Ga0466968_0159575_80_214 | 44 |
| 704 | 3300044765 | Ga0466970_0001729 | Ga0466970_0001729_9881_10015 | 44 |
| 705 | 3300044842 | Ga0466957_0053853 | Ga0466957_0053853_1489_1623 | 44 |
| 706 | 3300044842 | Ga0466957_0187747 | Ga0466957_0187747_276_410 | 44 |
| 707 | 3300044901 | Ga0466960_0407238 | Ga0466960_0407238_478_612 | 44 |
| 708 | 3300044901 | Ga0466960_0909614 | Ga0466960_0909614_118_252 | 44 |
| 709 | 3300045049 | Ga0466959_0008813 | Ga0466959_0008813_2542_2676 | 44 |
| 710 | 3300045049 | Ga0466959_0055230 | Ga0466959_0055230_126_260 | 44 |
| 711 | 3300045051 | Ga0451576_0002405 | Ga0451576_0002405_6098_6250 | 44 |
| 712 | 3300045051 | Ga0451576_0367046 | Ga0451576_0367046_920_1072 | 44 |
| 713 | 3300045051 | Ga0451576_0686299 | Ga0451576_0686299_536_682 | 44 |
| 714 | 3300045051 | Ga0451576_0728125 | Ga0451576_0728125_138_287 | 44 |
| 715 | 3300045976 | Ga0466967_1252470 | Ga0466967_1252470_338_472 | 44 |
| 716 | 3300046452 | Ga0495617_166210 | Ga0495617_166210_168_302 | 44 |
| 717 | 3300046460 | Ga0495638_0358370 | Ga0495638_0358370_98_232 | 44 |
| 718 | 3300046472 | Ga0495580_0019287 | Ga0495580_0019287_4918_5052 | 44 |
| 719 | 3300046491 | Ga0495584_0594405 | Ga0495584_0594405_328_462 | 44 |
| 720 | 3300046500 | Ga0495596_0335844 | Ga0495596_0335844_249_383 | 44 |
| 721 | 3300046513 | Ga0495616_0217093 | Ga0495616_0217093_307_441 | 44 |
| 722 | 3300046536 | Ga0495587_0156491 | Ga0495587_0156491_685_819 | 44 |
| 723 | 3300046543 | Ga0495645_0271530 | Ga0495645_0271530_121_255 | 44 |
| 724 | 3300046660 | Ga0495625_0906652 | Ga0495625_0906652_109_243 | 44 |
| 725 | 3300046679 | Ga0495623_0338001 | Ga0495623_0338001_384_518 | 44 |
| 726 | 3300046683 | Ga0495658_0900844 | Ga0495658_0900844_69_203 | 44 |
| 727 | 3300046691 | Ga0495670_0732512 | Ga0495670_0732512_13_147 | 44 |
| 728 | 3300046692 | Ga0495671_0111247 | Ga0495671_0111247_684_818 | 44 |
| 729 | 3300046809 | Ga0495600_0326181 | Ga0495600_0326181_56_190 | 44 |
| 730 | 3300046809 | Ga0495600_0558619 | Ga0495600_0558619_28_162 | 44 |
| 731 | 3300047317 | Ga0495604_0585522 | Ga0495604_0585522_37_171 | 44 |
| 732 | 3300047317 | Ga0495604_0731825 | Ga0495604_0731825_466_600 | 44 |
| 733 | 3300047319 | Ga0495674_0515779 | Ga0495674_0515779_649_783 | 44 |
| 734 | 3300047444 | Ga0495675_0263904 | Ga0495675_0263904_499_633 | 44 |
| 735 | 3300047469 | Ga0495673_0157680 | Ga0495673_0157680_47_181 | 44 |
| 736 | 3300047472 | Ga0495686_0064522 | Ga0495686_0064522_1701_1835 | 44 |
| 737 | 3300047472 | Ga0495686_0212396 | Ga0495686_0212396_805_939 | 44 |
| 738 | 3300048088 | Ga0495602_0655096 | Ga0495602_0655096_408_542 | 44 |
| 739 | 3300048903 | Ga0496100_1063393 | Ga0496100_1063393_83_217 | 44 |
| 740 | 3300048904 | Ga0496101_0073290 | Ga0496101_0073290_145_279 | 44 |
| 741 | 3300048904 | Ga0496101_0332802 | Ga0496101_0332802_449_583 | 44 |
| 742 | 3300048904 | Ga0496101_1549729 | Ga0496101_1549729_151_324 | 44 |
| 743 | 3300048905 | Ga0496102_0046953 | Ga0496102_0046953_2080_2214 | 44 |
| 744 | 3300048907 | Ga0496104_0014145 | Ga0496104_0014145_3987_4121 | 44 |
| 745 | 3300048907 | Ga0496104_0202644 | Ga0496104_0202644_983_1117 | 44 |
| 746 | 3300048907 | Ga0496104_0775416 | Ga0496104_0775416_45_179 | 44 |
| 747 | 3300048908 | Ga0496105_0016438 | Ga0496105_0016438_3063_3197 | 44 |
| 748 | 3300048908 | Ga0496105_0364564 | Ga0496105_0364564_542_676 | 44 |
| 749 | 3300048909 | Ga0496106_0061455 | Ga0496106_0061455_1430_1564 | 44 |
| 750 | 3300048909 | Ga0496106_0150760 | Ga0496106_0150760_685_819 | 44 |
| 751 | 3300048910 | Ga0496107_0102183 | Ga0496107_0102183_1145_1279 | 44 |
| 752 | 3300048910 | Ga0496107_0385291 | Ga0496107_0385291_571_705 | 44 |
| 753 | 3300048911 | Ga0496108_0026214 | Ga0496108_0026214_1759_1893 | 44 |
| 754 | 3300048911 | Ga0496108_0287555 | Ga0496108_0287555_220_354 | 44 |
| 755 | 3300048911 | Ga0496108_0846070 | Ga0496108_0846070_48_221 | 44 |
| 756 | 3300048912 | Ga0496109_0419264 | Ga0496109_0419264_274_408 | 44 |
| 757 | 3300048912 | Ga0496109_1909461 | Ga0496109_1909461_282_416 | 44 |
| 758 | 3300048913 | Ga0496110_0002929 | Ga0496110_0002929_4910_5044 | 44 |
| 759 | 3300048913 | Ga0496110_0009323 | Ga0496110_0009323_4898_5032 | 44 |
| 760 | 3300048914 | Ga0496111_0198764 | Ga0496111_0198764_779_913 | 44 |
| 761 | 3300048914 | Ga0496111_1175382 | Ga0496111_1175382_266_400 | 44 |
| 762 | 3300048915 | Ga0496112_0166803 | Ga0496112_0166803_1157_1291 | 44 |
| 763 | 3300048915 | Ga0496112_0876384 | Ga0496112_0876384_606_740 | 44 |
| 764 | 3300048916 | Ga0496113_0074417 | Ga0496113_0074417_28_162 | 44 |
| 765 | 3300048917 | Ga0496114_0065909 | Ga0496114_0065909_1272_1406 | 44 |
| 766 | 3300048917 | Ga0496114_0255873 | Ga0496114_0255873_1383_1517 | 44 |
| 767 | 3300048917 | Ga0496114_1060247 | Ga0496114_1060247_328_462 | 44 |
| 768 | 3300048918 | Ga0496115_0655405 | Ga0496115_0655405_289_423 | 44 |
| 769 | 3300048919 | Ga0496116_0037032 | Ga0496116_0037032_694_867 | 44 |
| 770 | 3300048920 | Ga0496117_0008275 | Ga0496117_0008275_1795_1968 | 44 |
| 771 | 3300048920 | Ga0496117_0416497 | Ga0496117_0416497_104_238 | 44 |
| 772 | 3300048921 | Ga0496118_0009209 | Ga0496118_0009209_8009_8182 | 44 |
| 773 | 3300048921 | Ga0496118_0131646 | Ga0496118_0131646_1023_1196 | 44 |
| 774 | 3300048922 | Ga0496119_0001089 | Ga0496119_0001089_29341_29475 | 44 |
| 775 | 3300048922 | Ga0496119_0136119 | Ga0496119_0136119_133_267 | 44 |
| 776 | 3300048924 | Ga0496121_0000246 | Ga0496121_0000246_106700_106873 | 44 |
| 777 | 3300048924 | Ga0496121_0067412 | Ga0496121_0067412_1484_1618 | 44 |
| 778 | 3300048924 | Ga0496121_0358467 | Ga0496121_0358467_671_805 | 44 |
| 779 | 3300048925 | Ga0496122_0021783 | Ga0496122_0021783_1544_1678 | 44 |
| 780 | 3300048925 | Ga0496122_0056325 | Ga0496122_0056325_1301_1474 | 44 |
| 781 | 3300048926 | Ga0496123_0009931 | Ga0496123_0009931_4043_4177 | 44 |
| 782 | 3300048926 | Ga0496123_0022057 | Ga0496123_0022057_2104_2277 | 44 |
| 783 | 3300048927 | Ga0496124_0307293 | Ga0496124_0307293_158_331 | 44 |
| 784 | 3300048928 | Ga0496125_0054673 | Ga0496125_0054673_421_594 | 44 |
| 785 | 3300048929 | Ga0496126_0021917 | Ga0496126_0021917_5262_5435 | 44 |
| 786 | 3300048929 | Ga0496126_0562605 | Ga0496126_0562605_201_338 | 44 |
| 787 | 3300049569 | Ga0501032_0499105 | Ga0501032_0499105_558_692 | 44 |
| 788 | 3300049569 | Ga0501032_0565924 | Ga0501032_0565924_77_211 | 44 |
| 789 | 3300049571 | Ga0501034_0005650 | Ga0501034_0005650_892_1026 | 44 |
| 790 | 3300049571 | Ga0501034_0082117 | Ga0501034_0082117_1298_1432 | 44 |
| 791 | 3300049571 | Ga0501034_0194858 | Ga0501034_0194858_1367_1501 | 44 |
| 792 | 3300049571 | Ga0501034_0535765 | Ga0501034_0535765_681_818 | 44 |
| 793 | 3300049571 | Ga0501034_1455585 | Ga0501034_1455585_167_301 | 44 |
| 794 | 3300049573 | Ga0501037_0644236 | Ga0501037_0644236_296_445 | 44 |
| 795 | 3300049574 | Ga0501038_0642748 | Ga0501038_0642748_421_555 | 44 |
| 796 | 3300049575 | Ga0501039_1505163 | Ga0501039_1505163_251_385 | 44 |
| 797 | 3300049576 | Ga0501040_0001085 | Ga0501040_0001085_10672_10806 | 44 |
| 798 | 3300049576 | Ga0501040_0394066 | Ga0501040_0394066_717_851 | 44 |
| 799 | 3300049576 | Ga0501040_0952130 | Ga0501040_0952130_98_232 | 44 |
| 800 | 3300049577 | Ga0501041_0646736 | Ga0501041_0646736_501_635 | 44 |
| 801 | 3300049578 | Ga0501042_0051340 | Ga0501042_0051340_772_906 | 44 |
| 802 | 3300049578 | Ga0501042_0079004 | Ga0501042_0079004_1873_2007 | 44 |
| 803 | 3300049581 | Ga0501047_0196075 | Ga0501047_0196075_558_716 | 44 |
| 804 | 3300049581 | Ga0501047_0428432 | Ga0501047_0428432_1003_1140 | 44 |
| 805 | 3300049583 | Ga0501067_0023609 | Ga0501067_0023609_2123_2257 | 44 |
| 806 | 3300049584 | Ga0501068_0023531 | Ga0501068_0023531_555_689 | 44 |
| 807 | 3300049584 | Ga0501068_0299546 | Ga0501068_0299546_715_849 | 44 |
| 808 | 3300049584 | Ga0501068_0536066 | Ga0501068_0536066_92_226 | 44 |
| 809 | 3300049585 | Ga0501069_0029799 | Ga0501069_0029799_2522_2656 | 44 |
| 810 | 3300049586 | Ga0501070_0719371 | Ga0501070_0719371_97_231 | 44 |
| 811 | 3300049586 | Ga0501070_0833247 | Ga0501070_0833247_495_629 | 44 |
| 812 | 3300049587 | Ga0501071_0007964 | Ga0501071_0007964_6297_6431 | 44 |
| 813 | 3300049587 | Ga0501071_0497418 | Ga0501071_0497418_402_536 | 44 |
| 814 | 3300049587 | Ga0501071_0736179 | Ga0501071_0736179_407_541 | 44 |
| 815 | 3300049588 | Ga0501072_0030078 | Ga0501072_0030078_3812_3946 | 44 |
| 816 | 3300049588 | Ga0501072_0527385 | Ga0501072_0527385_123_257 | 44 |
| 817 | 3300049589 | Ga0501073_0002828 | Ga0501073_0002828_11959_12093 | 44 |
| 818 | 3300049589 | Ga0501073_0069437 | Ga0501073_0069437_1693_1827 | 44 |
| 819 | 3300049589 | Ga0501073_0930978 | Ga0501073_0930978_174_326 | 44 |
| 820 | 3300049589 | Ga0501073_1071818 | Ga0501073_1071818_166_300 | 44 |
| 821 | 3300049590 | Ga0501074_0000646 | Ga0501074_0000646_17309_17443 | 44 |
| 822 | 3300049590 | Ga0501074_0210573 | Ga0501074_0210573_230_364 | 44 |
| 823 | 3300049590 | Ga0501074_0464069 | Ga0501074_0464069_693_827 | 44 |
| 824 | 3300049590 | Ga0501074_0637863 | Ga0501074_0637863_398_532 | 44 |
| 825 | 3300049590 | Ga0501074_0658354 | Ga0501074_0658354_474_608 | 44 |
| 826 | 3300049591 | Ga0501075_0079029 | Ga0501075_0079029_417_551 | 44 |
| 827 | 3300049592 | Ga0501076_0020771 | Ga0501076_0020771_2226_2360 | 44 |
| 828 | 3300049592 | Ga0501076_0109716 | Ga0501076_0109716_1524_1658 | 44 |
| 829 | 3300049592 | Ga0501076_0332817 | Ga0501076_0332817_1031_1165 | 44 |
| 830 | 3300049592 | Ga0501076_0485682 | Ga0501076_0485682_186_320 | 44 |
| 831 | 3300049593 | Ga0501077_0019747 | Ga0501077_0019747_417_551 | 44 |
| 832 | 3300049593 | Ga0501077_0123178 | Ga0501077_0123178_1099_1233 | 44 |
| 833 | 3300049741 | Ga0501079_0026230 | Ga0501079_0026230_1601_1735 | 44 |
| 834 | 3300049741 | Ga0501079_0062681 | Ga0501079_0062681_2235_2369 | 44 |
| 835 | 3300049741 | Ga0501079_1244395 | Ga0501079_1244395_83_217 | 44 |
| 836 | 3300049742 | Ga0501080_0005283 | Ga0501080_0005283_5759_5893 | 44 |
| 837 | 3300049742 | Ga0501080_0131776 | Ga0501080_0131776_979_1113 | 44 |
| 838 | 3300049742 | Ga0501080_0636451 | Ga0501080_0636451_258_392 | 44 |
| 839 | 3300049743 | Ga0501081_0002762 | Ga0501081_0002762_2589_2723 | 44 |
| 840 | 3300049743 | Ga0501081_0634303 | Ga0501081_0634303_280_414 | 44 |
| 841 | 3300049743 | Ga0501081_0756212 | Ga0501081_0756212_558_692 | 44 |
| 842 | 3300049743 | Ga0501081_1137776 | Ga0501081_1137776_205_339 | 44 |
| 843 | 3300049744 | Ga0501083_0222212 | Ga0501083_0222212_1028_1162 | 44 |
| 844 | 3300049744 | Ga0501083_0263413 | Ga0501083_0263413_476_610 | 44 |
| 845 | 3300049822 | Ga0501035_0130925 | Ga0501035_0130925_749_955 | 44 |
| 846 | 3300049823 | Ga0501044_0126154 | Ga0501044_0126154_1494_1628 | 44 |
| 847 | 3300049823 | Ga0501044_0258868 | Ga0501044_0258868_567_773 | 44 |
| 848 | 3300049823 | Ga0501044_0287534 | Ga0501044_0287534_754_948 | 44 |
| 849 | 3300049823 | Ga0501044_0944226 | Ga0501044_0944226_472_606 | 44 |
| 850 | 3300049824 | Ga0501045_0594073 | Ga0501045_0594073_534_695 | 44 |
| 851 | 3300049824 | Ga0501045_0750882 | Ga0501045_0750882_514_648 | 44 |
| 852 | 3300049824 | Ga0501045_1423634 | Ga0501045_1423634_131_280 | 44 |
| 853 | 3300050489 | nmdc:mga03683_345695_c1 | nmdc:mga03683_345695_c1_543_677 | 44 |
| 854 | 3300050491 | nmdc:mga00v17_482375_c1 | nmdc:mga00v17_482375_c1_210_347 | 44 |
| 855 | 3300050491 | nmdc:mga00v17_733365_c1 | nmdc:mga00v17_733365_c1_374_508 | 44 |
| 856 | 3300050493 | nmdc:mga0k408_694415_c1 | nmdc:mga0k408_694415_c1_360_494 | 44 |
| 857 | 3300050496 | nmdc:mga07m45_526252_c1 | nmdc:mga07m45_526252_c1_52_189 | 44 |
| 858 | 3300050496 | nmdc:mga07m45_567688_c1 | nmdc:mga07m45_567688_c1_283_417 | 44 |
| 859 | 3300050496 | nmdc:mga07m45_682052_c1 | nmdc:mga07m45_682052_c1_190_327 | 44 |
| 860 | 3300050507 | nmdc:mga05p37_63902_c1 | nmdc:mga05p37_63902_c1_981_1133 | 44 |
| 861 | 3300050509 | nmdc:mga0qj67_165290_c1 | nmdc:mga0qj67_165290_c1_998_1132 | 44 |
| 862 | 3300050509 | nmdc:mga0qj67_535010_c1 | nmdc:mga0qj67_535010_c1_575_715 | 44 |
| 863 | 3300050511 | nmdc:mga08y16_11753_c1 | nmdc:mga08y16_11753_c1_935_1087 | 44 |
| 864 | 3300050511 | nmdc:mga08y16_123582_c1 | nmdc:mga08y16_123582_c1_1011_1145 | 44 |
| 865 | 3300050511 | nmdc:mga08y16_1470419_c1 | nmdc:mga08y16_1470419_c1_35_169 | 44 |
| 866 | 3300050511 | nmdc:mga08y16_515024_c1 | nmdc:mga08y16_515024_c1_684_818 | 44 |
| 867 | 3300050512 | nmdc:mga0n895_255548_c1 | nmdc:mga0n895_255548_c1_1384_1518 | 44 |
| 868 | 3300050513 | nmdc:mga0rr50_118408_c1 | nmdc:mga0rr50_118408_c1_288_422 | 44 |
| 869 | 3300050514 | nmdc:mga08x19_265181_c1 | nmdc:mga08x19_265181_c1_857_991 | 44 |
| 870 | 3300050516 | nmdc:mga0sz30_144664_c2 | nmdc:mga0sz30_144664_c2_84_218 | 44 |
| 871 | 3300050516 | nmdc:mga0sz30_222956_c1 | nmdc:mga0sz30_222956_c1_505_678 | 44 |
| 872 | 3300053078 | Ga0495612_0082790 | Ga0495612_0082790_979_1113 | 44 |
| 873 | 3300053084 | Ga0495595_0392205 | Ga0495595_0392205_362_496 | 44 |
| 874 | 3300053085 | Ga0495619_0295000 | Ga0495619_0295000_165_299 | 44 |
| 875 | 3300053087 | Ga0500643_006566 | Ga0500643_006566_3260_3409 | 44 |
| 876 | 3300053087 | Ga0500643_179186 | Ga0500643_179186_372_506 | 44 |
| 877 | 3300053088 | Ga0500644_0118743 | Ga0500644_0118743_580_714 | 44 |
| 878 | 3300053092 | Ga0500583_0001730 | Ga0500583_0001730_754_888 | 44 |
| 879 | 3300053092 | Ga0500583_0003168 | Ga0500583_0003168_609_743 | 44 |
| 880 | 3300053093 | Ga0500651_0457249 | Ga0500651_0457249_330_464 | 44 |
| 881 | 3300053096 | Ga0500641_0018311 | Ga0500641_0018311_2473_2607 | 44 |
| 882 | 3300053096 | Ga0500641_0170442 | Ga0500641_0170442_413_547 | 44 |
| 883 | 3300053104 | Ga0500556_0000033 | Ga0500556_0000033_76179_76313 | 44 |
| 884 | 3300053104 | Ga0500556_0000549 | Ga0500556_0000549_20764_20898 | 44 |
| 885 | 3300053104 | Ga0500556_0016484 | Ga0500556_0016484_1282_1416 | 44 |
| 886 | 3300053105 | Ga0500557_158173 | Ga0500557_158173_301_435 | 44 |
| 887 | 3300053108 | Ga0500562_000202 | Ga0500562_000202_2674_2808 | 44 |
| 888 | 3300053108 | Ga0500562_035872 | Ga0500562_035872_615_749 | 44 |
| 889 | 3300053108 | Ga0500562_145305 | Ga0500562_145305_14_151 | 44 |
| 890 | 3300053118 | Ga0500594_0024949 | Ga0500594_0024949_1096_1230 | 44 |
| 891 | 3300053118 | Ga0500594_0122285 | Ga0500594_0122285_77_211 | 44 |
| 892 | 3300053119 | Ga0500595_034889 | Ga0500595_034889_476_610 | 44 |
| 893 | 3300053120 | Ga0500597_174709 | Ga0500597_174709_521_655 | 44 |
| 894 | 3300053124 | Ga0500617_107312 | Ga0500617_107312_971_1105 | 44 |
| 895 | 3300053130 | Ga0500642_0034856 | Ga0500642_0034856_1032_1166 | 44 |
| 896 | 3300053131 | Ga0500652_079453 | Ga0500652_079453_377_511 | 44 |
| 897 | 3300053134 | Ga0500658_0045506 | Ga0500658_0045506_453_587 | 44 |
| 898 | 3300053136 | Ga0500559_0432702 | Ga0500559_0432702_269_403 | 44 |
| 899 | 3300053137 | Ga0500561_0028843 | Ga0500561_0028843_43_177 | 44 |
| 900 | 3300053139 | Ga0500568_0007280 | Ga0500568_0007280_673_822 | 44 |
| 901 | 3300053139 | Ga0500568_0051166 | Ga0500568_0051166_454_591 | 44 |
| 902 | 3300053139 | Ga0500568_0087516 | Ga0500568_0087516_538_672 | 44 |
| 903 | 3300053139 | Ga0500568_0124194 | Ga0500568_0124194_581_715 | 44 |
| 904 | 3300053142 | Ga0500577_0472368 | Ga0500577_0472368_242_376 | 44 |
| 905 | 3300053146 | Ga0500588_0001229 | Ga0500588_0001229_1282_1416 | 44 |
| 906 | 3300053147 | Ga0500589_188077 | Ga0500589_188077_443_577 | 44 |
| 907 | 3300053151 | Ga0500604_0105037 | Ga0500604_0105037_637_771 | 44 |
| 908 | 3300053153 | Ga0500616_0000074 | Ga0500616_0000074_116390_116524 | 44 |
| 909 | 3300053158 | Ga0500627_0226470 | Ga0500627_0226470_635_769 | 44 |
| 910 | 3300053160 | Ga0500633_0125810 | Ga0500633_0125810_413_547 | 44 |
| 911 | 3300053177 | Ga0500636_0252685 | Ga0500636_0252685_656_790 | 44 |
| 912 | 3300053178 | Ga0500637_0000804 | Ga0500637_0000804_5243_5377 | 44 |
| 913 | 3300053730 | Ga0500645_004392 | Ga0500645_004392_4023_4157 | 44 |
| 914 | 3300053732 | Ga0500656_003331 | Ga0500656_003331_1296_1430 | 44 |
| 915 | 3300053733 | Ga0500552_056537 | Ga0500552_056537_114_248 | 44 |
| 916 | 3300053735 | Ga0500596_107189 | Ga0500596_107189_82_216 | 44 |
| 917 | 3300054114 | Ga0501084_0005783 | Ga0501084_0005783_706_840 | 44 |
| 918 | 3300054114 | Ga0501084_0008467 | Ga0501084_0008467_6869_7003 | 44 |
| 919 | 3300054114 | Ga0501084_1333813 | Ga0501084_1333813_46_180 | 44 |
| 920 | 3300059492 | Ga0587073_0242058 | Ga0587073_0242058_337_471 | 44 |
| 921 | 3300059503 | Ga0587080_081482 | Ga0587080_081482_84_218 | 44 |
| 922 | 3300059505 | Ga0587083_0171740 | Ga0587083_0171740_337_471 | 44 |
| 923 | 3300059505 | Ga0587083_0226268 | Ga0587083_0226268_387_521 | 44 |
| 924 | 3300059508 | Ga0587088_084173 | Ga0587088_084173_461_595 | 44 |
| 925 | 3300059509 | Ga0587089_086309 | Ga0587089_086309_50_184 | 44 |
| 926 | 3300059510 | Ga0587090_079888 | Ga0587090_079888_68_202 | 44 |
| 927 | 3300059607 | Ga0587125_032488 | Ga0587125_032488_508_642 | 44 |
| 928 | 3300059630 | Ga0587128_020797 | Ga0587128_020797_799_933 | 44 |
| 929 | 3300059640 | Ga0587067_091641 | Ga0587067_091641_87_221 | 44 |
| 930 | 3300059643 | Ga0587072_114274 | Ga0587072_114274_451_585 | 44 |
| 931 | 3300059645 | Ga0587076_064033 | Ga0587076_064033_547_681 | 44 |
| 932 | 3300059647 | Ga0587079_145504 | Ga0587079_145504_94_228 | 44 |
| 933 | 3300059652 | Ga0587107_037040 | Ga0587107_037040_546_680 | 44 |
| 934 | 3300060346 | Ga0587111_0061349 | Ga0587111_0061349_88_222 | 44 |
| 935 | 3300060346 | Ga0587111_0115460 | Ga0587111_0115460_515_649 | 44 |
| 936 | 3300060353 | Ga0501082_0005773 | Ga0501082_0005773_9034_9168 | 44 |
| 937 | 3300060353 | Ga0501082_0077802 | Ga0501082_0077802_2239_2373 | 44 |
| 938 | 3300060353 | Ga0501082_0438602 | Ga0501082_0438602_25_159 | 44 |
| 939 | 3300060353 | Ga0501082_1126860 | Ga0501082_1126860_444_578 | 44 |
| 940 | 3300060353 | Ga0501082_1255458 | Ga0501082_1255458_195_329 | 44 |
| 941 | 3300061719 | Ga0466962_0000690 | Ga0466962_0000690_3288_3422 | 44 |
| 942 | 3300061719 | Ga0466962_0182138 | Ga0466962_0182138_541_675 | 44 |
| 943 | 3300061734 | Ga0530510_0447788 | Ga0530510_0447788_524_676 | 44 |
| 944 | 3300061734 | Ga0530510_0578340 | Ga0530510_0578340_458_592 | 44 |
| 945 | 3300061734 | Ga0530510_1076071 | Ga0530510_1076071_99_233 | 44 |
| 946 | 3300061734 | Ga0530510_1162525 | Ga0530510_1162525_345_479 | 44 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5j5b-assembly1.cif.gz_D3 | structure of the wt e coli ribosome bound to tetracycline | 0.6587 | 1 | 35 |
| 5j91-assembly2.cif.gz_C3 | structure of the wild-type 70s e coli ribosome bound to tigecycline | 0.6542 | 1 | 35 |
| 6wda-assembly1.cif.gz_D | cryo-em of elongating ribosome with ef-tu*gtp elucidates trna proofreading (cognate structure iii-c) | 0.6512 | 1 | 35 |
| 7bv8-assembly1.cif.gz_d | mature 50s ribosomal subunit from rrmj knock out e.coli strain | 0.6489 | 1 | 35 |
| 6gb2-assembly1.cif.gz_B7 | unique features of mammalian mitochondrial translation initiation revealed by cryo-em. this file contains the 39s ribosomal subunit. | 0.6473 | 1 | 35 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3oat200 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.6648 | 1 | 35 | 1.10.287.3980 |
| 3i1n200 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.6631 | 1 | 35 | 1.10.287.3980 |
| 1vw4Y00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.6445 | 1 | 35 | 1.10.287.3980 |
| 3j7y200 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.6436 | 2 | 35 | 1.10.287.3980 |
| 5dm7200 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.64 | 1 | 35 | 1.10.287.3980 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S4WMJ6-F1-model_v4 | deleted | 0.8788 | 1 | 25 |
|
| AF-A0A7W2GEI9-F1-model_v4 | deleted | 0.8253 | 1 | 26 |
|
| AF-A0A7K0RYU2-F1-model_v4 | Large ribosomal subunit protein bL34 (50S ribosomal protein L34) | 0.8124 | 1 | 25 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7W2GEI9-F1-model_v4 | deleted | 0.8034 | 1 | 26 |
|
| AF-A0A2H0PZA1-F1-model_v4 | Large ribosomal subunit protein bL34 (50S ribosomal protein L34) | 0.8023 | 1 | 25 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar