F486450

General Info

Members Datasets Scaffolds Average Seq Length
946 458 946 45

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_102270138|Ga0097621_1022701382
Length 54
Sequence LPAFSGALLTMKRTYQPSKLRRKRTHGFRARMATKNGRKVLARRRSKGRKKLIP

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
129 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
133 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
206 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
207 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
208 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
209 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
210 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
211 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
212 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
215 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
216 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
217 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
218 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
219 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
220 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
221 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
222 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
223 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
224 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
225 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
226 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
227 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
230 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
232 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
233 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
235 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
236 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
237 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
238 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
239 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
240 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
241 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
242 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
243 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
244 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
246 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
247 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
248 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
249 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
250 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
257 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
258 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
259 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
260 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
261 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
262 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
263 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
264 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
265 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
266 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
267 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
268 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
269 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
270 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
271 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
272 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
273 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
274 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
275 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
276 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
277 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
278 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
279 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
280 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
281 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
282 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
283 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
284 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
285 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
286 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
287 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
288 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
289 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
290 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
291 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
292 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
293 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
294 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
295 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
296 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
297 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
298 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
299 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
300 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
301 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
302 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
303 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
304 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
305 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
306 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
307 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
308 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
309 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
310 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
311 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
312 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
313 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
314 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
315 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
316 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
317 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
318 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
319 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
320 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
321 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
322 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
323 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
324 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
325 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
326 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
327 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
328 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
329 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
330 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
331 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
332 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
333 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
334 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
335 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
336 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
337 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
338 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
339 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
340 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
341 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
342 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
343 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
344 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
345 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
346 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
347 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
348 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
349 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
350 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
351 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
352 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
353 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
354 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
355 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
356 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
357 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
358 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
359 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
360 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
361 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
362 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
363 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
364 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
365 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
379 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
380 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
381 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
382 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
383 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
384 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
385 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
386 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
387 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
388 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
389 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
390 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
391 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
392 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
393 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
396 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
397 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
398 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
399 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
400 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
401 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
402 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
403 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
404 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
405 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
406 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
407 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
408 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
409 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
410 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
411 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
412 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
413 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
414 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
415 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
416 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
417 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
418 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
419 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
420 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
421 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
422 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
423 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
424 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
425 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
426 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
427 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
428 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
429 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
430 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
431 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
432 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
433 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
434 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
435 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
436 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
437 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
438 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
439 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
440 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
441 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
442 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
457 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
458 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.57
Metatranscriptomes 2.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.66
Nodule 0
Rhizoplane 3.81
Rhizosphere 83.19
Stem 0
Stem Tuber 0
Unclassified 6.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10046276 3300003187 Bacteria 1526
2 JGI25406J46586_10015769 3300003203 Bacteria 3174
3 rootH1_10118379 3300003323 Bacteria 1250
4 Ga0055538_1000206 3300003751 Bacteria 35313
5 Ga0055538_1000658 3300003751 Bacteria 10939
6 Ga0055536_1041917 3300003781 Bacteria 1075
7 Ga0055536_1066973 3300003781 Bacteria 722
8 Ga0055536_1089251 3300003781 Bacteria 570
9 JGI25405J52794_10027349 3300003911 Bacteria 1174
10 Ga0065712_10248897 3300005290 Unclassified 965
11 Ga0070658_10935262 3300005327 Unclassified 754
12 Ga0070676_10156234 3300005328 Bacteria 1464
13 Ga0070676_11394173 3300005328 Bacteria 537
14 Ga0070676_11502862 3300005328 Unclassified 519
15 Ga0070683_100054413 3300005329 Bacteria 3711
16 Ga0070683_100192791 3300005329 Unclassified 1935
17 Ga0070690_100003231 3300005330 Bacteria 8892
18 Ga0070690_100009245 3300005330 Bacteria 5704
19 Ga0070670_100067271 3300005331 Bacteria 3074
20 Ga0070670_100320063 3300005331 Bacteria 1359
21 Ga0070670_100992146 3300005331 Unclassified 764
22 Ga0070677_10143081 3300005333 Bacteria 1105
23 Ga0070666_10845613 3300005335 Unclassified 675
24 Ga0070680_100025820 3300005336 Bacteria 4697
25 Ga0070680_100093099 3300005336 Bacteria 2496
26 Ga0070680_100879634 3300005336 Bacteria 773
27 Ga0070680_101699098 3300005336 Bacteria 547
28 Ga0070682_101551654 3300005337 Unclassified 571
29 Ga0068868_100931770 3300005338 Bacteria 791
30 Ga0070689_100010982 3300005340 Bacteria 6472
31 Ga0070689_101638495 3300005340 Unclassified 585
32 Ga0070691_10140828 3300005341 Bacteria 1229
33 Ga0070687_100447103 3300005343 Unclassified 859
34 Ga0070661_100000183 3300005344 Bacteria 51585
35 Ga0070661_100376717 3300005344 Unclassified 1118
36 Ga0070661_100455303 3300005344 Unclassified 1018
37 Ga0070661_100562570 3300005344 Bacteria 919
38 Ga0070692_10898304 3300005345 Bacteria 612
39 Ga0070668_100235981 3300005347 Bacteria 1513
40 Ga0070668_100636238 3300005347 Bacteria 936
41 Ga0070669_100512739 3300005353 Bacteria 996
42 Ga0070669_100998965 3300005353 Unclassified 718
43 Ga0070675_100111925 3300005354 Bacteria 2311
44 Ga0070671_100058258 3300005355 Bacteria 3216
45 Ga0070671_101094650 3300005355 Unclassified 700
46 Ga0070671_101398364 3300005355 Unclassified 618
47 Ga0070671_102056739 3300005355 Bacteria 509
48 Ga0070674_100016413 3300005356 Bacteria 4640
49 Ga0070673_100049769 3300005364 Bacteria 3273
50 Ga0070673_100099806 3300005364 Bacteria 2389
51 Ga0070673_101111246 3300005364 Bacteria 739
52 Ga0070673_101504916 3300005364 Unclassified 635
53 Ga0070688_100039439 3300005365 Bacteria 2890
54 Ga0070688_100164909 3300005365 Bacteria 1525
55 Ga0070659_100114447 3300005366 Bacteria 2179
56 Ga0070659_101567723 3300005366 Unclassified 588
57 Ga0070709_10002110 3300005434 Bacteria 10759
58 Ga0070709_10025676 3300005434 Bacteria 3483
59 Ga0070709_10345689 3300005434 Unclassified 1098
60 Ga0070714_100026296 3300005435 Bacteria 4809
61 Ga0070714_100118183 3300005435 Bacteria 2355
62 Ga0070714_100201334 3300005435 Bacteria 1821
63 Ga0070714_102395599 3300005435 Unclassified 513
64 Ga0070713_100032340 3300005436 Bacteria 4177
65 Ga0070713_100095748 3300005436 Bacteria 2562
66 Ga0070713_100272792 3300005436 Bacteria 1549
67 Ga0070713_101228603 3300005436 Unclassified 725
68 Ga0070710_10074514 3300005437 Bacteria 1965
69 Ga0070710_10138473 3300005437 Bacteria 1490
70 Ga0070710_10474736 3300005437 Bacteria 852
71 Ga0070710_10543033 3300005437 Unclassified 802
72 Ga0070710_10580617 3300005437 Bacteria 778
73 Ga0070701_10044575 3300005438 Bacteria 2272
74 Ga0070701_10114596 3300005438 Bacteria 1511
75 Ga0070701_10119681 3300005438 Bacteria 1482
76 Ga0070701_10200321 3300005438 Bacteria 1180
77 Ga0070701_10354570 3300005438 Bacteria 917
78 Ga0070711_100016582 3300005439 Bacteria 4679
79 Ga0070711_100049836 3300005439 Bacteria 2868
80 Ga0070711_100054931 3300005439 Bacteria 2750
81 Ga0070711_100116010 3300005439 Bacteria 1973
82 Ga0070711_101179453 3300005439 Bacteria 662
83 Ga0070705_100019745 3300005440 Bacteria 3552
84 Ga0070705_101265511 3300005440 Bacteria 610
85 Ga0070700_100054830 3300005441 Bacteria 2493
86 Ga0070694_100254155 3300005444 Bacteria 1330
87 Ga0070708_100923735 3300005445 Bacteria 819
88 Ga0070663_100341735 3300005455 Bacteria 1210
89 Ga0070678_100117275 3300005456 Bacteria 2093
90 Ga0070678_100798040 3300005456 Unclassified 857
91 Ga0070662_100317973 3300005457 Bacteria 1269
92 Ga0070662_100568302 3300005457 Bacteria 951
93 Ga0070681_10003033 3300005458 Bacteria 15561
94 Ga0070681_10019166 3300005458 Bacteria 6847
95 Ga0070681_10034405 3300005458 Bacteria 5087
96 Ga0070681_10034982 3300005458 Bacteria 5045
97 Ga0070681_10061388 3300005458 Bacteria 3734
98 Ga0068867_101271684 3300005459 Bacteria 678
99 Ga0070685_10101524 3300005466 Bacteria 1757
100 Ga0070685_10449132 3300005466 Unclassified 903
101 Ga0070707_101680682 3300005468 Bacteria 602
102 Ga0070699_100041632 3300005518 Bacteria 3976
103 Ga0070679_100007660 3300005530 Bacteria 10108
104 Ga0070679_100029196 3300005530 Bacteria 5440
105 Ga0070679_100037832 3300005530 Bacteria 4795
106 Ga0070679_100059089 3300005530 Bacteria 3822
107 Ga0070679_100602641 3300005530 Unclassified 1042
108 Ga0070684_100041728 3300005535 Bacteria 3958
109 Ga0070684_100367116 3300005535 Bacteria 1325
110 Ga0070684_100919822 3300005535 Bacteria 820
111 Ga0070684_101424555 3300005535 Unclassified 653
112 Ga0070697_101333618 3300005536 Bacteria 640
113 Ga0068853_100033553 3300005539 Bacteria 4356
114 Ga0068853_100252784 3300005539 Bacteria 1618
115 Ga0068853_101373932 3300005539 Bacteria 683
116 Ga0068853_102262481 3300005539 Unclassified 527
117 Ga0070672_100030659 3300005543 Bacteria 4042
118 Ga0070672_100061996 3300005543 Bacteria 2950
119 Ga0070672_100102000 3300005543 Bacteria 2328
120 Ga0070672_101458839 3300005543 Unclassified 613
121 Ga0070672_101652855 3300005543 Bacteria 575
122 Ga0070686_100525269 3300005544 Bacteria 922
123 Ga0070695_100021853 3300005545 Bacteria 3920
124 Ga0070695_100390108 3300005545 Bacteria 1053
125 Ga0070696_100094393 3300005546 Bacteria 2135
126 Ga0070693_100054417 3300005547 Bacteria 2302
127 Ga0070693_100302233 3300005547 Bacteria 1079
128 Ga0070693_101564081 3300005547 Bacteria 517
129 Ga0070665_100009741 3300005548 Bacteria 9715
130 Ga0070665_100344014 3300005548 Unclassified 1496
131 Ga0070665_100483203 3300005548 Bacteria 1249
132 Ga0070665_101156760 3300005548 Unclassified 785
133 Ga0070665_101766514 3300005548 Unclassified 625
134 Ga0070704_100106234 3300005549 Bacteria 2127
135 Ga0068855_100000188 3300005563 Bacteria 79535
136 Ga0068855_100004121 3300005563 Bacteria 17722
137 Ga0068855_100033609 3300005563 Bacteria 6119
138 Ga0068855_100343487 3300005563 Bacteria 1645
139 Ga0068855_102078530 3300005563 Bacteria 572
140 Ga0068855_102190585 3300005563 Unclassified 555
141 Ga0070664_101588348 3300005564 Unclassified 619
142 Ga0068857_100350725 3300005577 Bacteria 1366
143 Ga0068857_101124729 3300005577 Bacteria 759
144 Ga0068854_100062432 3300005578 Bacteria 2701
145 Ga0068854_100659430 3300005578 Bacteria 899
146 Ga0068856_100108527 3300005614 Bacteria 2772
147 Ga0068856_100213608 3300005614 Bacteria 1944
148 Ga0070702_100011240 3300005615 Bacteria 4446
149 Ga0068852_100025840 3300005616 Bacteria 4764
150 Ga0068852_100762310 3300005616 Bacteria 980
151 Ga0068852_101077044 3300005616 Bacteria 824
152 Ga0068859_100026672 3300005617 Bacteria 5794
153 Ga0068859_100203345 3300005617 Bacteria 2065
154 Ga0068859_100456496 3300005617 Bacteria 1374
155 Ga0068859_101375822 3300005617 Unclassified 778
156 Ga0068864_101069930 3300005618 Unclassified 802
157 Ga0068866_10201315 3300005718 Bacteria 1190
158 Ga0068861_100033657 3300005719 Bacteria 3783
159 Ga0068861_100055843 3300005719 Bacteria 3012
160 Ga0068861_100079169 3300005719 Bacteria 2568
161 Ga0068861_100129233 3300005719 Bacteria 2048
162 Ga0068861_100242654 3300005719 Bacteria 1533
163 Ga0068861_100418873 3300005719 Bacteria 1193
164 Ga0068861_100912097 3300005719 Bacteria 833
165 Ga0068851_10000624 3300005834 Bacteria 15079
166 Ga0068870_10019332 3300005840 Bacteria 3303
167 Ga0068870_10030584 3300005840 Bacteria 2722
168 Ga0068863_100025727 3300005841 Bacteria 5613
169 Ga0068863_100031365 3300005841 Bacteria 5072
170 Ga0068863_100414435 3300005841 Unclassified 1319
171 Ga0068858_100268235 3300005842 Bacteria 1624
172 Ga0068858_100415704 3300005842 Bacteria 1293
173 Ga0068860_100286937 3300005843 Bacteria 1609
174 Ga0068860_100774913 3300005843 Bacteria 972
175 Ga0068862_100043148 3300005844 Bacteria 3844
176 Ga0068862_100138133 3300005844 Bacteria 2161
177 Ga0068862_100180570 3300005844 Bacteria 1894
178 Ga0068862_100273738 3300005844 Unclassified 1545
179 Ga0068862_100305677 3300005844 Bacteria 1464
180 Ga0068862_100362944 3300005844 Unclassified 1346
181 Ga0068862_100583577 3300005844 Bacteria 1071
182 Ga0081455_10003146 3300005937 Bacteria 19189
183 Ga0081455_10009144 3300005937 Bacteria 10217
184 Ga0081455_10183503 3300005937 Unclassified 1582
185 Ga0081455_11011973 3300005937 Bacteria 514
186 Ga0081539_10000007 3300005985 Bacteria 532790
187 Ga0081539_10265733 3300005985 Bacteria 754
188 Ga0070717_10036645 3300006028 Bacteria 3979
189 Ga0075364_10205878 3300006051 Bacteria 1334
190 Ga0070715_10077091 3300006163 Bacteria 1504
191 Ga0070715_10241849 3300006163 Bacteria 939
192 Ga0070716_100019529 3300006173 Bacteria 3543
193 Ga0070716_100047162 3300006173 Bacteria 2429
194 Ga0070716_101512196 3300006173 Bacteria 549
195 Ga0070712_100040536 3300006175 Bacteria 3193
196 Ga0070712_100583070 3300006175 Bacteria 945
197 Ga0075369_10358224 3300006186 Bacteria 685
198 Ga0075366_10397780 3300006195 Bacteria 848
199 Ga0075366_11065825 3300006195 Unclassified 505
200 Ga0097621_100172832 3300006237 Bacteria 1863
201 Ga0097621_100234457 3300006237 Bacteria 1603
202 Ga0097621_100328057 3300006237 Bacteria 1357
203 Ga0097621_100471259 3300006237 Bacteria 1134
204 Ga0097621_101085435 3300006237 Bacteria 751
205 Ga0097621_102270138 3300006237 Bacteria 519
206 Ga0075370_10095999 3300006353 Bacteria 1713
207 Ga0075370_10103459 3300006353 Bacteria 1650
208 Ga0068871_100075785 3300006358 Bacteria 2777
209 Ga0068871_100146619 3300006358 Bacteria 2010
210 Ga0068871_100205879 3300006358 Bacteria 1700
211 Ga0068871_100467226 3300006358 Bacteria 1133
212 Ga0068871_100967190 3300006358 Bacteria 792
213 Ga0075428_100002697 3300006844 Bacteria 19313
214 Ga0075428_100741808 3300006844 Bacteria 1045
215 Ga0075430_100224532 3300006846 Bacteria 1558
216 Ga0075430_100471331 3300006846 Bacteria 1036
217 Ga0075434_100246605 3300006871 Unclassified 1806
218 Ga0068865_100056081 3300006881 Unclassified 2744
219 Ga0068865_100507923 3300006881 Bacteria 1006
220 Ga0068865_100543380 3300006881 Unclassified 975
221 Ga0068865_100647878 3300006881 Bacteria 897
222 Ga0075436_100145267 3300006914 Bacteria 1668
223 Ga0097620_100026672 3300006931 Bacteria 5794
224 Ga0097620_100203345 3300006931 Bacteria 2065
225 Ga0097620_100456474 3300006931 Bacteria 1374
226 Ga0097620_101375339 3300006931 Unclassified 778
227 Ga0075435_100143865 3300007076 Unclassified 2002
228 Ga0099795_10000282 3300007788 Bacteria 9108
229 Ga0105240_10005799 3300009093 Bacteria 18318
230 Ga0105240_10051665 3300009093 Bacteria 5171
231 Ga0105240_10174910 3300009093 Unclassified 2539
232 Ga0105240_10235256 3300009093 Bacteria 2126
233 Ga0105240_12676154 3300009093 Unclassified 515
234 Ga0111539_10207184 3300009094 Bacteria 2285
235 Ga0111539_10255994 3300009094 Bacteria 2038
236 Ga0111539_11533508 3300009094 Bacteria 773
237 Ga0105245_10374606 3300009098 Bacteria 1416
238 Ga0105245_11119519 3300009098 Unclassified 834
239 Ga0105245_11842389 3300009098 Bacteria 658
240 Ga0114129_10012058 3300009147 Bacteria 12298
241 Ga0105243_11137592 3300009148 Bacteria 791
242 Ga0105241_11803145 3300009174 Bacteria 597
243 Ga0105241_11940069 3300009174 Bacteria 578
244 Ga0105242_10470967 3300009176 Bacteria 1188
245 Ga0105242_10760987 3300009176 Unclassified 955
246 Ga0105242_11176334 3300009176 Unclassified 785
247 Ga0105248_10136603 3300009177 Bacteria 2766
248 Ga0105237_10294384 3300009545 Bacteria 1626
249 Ga0105237_10448494 3300009545 Bacteria 1296
250 Ga0105237_10655183 3300009545 Bacteria 1057
251 Ga0105237_11057173 3300009545 Unclassified 819
252 Ga0105237_11600214 3300009545 Bacteria 658
253 Ga0105238_10036079 3300009551 Bacteria 5026
254 Ga0105238_10062041 3300009551 Bacteria 3740
255 Ga0105238_10124228 3300009551 Unclassified 2560
256 Ga0105238_10685246 3300009551 Bacteria 1036
257 Ga0105238_12940494 3300009551 Bacteria 512
258 Ga0105249_10431405 3300009553 Bacteria 1354
259 Ga0105249_11076291 3300009553 Unclassified 874
260 Ga0099796_10000351 3300010159 Bacteria 7483
261 Ga0105239_10005674 3300010375 Bacteria 14585
262 Ga0105239_10011221 3300010375 Bacteria 9999
263 Ga0105239_10239173 3300010375 Bacteria 2038
264 Ga0105239_10578061 3300010375 Unclassified 1281
265 Ga0105239_12274522 3300010375 Unclassified 631
266 Ga0105246_11333597 3300011119 Unclassified 666
267 Ga0105246_12147077 3300011119 Unclassified 542
268 Ga0157373_10872349 3300013100 Bacteria 666
269 Ga0157370_10024850 3300013104 Bacteria 5933
270 Ga0157370_10053986 3300013104 Bacteria 3831
271 Ga0157370_10276958 3300013104 Bacteria 1550
272 Ga0157370_11348601 3300013104 Bacteria 642
273 Ga0157369_10008652 3300013105 Bacteria 11675
274 Ga0157369_10027891 3300013105 Bacteria 6255
275 Ga0157369_10042967 3300013105 Bacteria 4928
276 Ga0157369_10043594 3300013105 Bacteria 4889
277 Ga0157369_10218110 3300013105 Bacteria 1998
278 Ga0157374_10174061 3300013296 Unclassified 2101
279 Ga0157374_10259725 3300013296 Bacteria 1710
280 Ga0157374_12649916 3300013296 Unclassified 529
281 Ga0157378_10056476 3300013297 Bacteria 3498
282 Ga0157378_10115932 3300013297 Bacteria 2463
283 Ga0157378_11645549 3300013297 Bacteria 688
284 Ga0157378_12058916 3300013297 Bacteria 621
285 Ga0163162_13232927 3300013306 Unclassified 523
286 Ga0157372_10108989 3300013307 Bacteria 3171
287 Ga0157372_10340299 3300013307 Bacteria 1747
288 Ga0157375_10549287 3300013308 Bacteria 1317
289 Ga0157375_10774259 3300013308 Unclassified 1110
290 Ga0163163_10437165 3300014325 Bacteria 1368
291 Ga0163163_13105034 3300014325 Bacteria 518
292 Ga0157380_10012927 3300014326 Bacteria 6068
293 Ga0157380_10015948 3300014326 Bacteria 5531
294 Ga0157380_10452107 3300014326 Bacteria 1234
295 Ga0157377_10449587 3300014745 Unclassified 889
296 Ga0157379_10970303 3300014968 Unclassified 809
297 Ga0157379_12353362 3300014968 Bacteria 531
298 Ga0157376_10150997 3300014969 Bacteria 2095
299 Ga0157376_11489396 3300014969 Unclassified 709
300 Ga0157376_12399733 3300014969 Unclassified 567
301 Ga0157376_12857424 3300014969 Bacteria 523
302 Ga0163161_11059262 3300017792 Bacteria 695
303 Ga0206356_11774328 3300020070 Bacteria 1233
304 Ga0206355_1088868 3300020076 Bacteria 601
305 Ga0206353_11331178 3300020082 Unclassified 709
306 Ga0213873_10019840 3300021358 Bacteria 1564
307 Ga0213874_10005856 3300021377 Bacteria 2885
308 Ga0213874_10172082 3300021377 Unclassified 766
309 Ga0213876_10206594 3300021384 Bacteria 1044
310 Ga0213876_10235677 3300021384 Bacteria 973
311 Ga0213875_10119915 3300021388 Bacteria 1229
312 Ga0213871_10057376 3300021441 Bacteria 1078
313 Ga0213871_10072548 3300021441 Bacteria 975
314 Ga0213871_10129833 3300021441 Unclassified 756
315 Ga0224712_10431233 3300022467 Bacteria 631
316 Ga0207656_10000370 3300025321 Bacteria 15063
317 Ga0207682_10152043 3300025893 Bacteria 1044
318 Ga0207682_10532343 3300025893 Unclassified 556
319 Ga0207692_10069210 3300025898 Bacteria 1854
320 Ga0207692_10211770 3300025898 Bacteria 1145
321 Ga0207692_10835598 3300025898 Unclassified 604
322 Ga0207692_10840439 3300025898 Bacteria 602
323 Ga0207642_10823791 3300025899 Bacteria 591
324 Ga0207688_10625688 3300025901 Bacteria 679
325 Ga0207680_10684593 3300025903 Bacteria 735
326 Ga0207647_10431481 3300025904 Bacteria 740
327 Ga0207685_10068339 3300025905 Bacteria 1431
328 Ga0207685_10082343 3300025905 Bacteria 1335
329 Ga0207699_10001988 3300025906 Bacteria 9665
330 Ga0207699_10036146 3300025906 Bacteria 2814
331 Ga0207699_10545610 3300025906 Bacteria 840
332 Ga0207645_10021794 3300025907 Bacteria 4174
333 Ga0207645_10047720 3300025907 Bacteria 2734
334 Ga0207645_10316290 3300025907 Bacteria 1041
335 Ga0207643_10082801 3300025908 Bacteria 1861
336 Ga0207643_10095420 3300025908 Bacteria 1738
337 Ga0207705_11229801 3300025909 Unclassified 574
338 Ga0207654_10068226 3300025911 Bacteria 2103
339 Ga0207707_10000213 3300025912 Bacteria 61986
340 Ga0207707_10007306 3300025912 Bacteria 9618
341 Ga0207707_10014745 3300025912 Bacteria 6811
342 Ga0207707_10020379 3300025912 Bacteria 5790
343 Ga0207707_10060237 3300025912 Bacteria 3303
344 Ga0207707_10112937 3300025912 Bacteria 2375
345 Ga0207707_10168475 3300025912 Unclassified 1914
346 Ga0207707_10327100 3300025912 Bacteria 1323
347 Ga0207695_10014424 3300025913 Bacteria 9361
348 Ga0207695_10014685 3300025913 Bacteria 9260
349 Ga0207695_10091957 3300025913 Bacteria 3046
350 Ga0207695_10124464 3300025913 Unclassified 2542
351 Ga0207671_10064212 3300025914 Bacteria 2729
352 Ga0207671_10194204 3300025914 Bacteria 1583
353 Ga0207671_10624564 3300025914 Bacteria 858
354 Ga0207671_10651393 3300025914 Bacteria 839
355 Ga0207671_10679451 3300025914 Unclassified 819
356 Ga0207693_10045072 3300025915 Bacteria 3466
357 Ga0207693_10133955 3300025915 Unclassified 1948
358 Ga0207693_10745490 3300025915 Bacteria 757
359 Ga0207663_10082654 3300025916 Bacteria 2107
360 Ga0207663_10182166 3300025916 Unclassified 1501
361 Ga0207663_10194963 3300025916 Bacteria 1457
362 Ga0207663_10224888 3300025916 Bacteria 1367
363 Ga0207660_10012076 3300025917 Bacteria 5644
364 Ga0207660_10021999 3300025917 Bacteria 4293
365 Ga0207660_10026451 3300025917 Bacteria 3952
366 Ga0207662_10245185 3300025918 Unclassified 1174
367 Ga0207649_10002528 3300025920 Bacteria 10190
368 Ga0207649_11145062 3300025920 Unclassified 614
369 Ga0207652_10006162 3300025921 Bacteria 9696
370 Ga0207652_10044577 3300025921 Bacteria 3779
371 Ga0207652_10085557 3300025921 Bacteria 2763
372 Ga0207652_10231148 3300025921 Bacteria 1667
373 Ga0207681_10071969 3300025923 Bacteria 2413
374 Ga0207681_10744961 3300025923 Unclassified 816
375 Ga0207694_10071649 3300025924 Bacteria 2708
376 Ga0207694_10134634 3300025924 Unclassified 1983
377 Ga0207694_10164325 3300025924 Bacteria 1794
378 Ga0207694_10193405 3300025924 Bacteria 1653
379 Ga0207694_11391148 3300025924 Unclassified 593
380 Ga0207659_10087563 3300025926 Bacteria 2318
381 Ga0207687_10401748 3300025927 Bacteria 1127
382 Ga0207700_10091906 3300025928 Bacteria 2398
383 Ga0207700_10112405 3300025928 Bacteria 2194
384 Ga0207700_10236793 3300025928 Bacteria 1554
385 Ga0207664_10020147 3300025929 Bacteria 4938
386 Ga0207664_10217220 3300025929 Bacteria 1656
387 Ga0207664_10277403 3300025929 Bacteria 1470
388 Ga0207664_10752809 3300025929 Bacteria 876
389 Ga0207644_10617315 3300025931 Bacteria 901
390 Ga0207690_11135952 3300025932 Bacteria 652
391 Ga0207706_10120388 3300025933 Bacteria 2308
392 Ga0207706_10382206 3300025933 Bacteria 1222
393 Ga0207686_10043481 3300025934 Bacteria 2752
394 Ga0207686_10284565 3300025934 Bacteria 1222
395 Ga0207686_10399330 3300025934 Bacteria 1047
396 Ga0207686_11180846 3300025934 Unclassified 626
397 Ga0207670_10086237 3300025936 Bacteria 2208
398 Ga0207670_11087621 3300025936 Unclassified 675
399 Ga0207669_10115986 3300025937 Bacteria 1806
400 Ga0207669_10606015 3300025937 Bacteria 891
401 Ga0207669_10840680 3300025937 Bacteria 763
402 Ga0207704_10185268 3300025938 Bacteria 1508
403 Ga0207704_10362282 3300025938 Bacteria 1132
404 Ga0207704_11442475 3300025938 Bacteria 590
405 Ga0207665_10064341 3300025939 Bacteria 2492
406 Ga0207665_10068196 3300025939 Bacteria 2423
407 Ga0207665_11095268 3300025939 Bacteria 635
408 Ga0207691_10017268 3300025940 Bacteria 6845
409 Ga0207691_10018434 3300025940 Bacteria 6616
410 Ga0207691_10097535 3300025940 Bacteria 2627
411 Ga0207661_10057652 3300025944 Bacteria 3124
412 Ga0207661_10227524 3300025944 Unclassified 1650
413 Ga0207679_10396417 3300025945 Bacteria 1213
414 Ga0207667_10000417 3300025949 Bacteria 57396
415 Ga0207667_10004450 3300025949 Bacteria 17159
416 Ga0207667_10016797 3300025949 Bacteria 8256
417 Ga0207667_10244877 3300025949 Bacteria 1834
418 Ga0207667_11529482 3300025949 Bacteria 638
419 Ga0207667_12089198 3300025949 Bacteria 525
420 Ga0207651_10057790 3300025960 Bacteria 2677
421 Ga0207651_10076087 3300025960 Bacteria 2398
422 Ga0207651_10317734 3300025960 Bacteria 1301
423 Ga0207712_10128936 3300025961 Bacteria 1924
424 Ga0207668_10402796 3300025972 Bacteria 1157
425 Ga0207668_11109914 3300025972 Bacteria 709
426 Ga0207640_10017150 3300025981 Bacteria 4230
427 Ga0207640_10745333 3300025981 Bacteria 844
428 Ga0207658_12017914 3300025986 Bacteria 525
429 Ga0207677_10602364 3300026023 Bacteria 964
430 Ga0207703_10137721 3300026035 Bacteria 2115
431 Ga0207703_11046202 3300026035 Unclassified 784
432 Ga0207639_10001042 3300026041 Bacteria 18826
433 Ga0207639_10387857 3300026041 Bacteria 1256
434 Ga0207639_11856794 3300026041 Bacteria 563
435 Ga0207708_11861019 3300026075 Unclassified 528
436 Ga0207702_10079829 3300026078 Bacteria 2837
437 Ga0207702_10092220 3300026078 Bacteria 2654
438 Ga0207702_11326402 3300026078 Bacteria 714
439 Ga0207641_10029602 3300026088 Bacteria 4530
440 Ga0207648_10038337 3300026089 Bacteria 4217
441 Ga0207648_10353672 3300026089 Bacteria 1325
442 Ga0207648_11167679 3300026089 Bacteria 723
443 Ga0207676_10312610 3300026095 Bacteria 1439
444 Ga0207676_10815221 3300026095 Unclassified 911
445 Ga0207674_10147374 3300026116 Bacteria 2312
446 Ga0207674_10313032 3300026116 Bacteria 1519
447 Ga0207675_100074665 3300026118 Bacteria 3173
448 Ga0207675_100084724 3300026118 Bacteria 2974
449 Ga0207675_100244191 3300026118 Bacteria 1736
450 Ga0207675_100253596 3300026118 Bacteria 1703
451 Ga0207675_100541373 3300026118 Bacteria 1163
452 Ga0207675_100608281 3300026118 Bacteria 1096
453 Ga0207675_100618658 3300026118 Bacteria 1087
454 Ga0207675_100844461 3300026118 Bacteria 930
455 Ga0207683_10278448 3300026121 Bacteria 1529
456 Ga0207683_11651289 3300026121 Unclassified 590
457 Ga0207698_10004240 3300026142 Bacteria 8724
458 Ga0207698_10640694 3300026142 Bacteria 1052
459 Ga0207698_11043519 3300026142 Bacteria 829
460 Ga0207698_11738529 3300026142 Bacteria 639
461 Ga0209996_1026242 3300027395 Bacteria 835
462 Ga0210000_1062558 3300027462 Bacteria 603
463 Ga0209179_1000011 3300027512 Bacteria 66977
464 Ga0209970_1014213 3300027614 Bacteria 1322
465 Ga0210002_1042785 3300027617 Bacteria 771
466 Ga0209983_1025191 3300027665 Bacteria 1254
467 Ga0209971_1003831 3300027682 Bacteria 3557
468 Ga0207428_10073761 3300027907 Bacteria 2677
469 Ga0268266_10008271 3300028379 Bacteria 9271
470 Ga0268266_10019127 3300028379 Bacteria 5832
471 Ga0268266_10285364 3300028379 Bacteria 1536
472 Ga0268266_10289921 3300028379 Unclassified 1524
473 Ga0268266_11337733 3300028379 Unclassified 692
474 Ga0268266_12335084 3300028379 Unclassified 506
475 Ga0268265_10049380 3300028380 Bacteria 3164
476 Ga0268265_10162718 3300028380 Unclassified 1898
477 Ga0268265_10187412 3300028380 Bacteria 1783
478 Ga0268265_10273390 3300028380 Bacteria 1508
479 Ga0268265_10598796 3300028380 Bacteria 1053
480 Ga0268265_11729258 3300028380 Unclassified 631
481 Ga0268264_10234722 3300028381 Bacteria 1695
482 Ga0268264_12282993 3300028381 Bacteria 548
483 Ga0307517_10628206 3300028786 Unclassified 525
484 Ga0307515_10448584 3300028794 Bacteria 906
485 Ga0265760_10132502 3300031090 Bacteria 807
486 Ga0265330_10003651 3300031235 Bacteria 7999
487 Ga0265332_10013547 3300031238 Bacteria 3612
488 Ga0265325_10052553 3300031241 Bacteria 2091
489 Ga0265340_10000356 3300031247 Bacteria 24392
490 Ga0265340_10002297 3300031247 Bacteria 10933
491 Ga0265340_10026230 3300031247 Bacteria 2947
492 Ga0265331_10010679 3300031250 Bacteria 5064
493 Ga0265331_10053274 3300031250 Bacteria 1930
494 Ga0265316_10000146 3300031344 Bacteria 77550
495 Ga0265316_10005304 3300031344 Bacteria 12575
496 Ga0265316_10019427 3300031344 Bacteria 5813
497 Ga0265316_10143604 3300031344 Bacteria 1791
498 Ga0307513_10860728 3300031456 Bacteria 613
499 Ga0307509_10391286 3300031507 Bacteria 1100
500 Ga0307408_100014096 3300031548 Bacteria 5311
501 Ga0307408_100199178 3300031548 Bacteria 1619
502 Ga0307408_100243515 3300031548 Bacteria 1479
503 Ga0265313_10011164 3300031595 Bacteria 5600
504 Ga0265314_10018561 3300031711 Bacteria 5421
505 Ga0265314_10020776 3300031711 Bacteria 5064
506 Ga0265314_10034849 3300031711 Bacteria 3673
507 Ga0265342_10009625 3300031712 Bacteria 6783
508 Ga0316578_10056067 3300031728 Bacteria 2314
509 Ga0307516_10027775 3300031730 Bacteria 5735
510 Ga0307405_10003677 3300031731 Bacteria 7108
511 Ga0307405_10100758 3300031731 Bacteria 1936
512 Ga0307405_10343032 3300031731 Bacteria 1149
513 Ga0307413_10099863 3300031824 Bacteria 1914
514 Ga0307413_11325960 3300031824 Bacteria 630
515 Ga0307410_10087072 3300031852 Bacteria 2208
516 Ga0307410_10147680 3300031852 Bacteria 1746
517 Ga0307410_10249791 3300031852 Bacteria 1378
518 Ga0307406_10008451 3300031901 Bacteria 5744
519 Ga0307406_10127370 3300031901 Bacteria 1781
520 Ga0307407_10071208 3300031903 Bacteria 2069
521 Ga0307407_10484863 3300031903 Bacteria 903
522 Ga0307412_10865391 3300031911 Bacteria 789
523 Ga0307409_100089593 3300031995 Bacteria 2515
524 Ga0307409_100180885 3300031995 Bacteria 1866
525 Ga0307409_100339220 3300031995 Bacteria 1413
526 Ga0307409_101444270 3300031995 Bacteria 715
527 Ga0307416_100017839 3300032002 Bacteria 4980
528 Ga0307416_100056976 3300032002 Bacteria 3158
529 Ga0307416_100787918 3300032002 Bacteria 1045
530 Ga0307414_10416850 3300032004 Bacteria 1170
531 Ga0307414_10704840 3300032004 Bacteria 914
532 Ga0307414_10879792 3300032004 Bacteria 820
533 Ga0307411_10010900 3300032005 Bacteria 4873
534 Ga0307411_10231863 3300032005 Bacteria 1439
535 Ga0307411_10551300 3300032005 Bacteria 983
536 Ga0307415_100010480 3300032126 Bacteria 5252
537 Ga0307415_100044945 3300032126 Bacteria 2957
538 Ga0307415_100559809 3300032126 Bacteria 1010
539 Ga0307415_101853842 3300032126 Bacteria 585
540 Ga0316593_10013972 3300032168 Bacteria 2386
541 Ga0316593_10050031 3300032168 Bacteria 1409
542 Ga0373934_0028694 3300035086 Bacteria 2171
543 Ga0373923_0217042 3300035111 Bacteria 888
544 Ga0373936_0305206 3300035113 Bacteria 719
545 Ga0373945_0159125 3300035116 Bacteria 920
546 Ga0373953_0131990 3300035117 Bacteria 1065
547 Ga0373953_0292554 3300035117 Unclassified 710
548 Ga0373954_0011589 3300035118 Bacteria 3910
549 Ga0373956_0068388 3300035119 Unclassified 1618
550 Ga0373956_0103361 3300035119 Bacteria 1323
551 Ga0373957_0087056 3300035120 Unclassified 1238
552 Ga0373946_0037368 3300035171 Bacteria 1973
553 Ga0373946_0084106 3300035171 Bacteria 1399
554 Ga0373955_0363998 3300035172 Unclassified 877
555 Ga0373961_0327814 3300035241 Bacteria 573
556 Ga0316574_0125189 3300035398 Bacteria 1652
557 Ga0316574_0872616 3300035398 Unclassified 545
558 Ga0373931_1084408 3300035691 Unclassified 545
559 Ga0373935_0113584 3300035692 Bacteria 1801
560 Ga0373927_0293847 3300035695 Bacteria 1069
561 Ga0373927_0745948 3300035695 Bacteria 647
562 Ga0373933_0013068 3300035724 Bacteria 4597
563 Ga0373933_0302952 3300035724 Bacteria 1035
564 Ga0373947_0106191 3300035725 Bacteria 1770
565 Ga0373947_0532529 3300035725 Bacteria 799
566 Ga0373937_0003538 3300036401 Bacteria 13152
567 Ga0373937_0158586 3300036401 Unclassified 2121
568 Ga0373937_0373072 3300036401 Bacteria 1353
569 Ga0373937_1472491 3300036401 Bacteria 628
570 Ga0373937_1869959 3300036401 Unclassified 547
571 Ga0316582_0054406 3300036647 Bacteria 2548
572 Ga0316582_0648356 3300036647 Bacteria 726
573 Ga0395899_0593172 3300037312 Bacteria 707
574 Ga0395900_0062660 3300037418 Bacteria 3823
575 Ga0395900_0233243 3300037418 Unclassified 1850
576 Ga0395898_0034073 3300037466 Bacteria 5078
577 Ga0395898_0163271 3300037466 Unclassified 2131
578 Ga0395898_0584594 3300037466 Bacteria 1059
579 Ga0395905_0379781 3300037471 Bacteria 1307
580 Ga0436364_0422126 3300037853 Unclassified 645
581 Ga0436364_0507816 3300037853 Bacteria 1215
582 Ga0395901_0235546 3300038443 Bacteria 1911
583 Ga0395901_1035192 3300038443 Bacteria 795
584 Ga0395901_1495614 3300038443 Bacteria 631
585 Ga0400490_27866 3300038726 Bacteria 31976
586 Ga0400488_14628 3300038741 Bacteria 3102
587 Ga0400488_36631 3300038741 Bacteria 4314
588 Ga0400488_39676 3300038741 Bacteria 3344
589 Ga0400488_62698 3300038741 Bacteria 1767
590 Ga0400486_29232 3300038742 Bacteria 2077
591 Ga0400483_007661 3300039062 Bacteria 20710
592 Ga0400483_031605 3300039062 Bacteria 1730
593 Ga0400483_059913 3300039062 Bacteria 1635
594 Ga0400483_091647 3300039062 Bacteria 12066
595 Ga0400483_122739 3300039062 Bacteria 23925
596 Ga0400483_165155 3300039062 Bacteria 5784
597 Ga0400483_167560 3300039062 Bacteria 1117
598 Ga0400483_269614 3300039062 Bacteria 133457
599 Ga0400483_286327 3300039062 Bacteria 16786
600 Ga0400487_51472 3300039110 Bacteria 14864
601 Ga0436365_0990718 3300039437 Bacteria 3933
602 Ga0436365_1123454 3300039437 Bacteria 655
603 Ga0436365_1829985 3300039437 Bacteria 1098
604 Ga0436360_0230968 3300039438 Bacteria 1453
605 Ga0436360_0249274 3300039438 Bacteria 2033
606 Ga0436360_0846674 3300039438 Bacteria 3043
607 Ga0436360_0887930 3300039438 Unclassified 788
608 Ga0436360_1157685 3300039438 Bacteria 10179
609 Ga0436361_0275763 3300039447 Bacteria 508
610 Ga0436363_0040943 3300039450 Bacteria 1347
611 Ga0436363_0073651 3300039450 Bacteria 2120
612 Ga0436363_0117506 3300039450 Bacteria 7799
613 Ga0436363_0382304 3300039450 Bacteria 893
614 Ga0436363_0553853 3300039450 Bacteria 531
615 Ga0436362_0751592 3300039453 Bacteria 4345
616 Ga0436362_1213266 3300039453 Bacteria 512
617 Ga0439439_0027133 3300041406 Bacteria 1446
618 Ga0439453_0006516 3300041408 Bacteria 1820
619 Ga0439461_0002922 3300041410 Bacteria 2773
620 Ga0439461_0143519 3300041410 Bacteria 612
621 Ga0439466_0162554 3300041411 Bacteria 683
622 Ga0439465_0042626 3300041413 Bacteria 1471
623 Ga0439465_0051976 3300041413 Bacteria 1344
624 Ga0439465_0052220 3300041413 Bacteria 1341
625 Ga0451791_0349922 3300041451 Bacteria 561
626 Ga0451793_1904977 3300041452 Bacteria 521
627 Ga0451795_0207582 3300041456 Bacteria 510
628 Ga0451798_0531086 3300041458 Bacteria 557
629 Ga0451804_0349009 3300041463 Bacteria 529
630 Ga0451807_1912619 3300041486 Unclassified 568
631 Ga0451839_1253933 3300041496 Bacteria 610
632 Ga0451839_1368483 3300041496 Bacteria 605
633 Ga0451855_0421856 3300041511 Bacteria 752
634 Ga0451853_2078235 3300041512 Bacteria 762
635 Ga0451853_3356625 3300041512 Bacteria 520
636 Ga0439431_0132112 3300041997 Bacteria 701
637 Ga0439431_0265471 3300041997 Bacteria 512
638 Ga0439433_0020103 3300041999 Bacteria 1490
639 Ga0439441_004293 3300042001 Bacteria 2151
640 Ga0439443_002580 3300042003 Bacteria 2181
641 Ga0439445_0189597 3300042004 Bacteria 605
642 Ga0439445_0201043 3300042004 Bacteria 588
643 Ga0439449_0315167 3300042007 Bacteria 591
644 Ga0439451_039226 3300042009 Bacteria 951
645 Ga0439451_093501 3300042009 Unclassified 606
646 Ga0439454_060004 3300042011 Bacteria 658
647 Ga0439456_006559 3300042013 Bacteria 2380
648 Ga0450920_002594 3300042122 Bacteria 3085
649 Ga0450923_068802 3300042125 Bacteria 782
650 Ga0450888_036244 3300042126 Unclassified 674
651 Ga0450890_083627 3300042127 Unclassified 523
652 Ga0450896_012716 3300042133 Bacteria 1192
653 Ga0450906_012735 3300042145 Bacteria 1557
654 Ga0439446_0000175 3300042156 Bacteria 11262
655 Ga0450908_015155 3300042184 Bacteria 1381
656 Ga0439434_0012351 3300042435 Bacteria 2527
657 Ga0439435_0006278 3300042436 Bacteria 2664
658 Ga0439444_0005437 3300042437 Bacteria 1889
659 Ga0439459_0102331 3300042438 Unclassified 702
660 Ga0439460_0004358 3300042461 Bacteria 3452
661 Ga0451577_0090855 3300042876 Bacteria 2725
662 Ga0451577_0098888 3300042876 Bacteria 2606
663 Ga0451577_0104390 3300042876 Bacteria 2533
664 Ga0451577_1196362 3300042876 Bacteria 678
665 Ga0451577_1795478 3300042876 Bacteria 538
666 Ga0466969_0007341 3300044656 Bacteria 5859
667 Ga0466969_0024727 3300044656 Bacteria 3089
668 Ga0466972_0020775 3300044658 Bacteria 3279
669 Ga0453683_0484486 3300044673 Bacteria 802
670 Ga0466965_0191666 3300044683 Bacteria 1081
671 Ga0466966_0000557 3300044684 Bacteria 23782
672 Ga0466961_0001702 3300044693 Bacteria 13703
673 Ga0466963_0476448 3300044694 Bacteria 881
674 Ga0466964_0000388 3300044706 Bacteria 13356
675 Ga0453684_0634960 3300044712 Bacteria 1167
676 Ga0453684_1247006 3300044712 Bacteria 778
677 Ga0453684_1476662 3300044712 Bacteria 702
678 Ga0466971_0003199 3300044719 Bacteria 6981
679 Ga0466968_0041783 3300044735 Bacteria 1937
680 Ga0466968_0159575 3300044735 Bacteria 1040
681 Ga0466970_0001729 3300044765 Bacteria 10524
682 Ga0466957_0053853 3300044842 Bacteria 2454
683 Ga0466957_0187747 3300044842 Bacteria 1352
684 Ga0466960_0407238 3300044901 Bacteria 784
685 Ga0466960_0909614 3300044901 Bacteria 537
686 Ga0466959_0008813 3300045049 Bacteria 7147
687 Ga0466959_0055230 3300045049 Bacteria 2900
688 Ga0451576_0002405 3300045051 Bacteria 28072
689 Ga0451576_0367046 3300045051 Unclassified 1508
690 Ga0451576_0686299 3300045051 Bacteria 1076
691 Ga0451576_0728125 3300045051 Bacteria 1042
692 Ga0466967_1252470 3300045976 Bacteria 739
693 Ga0495617_166210 3300046452 Unclassified 698
694 Ga0495638_0358370 3300046460 Bacteria 768
695 Ga0495580_0019287 3300046472 Bacteria 5067
696 Ga0495584_0594405 3300046491 Bacteria 564
697 Ga0495596_0335844 3300046500 Unclassified 588
698 Ga0495616_0217093 3300046513 Bacteria 834
699 Ga0495587_0156491 3300046536 Unclassified 1298
700 Ga0495645_0271530 3300046543 Bacteria 1119
701 Ga0495625_0906652 3300046660 Bacteria 505
702 Ga0495623_0338001 3300046679 Bacteria 823
703 Ga0495658_0900844 3300046683 Bacteria 565
704 Ga0495670_0732512 3300046691 Bacteria 539
705 Ga0495671_0111247 3300046692 Bacteria 1337
706 Ga0495600_0326181 3300046809 Unclassified 965
707 Ga0495600_0558619 3300046809 Unclassified 699
708 Ga0495604_0585522 3300047317 Bacteria 717
709 Ga0495604_0731825 3300047317 Bacteria 627
710 Ga0495674_0515779 3300047319 Bacteria 955
711 Ga0495675_0263904 3300047444 Bacteria 1031
712 Ga0495673_0157680 3300047469 Bacteria 873
713 Ga0495686_0064522 3300047472 Bacteria 2266
714 Ga0495686_0212396 3300047472 Bacteria 1105
715 Ga0495602_0655096 3300048088 Bacteria 717
716 Ga0496100_1063393 3300048903 Bacteria 637
717 Ga0496101_0073290 3300048904 Bacteria 2515
718 Ga0496101_0332802 3300048904 Bacteria 1192
719 Ga0496101_1549729 3300048904 Bacteria 515
720 Ga0496102_0046953 3300048905 Bacteria 3923
721 Ga0496104_0014145 3300048907 Bacteria 7202
722 Ga0496104_0202644 3300048907 Bacteria 1896
723 Ga0496104_0775416 3300048907 Unclassified 865
724 Ga0496105_0016438 3300048908 Bacteria 5909
725 Ga0496105_0364564 3300048908 Bacteria 1152
726 Ga0496106_0061455 3300048909 Bacteria 2850
727 Ga0496106_0150760 3300048909 Bacteria 1834
728 Ga0496107_0102183 3300048910 Bacteria 2102
729 Ga0496107_0385291 3300048910 Bacteria 1043
730 Ga0496108_0026214 3300048911 Bacteria 4807
731 Ga0496108_0287555 3300048911 Bacteria 1431
732 Ga0496108_0846070 3300048911 Bacteria 787
733 Ga0496109_0419264 3300048912 Bacteria 1264
734 Ga0496109_1909461 3300048912 Unclassified 526
735 Ga0496110_0002929 3300048913 Bacteria 12922
736 Ga0496110_0009323 3300048913 Bacteria 7941
737 Ga0496111_0198764 3300048914 Bacteria 1490
738 Ga0496111_1175382 3300048914 Bacteria 544
739 Ga0496112_0166803 3300048915 Bacteria 2168
740 Ga0496112_0876384 3300048915 Bacteria 820
741 Ga0496113_0074417 3300048916 Bacteria 2590
742 Ga0496114_0065909 3300048917 Bacteria 3035
743 Ga0496114_0255873 3300048917 Bacteria 1541
744 Ga0496114_1060247 3300048917 Unclassified 695
745 Ga0496115_0655405 3300048918 Bacteria 829
746 Ga0496116_0037032 3300048919 Bacteria 3407
747 Ga0496117_0008275 3300048920 Bacteria 9900
748 Ga0496117_0416497 3300048920 Bacteria 673
749 Ga0496118_0009209 3300048921 Bacteria 10030
750 Ga0496118_0131646 3300048921 Bacteria 1605
751 Ga0496119_0001089 3300048922 Bacteria 34251
752 Ga0496119_0136119 3300048922 Bacteria 1332
753 Ga0496121_0000246 3300048924 Bacteria 114919
754 Ga0496121_0067412 3300048924 Bacteria 2901
755 Ga0496121_0358467 3300048924 Bacteria 969
756 Ga0496122_0021783 3300048925 Bacteria 5720
757 Ga0496122_0056325 3300048925 Bacteria 2931
758 Ga0496123_0009931 3300048926 Bacteria 8490
759 Ga0496123_0022057 3300048926 Bacteria 4924
760 Ga0496124_0307293 3300048927 Bacteria 1142
761 Ga0496125_0054673 3300048928 Bacteria 3260
762 Ga0496126_0021917 3300048929 Bacteria 6231
763 Ga0496126_0562605 3300048929 Bacteria 903
764 Ga0501032_0499105 3300049569 Bacteria 778
765 Ga0501032_0565924 3300049569 Unclassified 724
766 Ga0501034_0005650 3300049571 Bacteria 13607
767 Ga0501034_0082117 3300049571 Bacteria 3225
768 Ga0501034_0194858 3300049571 Bacteria 1987
769 Ga0501034_0535765 3300049571 Bacteria 1081
770 Ga0501034_1455585 3300049571 Unclassified 559
771 Ga0501036_0323630 3300049572 Bacteria 1288
772 Ga0501036_0525192 3300049572 Bacteria 984
773 Ga0501037_0471717 3300049573 Bacteria 854
774 Ga0501037_0644236 3300049573 Bacteria 709
775 Ga0501038_0527902 3300049574 Bacteria 900
776 Ga0501038_0642748 3300049574 Unclassified 799
777 Ga0501039_0109497 3300049575 Bacteria 2159
778 Ga0501039_1505163 3300049575 Bacteria 517
779 Ga0501040_0001085 3300049576 Bacteria 17202
780 Ga0501040_0394066 3300049576 Bacteria 994
781 Ga0501040_0495195 3300049576 Bacteria 881
782 Ga0501040_0952130 3300049576 Bacteria 622
783 Ga0501041_0079903 3300049577 Bacteria 2013
784 Ga0501041_0646736 3300049577 Bacteria 676
785 Ga0501042_0039134 3300049578 Bacteria 3369
786 Ga0501042_0051340 3300049578 Bacteria 2941
787 Ga0501042_0079004 3300049578 Bacteria 2356
788 Ga0501042_0484295 3300049578 Bacteria 898
789 Ga0501043_0410074 3300049579 Bacteria 1023
790 Ga0501046_1119961 3300049580 Bacteria 543
791 Ga0501047_0196075 3300049581 Bacteria 1882
792 Ga0501047_0428432 3300049581 Bacteria 1154
793 Ga0501048_0513547 3300049582 Bacteria 859
794 Ga0501067_0023609 3300049583 Bacteria 3408
795 Ga0501068_0023531 3300049584 Bacteria 3610
796 Ga0501068_0299546 3300049584 Bacteria 1029
797 Ga0501068_0536066 3300049584 Bacteria 760
798 Ga0501069_0029799 3300049585 Bacteria 2996
799 Ga0501070_0719371 3300049586 Unclassified 789
800 Ga0501070_0833247 3300049586 Bacteria 723
801 Ga0501071_0007964 3300049587 Bacteria 6991
802 Ga0501071_0497418 3300049587 Bacteria 935
803 Ga0501071_0736179 3300049587 Bacteria 760
804 Ga0501071_1010208 3300049587 Bacteria 642
805 Ga0501072_0030078 3300049588 Bacteria 4245
806 Ga0501072_0236854 3300049588 Bacteria 1454
807 Ga0501072_0527385 3300049588 Bacteria 933
808 Ga0501072_0562762 3300049588 Bacteria 900
809 Ga0501073_0002828 3300049589 Bacteria 13003
810 Ga0501073_0069437 3300049589 Bacteria 2455
811 Ga0501073_0178446 3300049589 Bacteria 1470
812 Ga0501073_0930978 3300049589 Bacteria 598
813 Ga0501073_1071818 3300049589 Bacteria 554
814 Ga0501074_0000646 3300049590 Bacteria 21639
815 Ga0501074_0210573 3300049590 Bacteria 1385
816 Ga0501074_0464069 3300049590 Bacteria 897
817 Ga0501074_0637863 3300049590 Bacteria 753
818 Ga0501074_0658354 3300049590 Bacteria 740
819 Ga0501075_0079029 3300049591 Unclassified 2490
820 Ga0501075_0131325 3300049591 Bacteria 1908
821 Ga0501076_0020771 3300049592 Bacteria 5028
822 Ga0501076_0054945 3300049592 Bacteria 3157
823 Ga0501076_0109716 3300049592 Bacteria 2230
824 Ga0501076_0332817 3300049592 Bacteria 1246
825 Ga0501076_0485682 3300049592 Bacteria 1018
826 Ga0501076_0601048 3300049592 Bacteria 907
827 Ga0501076_1327821 3300049592 Bacteria 591
828 Ga0501077_0019747 3300049593 Bacteria 4262
829 Ga0501077_0123178 3300049593 Bacteria 1643
830 Ga0501079_0026230 3300049741 Bacteria 4466
831 Ga0501079_0062681 3300049741 Bacteria 2867
832 Ga0501079_1244395 3300049741 Bacteria 586
833 Ga0501080_0005283 3300049742 Bacteria 11501
834 Ga0501080_0131776 3300049742 Bacteria 2315
835 Ga0501080_0636451 3300049742 Bacteria 944
836 Ga0501081_0002762 3300049743 Bacteria 11123
837 Ga0501081_0286176 3300049743 Bacteria 1207
838 Ga0501081_0634303 3300049743 Bacteria 801
839 Ga0501081_0756212 3300049743 Bacteria 730
840 Ga0501081_1137776 3300049743 Unclassified 591
841 Ga0501083_0222212 3300049744 Bacteria 1230
842 Ga0501083_0263413 3300049744 Bacteria 1121
843 Ga0501035_0130925 3300049822 Bacteria 2187
844 Ga0501044_0126154 3300049823 Bacteria 2557
845 Ga0501044_0258868 3300049823 Bacteria 1679
846 Ga0501044_0287534 3300049823 Bacteria 1576
847 Ga0501044_0944226 3300049823 Bacteria 736
848 Ga0501045_0380757 3300049824 Bacteria 1050
849 Ga0501045_0594073 3300049824 Bacteria 820
850 Ga0501045_0750882 3300049824 Bacteria 719
851 Ga0501045_1423634 3300049824 Unclassified 503
852 nmdc:mga03683_345695_c1 3300050489 Bacteria 703
853 nmdc:mga00v17_482375_c1 3300050491 Bacteria 804
854 nmdc:mga00v17_733365_c1 3300050491 Unclassified 632
855 nmdc:mga0k408_694415_c1 3300050493 Unclassified 596
856 nmdc:mga07m45_526252_c1 3300050496 Bacteria 684
857 nmdc:mga07m45_567688_c1 3300050496 Bacteria 656
858 nmdc:mga07m45_682052_c1 3300050496 Bacteria 591
859 nmdc:mga05p37_63902_c1 3300050507 Bacteria 4530
860 nmdc:mga0qj67_165290_c1 3300050509 Bacteria 1796
861 nmdc:mga0qj67_535010_c1 3300050509 Bacteria 940
862 nmdc:mga08y16_11753_c1 3300050511 Bacteria 9197
863 nmdc:mga08y16_123582_c1 3300050511 Bacteria 2693
864 nmdc:mga08y16_1470419_c1 3300050511 Unclassified 643
865 nmdc:mga08y16_515024_c1 3300050511 Bacteria 1214
866 nmdc:mga0n895_255548_c1 3300050512 Unclassified 1778
867 nmdc:mga0rr50_118408_c1 3300050513 Unclassified 2104
868 nmdc:mga08x19_265181_c1 3300050514 Bacteria 1188
869 nmdc:mga0sz30_144664_c2 3300050516 Bacteria 695
870 nmdc:mga0sz30_222956_c1 3300050516 Bacteria 838
871 Ga0495612_0082790 3300053078 Bacteria 1350
872 Ga0495595_0392205 3300053084 Bacteria 703
873 Ga0495619_0295000 3300053085 Bacteria 1123
874 Ga0500643_006566 3300053087 Bacteria 4842
875 Ga0500643_179186 3300053087 Bacteria 568
876 Ga0500644_0118743 3300053088 Bacteria 1028
877 Ga0500583_0001730 3300053092 Bacteria 6381
878 Ga0500583_0003168 3300053092 Bacteria 5113
879 Ga0500651_0457249 3300053093 Unclassified 709
880 Ga0500641_0018311 3300053096 Bacteria 2633
881 Ga0500641_0170442 3300053096 Unclassified 937
882 Ga0500556_0000033 3300053104 Bacteria 147801
883 Ga0500556_0000549 3300053104 Bacteria 25200
884 Ga0500556_0016484 3300053104 Bacteria 2298
885 Ga0500557_158173 3300053105 Unclassified 744
886 Ga0500562_000202 3300053108 Bacteria 16162
887 Ga0500562_035872 3300053108 Bacteria 1314
888 Ga0500562_145305 3300053108 Bacteria 646
889 Ga0500594_0024949 3300053118 Bacteria 1528
890 Ga0500594_0122285 3300053118 Unclassified 818
891 Ga0500595_034889 3300053119 Bacteria 1660
892 Ga0500597_174709 3300053120 Bacteria 914
893 Ga0500617_107312 3300053124 Bacteria 1172
894 Ga0500642_0034856 3300053130 Bacteria 2133
895 Ga0500652_079453 3300053131 Bacteria 1365
896 Ga0500658_0045506 3300053134 Bacteria 1774
897 Ga0500559_0432702 3300053136 Bacteria 610
898 Ga0500561_0028843 3300053137 Bacteria 1381
899 Ga0500568_0007280 3300053139 Bacteria 5447
900 Ga0500568_0051166 3300053139 Bacteria 1626
901 Ga0500568_0087516 3300053139 Bacteria 1177
902 Ga0500568_0124194 3300053139 Unclassified 961
903 Ga0500577_0472368 3300053142 Bacteria 548
904 Ga0500588_0001229 3300053146 Bacteria 4753
905 Ga0500589_188077 3300053147 Unclassified 805
906 Ga0500604_0105037 3300053151 Unclassified 934
907 Ga0500616_0000074 3300053153 Bacteria 222910
908 Ga0500627_0226470 3300053158 Bacteria 833
909 Ga0500633_0125810 3300053160 Unclassified 955
910 Ga0500636_0252685 3300053177 Bacteria 898
911 Ga0500637_0000804 3300053178 Bacteria 12521
912 Ga0500645_004392 3300053730 Bacteria 5421
913 Ga0500656_003331 3300053732 Bacteria 1498
914 Ga0500552_056537 3300053733 Bacteria 677
915 Ga0500596_107189 3300053735 Bacteria 507
916 Ga0501084_0005783 3300054114 Bacteria 10170
917 Ga0501084_0008467 3300054114 Bacteria 8506
918 Ga0501084_1333813 3300054114 Bacteria 601
919 Ga0587073_0242058 3300059492 Bacteria 562
920 Ga0587080_081482 3300059503 Bacteria 665
921 Ga0587083_0171740 3300059505 Bacteria 601
922 Ga0587083_0226268 3300059505 Unclassified 546
923 Ga0587088_084173 3300059508 Bacteria 686
924 Ga0587089_086309 3300059509 Bacteria 553
925 Ga0587090_079888 3300059510 Bacteria 653
926 Ga0587125_032488 3300059607 Bacteria 673
927 Ga0587128_020797 3300059630 Bacteria 1006
928 Ga0587067_091641 3300059640 Bacteria 690
929 Ga0587072_114274 3300059643 Bacteria 619
930 Ga0587076_064033 3300059645 Bacteria 748
931 Ga0587079_145504 3300059647 Bacteria 608
932 Ga0587107_037040 3300059652 Bacteria 771
933 Ga0587111_0061349 3300060346 Bacteria 856
934 Ga0587111_0115460 3300060346 Bacteria 685
935 Ga0501082_0005773 3300060353 Bacteria 10741
936 Ga0501082_0077802 3300060353 Bacteria 2860
937 Ga0501082_0438602 3300060353 Bacteria 1141
938 Ga0501082_1126860 3300060353 Bacteria 686
939 Ga0501082_1255458 3300060353 Bacteria 647
940 Ga0501082_1418253 3300060353 Bacteria 606
941 Ga0466962_0000690 3300061719 Bacteria 15026
942 Ga0466962_0182138 3300061719 Bacteria 1024
943 Ga0530510_0447788 3300061734 Bacteria 976
944 Ga0530510_0578340 3300061734 Bacteria 854
945 Ga0530510_1076071 3300061734 Bacteria 616
946 Ga0530510_1162525 3300061734 Unclassified 591

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0323630 Ga0501036_0323630_611_763 38
2 3300049572 Ga0501036_0525192 Ga0501036_0525192_612_764 38
3 3300049573 Ga0501037_0471717 Ga0501037_0471717_366_518 38
4 3300049574 Ga0501038_0527902 Ga0501038_0527902_108_260 38
5 3300049575 Ga0501039_0109497 Ga0501039_0109497_1937_2089 38
6 3300049576 Ga0501040_0495195 Ga0501040_0495195_208_360 38
7 3300049577 Ga0501041_0079903 Ga0501041_0079903_842_994 38
8 3300049578 Ga0501042_0039134 Ga0501042_0039134_2090_2242 38
9 3300049578 Ga0501042_0484295 Ga0501042_0484295_41_193 38
10 3300049579 Ga0501043_0410074 Ga0501043_0410074_93_245 38
11 3300049580 Ga0501046_1119961 Ga0501046_1119961_350_502 38
12 3300049582 Ga0501048_0513547 Ga0501048_0513547_189_341 38
13 3300049587 Ga0501071_1010208 Ga0501071_1010208_444_596 38
14 3300049588 Ga0501072_0236854 Ga0501072_0236854_1169_1321 38
15 3300049588 Ga0501072_0562762 Ga0501072_0562762_74_226 38
16 3300049589 Ga0501073_0178446 Ga0501073_0178446_1073_1225 38
17 3300049591 Ga0501075_0131325 Ga0501075_0131325_983_1135 38
18 3300049592 Ga0501076_0054945 Ga0501076_0054945_614_766 38
19 3300049592 Ga0501076_0601048 Ga0501076_0601048_654_806 38
20 3300049592 Ga0501076_1327821 Ga0501076_1327821_405_557 38
21 3300049743 Ga0501081_0286176 Ga0501081_0286176_787_939 38
22 3300049824 Ga0501045_0380757 Ga0501045_0380757_28_180 38
23 3300060353 Ga0501082_1418253 Ga0501082_1418253_274_426 38
24 3300003187 JGI25151J46595_10046276 JGI25151J46595_100462762 44
25 3300003203 JGI25406J46586_10015769 JGI25406J46586_100157692 44
26 3300003323 rootH1_10118379 rootH1_101183793 44
27 3300003751 Ga0055538_1000206 Ga0055538_10002063 44
28 3300003751 Ga0055538_1000658 Ga0055538_100065812 44
29 3300003781 Ga0055536_1041917 Ga0055536_10419171 44
30 3300003781 Ga0055536_1066973 Ga0055536_10669731 44
31 3300003781 Ga0055536_1089251 Ga0055536_10892511 44
32 3300003911 JGI25405J52794_10027349 JGI25405J52794_100273492 44
33 3300005290 Ga0065712_10248897 Ga0065712_102488972 44
34 3300005327 Ga0070658_10935262 Ga0070658_109352622 44
35 3300005328 Ga0070676_10156234 Ga0070676_101562344 44
36 3300005328 Ga0070676_11394173 Ga0070676_113941731 44
37 3300005328 Ga0070676_11502862 Ga0070676_115028622 44
38 3300005329 Ga0070683_100054413 Ga0070683_1000544132 44
39 3300005329 Ga0070683_100192791 Ga0070683_1001927913 44
40 3300005330 Ga0070690_100003231 Ga0070690_10000323110 44
41 3300005330 Ga0070690_100009245 Ga0070690_1000092455 44
42 3300005331 Ga0070670_100067271 Ga0070670_1000672713 44
43 3300005331 Ga0070670_100320063 Ga0070670_1003200631 44
44 3300005331 Ga0070670_100992146 Ga0070670_1009921462 44
45 3300005333 Ga0070677_10143081 Ga0070677_101430812 44
46 3300005335 Ga0070666_10845613 Ga0070666_108456131 44
47 3300005336 Ga0070680_100025820 Ga0070680_1000258205 44
48 3300005336 Ga0070680_100093099 Ga0070680_1000930993 44
49 3300005336 Ga0070680_100879634 Ga0070680_1008796342 44
50 3300005336 Ga0070680_101699098 Ga0070680_1016990981 44
51 3300005337 Ga0070682_101551654 Ga0070682_1015516542 44
52 3300005338 Ga0068868_100931770 Ga0068868_1009317701 44
53 3300005340 Ga0070689_100010982 Ga0070689_1000109824 44
54 3300005340 Ga0070689_101638495 Ga0070689_1016384951 44
55 3300005341 Ga0070691_10140828 Ga0070691_101408282 44
56 3300005343 Ga0070687_100447103 Ga0070687_1004471032 44
57 3300005344 Ga0070661_100000183 Ga0070661_10000018332 44
58 3300005344 Ga0070661_100376717 Ga0070661_1003767172 44
59 3300005344 Ga0070661_100455303 Ga0070661_1004553032 44
60 3300005344 Ga0070661_100562570 Ga0070661_1005625702 44
61 3300005345 Ga0070692_10898304 Ga0070692_108983042 44
62 3300005347 Ga0070668_100235981 Ga0070668_1002359812 44
63 3300005347 Ga0070668_100636238 Ga0070668_1006362382 44
64 3300005353 Ga0070669_100512739 Ga0070669_1005127391 44
65 3300005353 Ga0070669_100998965 Ga0070669_1009989652 44
66 3300005354 Ga0070675_100111925 Ga0070675_1001119252 44
67 3300005355 Ga0070671_100058258 Ga0070671_1000582583 44
68 3300005355 Ga0070671_101094650 Ga0070671_1010946502 44
69 3300005355 Ga0070671_101398364 Ga0070671_1013983641 44
70 3300005355 Ga0070671_102056739 Ga0070671_1020567392 44
71 3300005356 Ga0070674_100016413 Ga0070674_1000164133 44
72 3300005364 Ga0070673_100049769 Ga0070673_1000497693 44
73 3300005364 Ga0070673_100099806 Ga0070673_1000998062 44
74 3300005364 Ga0070673_101111246 Ga0070673_1011112461 44
75 3300005364 Ga0070673_101504916 Ga0070673_1015049162 44
76 3300005365 Ga0070688_100039439 Ga0070688_1000394392 44
77 3300005365 Ga0070688_100164909 Ga0070688_1001649092 44
78 3300005366 Ga0070659_100114447 Ga0070659_1001144472 44
79 3300005366 Ga0070659_101567723 Ga0070659_1015677231 44
80 3300005434 Ga0070709_10002110 Ga0070709_100021107 44
81 3300005434 Ga0070709_10025676 Ga0070709_100256763 44
82 3300005434 Ga0070709_10345689 Ga0070709_103456892 44
83 3300005435 Ga0070714_100026296 Ga0070714_1000262962 44
84 3300005435 Ga0070714_100118183 Ga0070714_1001181832 44
85 3300005435 Ga0070714_100201334 Ga0070714_1002013342 44
86 3300005435 Ga0070714_102395599 Ga0070714_1023955991 44
87 3300005436 Ga0070713_100032340 Ga0070713_1000323404 44
88 3300005436 Ga0070713_100095748 Ga0070713_1000957483 44
89 3300005436 Ga0070713_100272792 Ga0070713_1002727922 44
90 3300005436 Ga0070713_101228603 Ga0070713_1012286031 44
91 3300005437 Ga0070710_10074514 Ga0070710_100745144 44
92 3300005437 Ga0070710_10138473 Ga0070710_101384732 44
93 3300005437 Ga0070710_10474736 Ga0070710_104747362 44
94 3300005437 Ga0070710_10543033 Ga0070710_105430331 44
95 3300005437 Ga0070710_10580617 Ga0070710_105806172 44
96 3300005438 Ga0070701_10044575 Ga0070701_100445752 44
97 3300005438 Ga0070701_10114596 Ga0070701_101145962 44
98 3300005438 Ga0070701_10119681 Ga0070701_101196814 44
99 3300005438 Ga0070701_10200321 Ga0070701_102003213 44
100 3300005438 Ga0070701_10354570 Ga0070701_103545703 44
101 3300005439 Ga0070711_100016582 Ga0070711_1000165824 44
102 3300005439 Ga0070711_100049836 Ga0070711_1000498362 44
103 3300005439 Ga0070711_100054931 Ga0070711_1000549314 44
104 3300005439 Ga0070711_100116010 Ga0070711_1001160102 44
105 3300005439 Ga0070711_101179453 Ga0070711_1011794532 44
106 3300005440 Ga0070705_100019745 Ga0070705_1000197455 44
107 3300005440 Ga0070705_101265511 Ga0070705_1012655111 44
108 3300005441 Ga0070700_100054830 Ga0070700_1000548301 44
109 3300005444 Ga0070694_100254155 Ga0070694_1002541554 44
110 3300005445 Ga0070708_100923735 Ga0070708_1009237352 44
111 3300005455 Ga0070663_100341735 Ga0070663_1003417352 44
112 3300005456 Ga0070678_100117275 Ga0070678_1001172753 44
113 3300005456 Ga0070678_100798040 Ga0070678_1007980402 44
114 3300005457 Ga0070662_100317973 Ga0070662_1003179733 44
115 3300005457 Ga0070662_100568302 Ga0070662_1005683021 44
116 3300005458 Ga0070681_10003033 Ga0070681_100030339 44
117 3300005458 Ga0070681_10019166 Ga0070681_100191664 44
118 3300005458 Ga0070681_10034405 Ga0070681_100344054 44
119 3300005458 Ga0070681_10034982 Ga0070681_100349824 44
120 3300005458 Ga0070681_10061388 Ga0070681_100613882 44
121 3300005459 Ga0068867_101271684 Ga0068867_1012716842 44
122 3300005466 Ga0070685_10101524 Ga0070685_101015241 44
123 3300005466 Ga0070685_10449132 Ga0070685_104491322 44
124 3300005468 Ga0070707_101680682 Ga0070707_1016806822 44
125 3300005518 Ga0070699_100041632 Ga0070699_1000416324 44
126 3300005530 Ga0070679_100007660 Ga0070679_1000076601 44
127 3300005530 Ga0070679_100029196 Ga0070679_1000291964 44
128 3300005530 Ga0070679_100037832 Ga0070679_1000378325 44
129 3300005530 Ga0070679_100059089 Ga0070679_1000590892 44
130 3300005530 Ga0070679_100602641 Ga0070679_1006026412 44
131 3300005535 Ga0070684_100041728 Ga0070684_1000417282 44
132 3300005535 Ga0070684_100367116 Ga0070684_1003671162 44
133 3300005535 Ga0070684_100919822 Ga0070684_1009198221 44
134 3300005535 Ga0070684_101424555 Ga0070684_1014245551 44
135 3300005536 Ga0070697_101333618 Ga0070697_1013336182 44
136 3300005539 Ga0068853_100033553 Ga0068853_1000335533 44
137 3300005539 Ga0068853_100252784 Ga0068853_1002527842 44
138 3300005539 Ga0068853_101373932 Ga0068853_1013739321 44
139 3300005539 Ga0068853_102262481 Ga0068853_1022624811 44
140 3300005543 Ga0070672_100030659 Ga0070672_1000306592 44
141 3300005543 Ga0070672_100061996 Ga0070672_1000619963 44
142 3300005543 Ga0070672_100102000 Ga0070672_1001020002 44
143 3300005543 Ga0070672_101458839 Ga0070672_1014588391 44
144 3300005543 Ga0070672_101652855 Ga0070672_1016528552 44
145 3300005544 Ga0070686_100525269 Ga0070686_1005252693 44
146 3300005545 Ga0070695_100021853 Ga0070695_1000218534 44
147 3300005545 Ga0070695_100390108 Ga0070695_1003901081 44
148 3300005546 Ga0070696_100094393 Ga0070696_1000943932 44
149 3300005547 Ga0070693_100054417 Ga0070693_1000544171 44
150 3300005547 Ga0070693_100302233 Ga0070693_1003022332 44
151 3300005547 Ga0070693_101564081 Ga0070693_1015640811 44
152 3300005548 Ga0070665_100009741 Ga0070665_1000097417 44
153 3300005548 Ga0070665_100344014 Ga0070665_1003440141 44
154 3300005548 Ga0070665_100483203 Ga0070665_1004832033 44
155 3300005548 Ga0070665_101156760 Ga0070665_1011567602 44
156 3300005548 Ga0070665_101766514 Ga0070665_1017665142 44
157 3300005549 Ga0070704_100106234 Ga0070704_1001062344 44
158 3300005563 Ga0068855_100000188 Ga0068855_10000018825 44
159 3300005563 Ga0068855_100004121 Ga0068855_1000041211 44
160 3300005563 Ga0068855_100033609 Ga0068855_1000336097 44
161 3300005563 Ga0068855_100343487 Ga0068855_1003434873 44
162 3300005563 Ga0068855_102078530 Ga0068855_1020785302 44
163 3300005563 Ga0068855_102190585 Ga0068855_1021905852 44
164 3300005564 Ga0070664_101588348 Ga0070664_1015883482 44
165 3300005577 Ga0068857_100350725 Ga0068857_1003507252 44
166 3300005577 Ga0068857_101124729 Ga0068857_1011247292 44
167 3300005578 Ga0068854_100062432 Ga0068854_1000624322 44
168 3300005578 Ga0068854_100659430 Ga0068854_1006594302 44
169 3300005614 Ga0068856_100108527 Ga0068856_1001085272 44
170 3300005614 Ga0068856_100213608 Ga0068856_1002136082 44
171 3300005615 Ga0070702_100011240 Ga0070702_1000112405 44
172 3300005616 Ga0068852_100025840 Ga0068852_1000258406 44
173 3300005616 Ga0068852_100762310 Ga0068852_1007623103 44
174 3300005616 Ga0068852_101077044 Ga0068852_1010770442 44
175 3300005617 Ga0068859_100026672 Ga0068859_1000266722 44
176 3300005617 Ga0068859_100203345 Ga0068859_1002033452 44
177 3300005617 Ga0068859_100456496 Ga0068859_1004564962 44
178 3300005617 Ga0068859_101375822 Ga0068859_1013758222 44
179 3300005618 Ga0068864_101069930 Ga0068864_1010699301 44
180 3300005718 Ga0068866_10201315 Ga0068866_102013153 44
181 3300005719 Ga0068861_100033657 Ga0068861_1000336573 44
182 3300005719 Ga0068861_100055843 Ga0068861_1000558434 44
183 3300005719 Ga0068861_100079169 Ga0068861_1000791692 44
184 3300005719 Ga0068861_100129233 Ga0068861_1001292332 44
185 3300005719 Ga0068861_100242654 Ga0068861_1002426542 44
186 3300005719 Ga0068861_100418873 Ga0068861_1004188732 44
187 3300005719 Ga0068861_100912097 Ga0068861_1009120971 44
188 3300005834 Ga0068851_10000624 Ga0068851_1000062417 44
189 3300005840 Ga0068870_10019332 Ga0068870_100193322 44
190 3300005840 Ga0068870_10030584 Ga0068870_100305841 44
191 3300005841 Ga0068863_100025727 Ga0068863_1000257274 44
192 3300005841 Ga0068863_100031365 Ga0068863_1000313655 44
193 3300005841 Ga0068863_100414435 Ga0068863_1004144352 44
194 3300005842 Ga0068858_100268235 Ga0068858_1002682354 44
195 3300005842 Ga0068858_100415704 Ga0068858_1004157043 44
196 3300005843 Ga0068860_100286937 Ga0068860_1002869372 44
197 3300005843 Ga0068860_100774913 Ga0068860_1007749132 44
198 3300005844 Ga0068862_100043148 Ga0068862_1000431485 44
199 3300005844 Ga0068862_100138133 Ga0068862_1001381334 44
200 3300005844 Ga0068862_100180570 Ga0068862_1001805702 44
201 3300005844 Ga0068862_100273738 Ga0068862_1002737384 44
202 3300005844 Ga0068862_100305677 Ga0068862_1003056773 44
203 3300005844 Ga0068862_100362944 Ga0068862_1003629444 44
204 3300005844 Ga0068862_100583577 Ga0068862_1005835772 44
205 3300005937 Ga0081455_10003146 Ga0081455_100031467 44
206 3300005937 Ga0081455_10009144 Ga0081455_100091447 44
207 3300005937 Ga0081455_10183503 Ga0081455_101835034 44
208 3300005937 Ga0081455_11011973 Ga0081455_110119732 44
209 3300005985 Ga0081539_10000007 Ga0081539_10000007112 44
210 3300005985 Ga0081539_10265733 Ga0081539_102657332 44
211 3300006028 Ga0070717_10036645 Ga0070717_100366455 44
212 3300006051 Ga0075364_10205878 Ga0075364_102058782 44
213 3300006163 Ga0070715_10077091 Ga0070715_100770912 44
214 3300006163 Ga0070715_10241849 Ga0070715_102418492 44
215 3300006173 Ga0070716_100019529 Ga0070716_1000195295 44
216 3300006173 Ga0070716_100047162 Ga0070716_1000471624 44
217 3300006173 Ga0070716_101512196 Ga0070716_1015121962 44
218 3300006175 Ga0070712_100040536 Ga0070712_1000405364 44
219 3300006175 Ga0070712_100583070 Ga0070712_1005830701 44
220 3300006186 Ga0075369_10358224 Ga0075369_103582242 44
221 3300006195 Ga0075366_10397780 Ga0075366_103977802 44
222 3300006195 Ga0075366_11065825 Ga0075366_110658252 44
223 3300006237 Ga0097621_100172832 Ga0097621_1001728322 44
224 3300006237 Ga0097621_100234457 Ga0097621_1002344575 44
225 3300006237 Ga0097621_100328057 Ga0097621_1003280572 44
226 3300006237 Ga0097621_100471259 Ga0097621_1004712594 44
227 3300006237 Ga0097621_101085435 Ga0097621_1010854352 44
228 3300006237 Ga0097621_102270138 Ga0097621_1022701382 44
229 3300006353 Ga0075370_10095999 Ga0075370_100959991 44
230 3300006353 Ga0075370_10103459 Ga0075370_101034592 44
231 3300006358 Ga0068871_100075785 Ga0068871_1000757852 44
232 3300006358 Ga0068871_100146619 Ga0068871_1001466193 44
233 3300006358 Ga0068871_100205879 Ga0068871_1002058792 44
234 3300006358 Ga0068871_100467226 Ga0068871_1004672263 44
235 3300006358 Ga0068871_100967190 Ga0068871_1009671901 44
236 3300006844 Ga0075428_100002697 Ga0075428_10000269718 44
237 3300006844 Ga0075428_100741808 Ga0075428_1007418084 44
238 3300006846 Ga0075430_100224532 Ga0075430_1002245322 44
239 3300006846 Ga0075430_100471331 Ga0075430_1004713314 44
240 3300006871 Ga0075434_100246605 Ga0075434_1002466054 44
241 3300006881 Ga0068865_100056081 Ga0068865_1000560814 44
242 3300006881 Ga0068865_100507923 Ga0068865_1005079232 44
243 3300006881 Ga0068865_100543380 Ga0068865_1005433803 44
244 3300006881 Ga0068865_100647878 Ga0068865_1006478782 44
245 3300006914 Ga0075436_100145267 Ga0075436_1001452672 44
246 3300006931 Ga0097620_100026672 Ga0097620_1000266722 44
247 3300006931 Ga0097620_100203345 Ga0097620_1002033452 44
248 3300006931 Ga0097620_100456474 Ga0097620_1004564744 44
249 3300006931 Ga0097620_101375339 Ga0097620_1013753391 44
250 3300007076 Ga0075435_100143865 Ga0075435_1001438654 44
251 3300007788 Ga0099795_10000282 Ga0099795_100002825 44
252 3300009093 Ga0105240_10005799 Ga0105240_100057993 44
253 3300009093 Ga0105240_10051665 Ga0105240_100516651 44
254 3300009093 Ga0105240_10174910 Ga0105240_101749101 44
255 3300009093 Ga0105240_10235256 Ga0105240_102352563 44
256 3300009093 Ga0105240_12676154 Ga0105240_126761541 44
257 3300009094 Ga0111539_10207184 Ga0111539_102071844 44
258 3300009094 Ga0111539_10255994 Ga0111539_102559944 44
259 3300009094 Ga0111539_11533508 Ga0111539_115335082 44
260 3300009098 Ga0105245_10374606 Ga0105245_103746062 44
261 3300009098 Ga0105245_11119519 Ga0105245_111195193 44
262 3300009098 Ga0105245_11842389 Ga0105245_118423891 44
263 3300009147 Ga0114129_10012058 Ga0114129_100120584 44
264 3300009148 Ga0105243_11137592 Ga0105243_111375922 44
265 3300009174 Ga0105241_11803145 Ga0105241_118031452 44
266 3300009174 Ga0105241_11940069 Ga0105241_119400692 44
267 3300009176 Ga0105242_10470967 Ga0105242_104709672 44
268 3300009176 Ga0105242_10760987 Ga0105242_107609873 44
269 3300009176 Ga0105242_11176334 Ga0105242_111763342 44
270 3300009177 Ga0105248_10136603 Ga0105248_101366034 44
271 3300009545 Ga0105237_10294384 Ga0105237_102943841 44
272 3300009545 Ga0105237_10448494 Ga0105237_104484942 44
273 3300009545 Ga0105237_10655183 Ga0105237_106551833 44
274 3300009545 Ga0105237_11057173 Ga0105237_110571732 44
275 3300009545 Ga0105237_11600214 Ga0105237_116002141 44
276 3300009551 Ga0105238_10036079 Ga0105238_100360793 44
277 3300009551 Ga0105238_10062041 Ga0105238_100620411 44
278 3300009551 Ga0105238_10124228 Ga0105238_101242281 44
279 3300009551 Ga0105238_10685246 Ga0105238_106852462 44
280 3300009551 Ga0105238_12940494 Ga0105238_129404941 44
281 3300009553 Ga0105249_10431405 Ga0105249_104314053 44
282 3300009553 Ga0105249_11076291 Ga0105249_110762912 44
283 3300010159 Ga0099796_10000351 Ga0099796_100003514 44
284 3300010375 Ga0105239_10005674 Ga0105239_1000567412 44
285 3300010375 Ga0105239_10011221 Ga0105239_100112214 44
286 3300010375 Ga0105239_10239173 Ga0105239_102391731 44
287 3300010375 Ga0105239_10578061 Ga0105239_105780613 44
288 3300010375 Ga0105239_12274522 Ga0105239_122745221 44
289 3300011119 Ga0105246_11333597 Ga0105246_113335972 44
290 3300011119 Ga0105246_12147077 Ga0105246_121470772 44
291 3300013100 Ga0157373_10872349 Ga0157373_108723491 44
292 3300013104 Ga0157370_10024850 Ga0157370_100248503 44
293 3300013104 Ga0157370_10053986 Ga0157370_100539863 44
294 3300013104 Ga0157370_10276958 Ga0157370_102769583 44
295 3300013104 Ga0157370_11348601 Ga0157370_113486011 44
296 3300013105 Ga0157369_10008652 Ga0157369_100086528 44
297 3300013105 Ga0157369_10027891 Ga0157369_100278912 44
298 3300013105 Ga0157369_10042967 Ga0157369_100429674 44
299 3300013105 Ga0157369_10043594 Ga0157369_100435941 44
300 3300013105 Ga0157369_10218110 Ga0157369_102181102 44
301 3300013296 Ga0157374_10174061 Ga0157374_101740612 44
302 3300013296 Ga0157374_10259725 Ga0157374_102597252 44
303 3300013296 Ga0157374_12649916 Ga0157374_126499161 44
304 3300013297 Ga0157378_10056476 Ga0157378_100564763 44
305 3300013297 Ga0157378_10115932 Ga0157378_101159323 44
306 3300013297 Ga0157378_11645549 Ga0157378_116455492 44
307 3300013297 Ga0157378_12058916 Ga0157378_120589162 44
308 3300013306 Ga0163162_13232927 Ga0163162_132329272 44
309 3300013307 Ga0157372_10108989 Ga0157372_101089893 44
310 3300013307 Ga0157372_10340299 Ga0157372_103402992 44
311 3300013308 Ga0157375_10549287 Ga0157375_105492871 44
312 3300013308 Ga0157375_10774259 Ga0157375_107742591 44
313 3300014325 Ga0163163_10437165 Ga0163163_104371653 44
314 3300014325 Ga0163163_13105034 Ga0163163_131050341 44
315 3300014326 Ga0157380_10012927 Ga0157380_100129274 44
316 3300014326 Ga0157380_10015948 Ga0157380_100159482 44
317 3300014326 Ga0157380_10452107 Ga0157380_104521072 44
318 3300014745 Ga0157377_10449587 Ga0157377_104495872 44
319 3300014968 Ga0157379_10970303 Ga0157379_109703032 44
320 3300014968 Ga0157379_12353362 Ga0157379_123533622 44
321 3300014969 Ga0157376_10150997 Ga0157376_101509972 44
322 3300014969 Ga0157376_11489396 Ga0157376_114893962 44
323 3300014969 Ga0157376_12399733 Ga0157376_123997332 44
324 3300014969 Ga0157376_12857424 Ga0157376_128574241 44
325 3300017792 Ga0163161_11059262 Ga0163161_110592622 44
326 3300020070 Ga0206356_11774328 Ga0206356_117743282 44
327 3300020076 Ga0206355_1088868 Ga0206355_10888682 44
328 3300020082 Ga0206353_11331178 Ga0206353_113311781 44
329 3300021358 Ga0213873_10019840 Ga0213873_100198402 44
330 3300021377 Ga0213874_10005856 Ga0213874_100058563 44
331 3300021377 Ga0213874_10172082 Ga0213874_101720822 44
332 3300021384 Ga0213876_10206594 Ga0213876_102065941 44
333 3300021384 Ga0213876_10235677 Ga0213876_102356772 44
334 3300021388 Ga0213875_10119915 Ga0213875_101199152 44
335 3300021441 Ga0213871_10057376 Ga0213871_100573762 44
336 3300021441 Ga0213871_10072548 Ga0213871_100725483 44
337 3300021441 Ga0213871_10129833 Ga0213871_101298331 44
338 3300022467 Ga0224712_10431233 Ga0224712_104312332 44
339 3300025321 Ga0207656_10000370 Ga0207656_100003704 44
340 3300025893 Ga0207682_10152043 Ga0207682_101520432 44
341 3300025893 Ga0207682_10532343 Ga0207682_105323432 44
342 3300025898 Ga0207692_10069210 Ga0207692_100692102 44
343 3300025898 Ga0207692_10211770 Ga0207692_102117702 44
344 3300025898 Ga0207692_10835598 Ga0207692_108355981 44
345 3300025898 Ga0207692_10840439 Ga0207692_108404393 44
346 3300025899 Ga0207642_10823791 Ga0207642_108237912 44
347 3300025901 Ga0207688_10625688 Ga0207688_106256881 44
348 3300025903 Ga0207680_10684593 Ga0207680_106845932 44
349 3300025904 Ga0207647_10431481 Ga0207647_104314812 44
350 3300025905 Ga0207685_10068339 Ga0207685_100683393 44
351 3300025905 Ga0207685_10082343 Ga0207685_100823434 44
352 3300025906 Ga0207699_10001988 Ga0207699_100019886 44
353 3300025906 Ga0207699_10036146 Ga0207699_100361463 44
354 3300025906 Ga0207699_10545610 Ga0207699_105456102 44
355 3300025907 Ga0207645_10021794 Ga0207645_100217944 44
356 3300025907 Ga0207645_10047720 Ga0207645_100477204 44
357 3300025907 Ga0207645_10316290 Ga0207645_103162902 44
358 3300025908 Ga0207643_10082801 Ga0207643_100828012 44
359 3300025908 Ga0207643_10095420 Ga0207643_100954204 44
360 3300025909 Ga0207705_11229801 Ga0207705_112298012 44
361 3300025911 Ga0207654_10068226 Ga0207654_100682263 44
362 3300025912 Ga0207707_10000213 Ga0207707_1000021330 44
363 3300025912 Ga0207707_10007306 Ga0207707_1000730610 44
364 3300025912 Ga0207707_10014745 Ga0207707_100147452 44
365 3300025912 Ga0207707_10020379 Ga0207707_100203793 44
366 3300025912 Ga0207707_10060237 Ga0207707_100602373 44
367 3300025912 Ga0207707_10112937 Ga0207707_101129371 44
368 3300025912 Ga0207707_10168475 Ga0207707_101684754 44
369 3300025912 Ga0207707_10327100 Ga0207707_103271003 44
370 3300025913 Ga0207695_10014424 Ga0207695_100144244 44
371 3300025913 Ga0207695_10014685 Ga0207695_100146851 44
372 3300025913 Ga0207695_10091957 Ga0207695_100919572 44
373 3300025913 Ga0207695_10124464 Ga0207695_101244641 44
374 3300025914 Ga0207671_10064212 Ga0207671_100642123 44
375 3300025914 Ga0207671_10194204 Ga0207671_101942043 44
376 3300025914 Ga0207671_10624564 Ga0207671_106245642 44
377 3300025914 Ga0207671_10651393 Ga0207671_106513933 44
378 3300025914 Ga0207671_10679451 Ga0207671_106794512 44
379 3300025915 Ga0207693_10045072 Ga0207693_100450722 44
380 3300025915 Ga0207693_10133955 Ga0207693_101339551 44
381 3300025915 Ga0207693_10745490 Ga0207693_107454902 44
382 3300025916 Ga0207663_10082654 Ga0207663_100826543 44
383 3300025916 Ga0207663_10182166 Ga0207663_101821664 44
384 3300025916 Ga0207663_10194963 Ga0207663_101949633 44
385 3300025916 Ga0207663_10224888 Ga0207663_102248883 44
386 3300025917 Ga0207660_10012076 Ga0207660_100120764 44
387 3300025917 Ga0207660_10021999 Ga0207660_100219991 44
388 3300025917 Ga0207660_10026451 Ga0207660_100264511 44
389 3300025918 Ga0207662_10245185 Ga0207662_102451852 44
390 3300025920 Ga0207649_10002528 Ga0207649_100025283 44
391 3300025920 Ga0207649_11145062 Ga0207649_111450622 44
392 3300025921 Ga0207652_10006162 Ga0207652_100061624 44
393 3300025921 Ga0207652_10044577 Ga0207652_100445774 44
394 3300025921 Ga0207652_10085557 Ga0207652_100855571 44
395 3300025921 Ga0207652_10231148 Ga0207652_102311483 44
396 3300025923 Ga0207681_10071969 Ga0207681_100719694 44
397 3300025923 Ga0207681_10744961 Ga0207681_107449612 44
398 3300025924 Ga0207694_10071649 Ga0207694_100716492 44
399 3300025924 Ga0207694_10134634 Ga0207694_101346343 44
400 3300025924 Ga0207694_10164325 Ga0207694_101643252 44
401 3300025924 Ga0207694_10193405 Ga0207694_101934051 44
402 3300025924 Ga0207694_11391148 Ga0207694_113911482 44
403 3300025926 Ga0207659_10087563 Ga0207659_100875633 44
404 3300025927 Ga0207687_10401748 Ga0207687_104017482 44
405 3300025928 Ga0207700_10091906 Ga0207700_100919062 44
406 3300025928 Ga0207700_10112405 Ga0207700_101124053 44
407 3300025928 Ga0207700_10236793 Ga0207700_102367932 44
408 3300025929 Ga0207664_10020147 Ga0207664_100201474 44
409 3300025929 Ga0207664_10217220 Ga0207664_102172201 44
410 3300025929 Ga0207664_10277403 Ga0207664_102774033 44
411 3300025929 Ga0207664_10752809 Ga0207664_107528093 44
412 3300025931 Ga0207644_10617315 Ga0207644_106173151 44
413 3300025932 Ga0207690_11135952 Ga0207690_111359521 44
414 3300025933 Ga0207706_10120388 Ga0207706_101203883 44
415 3300025933 Ga0207706_10382206 Ga0207706_103822062 44
416 3300025934 Ga0207686_10043481 Ga0207686_100434814 44
417 3300025934 Ga0207686_10284565 Ga0207686_102845653 44
418 3300025934 Ga0207686_10399330 Ga0207686_103993301 44
419 3300025934 Ga0207686_11180846 Ga0207686_111808462 44
420 3300025936 Ga0207670_10086237 Ga0207670_100862372 44
421 3300025936 Ga0207670_11087621 Ga0207670_110876212 44
422 3300025937 Ga0207669_10115986 Ga0207669_101159862 44
423 3300025937 Ga0207669_10606015 Ga0207669_106060152 44
424 3300025937 Ga0207669_10840680 Ga0207669_108406802 44
425 3300025938 Ga0207704_10185268 Ga0207704_101852682 44
426 3300025938 Ga0207704_10362282 Ga0207704_103622822 44
427 3300025938 Ga0207704_11442475 Ga0207704_114424751 44
428 3300025939 Ga0207665_10064341 Ga0207665_100643412 44
429 3300025939 Ga0207665_10068196 Ga0207665_100681963 44
430 3300025939 Ga0207665_11095268 Ga0207665_110952682 44
431 3300025940 Ga0207691_10017268 Ga0207691_100172684 44
432 3300025940 Ga0207691_10018434 Ga0207691_100184344 44
433 3300025940 Ga0207691_10097535 Ga0207691_100975354 44
434 3300025944 Ga0207661_10057652 Ga0207661_100576522 44
435 3300025944 Ga0207661_10227524 Ga0207661_102275242 44
436 3300025945 Ga0207679_10396417 Ga0207679_103964174 44
437 3300025949 Ga0207667_10000417 Ga0207667_100004178 44
438 3300025949 Ga0207667_10004450 Ga0207667_100044507 44
439 3300025949 Ga0207667_10016797 Ga0207667_100167977 44
440 3300025949 Ga0207667_10244877 Ga0207667_102448774 44
441 3300025949 Ga0207667_11529482 Ga0207667_115294821 44
442 3300025949 Ga0207667_12089198 Ga0207667_120891982 44
443 3300025960 Ga0207651_10057790 Ga0207651_100577903 44
444 3300025960 Ga0207651_10076087 Ga0207651_100760872 44
445 3300025960 Ga0207651_10317734 Ga0207651_103177344 44
446 3300025961 Ga0207712_10128936 Ga0207712_101289364 44
447 3300025972 Ga0207668_10402796 Ga0207668_104027963 44
448 3300025972 Ga0207668_11109914 Ga0207668_111099141 44
449 3300025981 Ga0207640_10017150 Ga0207640_100171502 44
450 3300025981 Ga0207640_10745333 Ga0207640_107453332 44
451 3300025986 Ga0207658_12017914 Ga0207658_120179142 44
452 3300026023 Ga0207677_10602364 Ga0207677_106023643 44
453 3300026035 Ga0207703_10137721 Ga0207703_101377212 44
454 3300026035 Ga0207703_11046202 Ga0207703_110462021 44
455 3300026041 Ga0207639_10001042 Ga0207639_100010423 44
456 3300026041 Ga0207639_10387857 Ga0207639_103878571 44
457 3300026041 Ga0207639_11856794 Ga0207639_118567941 44
458 3300026075 Ga0207708_11861019 Ga0207708_118610192 44
459 3300026078 Ga0207702_10079829 Ga0207702_100798292 44
460 3300026078 Ga0207702_10092220 Ga0207702_100922202 44
461 3300026078 Ga0207702_11326402 Ga0207702_113264022 44
462 3300026088 Ga0207641_10029602 Ga0207641_100296024 44
463 3300026089 Ga0207648_10038337 Ga0207648_100383376 44
464 3300026089 Ga0207648_10353672 Ga0207648_103536722 44
465 3300026089 Ga0207648_11167679 Ga0207648_111676792 44
466 3300026095 Ga0207676_10312610 Ga0207676_103126102 44
467 3300026095 Ga0207676_10815221 Ga0207676_108152212 44
468 3300026116 Ga0207674_10147374 Ga0207674_101473743 44
469 3300026116 Ga0207674_10313032 Ga0207674_103130324 44
470 3300026118 Ga0207675_100074665 Ga0207675_1000746654 44
471 3300026118 Ga0207675_100084724 Ga0207675_1000847242 44
472 3300026118 Ga0207675_100244191 Ga0207675_1002441912 44
473 3300026118 Ga0207675_100253596 Ga0207675_1002535962 44
474 3300026118 Ga0207675_100541373 Ga0207675_1005413732 44
475 3300026118 Ga0207675_100608281 Ga0207675_1006082812 44
476 3300026118 Ga0207675_100618658 Ga0207675_1006186582 44
477 3300026118 Ga0207675_100844461 Ga0207675_1008444612 44
478 3300026121 Ga0207683_10278448 Ga0207683_102784483 44
479 3300026121 Ga0207683_11651289 Ga0207683_116512891 44
480 3300026142 Ga0207698_10004240 Ga0207698_100042408 44
481 3300026142 Ga0207698_10640694 Ga0207698_106406942 44
482 3300026142 Ga0207698_11043519 Ga0207698_110435192 44
483 3300026142 Ga0207698_11738529 Ga0207698_117385292 44
484 3300027395 Ga0209996_1026242 Ga0209996_10262422 44
485 3300027462 Ga0210000_1062558 Ga0210000_10625581 44
486 3300027512 Ga0209179_1000011 Ga0209179_100001112 44
487 3300027614 Ga0209970_1014213 Ga0209970_10142132 44
488 3300027617 Ga0210002_1042785 Ga0210002_10427852 44
489 3300027665 Ga0209983_1025191 Ga0209983_10251912 44
490 3300027682 Ga0209971_1003831 Ga0209971_10038312 44
491 3300027907 Ga0207428_10073761 Ga0207428_100737612 44
492 3300028379 Ga0268266_10008271 Ga0268266_100082713 44
493 3300028379 Ga0268266_10019127 Ga0268266_100191274 44
494 3300028379 Ga0268266_10285364 Ga0268266_102853642 44
495 3300028379 Ga0268266_10289921 Ga0268266_102899213 44
496 3300028379 Ga0268266_11337733 Ga0268266_113377332 44
497 3300028379 Ga0268266_12335084 Ga0268266_123350841 44
498 3300028380 Ga0268265_10049380 Ga0268265_100493804 44
499 3300028380 Ga0268265_10162718 Ga0268265_101627182 44
500 3300028380 Ga0268265_10187412 Ga0268265_101874124 44
501 3300028380 Ga0268265_10273390 Ga0268265_102733902 44
502 3300028380 Ga0268265_10598796 Ga0268265_105987962 44
503 3300028380 Ga0268265_11729258 Ga0268265_117292582 44
504 3300028381 Ga0268264_10234722 Ga0268264_102347224 44
505 3300028381 Ga0268264_12282993 Ga0268264_122829931 44
506 3300028786 Ga0307517_10628206 Ga0307517_106282061 44
507 3300028794 Ga0307515_10448584 Ga0307515_104485842 44
508 3300031090 Ga0265760_10132502 Ga0265760_101325022 44
509 3300031235 Ga0265330_10003651 Ga0265330_100036512 44
510 3300031238 Ga0265332_10013547 Ga0265332_100135474 44
511 3300031241 Ga0265325_10052553 Ga0265325_100525534 44
512 3300031247 Ga0265340_10000356 Ga0265340_100003569 44
513 3300031247 Ga0265340_10002297 Ga0265340_100022976 44
514 3300031247 Ga0265340_10026230 Ga0265340_100262302 44
515 3300031250 Ga0265331_10010679 Ga0265331_100106792 44
516 3300031250 Ga0265331_10053274 Ga0265331_100532742 44
517 3300031344 Ga0265316_10000146 Ga0265316_1000014645 44
518 3300031344 Ga0265316_10005304 Ga0265316_100053044 44
519 3300031344 Ga0265316_10019427 Ga0265316_100194278 44
520 3300031344 Ga0265316_10143604 Ga0265316_101436044 44
521 3300031456 Ga0307513_10860728 Ga0307513_108607282 44
522 3300031507 Ga0307509_10391286 Ga0307509_103912862 44
523 3300031548 Ga0307408_100014096 Ga0307408_1000140966 44
524 3300031548 Ga0307408_100199178 Ga0307408_1001991782 44
525 3300031548 Ga0307408_100243515 Ga0307408_1002435152 44
526 3300031595 Ga0265313_10011164 Ga0265313_100111647 44
527 3300031711 Ga0265314_10018561 Ga0265314_100185618 44
528 3300031711 Ga0265314_10020776 Ga0265314_100207764 44
529 3300031711 Ga0265314_10034849 Ga0265314_100348492 44
530 3300031712 Ga0265342_10009625 Ga0265342_100096257 44
531 3300031728 Ga0316578_10056067 Ga0316578_100560673 44
532 3300031730 Ga0307516_10027775 Ga0307516_100277754 44
533 3300031731 Ga0307405_10003677 Ga0307405_100036772 44
534 3300031731 Ga0307405_10100758 Ga0307405_101007582 44
535 3300031731 Ga0307405_10343032 Ga0307405_103430322 44
536 3300031824 Ga0307413_10099863 Ga0307413_100998633 44
537 3300031824 Ga0307413_11325960 Ga0307413_113259601 44
538 3300031852 Ga0307410_10087072 Ga0307410_100870722 44
539 3300031852 Ga0307410_10147680 Ga0307410_101476802 44
540 3300031852 Ga0307410_10249791 Ga0307410_102497912 44
541 3300031901 Ga0307406_10008451 Ga0307406_100084516 44
542 3300031901 Ga0307406_10127370 Ga0307406_101273702 44
543 3300031903 Ga0307407_10071208 Ga0307407_100712082 44
544 3300031903 Ga0307407_10484863 Ga0307407_104848632 44
545 3300031911 Ga0307412_10865391 Ga0307412_108653912 44
546 3300031995 Ga0307409_100089593 Ga0307409_1000895932 44
547 3300031995 Ga0307409_100180885 Ga0307409_1001808852 44
548 3300031995 Ga0307409_100339220 Ga0307409_1003392202 44
549 3300031995 Ga0307409_101444270 Ga0307409_1014442702 44
550 3300032002 Ga0307416_100017839 Ga0307416_1000178392 44
551 3300032002 Ga0307416_100056976 Ga0307416_1000569762 44
552 3300032002 Ga0307416_100787918 Ga0307416_1007879182 44
553 3300032004 Ga0307414_10416850 Ga0307414_104168502 44
554 3300032004 Ga0307414_10704840 Ga0307414_107048401 44
555 3300032004 Ga0307414_10879792 Ga0307414_108797922 44
556 3300032005 Ga0307411_10010900 Ga0307411_100109002 44
557 3300032005 Ga0307411_10231863 Ga0307411_102318632 44
558 3300032005 Ga0307411_10551300 Ga0307411_105513001 44
559 3300032126 Ga0307415_100010480 Ga0307415_1000104803 44
560 3300032126 Ga0307415_100044945 Ga0307415_1000449454 44
561 3300032126 Ga0307415_100559809 Ga0307415_1005598092 44
562 3300032126 Ga0307415_101853842 Ga0307415_1018538422 44
563 3300032168 Ga0316593_10013972 Ga0316593_100139723 44
564 3300032168 Ga0316593_10050031 Ga0316593_100500313 44
565 3300035086 Ga0373934_0028694 Ga0373934_0028694_1038_1172 44
566 3300035111 Ga0373923_0217042 Ga0373923_0217042_83_217 44
567 3300035113 Ga0373936_0305206 Ga0373936_0305206_185_319 44
568 3300035116 Ga0373945_0159125 Ga0373945_0159125_32_166 44
569 3300035117 Ga0373953_0131990 Ga0373953_0131990_40_174 44
570 3300035117 Ga0373953_0292554 Ga0373953_0292554_268_402 44
571 3300035118 Ga0373954_0011589 Ga0373954_0011589_990_1124 44
572 3300035119 Ga0373956_0068388 Ga0373956_0068388_347_481 44
573 3300035119 Ga0373956_0103361 Ga0373956_0103361_1104_1238 44
574 3300035120 Ga0373957_0087056 Ga0373957_0087056_440_574 44
575 3300035171 Ga0373946_0037368 Ga0373946_0037368_1164_1298 44
576 3300035171 Ga0373946_0084106 Ga0373946_0084106_199_333 44
577 3300035172 Ga0373955_0363998 Ga0373955_0363998_50_184 44
578 3300035241 Ga0373961_0327814 Ga0373961_0327814_96_230 44
579 3300035398 Ga0316574_0125189 Ga0316574_0125189_631_786 44
580 3300035398 Ga0316574_0872616 Ga0316574_0872616_329_463 44
581 3300035691 Ga0373931_1084408 Ga0373931_1084408_116_250 44
582 3300035692 Ga0373935_0113584 Ga0373935_0113584_1328_1462 44
583 3300035695 Ga0373927_0293847 Ga0373927_0293847_423_557 44
584 3300035695 Ga0373927_0745948 Ga0373927_0745948_111_245 44
585 3300035724 Ga0373933_0013068 Ga0373933_0013068_3160_3294 44
586 3300035724 Ga0373933_0302952 Ga0373933_0302952_645_779 44
587 3300035725 Ga0373947_0106191 Ga0373947_0106191_143_277 44
588 3300035725 Ga0373947_0532529 Ga0373947_0532529_565_699 44
589 3300036401 Ga0373937_0003538 Ga0373937_0003538_1048_1182 44
590 3300036401 Ga0373937_0158586 Ga0373937_0158586_1389_1523 44
591 3300036401 Ga0373937_0373072 Ga0373937_0373072_294_428 44
592 3300036401 Ga0373937_1472491 Ga0373937_1472491_464_598 44
593 3300036401 Ga0373937_1869959 Ga0373937_1869959_142_276 44
594 3300036647 Ga0316582_0054406 Ga0316582_0054406_2188_2322 44
595 3300036647 Ga0316582_0648356 Ga0316582_0648356_474_608 44
596 3300037312 Ga0395899_0593172 Ga0395899_0593172_127_261 44
597 3300037418 Ga0395900_0062660 Ga0395900_0062660_536_670 44
598 3300037418 Ga0395900_0233243 Ga0395900_0233243_1025_1159 44
599 3300037466 Ga0395898_0034073 Ga0395898_0034073_99_233 44
600 3300037466 Ga0395898_0163271 Ga0395898_0163271_1267_1401 44
601 3300037466 Ga0395898_0584594 Ga0395898_0584594_92_226 44
602 3300037471 Ga0395905_0379781 Ga0395905_0379781_762_896 44
603 3300037853 Ga0436364_0422126 Ga0436364_0422126_124_258 44
604 3300037853 Ga0436364_0507816 Ga0436364_0507816_378_512 44
605 3300038443 Ga0395901_0235546 Ga0395901_0235546_659_793 44
606 3300038443 Ga0395901_1035192 Ga0395901_1035192_224_358 44
607 3300038443 Ga0395901_1495614 Ga0395901_1495614_417_551 44
608 3300038726 Ga0400490_27866 Ga0400490_27866_25731_25865 44
609 3300038741 Ga0400488_14628 Ga0400488_14628_2943_3077 44
610 3300038741 Ga0400488_36631 Ga0400488_36631_13_147 44
611 3300038741 Ga0400488_39676 Ga0400488_39676_2977_3111 44
612 3300038741 Ga0400488_62698 Ga0400488_62698_826_960 44
613 3300038742 Ga0400486_29232 Ga0400486_29232_278_412 44
614 3300039062 Ga0400483_007661 Ga0400483_007661_8097_8231 44
615 3300039062 Ga0400483_031605 Ga0400483_031605_1127_1261 44
616 3300039062 Ga0400483_059913 Ga0400483_059913_1180_1314 44
617 3300039062 Ga0400483_091647 Ga0400483_091647_5143_5277 44
618 3300039062 Ga0400483_122739 Ga0400483_122739_21490_21624 44
619 3300039062 Ga0400483_165155 Ga0400483_165155_3434_3568 44
620 3300039062 Ga0400483_167560 Ga0400483_167560_390_524 44
621 3300039062 Ga0400483_269614 Ga0400483_269614_7403_7537 44
622 3300039062 Ga0400483_286327 Ga0400483_286327_12534_12668 44
623 3300039110 Ga0400487_51472 Ga0400487_51472_3605_3739 44
624 3300039437 Ga0436365_0990718 Ga0436365_0990718_204_338 44
625 3300039437 Ga0436365_1123454 Ga0436365_1123454_193_327 44
626 3300039437 Ga0436365_1829985 Ga0436365_1829985_638_772 44
627 3300039438 Ga0436360_0230968 Ga0436360_0230968_496_630 44
628 3300039438 Ga0436360_0249274 Ga0436360_0249274_387_521 44
629 3300039438 Ga0436360_0846674 Ga0436360_0846674_344_478 44
630 3300039438 Ga0436360_0887930 Ga0436360_0887930_436_570 44
631 3300039438 Ga0436360_1157685 Ga0436360_1157685_7097_7231 44
632 3300039447 Ga0436361_0275763 Ga0436361_0275763_70_204 44
633 3300039450 Ga0436363_0040943 Ga0436363_0040943_980_1114 44
634 3300039450 Ga0436363_0073651 Ga0436363_0073651_1227_1361 44
635 3300039450 Ga0436363_0117506 Ga0436363_0117506_2623_2757 44
636 3300039450 Ga0436363_0382304 Ga0436363_0382304_337_471 44
637 3300039450 Ga0436363_0553853 Ga0436363_0553853_95_229 44
638 3300039453 Ga0436362_0751592 Ga0436362_0751592_3831_3965 44
639 3300039453 Ga0436362_1213266 Ga0436362_1213266_163_297 44
640 3300041406 Ga0439439_0027133 Ga0439439_0027133_414_566 44
641 3300041408 Ga0439453_0006516 Ga0439453_0006516_144_296 44
642 3300041410 Ga0439461_0002922 Ga0439461_0002922_1579_1731 44
643 3300041410 Ga0439461_0143519 Ga0439461_0143519_225_359 44
644 3300041411 Ga0439466_0162554 Ga0439466_0162554_169_303 44
645 3300041413 Ga0439465_0042626 Ga0439465_0042626_205_342 44
646 3300041413 Ga0439465_0051976 Ga0439465_0051976_1057_1194 44
647 3300041413 Ga0439465_0052220 Ga0439465_0052220_956_1090 44
648 3300041451 Ga0451791_0349922 Ga0451791_0349922_13_147 44
649 3300041452 Ga0451793_1904977 Ga0451793_1904977_168_305 44
650 3300041456 Ga0451795_0207582 Ga0451795_0207582_294_428 44
651 3300041458 Ga0451798_0531086 Ga0451798_0531086_339_473 44
652 3300041463 Ga0451804_0349009 Ga0451804_0349009_114_248 44
653 3300041486 Ga0451807_1912619 Ga0451807_1912619_147_281 44
654 3300041496 Ga0451839_1253933 Ga0451839_1253933_104_241 44
655 3300041496 Ga0451839_1368483 Ga0451839_1368483_125_259 44
656 3300041511 Ga0451855_0421856 Ga0451855_0421856_290_424 44
657 3300041512 Ga0451853_2078235 Ga0451853_2078235_366_500 44
658 3300041512 Ga0451853_3356625 Ga0451853_3356625_65_199 44
659 3300041997 Ga0439431_0132112 Ga0439431_0132112_413_547 44
660 3300041997 Ga0439431_0265471 Ga0439431_0265471_33_167 44
661 3300041999 Ga0439433_0020103 Ga0439433_0020103_1324_1476 44
662 3300042001 Ga0439441_004293 Ga0439441_004293_159_293 44
663 3300042003 Ga0439443_002580 Ga0439443_002580_977_1129 44
664 3300042004 Ga0439445_0189597 Ga0439445_0189597_145_297 44
665 3300042004 Ga0439445_0201043 Ga0439445_0201043_441_575 44
666 3300042007 Ga0439449_0315167 Ga0439449_0315167_82_219 44
667 3300042009 Ga0439451_039226 Ga0439451_039226_456_608 44
668 3300042009 Ga0439451_093501 Ga0439451_093501_20_154 44
669 3300042011 Ga0439454_060004 Ga0439454_060004_454_606 44
670 3300042013 Ga0439456_006559 Ga0439456_006559_1499_1651 44
671 3300042122 Ga0450920_002594 Ga0450920_002594_729_881 44
672 3300042125 Ga0450923_068802 Ga0450923_068802_565_717 44
673 3300042126 Ga0450888_036244 Ga0450888_036244_112_261 44
674 3300042127 Ga0450890_083627 Ga0450890_083627_54_188 44
675 3300042133 Ga0450896_012716 Ga0450896_012716_648_800 44
676 3300042145 Ga0450906_012735 Ga0450906_012735_284_436 44
677 3300042156 Ga0439446_0000175 Ga0439446_0000175_8495_8647 44
678 3300042184 Ga0450908_015155 Ga0450908_015155_760_912 44
679 3300042435 Ga0439434_0012351 Ga0439434_0012351_605_757 44
680 3300042436 Ga0439435_0006278 Ga0439435_0006278_1499_1651 44
681 3300042437 Ga0439444_0005437 Ga0439444_0005437_693_845 44
682 3300042438 Ga0439459_0102331 Ga0439459_0102331_300_434 44
683 3300042461 Ga0439460_0004358 Ga0439460_0004358_1968_2120 44
684 3300042876 Ga0451577_0090855 Ga0451577_0090855_432_578 44
685 3300042876 Ga0451577_0098888 Ga0451577_0098888_517_669 44
686 3300042876 Ga0451577_0104390 Ga0451577_0104390_2121_2255 44
687 3300042876 Ga0451577_1196362 Ga0451577_1196362_58_213 44
688 3300042876 Ga0451577_1795478 Ga0451577_1795478_220_354 44
689 3300044656 Ga0466969_0007341 Ga0466969_0007341_5318_5452 44
690 3300044656 Ga0466969_0024727 Ga0466969_0024727_2253_2387 44
691 3300044658 Ga0466972_0020775 Ga0466972_0020775_1812_1946 44
692 3300044673 Ga0453683_0484486 Ga0453683_0484486_153_287 44
693 3300044683 Ga0466965_0191666 Ga0466965_0191666_379_516 44
694 3300044684 Ga0466966_0000557 Ga0466966_0000557_13683_13817 44
695 3300044693 Ga0466961_0001702 Ga0466961_0001702_1454_1588 44
696 3300044694 Ga0466963_0476448 Ga0466963_0476448_130_264 44
697 3300044706 Ga0466964_0000388 Ga0466964_0000388_11815_11949 44
698 3300044712 Ga0453684_0634960 Ga0453684_0634960_887_1039 44
699 3300044712 Ga0453684_1247006 Ga0453684_1247006_616_750 44
700 3300044712 Ga0453684_1476662 Ga0453684_1476662_378_527 44
701 3300044719 Ga0466971_0003199 Ga0466971_0003199_6027_6161 44
702 3300044735 Ga0466968_0041783 Ga0466968_0041783_318_452 44
703 3300044735 Ga0466968_0159575 Ga0466968_0159575_80_214 44
704 3300044765 Ga0466970_0001729 Ga0466970_0001729_9881_10015 44
705 3300044842 Ga0466957_0053853 Ga0466957_0053853_1489_1623 44
706 3300044842 Ga0466957_0187747 Ga0466957_0187747_276_410 44
707 3300044901 Ga0466960_0407238 Ga0466960_0407238_478_612 44
708 3300044901 Ga0466960_0909614 Ga0466960_0909614_118_252 44
709 3300045049 Ga0466959_0008813 Ga0466959_0008813_2542_2676 44
710 3300045049 Ga0466959_0055230 Ga0466959_0055230_126_260 44
711 3300045051 Ga0451576_0002405 Ga0451576_0002405_6098_6250 44
712 3300045051 Ga0451576_0367046 Ga0451576_0367046_920_1072 44
713 3300045051 Ga0451576_0686299 Ga0451576_0686299_536_682 44
714 3300045051 Ga0451576_0728125 Ga0451576_0728125_138_287 44
715 3300045976 Ga0466967_1252470 Ga0466967_1252470_338_472 44
716 3300046452 Ga0495617_166210 Ga0495617_166210_168_302 44
717 3300046460 Ga0495638_0358370 Ga0495638_0358370_98_232 44
718 3300046472 Ga0495580_0019287 Ga0495580_0019287_4918_5052 44
719 3300046491 Ga0495584_0594405 Ga0495584_0594405_328_462 44
720 3300046500 Ga0495596_0335844 Ga0495596_0335844_249_383 44
721 3300046513 Ga0495616_0217093 Ga0495616_0217093_307_441 44
722 3300046536 Ga0495587_0156491 Ga0495587_0156491_685_819 44
723 3300046543 Ga0495645_0271530 Ga0495645_0271530_121_255 44
724 3300046660 Ga0495625_0906652 Ga0495625_0906652_109_243 44
725 3300046679 Ga0495623_0338001 Ga0495623_0338001_384_518 44
726 3300046683 Ga0495658_0900844 Ga0495658_0900844_69_203 44
727 3300046691 Ga0495670_0732512 Ga0495670_0732512_13_147 44
728 3300046692 Ga0495671_0111247 Ga0495671_0111247_684_818 44
729 3300046809 Ga0495600_0326181 Ga0495600_0326181_56_190 44
730 3300046809 Ga0495600_0558619 Ga0495600_0558619_28_162 44
731 3300047317 Ga0495604_0585522 Ga0495604_0585522_37_171 44
732 3300047317 Ga0495604_0731825 Ga0495604_0731825_466_600 44
733 3300047319 Ga0495674_0515779 Ga0495674_0515779_649_783 44
734 3300047444 Ga0495675_0263904 Ga0495675_0263904_499_633 44
735 3300047469 Ga0495673_0157680 Ga0495673_0157680_47_181 44
736 3300047472 Ga0495686_0064522 Ga0495686_0064522_1701_1835 44
737 3300047472 Ga0495686_0212396 Ga0495686_0212396_805_939 44
738 3300048088 Ga0495602_0655096 Ga0495602_0655096_408_542 44
739 3300048903 Ga0496100_1063393 Ga0496100_1063393_83_217 44
740 3300048904 Ga0496101_0073290 Ga0496101_0073290_145_279 44
741 3300048904 Ga0496101_0332802 Ga0496101_0332802_449_583 44
742 3300048904 Ga0496101_1549729 Ga0496101_1549729_151_324 44
743 3300048905 Ga0496102_0046953 Ga0496102_0046953_2080_2214 44
744 3300048907 Ga0496104_0014145 Ga0496104_0014145_3987_4121 44
745 3300048907 Ga0496104_0202644 Ga0496104_0202644_983_1117 44
746 3300048907 Ga0496104_0775416 Ga0496104_0775416_45_179 44
747 3300048908 Ga0496105_0016438 Ga0496105_0016438_3063_3197 44
748 3300048908 Ga0496105_0364564 Ga0496105_0364564_542_676 44
749 3300048909 Ga0496106_0061455 Ga0496106_0061455_1430_1564 44
750 3300048909 Ga0496106_0150760 Ga0496106_0150760_685_819 44
751 3300048910 Ga0496107_0102183 Ga0496107_0102183_1145_1279 44
752 3300048910 Ga0496107_0385291 Ga0496107_0385291_571_705 44
753 3300048911 Ga0496108_0026214 Ga0496108_0026214_1759_1893 44
754 3300048911 Ga0496108_0287555 Ga0496108_0287555_220_354 44
755 3300048911 Ga0496108_0846070 Ga0496108_0846070_48_221 44
756 3300048912 Ga0496109_0419264 Ga0496109_0419264_274_408 44
757 3300048912 Ga0496109_1909461 Ga0496109_1909461_282_416 44
758 3300048913 Ga0496110_0002929 Ga0496110_0002929_4910_5044 44
759 3300048913 Ga0496110_0009323 Ga0496110_0009323_4898_5032 44
760 3300048914 Ga0496111_0198764 Ga0496111_0198764_779_913 44
761 3300048914 Ga0496111_1175382 Ga0496111_1175382_266_400 44
762 3300048915 Ga0496112_0166803 Ga0496112_0166803_1157_1291 44
763 3300048915 Ga0496112_0876384 Ga0496112_0876384_606_740 44
764 3300048916 Ga0496113_0074417 Ga0496113_0074417_28_162 44
765 3300048917 Ga0496114_0065909 Ga0496114_0065909_1272_1406 44
766 3300048917 Ga0496114_0255873 Ga0496114_0255873_1383_1517 44
767 3300048917 Ga0496114_1060247 Ga0496114_1060247_328_462 44
768 3300048918 Ga0496115_0655405 Ga0496115_0655405_289_423 44
769 3300048919 Ga0496116_0037032 Ga0496116_0037032_694_867 44
770 3300048920 Ga0496117_0008275 Ga0496117_0008275_1795_1968 44
771 3300048920 Ga0496117_0416497 Ga0496117_0416497_104_238 44
772 3300048921 Ga0496118_0009209 Ga0496118_0009209_8009_8182 44
773 3300048921 Ga0496118_0131646 Ga0496118_0131646_1023_1196 44
774 3300048922 Ga0496119_0001089 Ga0496119_0001089_29341_29475 44
775 3300048922 Ga0496119_0136119 Ga0496119_0136119_133_267 44
776 3300048924 Ga0496121_0000246 Ga0496121_0000246_106700_106873 44
777 3300048924 Ga0496121_0067412 Ga0496121_0067412_1484_1618 44
778 3300048924 Ga0496121_0358467 Ga0496121_0358467_671_805 44
779 3300048925 Ga0496122_0021783 Ga0496122_0021783_1544_1678 44
780 3300048925 Ga0496122_0056325 Ga0496122_0056325_1301_1474 44
781 3300048926 Ga0496123_0009931 Ga0496123_0009931_4043_4177 44
782 3300048926 Ga0496123_0022057 Ga0496123_0022057_2104_2277 44
783 3300048927 Ga0496124_0307293 Ga0496124_0307293_158_331 44
784 3300048928 Ga0496125_0054673 Ga0496125_0054673_421_594 44
785 3300048929 Ga0496126_0021917 Ga0496126_0021917_5262_5435 44
786 3300048929 Ga0496126_0562605 Ga0496126_0562605_201_338 44
787 3300049569 Ga0501032_0499105 Ga0501032_0499105_558_692 44
788 3300049569 Ga0501032_0565924 Ga0501032_0565924_77_211 44
789 3300049571 Ga0501034_0005650 Ga0501034_0005650_892_1026 44
790 3300049571 Ga0501034_0082117 Ga0501034_0082117_1298_1432 44
791 3300049571 Ga0501034_0194858 Ga0501034_0194858_1367_1501 44
792 3300049571 Ga0501034_0535765 Ga0501034_0535765_681_818 44
793 3300049571 Ga0501034_1455585 Ga0501034_1455585_167_301 44
794 3300049573 Ga0501037_0644236 Ga0501037_0644236_296_445 44
795 3300049574 Ga0501038_0642748 Ga0501038_0642748_421_555 44
796 3300049575 Ga0501039_1505163 Ga0501039_1505163_251_385 44
797 3300049576 Ga0501040_0001085 Ga0501040_0001085_10672_10806 44
798 3300049576 Ga0501040_0394066 Ga0501040_0394066_717_851 44
799 3300049576 Ga0501040_0952130 Ga0501040_0952130_98_232 44
800 3300049577 Ga0501041_0646736 Ga0501041_0646736_501_635 44
801 3300049578 Ga0501042_0051340 Ga0501042_0051340_772_906 44
802 3300049578 Ga0501042_0079004 Ga0501042_0079004_1873_2007 44
803 3300049581 Ga0501047_0196075 Ga0501047_0196075_558_716 44
804 3300049581 Ga0501047_0428432 Ga0501047_0428432_1003_1140 44
805 3300049583 Ga0501067_0023609 Ga0501067_0023609_2123_2257 44
806 3300049584 Ga0501068_0023531 Ga0501068_0023531_555_689 44
807 3300049584 Ga0501068_0299546 Ga0501068_0299546_715_849 44
808 3300049584 Ga0501068_0536066 Ga0501068_0536066_92_226 44
809 3300049585 Ga0501069_0029799 Ga0501069_0029799_2522_2656 44
810 3300049586 Ga0501070_0719371 Ga0501070_0719371_97_231 44
811 3300049586 Ga0501070_0833247 Ga0501070_0833247_495_629 44
812 3300049587 Ga0501071_0007964 Ga0501071_0007964_6297_6431 44
813 3300049587 Ga0501071_0497418 Ga0501071_0497418_402_536 44
814 3300049587 Ga0501071_0736179 Ga0501071_0736179_407_541 44
815 3300049588 Ga0501072_0030078 Ga0501072_0030078_3812_3946 44
816 3300049588 Ga0501072_0527385 Ga0501072_0527385_123_257 44
817 3300049589 Ga0501073_0002828 Ga0501073_0002828_11959_12093 44
818 3300049589 Ga0501073_0069437 Ga0501073_0069437_1693_1827 44
819 3300049589 Ga0501073_0930978 Ga0501073_0930978_174_326 44
820 3300049589 Ga0501073_1071818 Ga0501073_1071818_166_300 44
821 3300049590 Ga0501074_0000646 Ga0501074_0000646_17309_17443 44
822 3300049590 Ga0501074_0210573 Ga0501074_0210573_230_364 44
823 3300049590 Ga0501074_0464069 Ga0501074_0464069_693_827 44
824 3300049590 Ga0501074_0637863 Ga0501074_0637863_398_532 44
825 3300049590 Ga0501074_0658354 Ga0501074_0658354_474_608 44
826 3300049591 Ga0501075_0079029 Ga0501075_0079029_417_551 44
827 3300049592 Ga0501076_0020771 Ga0501076_0020771_2226_2360 44
828 3300049592 Ga0501076_0109716 Ga0501076_0109716_1524_1658 44
829 3300049592 Ga0501076_0332817 Ga0501076_0332817_1031_1165 44
830 3300049592 Ga0501076_0485682 Ga0501076_0485682_186_320 44
831 3300049593 Ga0501077_0019747 Ga0501077_0019747_417_551 44
832 3300049593 Ga0501077_0123178 Ga0501077_0123178_1099_1233 44
833 3300049741 Ga0501079_0026230 Ga0501079_0026230_1601_1735 44
834 3300049741 Ga0501079_0062681 Ga0501079_0062681_2235_2369 44
835 3300049741 Ga0501079_1244395 Ga0501079_1244395_83_217 44
836 3300049742 Ga0501080_0005283 Ga0501080_0005283_5759_5893 44
837 3300049742 Ga0501080_0131776 Ga0501080_0131776_979_1113 44
838 3300049742 Ga0501080_0636451 Ga0501080_0636451_258_392 44
839 3300049743 Ga0501081_0002762 Ga0501081_0002762_2589_2723 44
840 3300049743 Ga0501081_0634303 Ga0501081_0634303_280_414 44
841 3300049743 Ga0501081_0756212 Ga0501081_0756212_558_692 44
842 3300049743 Ga0501081_1137776 Ga0501081_1137776_205_339 44
843 3300049744 Ga0501083_0222212 Ga0501083_0222212_1028_1162 44
844 3300049744 Ga0501083_0263413 Ga0501083_0263413_476_610 44
845 3300049822 Ga0501035_0130925 Ga0501035_0130925_749_955 44
846 3300049823 Ga0501044_0126154 Ga0501044_0126154_1494_1628 44
847 3300049823 Ga0501044_0258868 Ga0501044_0258868_567_773 44
848 3300049823 Ga0501044_0287534 Ga0501044_0287534_754_948 44
849 3300049823 Ga0501044_0944226 Ga0501044_0944226_472_606 44
850 3300049824 Ga0501045_0594073 Ga0501045_0594073_534_695 44
851 3300049824 Ga0501045_0750882 Ga0501045_0750882_514_648 44
852 3300049824 Ga0501045_1423634 Ga0501045_1423634_131_280 44
853 3300050489 nmdc:mga03683_345695_c1 nmdc:mga03683_345695_c1_543_677 44
854 3300050491 nmdc:mga00v17_482375_c1 nmdc:mga00v17_482375_c1_210_347 44
855 3300050491 nmdc:mga00v17_733365_c1 nmdc:mga00v17_733365_c1_374_508 44
856 3300050493 nmdc:mga0k408_694415_c1 nmdc:mga0k408_694415_c1_360_494 44
857 3300050496 nmdc:mga07m45_526252_c1 nmdc:mga07m45_526252_c1_52_189 44
858 3300050496 nmdc:mga07m45_567688_c1 nmdc:mga07m45_567688_c1_283_417 44
859 3300050496 nmdc:mga07m45_682052_c1 nmdc:mga07m45_682052_c1_190_327 44
860 3300050507 nmdc:mga05p37_63902_c1 nmdc:mga05p37_63902_c1_981_1133 44
861 3300050509 nmdc:mga0qj67_165290_c1 nmdc:mga0qj67_165290_c1_998_1132 44
862 3300050509 nmdc:mga0qj67_535010_c1 nmdc:mga0qj67_535010_c1_575_715 44
863 3300050511 nmdc:mga08y16_11753_c1 nmdc:mga08y16_11753_c1_935_1087 44
864 3300050511 nmdc:mga08y16_123582_c1 nmdc:mga08y16_123582_c1_1011_1145 44
865 3300050511 nmdc:mga08y16_1470419_c1 nmdc:mga08y16_1470419_c1_35_169 44
866 3300050511 nmdc:mga08y16_515024_c1 nmdc:mga08y16_515024_c1_684_818 44
867 3300050512 nmdc:mga0n895_255548_c1 nmdc:mga0n895_255548_c1_1384_1518 44
868 3300050513 nmdc:mga0rr50_118408_c1 nmdc:mga0rr50_118408_c1_288_422 44
869 3300050514 nmdc:mga08x19_265181_c1 nmdc:mga08x19_265181_c1_857_991 44
870 3300050516 nmdc:mga0sz30_144664_c2 nmdc:mga0sz30_144664_c2_84_218 44
871 3300050516 nmdc:mga0sz30_222956_c1 nmdc:mga0sz30_222956_c1_505_678 44
872 3300053078 Ga0495612_0082790 Ga0495612_0082790_979_1113 44
873 3300053084 Ga0495595_0392205 Ga0495595_0392205_362_496 44
874 3300053085 Ga0495619_0295000 Ga0495619_0295000_165_299 44
875 3300053087 Ga0500643_006566 Ga0500643_006566_3260_3409 44
876 3300053087 Ga0500643_179186 Ga0500643_179186_372_506 44
877 3300053088 Ga0500644_0118743 Ga0500644_0118743_580_714 44
878 3300053092 Ga0500583_0001730 Ga0500583_0001730_754_888 44
879 3300053092 Ga0500583_0003168 Ga0500583_0003168_609_743 44
880 3300053093 Ga0500651_0457249 Ga0500651_0457249_330_464 44
881 3300053096 Ga0500641_0018311 Ga0500641_0018311_2473_2607 44
882 3300053096 Ga0500641_0170442 Ga0500641_0170442_413_547 44
883 3300053104 Ga0500556_0000033 Ga0500556_0000033_76179_76313 44
884 3300053104 Ga0500556_0000549 Ga0500556_0000549_20764_20898 44
885 3300053104 Ga0500556_0016484 Ga0500556_0016484_1282_1416 44
886 3300053105 Ga0500557_158173 Ga0500557_158173_301_435 44
887 3300053108 Ga0500562_000202 Ga0500562_000202_2674_2808 44
888 3300053108 Ga0500562_035872 Ga0500562_035872_615_749 44
889 3300053108 Ga0500562_145305 Ga0500562_145305_14_151 44
890 3300053118 Ga0500594_0024949 Ga0500594_0024949_1096_1230 44
891 3300053118 Ga0500594_0122285 Ga0500594_0122285_77_211 44
892 3300053119 Ga0500595_034889 Ga0500595_034889_476_610 44
893 3300053120 Ga0500597_174709 Ga0500597_174709_521_655 44
894 3300053124 Ga0500617_107312 Ga0500617_107312_971_1105 44
895 3300053130 Ga0500642_0034856 Ga0500642_0034856_1032_1166 44
896 3300053131 Ga0500652_079453 Ga0500652_079453_377_511 44
897 3300053134 Ga0500658_0045506 Ga0500658_0045506_453_587 44
898 3300053136 Ga0500559_0432702 Ga0500559_0432702_269_403 44
899 3300053137 Ga0500561_0028843 Ga0500561_0028843_43_177 44
900 3300053139 Ga0500568_0007280 Ga0500568_0007280_673_822 44
901 3300053139 Ga0500568_0051166 Ga0500568_0051166_454_591 44
902 3300053139 Ga0500568_0087516 Ga0500568_0087516_538_672 44
903 3300053139 Ga0500568_0124194 Ga0500568_0124194_581_715 44
904 3300053142 Ga0500577_0472368 Ga0500577_0472368_242_376 44
905 3300053146 Ga0500588_0001229 Ga0500588_0001229_1282_1416 44
906 3300053147 Ga0500589_188077 Ga0500589_188077_443_577 44
907 3300053151 Ga0500604_0105037 Ga0500604_0105037_637_771 44
908 3300053153 Ga0500616_0000074 Ga0500616_0000074_116390_116524 44
909 3300053158 Ga0500627_0226470 Ga0500627_0226470_635_769 44
910 3300053160 Ga0500633_0125810 Ga0500633_0125810_413_547 44
911 3300053177 Ga0500636_0252685 Ga0500636_0252685_656_790 44
912 3300053178 Ga0500637_0000804 Ga0500637_0000804_5243_5377 44
913 3300053730 Ga0500645_004392 Ga0500645_004392_4023_4157 44
914 3300053732 Ga0500656_003331 Ga0500656_003331_1296_1430 44
915 3300053733 Ga0500552_056537 Ga0500552_056537_114_248 44
916 3300053735 Ga0500596_107189 Ga0500596_107189_82_216 44
917 3300054114 Ga0501084_0005783 Ga0501084_0005783_706_840 44
918 3300054114 Ga0501084_0008467 Ga0501084_0008467_6869_7003 44
919 3300054114 Ga0501084_1333813 Ga0501084_1333813_46_180 44
920 3300059492 Ga0587073_0242058 Ga0587073_0242058_337_471 44
921 3300059503 Ga0587080_081482 Ga0587080_081482_84_218 44
922 3300059505 Ga0587083_0171740 Ga0587083_0171740_337_471 44
923 3300059505 Ga0587083_0226268 Ga0587083_0226268_387_521 44
924 3300059508 Ga0587088_084173 Ga0587088_084173_461_595 44
925 3300059509 Ga0587089_086309 Ga0587089_086309_50_184 44
926 3300059510 Ga0587090_079888 Ga0587090_079888_68_202 44
927 3300059607 Ga0587125_032488 Ga0587125_032488_508_642 44
928 3300059630 Ga0587128_020797 Ga0587128_020797_799_933 44
929 3300059640 Ga0587067_091641 Ga0587067_091641_87_221 44
930 3300059643 Ga0587072_114274 Ga0587072_114274_451_585 44
931 3300059645 Ga0587076_064033 Ga0587076_064033_547_681 44
932 3300059647 Ga0587079_145504 Ga0587079_145504_94_228 44
933 3300059652 Ga0587107_037040 Ga0587107_037040_546_680 44
934 3300060346 Ga0587111_0061349 Ga0587111_0061349_88_222 44
935 3300060346 Ga0587111_0115460 Ga0587111_0115460_515_649 44
936 3300060353 Ga0501082_0005773 Ga0501082_0005773_9034_9168 44
937 3300060353 Ga0501082_0077802 Ga0501082_0077802_2239_2373 44
938 3300060353 Ga0501082_0438602 Ga0501082_0438602_25_159 44
939 3300060353 Ga0501082_1126860 Ga0501082_1126860_444_578 44
940 3300060353 Ga0501082_1255458 Ga0501082_1255458_195_329 44
941 3300061719 Ga0466962_0000690 Ga0466962_0000690_3288_3422 44
942 3300061719 Ga0466962_0182138 Ga0466962_0182138_541_675 44
943 3300061734 Ga0530510_0447788 Ga0530510_0447788_524_676 44
944 3300061734 Ga0530510_0578340 Ga0530510_0578340_458_592 44
945 3300061734 Ga0530510_1076071 Ga0530510_1076071_99_233 44
946 3300061734 Ga0530510_1162525 Ga0530510_1162525_345_479 44

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00468

Ribosomal_L34

Ribosomal protein L34

11

53

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j5b-assembly1.cif.gz_D3 structure of the wt e coli ribosome bound to tetracycline 0.6587 1 35
5j91-assembly2.cif.gz_C3 structure of the wild-type 70s e coli ribosome bound to tigecycline 0.6542 1 35
6wda-assembly1.cif.gz_D cryo-em of elongating ribosome with ef-tu*gtp elucidates trna proofreading (cognate structure iii-c) 0.6512 1 35
7bv8-assembly1.cif.gz_d mature 50s ribosomal subunit from rrmj knock out e.coli strain 0.6489 1 35
6gb2-assembly1.cif.gz_B7 unique features of mammalian mitochondrial translation initiation revealed by cryo-em. this file contains the 39s ribosomal subunit. 0.6473 1 35
ID Description Score Start End Superfamily
3oat200 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6648 1 35 1.10.287.3980
3i1n200 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6631 1 35 1.10.287.3980
1vw4Y00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6445 1 35 1.10.287.3980
3j7y200 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6436 2 35 1.10.287.3980
5dm7200 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.64 1 35 1.10.287.3980
ID Description Score Start End GO Terms
AF-A0A3S4WMJ6-F1-model_v4 deleted 0.8788 1 25
AF-A0A7W2GEI9-F1-model_v4 deleted 0.8253 1 26
AF-A0A7K0RYU2-F1-model_v4 Large ribosomal subunit protein bL34 (50S ribosomal protein L34) 0.8124 1 25 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7W2GEI9-F1-model_v4 deleted 0.8034 1 26
AF-A0A2H0PZA1-F1-model_v4 Large ribosomal subunit protein bL34 (50S ribosomal protein L34) 0.8023 1 25 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
88.7 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map