F486335
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 941 | 399 | 907 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300039062|Ga0400483_266032|Ga0400483_266032_683_1060 |
| Length | 125 |
| Sequence | MPTIQQLVRKGRSKQVYKSKAPALDACPQKRGVCVRVYTTTPKKPNSAMRKVARVRITKSGKEVNAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHLIRGALDTAGVEGRTQRRSKYGAKRPKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 2 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 3 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 4 | 2630968484 | Bacillus methylotrophicus KACC 13105 | Isolate | Rhizosphere |
| 5 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 6 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 7 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 8 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 9 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 10 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 11 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 12 | 2857604169 | Domibacillus sp. R-71921 | Isolate | Unclassified |
| 13 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 14 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 15 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 16 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 17 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 18 | 2916971899 | Alkalihalobacillus miscanthi AK13 | Isolate | Rhizosphere |
| 19 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 20 | 2964375228 | Anaerobacillus alkaliphilus B16-10 | Isolate | Rhizosphere |
| 21 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 22 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 23 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 24 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 25 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 26 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 27 | 3006826541 | Bacillus haikouensis CrR16 | Isolate | Unclassified |
| 28 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 29 | 3006879489 | Bacillus atrophaeus UCMB-5137 | Isolate | Rhizosphere |
| 30 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 31 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 32 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 33 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 99 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 100 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300023438 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc | Metatranscriptome | Rhizosphere |
| 128 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 129 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 174 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 181 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 182 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 191 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 193 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 194 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 195 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 197 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 198 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 202 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 203 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 206 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 207 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 212 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 213 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 217 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 218 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 219 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 220 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 221 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 222 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 223 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 230 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 231 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 238 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 241 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 245 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 246 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 249 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 250 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 252 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 253 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 254 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 257 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 258 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 259 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 260 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 261 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 263 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 264 | 3300041508 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT | Metatranscriptome | Unclassified |
| 265 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 266 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 267 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 268 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 269 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 270 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 271 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 272 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 273 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 274 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 321 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 322 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 326 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 327 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 328 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 329 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 330 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 331 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 338 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 366 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 367 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 374 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 397 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 398 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
| 399 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.53 |
| Metatranscriptomes | 12.86 |
| Isolates | 3.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 1.7 |
| Rhizosphere | 94.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006759J45824_1150259 | 3300003163 | Bacteria | 616 |
| 2 | rootH1_10069712 | 3300003323 | Bacteria | 4000 |
| 3 | rootH1_10403485 | 3300003323 | Bacteria | 1254 |
| 4 | Ga0065707_10167338 | 3300005295 | Bacteria | 1512 |
| 5 | Ga0070676_11259696 | 3300005328 | Bacteria | 564 |
| 6 | Ga0070683_100648598 | 3300005329 | Bacteria | 1011 |
| 7 | Ga0070690_100530485 | 3300005330 | Bacteria | 885 |
| 8 | Ga0070670_100590010 | 3300005331 | Bacteria | 994 |
| 9 | Ga0068869_100099622 | 3300005334 | Bacteria | 2196 |
| 10 | Ga0070680_100355547 | 3300005336 | Bacteria | 1246 |
| 11 | Ga0070682_100791466 | 3300005337 | Bacteria | 769 |
| 12 | Ga0070689_101065984 | 3300005340 | Bacteria | 721 |
| 13 | Ga0070689_101343123 | 3300005340 | Bacteria | 645 |
| 14 | Ga0070689_101454326 | 3300005340 | Bacteria | 620 |
| 15 | Ga0070692_10380746 | 3300005345 | Bacteria | 885 |
| 16 | Ga0070674_100068400 | 3300005356 | Bacteria | 2502 |
| 17 | Ga0070673_100506945 | 3300005364 | Bacteria | 1092 |
| 18 | Ga0070667_101407232 | 3300005367 | Bacteria | 654 |
| 19 | Ga0070703_10037289 | 3300005406 | Bacteria | 1497 |
| 20 | Ga0070709_10006493 | 3300005434 | Bacteria | 6375 |
| 21 | Ga0070709_10068471 | 3300005434 | Bacteria | 2283 |
| 22 | Ga0070714_100506323 | 3300005435 | Bacteria | 1152 |
| 23 | Ga0070714_100758792 | 3300005435 | Bacteria | 938 |
| 24 | Ga0070713_100002365 | 3300005436 | Bacteria | 12304 |
| 25 | Ga0070713_100016190 | 3300005436 | Bacteria | 5604 |
| 26 | Ga0070713_100242785 | 3300005436 | Bacteria | 1641 |
| 27 | Ga0070713_100428436 | 3300005436 | Bacteria | 1239 |
| 28 | Ga0070713_100854865 | 3300005436 | Bacteria | 874 |
| 29 | Ga0070710_10043474 | 3300005437 | Bacteria | 2488 |
| 30 | Ga0070710_10166147 | 3300005437 | Bacteria | 1372 |
| 31 | Ga0070710_10273875 | 3300005437 | Bacteria | 1093 |
| 32 | Ga0070710_11159375 | 3300005437 | Bacteria | 570 |
| 33 | Ga0070701_10184773 | 3300005438 | Bacteria | 1223 |
| 34 | Ga0070711_100001449 | 3300005439 | Bacteria | 13051 |
| 35 | Ga0070711_100045540 | 3300005439 | Bacteria | 2985 |
| 36 | Ga0070711_100090240 | 3300005439 | Bacteria | 2207 |
| 37 | Ga0070711_100130525 | 3300005439 | Bacteria | 1871 |
| 38 | Ga0070711_101221300 | 3300005439 | Bacteria | 651 |
| 39 | Ga0070705_100086727 | 3300005440 | Bacteria | 1939 |
| 40 | Ga0070705_100925381 | 3300005440 | Bacteria | 703 |
| 41 | Ga0070705_101040583 | 3300005440 | Bacteria | 667 |
| 42 | Ga0070705_101487901 | 3300005440 | Bacteria | 567 |
| 43 | Ga0070694_100008757 | 3300005444 | Bacteria | 6199 |
| 44 | Ga0070708_100004769 | 3300005445 | Bacteria | 10687 |
| 45 | Ga0070708_100016611 | 3300005445 | Bacteria | 6112 |
| 46 | Ga0070708_100807413 | 3300005445 | Bacteria | 882 |
| 47 | Ga0070708_100974040 | 3300005445 | Bacteria | 795 |
| 48 | Ga0070678_100070409 | 3300005456 | Bacteria | 2614 |
| 49 | Ga0070681_10198635 | 3300005458 | Bacteria | 1924 |
| 50 | Ga0070681_10700340 | 3300005458 | Bacteria | 929 |
| 51 | Ga0068867_100257994 | 3300005459 | Bacteria | 1420 |
| 52 | Ga0068867_100259979 | 3300005459 | Bacteria | 1415 |
| 53 | Ga0070706_100027065 | 3300005467 | Bacteria | 5277 |
| 54 | Ga0070706_100038479 | 3300005467 | Bacteria | 4414 |
| 55 | Ga0070706_100045252 | 3300005467 | Bacteria | 4066 |
| 56 | Ga0070706_100090069 | 3300005467 | Bacteria | 2845 |
| 57 | Ga0070706_100233626 | 3300005467 | Bacteria | 1716 |
| 58 | Ga0070707_100010443 | 3300005468 | Bacteria | 8648 |
| 59 | Ga0070707_100012413 | 3300005468 | Bacteria | 7956 |
| 60 | Ga0070707_100014471 | 3300005468 | Bacteria | 7393 |
| 61 | Ga0070707_101011500 | 3300005468 | Bacteria | 797 |
| 62 | Ga0070698_100003219 | 3300005471 | Bacteria | 17992 |
| 63 | Ga0070698_100065898 | 3300005471 | Bacteria | 3647 |
| 64 | Ga0070698_100068156 | 3300005471 | Bacteria | 3577 |
| 65 | Ga0070698_100480315 | 3300005471 | Bacteria | 1180 |
| 66 | Ga0070698_100911535 | 3300005471 | Bacteria | 825 |
| 67 | Ga0070698_101394679 | 3300005471 | Bacteria | 651 |
| 68 | Ga0070699_100037932 | 3300005518 | Bacteria | 4171 |
| 69 | Ga0070699_100063431 | 3300005518 | Bacteria | 3204 |
| 70 | Ga0070699_100186526 | 3300005518 | Bacteria | 1842 |
| 71 | Ga0070699_100334911 | 3300005518 | Bacteria | 1361 |
| 72 | Ga0070679_100024467 | 3300005530 | Bacteria | 5917 |
| 73 | Ga0070679_100685245 | 3300005530 | Bacteria | 968 |
| 74 | Ga0070684_101702750 | 3300005535 | Bacteria | 595 |
| 75 | Ga0070697_100130858 | 3300005536 | Bacteria | 2104 |
| 76 | Ga0070697_100414395 | 3300005536 | Bacteria | 1170 |
| 77 | Ga0070697_100593093 | 3300005536 | Bacteria | 973 |
| 78 | Ga0070697_101102441 | 3300005536 | Bacteria | 707 |
| 79 | Ga0070697_101315149 | 3300005536 | Bacteria | 645 |
| 80 | Ga0070697_101446656 | 3300005536 | Bacteria | 614 |
| 81 | Ga0070697_101554003 | 3300005536 | Bacteria | 592 |
| 82 | Ga0070672_100013159 | 3300005543 | Bacteria | 5834 |
| 83 | Ga0070686_100356003 | 3300005544 | Bacteria | 1101 |
| 84 | Ga0070695_100027795 | 3300005545 | Bacteria | 3506 |
| 85 | Ga0070695_100124337 | 3300005545 | Bacteria | 1769 |
| 86 | Ga0070696_100003003 | 3300005546 | Bacteria | 11197 |
| 87 | Ga0070696_100044176 | 3300005546 | Bacteria | 3085 |
| 88 | Ga0070696_100648192 | 3300005546 | Bacteria | 856 |
| 89 | Ga0070696_102020260 | 3300005546 | Bacteria | 501 |
| 90 | Ga0070693_100000994 | 3300005547 | Bacteria | 12639 |
| 91 | Ga0070665_100000700 | 3300005548 | Bacteria | 44692 |
| 92 | Ga0070665_100004237 | 3300005548 | Bacteria | 15097 |
| 93 | Ga0070665_102085204 | 3300005548 | Bacteria | 572 |
| 94 | Ga0070704_100003283 | 3300005549 | Bacteria | 9244 |
| 95 | Ga0070704_100377124 | 3300005549 | Bacteria | 1204 |
| 96 | Ga0070704_100615286 | 3300005549 | Bacteria | 956 |
| 97 | Ga0070704_101517299 | 3300005549 | Bacteria | 617 |
| 98 | Ga0068854_100489662 | 3300005578 | Bacteria | 1034 |
| 99 | Ga0068854_100906868 | 3300005578 | Bacteria | 775 |
| 100 | Ga0068856_100465458 | 3300005614 | Bacteria | 1285 |
| 101 | Ga0068864_101268011 | 3300005618 | Bacteria | 737 |
| 102 | Ga0068861_101020095 | 3300005719 | Bacteria | 791 |
| 103 | Ga0068870_10529830 | 3300005840 | Bacteria | 790 |
| 104 | Ga0068863_100014791 | 3300005841 | Bacteria | 7503 |
| 105 | Ga0068858_100088230 | 3300005842 | Bacteria | 2885 |
| 106 | Ga0068860_100010580 | 3300005843 | Bacteria | 9113 |
| 107 | Ga0068860_100509204 | 3300005843 | Bacteria | 1202 |
| 108 | Ga0068862_100333204 | 3300005844 | Bacteria | 1404 |
| 109 | Ga0081455_10002585 | 3300005937 | Bacteria | 21454 |
| 110 | Ga0081455_10157276 | 3300005937 | Bacteria | 1746 |
| 111 | Ga0081538_10000250 | 3300005981 | Bacteria | 60946 |
| 112 | Ga0081538_10002047 | 3300005981 | Bacteria | 20127 |
| 113 | Ga0081538_10019032 | 3300005981 | Bacteria | 5126 |
| 114 | Ga0081538_10138015 | 3300005981 | Bacteria | 1131 |
| 115 | Ga0070715_10082874 | 3300006163 | Bacteria | 1459 |
| 116 | Ga0070715_10208809 | 3300006163 | Bacteria | 997 |
| 117 | Ga0070715_10212958 | 3300006163 | Bacteria | 989 |
| 118 | Ga0070716_100041393 | 3300006173 | Bacteria | 2566 |
| 119 | Ga0070716_100604165 | 3300006173 | Bacteria | 825 |
| 120 | Ga0070716_101367341 | 3300006173 | Bacteria | 575 |
| 121 | Ga0070712_100072105 | 3300006175 | Bacteria | 2473 |
| 122 | Ga0070712_100255026 | 3300006175 | Bacteria | 1403 |
| 123 | Ga0070712_100351408 | 3300006175 | Bacteria | 1207 |
| 124 | Ga0070712_100452968 | 3300006175 | Bacteria | 1069 |
| 125 | Ga0070712_101024728 | 3300006175 | Bacteria | 715 |
| 126 | Ga0097621_100171453 | 3300006237 | Bacteria | 1870 |
| 127 | Ga0097621_100332534 | 3300006237 | Bacteria | 1348 |
| 128 | Ga0097621_100689135 | 3300006237 | Bacteria | 940 |
| 129 | Ga0097621_100726987 | 3300006237 | Bacteria | 916 |
| 130 | Ga0068871_100022756 | 3300006358 | Bacteria | 4836 |
| 131 | Ga0068871_100716246 | 3300006358 | Bacteria | 918 |
| 132 | Ga0068871_101560463 | 3300006358 | Bacteria | 625 |
| 133 | Ga0075428_100263152 | 3300006844 | Bacteria | 1857 |
| 134 | Ga0075428_100269384 | 3300006844 | Bacteria | 1832 |
| 135 | Ga0075428_101151503 | 3300006844 | Bacteria | 818 |
| 136 | Ga0075428_102356328 | 3300006844 | Bacteria | 547 |
| 137 | Ga0075430_100039669 | 3300006846 | Bacteria | 3986 |
| 138 | Ga0075430_100225464 | 3300006846 | Bacteria | 1554 |
| 139 | Ga0075430_100829049 | 3300006846 | Bacteria | 762 |
| 140 | Ga0075431_100063276 | 3300006847 | Bacteria | 3818 |
| 141 | Ga0075431_100452149 | 3300006847 | Bacteria | 1280 |
| 142 | Ga0075431_101034084 | 3300006847 | Bacteria | 787 |
| 143 | Ga0075431_101113721 | 3300006847 | Bacteria | 754 |
| 144 | Ga0075433_10024717 | 3300006852 | Bacteria | 5073 |
| 145 | Ga0075433_10060259 | 3300006852 | Bacteria | 3322 |
| 146 | Ga0075433_10688173 | 3300006852 | Bacteria | 896 |
| 147 | Ga0075433_11130862 | 3300006852 | Bacteria | 681 |
| 148 | Ga0075434_100063706 | 3300006871 | Bacteria | 3670 |
| 149 | Ga0075434_100084572 | 3300006871 | Bacteria | 3171 |
| 150 | Ga0075434_101387012 | 3300006871 | Bacteria | 713 |
| 151 | Ga0075429_100048515 | 3300006880 | Bacteria | 3693 |
| 152 | Ga0075429_100267299 | 3300006880 | Bacteria | 1498 |
| 153 | Ga0075429_100284342 | 3300006880 | Bacteria | 1448 |
| 154 | Ga0075429_100602085 | 3300006880 | Bacteria | 963 |
| 155 | Ga0075429_100672111 | 3300006880 | Bacteria | 907 |
| 156 | Ga0068865_100072446 | 3300006881 | Bacteria | 2447 |
| 157 | Ga0068865_100204745 | 3300006881 | Bacteria | 1534 |
| 158 | Ga0068865_100712783 | 3300006881 | Bacteria | 858 |
| 159 | Ga0068865_101932220 | 3300006881 | Bacteria | 535 |
| 160 | Ga0075436_100005799 | 3300006914 | Bacteria | 8480 |
| 161 | Ga0075436_100009783 | 3300006914 | Bacteria | 6556 |
| 162 | Ga0075436_100800916 | 3300006914 | Bacteria | 701 |
| 163 | Ga0075435_100140998 | 3300007076 | Bacteria | 2022 |
| 164 | Ga0075435_100805145 | 3300007076 | Bacteria | 818 |
| 165 | Ga0075435_101405799 | 3300007076 | Bacteria | 611 |
| 166 | Ga0099794_10014076 | 3300007265 | Bacteria | 3497 |
| 167 | Ga0099794_10023888 | 3300007265 | Bacteria | 2801 |
| 168 | Ga0099794_10035542 | 3300007265 | Bacteria | 2352 |
| 169 | Ga0099794_10113447 | 3300007265 | Bacteria | 1359 |
| 170 | Ga0099795_10004417 | 3300007788 | Bacteria | 3627 |
| 171 | Ga0099795_10030072 | 3300007788 | Bacteria | 1862 |
| 172 | Ga0099795_10086438 | 3300007788 | Bacteria | 1209 |
| 173 | Ga0105250_10425161 | 3300009092 | Bacteria | 593 |
| 174 | Ga0105240_10004245 | 3300009093 | Bacteria | 21913 |
| 175 | Ga0105240_10121109 | 3300009093 | Bacteria | 3150 |
| 176 | Ga0105240_10274511 | 3300009093 | Bacteria | 1940 |
| 177 | Ga0105240_10922690 | 3300009093 | Bacteria | 938 |
| 178 | Ga0111539_10023538 | 3300009094 | Bacteria | 7567 |
| 179 | Ga0111539_10140216 | 3300009094 | Bacteria | 2830 |
| 180 | Ga0111539_10456351 | 3300009094 | Bacteria | 1488 |
| 181 | Ga0105245_10033891 | 3300009098 | Bacteria | 4526 |
| 182 | Ga0105247_10279487 | 3300009101 | Bacteria | 1151 |
| 183 | Ga0114129_10814565 | 3300009147 | Bacteria | 1190 |
| 184 | Ga0105242_10247762 | 3300009176 | Bacteria | 1604 |
| 185 | Ga0105242_10654675 | 3300009176 | Bacteria | 1022 |
| 186 | Ga0105242_10912622 | 3300009176 | Bacteria | 879 |
| 187 | Ga0105242_11090234 | 3300009176 | Bacteria | 812 |
| 188 | Ga0105242_12148188 | 3300009176 | Bacteria | 603 |
| 189 | Ga0105248_10373894 | 3300009177 | Bacteria | 1604 |
| 190 | Ga0105248_11056173 | 3300009177 | Bacteria | 918 |
| 191 | Ga0105248_11706920 | 3300009177 | Bacteria | 714 |
| 192 | Ga0105237_10072778 | 3300009545 | Bacteria | 3431 |
| 193 | Ga0105237_10150945 | 3300009545 | Bacteria | 2320 |
| 194 | Ga0105237_10222663 | 3300009545 | Bacteria | 1887 |
| 195 | Ga0099796_10063694 | 3300010159 | Bacteria | 1314 |
| 196 | Ga0105239_10022622 | 3300010375 | Bacteria | 6930 |
| 197 | Ga0105239_10030499 | 3300010375 | Bacteria | 5928 |
| 198 | Ga0105239_10544717 | 3300010375 | Bacteria | 1321 |
| 199 | Ga0157340_1008626 | 3300012473 | Bacteria | 685 |
| 200 | Ga0157371_10272231 | 3300013102 | Bacteria | 1222 |
| 201 | Ga0157371_10410538 | 3300013102 | Bacteria | 992 |
| 202 | Ga0157369_11202069 | 3300013105 | Bacteria | 774 |
| 203 | Ga0157374_10000801 | 3300013296 | Bacteria | 27561 |
| 204 | Ga0157374_10119097 | 3300013296 | Bacteria | 2547 |
| 205 | Ga0157378_10000272 | 3300013297 | Bacteria | 50377 |
| 206 | Ga0157378_10000886 | 3300013297 | Bacteria | 27619 |
| 207 | Ga0157378_10010996 | 3300013297 | Bacteria | 7921 |
| 208 | Ga0157378_10438127 | 3300013297 | Bacteria | 1295 |
| 209 | Ga0157378_10888802 | 3300013297 | Bacteria | 921 |
| 210 | Ga0157378_11598577 | 3300013297 | Bacteria | 698 |
| 211 | Ga0163162_10374288 | 3300013306 | Bacteria | 1557 |
| 212 | Ga0163162_11107878 | 3300013306 | Bacteria | 897 |
| 213 | Ga0157372_10098714 | 3300013307 | Bacteria | 3332 |
| 214 | Ga0157372_12959194 | 3300013307 | Bacteria | 543 |
| 215 | Ga0157375_10313280 | 3300013308 | Bacteria | 1733 |
| 216 | Ga0157375_11315401 | 3300013308 | Bacteria | 850 |
| 217 | Ga0157375_12507451 | 3300013308 | Bacteria | 616 |
| 218 | Ga0157375_12673585 | 3300013308 | Bacteria | 597 |
| 219 | Ga0157380_11062915 | 3300014326 | Bacteria | 846 |
| 220 | Ga0157380_13475935 | 3300014326 | Bacteria | 504 |
| 221 | Ga0157377_10540728 | 3300014745 | Bacteria | 821 |
| 222 | Ga0157379_10056214 | 3300014968 | Bacteria | 3516 |
| 223 | Ga0157379_11034308 | 3300014968 | Bacteria | 784 |
| 224 | Ga0157376_10000075 | 3300014969 | Bacteria | 75560 |
| 225 | Ga0157376_10002707 | 3300014969 | Bacteria | 12069 |
| 226 | Ga0157376_10226962 | 3300014969 | Bacteria | 1733 |
| 227 | Ga0157376_10438194 | 3300014969 | Bacteria | 1272 |
| 228 | Ga0157376_12354466 | 3300014969 | Bacteria | 572 |
| 229 | Ga0182007_10392064 | 3300015262 | Bacteria | 528 |
| 230 | Ga0184603_100407 | 3300019192 | Bacteria | 633 |
| 231 | Ga0213873_10179721 | 3300021358 | Bacteria | 649 |
| 232 | Ga0213876_10024420 | 3300021384 | Bacteria | 3191 |
| 233 | Ga0213876_10135418 | 3300021384 | Bacteria | 1310 |
| 234 | Ga0256720_139491 | 3300023438 | Bacteria | 598 |
| 235 | Ga0228598_1004458 | 3300024227 | Bacteria | 2965 |
| 236 | Ga0228598_1004932 | 3300024227 | Bacteria | 2808 |
| 237 | Ga0207653_10022350 | 3300025885 | Bacteria | 2008 |
| 238 | Ga0207642_10082809 | 3300025899 | Bacteria | 1563 |
| 239 | Ga0207688_10661977 | 3300025901 | Bacteria | 659 |
| 240 | Ga0207685_10053011 | 3300025905 | Bacteria | 1573 |
| 241 | Ga0207685_10274449 | 3300025905 | Bacteria | 825 |
| 242 | Ga0207699_10022332 | 3300025906 | Bacteria | 3427 |
| 243 | Ga0207699_10059947 | 3300025906 | Bacteria | 2283 |
| 244 | Ga0207699_10175452 | 3300025906 | Bacteria | 1437 |
| 245 | Ga0207699_10186348 | 3300025906 | Bacteria | 1398 |
| 246 | Ga0207699_10317275 | 3300025906 | Bacteria | 1092 |
| 247 | Ga0207699_10339564 | 3300025906 | Bacteria | 1058 |
| 248 | Ga0207699_10674165 | 3300025906 | Bacteria | 756 |
| 249 | Ga0207643_10554156 | 3300025908 | Bacteria | 738 |
| 250 | Ga0207705_10162926 | 3300025909 | Bacteria | 1676 |
| 251 | Ga0207684_10010612 | 3300025910 | Bacteria | 8097 |
| 252 | Ga0207684_10021082 | 3300025910 | Bacteria | 5564 |
| 253 | Ga0207684_10027856 | 3300025910 | Bacteria | 4813 |
| 254 | Ga0207684_10126378 | 3300025910 | Bacteria | 2194 |
| 255 | Ga0207684_10424447 | 3300025910 | Bacteria | 1142 |
| 256 | Ga0207707_11559912 | 3300025912 | Bacteria | 521 |
| 257 | Ga0207695_10104798 | 3300025913 | Bacteria | 2816 |
| 258 | Ga0207695_10184944 | 3300025913 | Bacteria | 2003 |
| 259 | Ga0207695_10861390 | 3300025913 | Bacteria | 786 |
| 260 | Ga0207671_10094363 | 3300025914 | Bacteria | 2258 |
| 261 | Ga0207671_10767804 | 3300025914 | Bacteria | 765 |
| 262 | Ga0207671_11231216 | 3300025914 | Bacteria | 585 |
| 263 | Ga0207693_10043266 | 3300025915 | Bacteria | 3543 |
| 264 | Ga0207693_10118572 | 3300025915 | Bacteria | 2078 |
| 265 | Ga0207693_10159441 | 3300025915 | Bacteria | 1775 |
| 266 | Ga0207693_10413993 | 3300025915 | Bacteria | 1054 |
| 267 | Ga0207663_10026105 | 3300025916 | Bacteria | 3387 |
| 268 | Ga0207663_10076628 | 3300025916 | Bacteria | 2174 |
| 269 | Ga0207663_10125904 | 3300025916 | Bacteria | 1762 |
| 270 | Ga0207663_10465398 | 3300025916 | Bacteria | 977 |
| 271 | Ga0207663_10496103 | 3300025916 | Bacteria | 948 |
| 272 | Ga0207663_10546106 | 3300025916 | Bacteria | 905 |
| 273 | Ga0207660_10288355 | 3300025917 | Bacteria | 1305 |
| 274 | Ga0207662_10723882 | 3300025918 | Bacteria | 698 |
| 275 | Ga0207662_10876025 | 3300025918 | Bacteria | 635 |
| 276 | Ga0207652_10032823 | 3300025921 | Bacteria | 4368 |
| 277 | Ga0207646_10001996 | 3300025922 | Bacteria | 24533 |
| 278 | Ga0207646_10016678 | 3300025922 | Bacteria | 6889 |
| 279 | Ga0207646_10093840 | 3300025922 | Bacteria | 2687 |
| 280 | Ga0207646_10242931 | 3300025922 | Bacteria | 1627 |
| 281 | Ga0207646_10317494 | 3300025922 | Bacteria | 1408 |
| 282 | Ga0207646_10669651 | 3300025922 | Bacteria | 929 |
| 283 | Ga0207681_10887101 | 3300025923 | Bacteria | 747 |
| 284 | Ga0207694_10482770 | 3300025924 | Bacteria | 1037 |
| 285 | Ga0207687_10777486 | 3300025927 | Bacteria | 816 |
| 286 | Ga0207700_10002600 | 3300025928 | Bacteria | 10384 |
| 287 | Ga0207700_10067895 | 3300025928 | Bacteria | 2731 |
| 288 | Ga0207700_10167004 | 3300025928 | Bacteria | 1832 |
| 289 | Ga0207700_10220042 | 3300025928 | Bacteria | 1609 |
| 290 | Ga0207664_10482958 | 3300025929 | Bacteria | 1108 |
| 291 | Ga0207686_10250328 | 3300025934 | Bacteria | 1294 |
| 292 | Ga0207686_10698442 | 3300025934 | Bacteria | 806 |
| 293 | Ga0207670_10288920 | 3300025936 | Bacteria | 1280 |
| 294 | Ga0207670_10384233 | 3300025936 | Bacteria | 1119 |
| 295 | Ga0207670_10954623 | 3300025936 | Bacteria | 720 |
| 296 | Ga0207670_11160662 | 3300025936 | Bacteria | 653 |
| 297 | Ga0207665_10005811 | 3300025939 | Bacteria | 8207 |
| 298 | Ga0207665_10031807 | 3300025939 | Bacteria | 3492 |
| 299 | Ga0207665_10090757 | 3300025939 | Bacteria | 2117 |
| 300 | Ga0207665_10135097 | 3300025939 | Bacteria | 1754 |
| 301 | Ga0207665_10138823 | 3300025939 | Bacteria | 1731 |
| 302 | Ga0207665_10559080 | 3300025939 | Bacteria | 890 |
| 303 | Ga0207665_10695306 | 3300025939 | Bacteria | 799 |
| 304 | Ga0207691_10479356 | 3300025940 | Bacteria | 1057 |
| 305 | Ga0207711_10306284 | 3300025941 | Bacteria | 1466 |
| 306 | Ga0207689_10183463 | 3300025942 | Bacteria | 1726 |
| 307 | Ga0207689_10612955 | 3300025942 | Bacteria | 916 |
| 308 | Ga0207661_10938254 | 3300025944 | Bacteria | 797 |
| 309 | Ga0207661_11042659 | 3300025944 | Bacteria | 753 |
| 310 | Ga0207651_10788706 | 3300025960 | Bacteria | 842 |
| 311 | Ga0207651_11330940 | 3300025960 | Bacteria | 646 |
| 312 | Ga0207651_11465341 | 3300025960 | Bacteria | 615 |
| 313 | Ga0207677_10206493 | 3300026023 | Bacteria | 1565 |
| 314 | Ga0207703_10017399 | 3300026035 | Bacteria | 5611 |
| 315 | Ga0207702_11581631 | 3300026078 | Bacteria | 649 |
| 316 | Ga0207641_10006158 | 3300026088 | Bacteria | 10152 |
| 317 | Ga0207641_10924854 | 3300026088 | Bacteria | 867 |
| 318 | Ga0207641_12459694 | 3300026088 | Bacteria | 519 |
| 319 | Ga0207648_10286078 | 3300026089 | Bacteria | 1475 |
| 320 | Ga0207648_10339454 | 3300026089 | Bacteria | 1352 |
| 321 | Ga0207676_11250965 | 3300026095 | Bacteria | 736 |
| 322 | Ga0207675_100097252 | 3300026118 | Bacteria | 2772 |
| 323 | Ga0207683_10030943 | 3300026121 | Bacteria | 4642 |
| 324 | Ga0209179_1017684 | 3300027512 | Bacteria | 1354 |
| 325 | Ga0209179_1030480 | 3300027512 | Bacteria | 1103 |
| 326 | Ga0209588_1009968 | 3300027671 | Bacteria | 2850 |
| 327 | Ga0209588_1013299 | 3300027671 | Bacteria | 2509 |
| 328 | Ga0209588_1023729 | 3300027671 | Bacteria | 1935 |
| 329 | Ga0207428_10687091 | 3300027907 | Bacteria | 733 |
| 330 | Ga0265354_1000344 | 3300028016 | Bacteria | 8226 |
| 331 | Ga0268266_10000259 | 3300028379 | Bacteria | 88660 |
| 332 | Ga0268266_10016375 | 3300028379 | Bacteria | 6339 |
| 333 | Ga0268264_10016281 | 3300028381 | Bacteria | 6088 |
| 334 | Ga0268264_10019364 | 3300028381 | Bacteria | 5563 |
| 335 | Ga0265326_10057163 | 3300028558 | Bacteria | 1104 |
| 336 | Ga0265319_1000006 | 3300028563 | Bacteria | 228868 |
| 337 | Ga0265319_1004383 | 3300028563 | Bacteria | 6996 |
| 338 | Ga0265319_1005558 | 3300028563 | Bacteria | 6010 |
| 339 | Ga0265319_1025804 | 3300028563 | Bacteria | 2099 |
| 340 | Ga0265334_10062672 | 3300028573 | Bacteria | 1399 |
| 341 | Ga0265318_10000466 | 3300028577 | Bacteria | 30068 |
| 342 | Ga0265318_10002149 | 3300028577 | Bacteria | 10711 |
| 343 | Ga0265322_10079760 | 3300028654 | Bacteria | 929 |
| 344 | Ga0265336_10026034 | 3300028666 | Bacteria | 1839 |
| 345 | Ga0265338_10051864 | 3300028800 | Bacteria | 3688 |
| 346 | Ga0265338_10065699 | 3300028800 | Bacteria | 3144 |
| 347 | Ga0265338_10070235 | 3300028800 | Bacteria | 3004 |
| 348 | Ga0265338_10219663 | 3300028800 | Bacteria | 1420 |
| 349 | Ga0265338_10426682 | 3300028800 | Bacteria | 942 |
| 350 | Ga0265338_10650042 | 3300028800 | Bacteria | 731 |
| 351 | Ga0265338_10912176 | 3300028800 | Bacteria | 598 |
| 352 | Ga0311001_1083056 | 3300029277 | Bacteria | 1199 |
| 353 | Ga0310981_1060993 | 3300029285 | Bacteria | 1104 |
| 354 | Ga0265324_10325219 | 3300029957 | Bacteria | 524 |
| 355 | Ga0265770_1003693 | 3300030878 | Bacteria | 2080 |
| 356 | Ga0265765_1006543 | 3300030879 | Bacteria | 1242 |
| 357 | Ga0265764_102136 | 3300030882 | Bacteria | 944 |
| 358 | Ga0265773_1001638 | 3300031018 | Bacteria | 1243 |
| 359 | Ga0265760_10000026 | 3300031090 | Bacteria | 63601 |
| 360 | Ga0265760_10019572 | 3300031090 | Bacteria | 1951 |
| 361 | Ga0265760_10021342 | 3300031090 | Bacteria | 1873 |
| 362 | Ga0265760_10051624 | 3300031090 | Bacteria | 1239 |
| 363 | Ga0265330_10044087 | 3300031235 | Bacteria | 1971 |
| 364 | Ga0265332_10011115 | 3300031238 | Bacteria | 4001 |
| 365 | Ga0265332_10125373 | 3300031238 | Bacteria | 1078 |
| 366 | Ga0265328_10048044 | 3300031239 | Bacteria | 1568 |
| 367 | Ga0265328_10154371 | 3300031239 | Bacteria | 864 |
| 368 | Ga0265328_10189103 | 3300031239 | Bacteria | 780 |
| 369 | Ga0265328_10192958 | 3300031239 | Bacteria | 772 |
| 370 | Ga0265320_10001540 | 3300031240 | Bacteria | 16675 |
| 371 | Ga0265320_10033071 | 3300031240 | Bacteria | 2642 |
| 372 | Ga0265320_10354462 | 3300031240 | Bacteria | 648 |
| 373 | Ga0265325_10012503 | 3300031241 | Bacteria | 4853 |
| 374 | Ga0265325_10111536 | 3300031241 | Bacteria | 1328 |
| 375 | Ga0265329_10004500 | 3300031242 | Bacteria | 5784 |
| 376 | Ga0265329_10006079 | 3300031242 | Bacteria | 4821 |
| 377 | Ga0265329_10008477 | 3300031242 | Bacteria | 3895 |
| 378 | Ga0265329_10100232 | 3300031242 | Bacteria | 922 |
| 379 | Ga0265340_10017605 | 3300031247 | Bacteria | 3696 |
| 380 | Ga0265340_10102258 | 3300031247 | Bacteria | 1331 |
| 381 | Ga0265339_10001807 | 3300031249 | Bacteria | 15694 |
| 382 | Ga0265331_10000025 | 3300031250 | Bacteria | 229346 |
| 383 | Ga0265331_10002674 | 3300031250 | Bacteria | 11903 |
| 384 | Ga0265331_10016846 | 3300031250 | Bacteria | 3825 |
| 385 | Ga0265331_10277030 | 3300031250 | Bacteria | 752 |
| 386 | Ga0265316_10000784 | 3300031344 | Bacteria | 35048 |
| 387 | Ga0265316_10001106 | 3300031344 | Bacteria | 29252 |
| 388 | Ga0265316_10031378 | 3300031344 | Bacteria | 4346 |
| 389 | Ga0265316_10124722 | 3300031344 | Bacteria | 1943 |
| 390 | Ga0265316_10357170 | 3300031344 | Bacteria | 1057 |
| 391 | Ga0265316_10612981 | 3300031344 | Bacteria | 771 |
| 392 | Ga0307509_10043415 | 3300031507 | Bacteria | 4865 |
| 393 | Ga0307408_100071079 | 3300031548 | Bacteria | 2572 |
| 394 | Ga0265313_10001605 | 3300031595 | Bacteria | 21001 |
| 395 | Ga0265313_10018591 | 3300031595 | Bacteria | 3896 |
| 396 | Ga0265313_10102933 | 3300031595 | Bacteria | 1265 |
| 397 | Ga0265313_10156241 | 3300031595 | Bacteria | 971 |
| 398 | Ga0316575_10108542 | 3300031665 | Bacteria | 1132 |
| 399 | Ga0316579_10019575 | 3300031691 | Bacteria | 2992 |
| 400 | Ga0316579_10033104 | 3300031691 | Bacteria | 2372 |
| 401 | Ga0316579_10057060 | 3300031691 | Bacteria | 1834 |
| 402 | Ga0316579_10102736 | 3300031691 | Bacteria | 1369 |
| 403 | Ga0316579_10109614 | 3300031691 | Bacteria | 1325 |
| 404 | Ga0316579_10254432 | 3300031691 | Bacteria | 849 |
| 405 | Ga0265314_10000087 | 3300031711 | Bacteria | 138681 |
| 406 | Ga0265314_10038233 | 3300031711 | Bacteria | 3470 |
| 407 | Ga0265314_10063634 | 3300031711 | Bacteria | 2502 |
| 408 | Ga0265314_10118535 | 3300031711 | Bacteria | 1670 |
| 409 | Ga0265342_10000362 | 3300031712 | Bacteria | 50260 |
| 410 | Ga0265342_10026417 | 3300031712 | Bacteria | 3638 |
| 411 | Ga0265342_10038414 | 3300031712 | Bacteria | 2916 |
| 412 | Ga0316576_10000859 | 3300031727 | Bacteria | 15370 |
| 413 | Ga0316576_10050533 | 3300031727 | Bacteria | 3024 |
| 414 | Ga0316576_10114440 | 3300031727 | Bacteria | 2023 |
| 415 | Ga0316576_10277870 | 3300031727 | Bacteria | 1254 |
| 416 | Ga0316576_10341683 | 3300031727 | Bacteria | 1115 |
| 417 | Ga0316576_10419265 | 3300031727 | Bacteria | 991 |
| 418 | Ga0316576_10447642 | 3300031727 | Bacteria | 954 |
| 419 | Ga0316576_10453360 | 3300031727 | Bacteria | 947 |
| 420 | Ga0316576_10495153 | 3300031727 | Bacteria | 899 |
| 421 | Ga0316576_10631927 | 3300031727 | Bacteria | 780 |
| 422 | Ga0316576_10849366 | 3300031727 | Bacteria | 655 |
| 423 | Ga0316576_11060207 | 3300031727 | Bacteria | 576 |
| 424 | Ga0316578_10000241 | 3300031728 | Bacteria | 16205 |
| 425 | Ga0316578_10004865 | 3300031728 | Bacteria | 6418 |
| 426 | Ga0316578_10022633 | 3300031728 | Bacteria | 3507 |
| 427 | Ga0316578_10105859 | 3300031728 | Bacteria | 1688 |
| 428 | Ga0316578_10395493 | 3300031728 | Bacteria | 819 |
| 429 | Ga0307405_10222748 | 3300031731 | Bacteria | 1385 |
| 430 | Ga0316577_10000447 | 3300031733 | Bacteria | 16151 |
| 431 | Ga0307413_10748047 | 3300031824 | Bacteria | 817 |
| 432 | Ga0307410_10231950 | 3300031852 | Bacteria | 1426 |
| 433 | Ga0307406_10062091 | 3300031901 | Bacteria | 2416 |
| 434 | Ga0307406_11341423 | 3300031901 | Bacteria | 625 |
| 435 | Ga0307407_10357030 | 3300031903 | Bacteria | 1037 |
| 436 | Ga0307412_10845582 | 3300031911 | Bacteria | 798 |
| 437 | Ga0307409_100265902 | 3300031995 | Bacteria | 1577 |
| 438 | Ga0307409_101197534 | 3300031995 | Bacteria | 783 |
| 439 | Ga0307416_100407877 | 3300032002 | Bacteria | 1399 |
| 440 | Ga0307416_100951267 | 3300032002 | Bacteria | 961 |
| 441 | Ga0307414_12323689 | 3300032004 | Bacteria | 501 |
| 442 | Ga0307411_11352474 | 3300032005 | Bacteria | 650 |
| 443 | Ga0307411_11786736 | 3300032005 | Bacteria | 570 |
| 444 | Ga0316053_104592 | 3300032120 | Bacteria | 855 |
| 445 | Ga0307415_100241717 | 3300032126 | Bacteria | 1461 |
| 446 | Ga0316583_10000319 | 3300032133 | Bacteria | 13537 |
| 447 | Ga0316583_10305313 | 3300032133 | Bacteria | 550 |
| 448 | Ga0316585_10004899 | 3300032137 | Bacteria | 3761 |
| 449 | Ga0316585_10111936 | 3300032137 | Bacteria | 897 |
| 450 | Ga0316580_10002598 | 3300032139 | Bacteria | 5004 |
| 451 | Ga0316580_10102712 | 3300032139 | Bacteria | 875 |
| 452 | Ga0316593_10000417 | 3300032168 | Bacteria | 7701 |
| 453 | Ga0316593_10000589 | 3300032168 | Bacteria | 6877 |
| 454 | Ga0316593_10000698 | 3300032168 | Bacteria | 6551 |
| 455 | Ga0316593_10000765 | 3300032168 | Bacteria | 6363 |
| 456 | Ga0316593_10001578 | 3300032168 | Bacteria | 5079 |
| 457 | Ga0316593_10001601 | 3300032168 | Bacteria | 5053 |
| 458 | Ga0316593_10001733 | 3300032168 | Bacteria | 4942 |
| 459 | Ga0316593_10003549 | 3300032168 | Bacteria | 3891 |
| 460 | Ga0316593_10004947 | 3300032168 | Bacteria | 3470 |
| 461 | Ga0316593_10008436 | 3300032168 | Bacteria | 2873 |
| 462 | Ga0316593_10018658 | 3300032168 | Bacteria | 2135 |
| 463 | Ga0316593_10019627 | 3300032168 | Bacteria | 2091 |
| 464 | Ga0316593_10032306 | 3300032168 | Bacteria | 1709 |
| 465 | Ga0316593_10058392 | 3300032168 | Bacteria | 1315 |
| 466 | Ga0316593_10062765 | 3300032168 | Bacteria | 1273 |
| 467 | Ga0316593_10064218 | 3300032168 | Bacteria | 1260 |
| 468 | Ga0316593_10067967 | 3300032168 | Bacteria | 1229 |
| 469 | Ga0316593_10094507 | 3300032168 | Bacteria | 1055 |
| 470 | Ga0316593_10095358 | 3300032168 | Bacteria | 1051 |
| 471 | Ga0316593_10108047 | 3300032168 | Bacteria | 992 |
| 472 | Ga0316593_10341679 | 3300032168 | Bacteria | 572 |
| 473 | Ga0316593_10386520 | 3300032168 | Bacteria | 539 |
| 474 | Ga0316592_1000662 | 3300033524 | Bacteria | 5022 |
| 475 | Ga0316592_1000955 | 3300033524 | Bacteria | 4438 |
| 476 | Ga0316592_1001027 | 3300033524 | Bacteria | 4334 |
| 477 | Ga0316592_1001802 | 3300033524 | Bacteria | 3568 |
| 478 | Ga0316592_1002156 | 3300033524 | Bacteria | 3355 |
| 479 | Ga0316592_1002445 | 3300033524 | Bacteria | 3211 |
| 480 | Ga0316592_1007962 | 3300033524 | Bacteria | 2080 |
| 481 | Ga0316592_1039484 | 3300033524 | Bacteria | 1043 |
| 482 | Ga0316592_1054794 | 3300033524 | Bacteria | 892 |
| 483 | Ga0316592_1067077 | 3300033524 | Bacteria | 809 |
| 484 | Ga0316592_1099061 | 3300033524 | Bacteria | 670 |
| 485 | Ga0316592_1126026 | 3300033524 | Bacteria | 596 |
| 486 | Ga0316592_1145451 | 3300033524 | Bacteria | 558 |
| 487 | Ga0316586_1000181 | 3300033527 | Bacteria | 5262 |
| 488 | Ga0316586_1000255 | 3300033527 | Bacteria | 4665 |
| 489 | Ga0316586_1008483 | 3300033527 | Bacteria | 1525 |
| 490 | Ga0316586_1008737 | 3300033527 | Bacteria | 1506 |
| 491 | Ga0316586_1071432 | 3300033527 | Bacteria | 640 |
| 492 | Ga0316588_1000659 | 3300033528 | Bacteria | 5008 |
| 493 | Ga0316588_1000759 | 3300033528 | Bacteria | 4790 |
| 494 | Ga0316588_1000948 | 3300033528 | Bacteria | 4477 |
| 495 | Ga0316588_1001353 | 3300033528 | Bacteria | 3982 |
| 496 | Ga0316588_1001472 | 3300033528 | Bacteria | 3874 |
| 497 | Ga0316588_1002494 | 3300033528 | Bacteria | 3210 |
| 498 | Ga0316588_1005683 | 3300033528 | Bacteria | 2447 |
| 499 | Ga0316588_1013709 | 3300033528 | Bacteria | 1763 |
| 500 | Ga0316588_1029418 | 3300033528 | Bacteria | 1284 |
| 501 | Ga0316588_1149495 | 3300033528 | Bacteria | 599 |
| 502 | Ga0316587_1000871 | 3300033529 | Bacteria | 3412 |
| 503 | Ga0316587_1001166 | 3300033529 | Bacteria | 3129 |
| 504 | Ga0316587_1002730 | 3300033529 | Bacteria | 2393 |
| 505 | Ga0316587_1019796 | 3300033529 | Bacteria | 1140 |
| 506 | Ga0316587_1022964 | 3300033529 | Bacteria | 1072 |
| 507 | Ga0316587_1025453 | 3300033529 | Bacteria | 1028 |
| 508 | Ga0316587_1025912 | 3300033529 | Bacteria | 1020 |
| 509 | Ga0316587_1044150 | 3300033529 | Bacteria | 809 |
| 510 | Ga0316587_1054006 | 3300033529 | Bacteria | 739 |
| 511 | Ga0316587_1095463 | 3300033529 | Bacteria | 570 |
| 512 | Ga0316596_1000015 | 3300033541 | Bacteria | 16015 |
| 513 | Ga0316596_1000019 | 3300033541 | Bacteria | 14934 |
| 514 | Ga0316596_1000051 | 3300033541 | Bacteria | 12718 |
| 515 | Ga0316596_1003186 | 3300033541 | Bacteria | 3575 |
| 516 | Ga0316596_1003324 | 3300033541 | Bacteria | 3511 |
| 517 | Ga0316596_1003362 | 3300033541 | Bacteria | 3499 |
| 518 | Ga0316596_1004711 | 3300033541 | Bacteria | 3079 |
| 519 | Ga0316596_1004760 | 3300033541 | Bacteria | 3065 |
| 520 | Ga0316596_1014132 | 3300033541 | Bacteria | 1977 |
| 521 | Ga0316596_1038286 | 3300033541 | Bacteria | 1256 |
| 522 | Ga0316596_1040097 | 3300033541 | Bacteria | 1229 |
| 523 | Ga0316596_1052486 | 3300033541 | Bacteria | 1081 |
| 524 | Ga0316596_1087267 | 3300033541 | Bacteria | 840 |
| 525 | Ga0316596_1090373 | 3300033541 | Bacteria | 825 |
| 526 | Ga0316596_1106758 | 3300033541 | Bacteria | 759 |
| 527 | Ga0316596_1110717 | 3300033541 | Bacteria | 745 |
| 528 | Ga0316596_1166113 | 3300033541 | Bacteria | 608 |
| 529 | Ga0316212_1002571 | 3300033547 | Bacteria | 2593 |
| 530 | Ga0316212_1006236 | 3300033547 | Bacteria | 1729 |
| 531 | Ga0373926_0174374 | 3300035083 | Bacteria | 823 |
| 532 | Ga0373934_0116127 | 3300035086 | Bacteria | 1087 |
| 533 | Ga0373934_0224577 | 3300035086 | Bacteria | 775 |
| 534 | Ga0373923_0021564 | 3300035111 | Bacteria | 2516 |
| 535 | Ga0373923_0105810 | 3300035111 | Bacteria | 1245 |
| 536 | Ga0373932_0362169 | 3300035112 | Bacteria | 554 |
| 537 | Ga0373953_0012646 | 3300035117 | Bacteria | 2995 |
| 538 | Ga0373953_0249313 | 3300035117 | Bacteria | 772 |
| 539 | Ga0373954_0004146 | 3300035118 | Bacteria | 6209 |
| 540 | Ga0373954_0054945 | 3300035118 | Bacteria | 1873 |
| 541 | Ga0373956_0001921 | 3300035119 | Bacteria | 8573 |
| 542 | Ga0373956_0262775 | 3300035119 | Bacteria | 821 |
| 543 | Ga0373956_0588856 | 3300035119 | Bacteria | 531 |
| 544 | Ga0373957_0000289 | 3300035120 | Bacteria | 12644 |
| 545 | Ga0373946_0041980 | 3300035171 | Bacteria | 1878 |
| 546 | Ga0373946_0104855 | 3300035171 | Bacteria | 1272 |
| 547 | Ga0373955_0005175 | 3300035172 | Bacteria | 5836 |
| 548 | Ga0373955_0158603 | 3300035172 | Bacteria | 1334 |
| 549 | Ga0373955_0353005 | 3300035172 | Bacteria | 891 |
| 550 | Ga0373955_0582717 | 3300035172 | Bacteria | 685 |
| 551 | Ga0316574_0129363 | 3300035398 | Bacteria | 1624 |
| 552 | Ga0316574_0165133 | 3300035398 | Bacteria | 1426 |
| 553 | Ga0373924_0036091 | 3300035410 | Bacteria | 2007 |
| 554 | Ga0373931_0596196 | 3300035691 | Bacteria | 722 |
| 555 | Ga0373935_0036026 | 3300035692 | Bacteria | 3091 |
| 556 | Ga0373935_0482747 | 3300035692 | Bacteria | 898 |
| 557 | Ga0373927_0014376 | 3300035695 | Bacteria | 5240 |
| 558 | Ga0373927_0091563 | 3300035695 | Bacteria | 1975 |
| 559 | Ga0373933_0008697 | 3300035724 | Bacteria | 5535 |
| 560 | Ga0373933_0056998 | 3300035724 | Bacteria | 2347 |
| 561 | Ga0373933_0746621 | 3300035724 | Bacteria | 644 |
| 562 | Ga0373947_0000905 | 3300035725 | Bacteria | 17957 |
| 563 | Ga0373947_0212700 | 3300035725 | Bacteria | 1269 |
| 564 | Ga0373937_0024810 | 3300036401 | Bacteria | 5411 |
| 565 | Ga0373937_0053565 | 3300036401 | Bacteria | 3700 |
| 566 | Ga0373937_0185079 | 3300036401 | Bacteria | 1956 |
| 567 | Ga0373937_0885021 | 3300036401 | Bacteria | 842 |
| 568 | Ga0316582_0002761 | 3300036647 | Bacteria | 8355 |
| 569 | Ga0316582_0010159 | 3300036647 | Bacteria | 5144 |
| 570 | Ga0316582_0401048 | 3300036647 | Bacteria | 945 |
| 571 | Ga0316582_1247372 | 3300036647 | Bacteria | 506 |
| 572 | Ga0316584_0001067 | 3300036712 | Bacteria | 15995 |
| 573 | Ga0316584_0027859 | 3300036712 | Bacteria | 4160 |
| 574 | Ga0316584_0087558 | 3300036712 | Bacteria | 2331 |
| 575 | Ga0316584_0167910 | 3300036712 | Bacteria | 1629 |
| 576 | Ga0316584_0542668 | 3300036712 | Bacteria | 813 |
| 577 | Ga0373925_0248932 | 3300037068 | Bacteria | 1425 |
| 578 | Ga0373925_0571442 | 3300037068 | Bacteria | 930 |
| 579 | Ga0395899_0007266 | 3300037312 | Bacteria | 8568 |
| 580 | Ga0395899_0326214 | 3300037312 | Bacteria | 1033 |
| 581 | Ga0395900_0037779 | 3300037418 | Bacteria | 4977 |
| 582 | Ga0395900_0660692 | 3300037418 | Bacteria | 981 |
| 583 | Ga0395900_0964913 | 3300037418 | Bacteria | 773 |
| 584 | Ga0395898_0240331 | 3300037466 | Bacteria | 1727 |
| 585 | Ga0395898_0684801 | 3300037466 | Bacteria | 967 |
| 586 | Ga0395898_0958273 | 3300037466 | Bacteria | 792 |
| 587 | Ga0395905_0000376 | 3300037471 | Bacteria | 63695 |
| 588 | Ga0395905_0563765 | 3300037471 | Bacteria | 1040 |
| 589 | Ga0395905_1233340 | 3300037471 | Bacteria | 651 |
| 590 | Ga0395901_0116510 | 3300038443 | Bacteria | 2806 |
| 591 | Ga0395901_0329662 | 3300038443 | Bacteria | 1578 |
| 592 | Ga0395901_1495669 | 3300038443 | Bacteria | 631 |
| 593 | Ga0400483_016634 | 3300039062 | Bacteria | 3272 |
| 594 | Ga0400483_024254 | 3300039062 | Bacteria | 2169 |
| 595 | Ga0400483_121213 | 3300039062 | Bacteria | 1059 |
| 596 | Ga0400483_145883 | 3300039062 | Bacteria | 4531 |
| 597 | Ga0400483_266032 | 3300039062 | Bacteria | 1622 |
| 598 | Ga0436365_0074160 | 3300039437 | Bacteria | 506 |
| 599 | Ga0436365_1256045 | 3300039437 | Bacteria | 3452 |
| 600 | Ga0436361_0557259 | 3300039447 | Bacteria | 1151 |
| 601 | Ga0436362_0113140 | 3300039453 | Bacteria | 598 |
| 602 | Ga0436362_1100490 | 3300039453 | Bacteria | 850 |
| 603 | Ga0451794_33567 | 3300041446 | Bacteria | 593 |
| 604 | Ga0451795_0631926 | 3300041456 | Bacteria | 942 |
| 605 | Ga0451805_008458 | 3300041461 | Bacteria | 653 |
| 606 | Ga0451837_0887641 | 3300041494 | Bacteria | 727 |
| 607 | Ga0451852_16322 | 3300041508 | Bacteria | 501 |
| 608 | Ga0451843_1239513 | 3300041509 | Bacteria | 1088 |
| 609 | Ga0451577_0000092 | 3300042876 | Bacteria | 198898 |
| 610 | Ga0451577_0002251 | 3300042876 | Bacteria | 23422 |
| 611 | Ga0451577_0017091 | 3300042876 | Bacteria | 6708 |
| 612 | Ga0451577_0037725 | 3300042876 | Bacteria | 4349 |
| 613 | Ga0451577_0155638 | 3300042876 | Bacteria | 2057 |
| 614 | Ga0451577_0225538 | 3300042876 | Bacteria | 1694 |
| 615 | Ga0451577_0239036 | 3300042876 | Bacteria | 1643 |
| 616 | Ga0451577_0418106 | 3300042876 | Bacteria | 1217 |
| 617 | Ga0451577_0898726 | 3300042876 | Bacteria | 797 |
| 618 | Ga0451577_1002833 | 3300042876 | Bacteria | 750 |
| 619 | Ga0451577_1273950 | 3300042876 | Bacteria | 654 |
| 620 | Ga0453683_0000522 | 3300044673 | Bacteria | 43145 |
| 621 | Ga0453683_0000935 | 3300044673 | Bacteria | 27791 |
| 622 | Ga0453683_0006598 | 3300044673 | Bacteria | 7948 |
| 623 | Ga0453683_0025793 | 3300044673 | Bacteria | 3731 |
| 624 | Ga0453683_0028929 | 3300044673 | Bacteria | 3506 |
| 625 | Ga0453683_0171760 | 3300044673 | Bacteria | 1373 |
| 626 | Ga0453683_0310911 | 3300044673 | Bacteria | 1009 |
| 627 | Ga0453683_0661052 | 3300044673 | Bacteria | 683 |
| 628 | Ga0453683_1056882 | 3300044673 | Bacteria | 540 |
| 629 | Ga0453684_0000432 | 3300044712 | Bacteria | 170746 |
| 630 | Ga0453684_0001193 | 3300044712 | Bacteria | 80343 |
| 631 | Ga0453684_0002324 | 3300044712 | Bacteria | 46610 |
| 632 | Ga0453684_0048592 | 3300044712 | Bacteria | 5606 |
| 633 | Ga0453684_0055571 | 3300044712 | Bacteria | 5146 |
| 634 | Ga0453684_0058446 | 3300044712 | Bacteria | 4981 |
| 635 | Ga0453684_0070061 | 3300044712 | Bacteria | 4443 |
| 636 | Ga0453684_0073743 | 3300044712 | Bacteria | 4301 |
| 637 | Ga0453684_0087736 | 3300044712 | Bacteria | 3854 |
| 638 | Ga0453684_0141642 | 3300044712 | Bacteria | 2870 |
| 639 | Ga0453684_0219846 | 3300044712 | Bacteria | 2201 |
| 640 | Ga0453684_0267587 | 3300044712 | Bacteria | 1955 |
| 641 | Ga0453684_0479027 | 3300044712 | Bacteria | 1381 |
| 642 | Ga0453684_0589068 | 3300044712 | Bacteria | 1220 |
| 643 | Ga0453684_1075362 | 3300044712 | Bacteria | 851 |
| 644 | Ga0453684_1309569 | 3300044712 | Bacteria | 755 |
| 645 | Ga0453684_2108582 | 3300044712 | Bacteria | 565 |
| 646 | Ga0453684_2291792 | 3300044712 | Bacteria | 537 |
| 647 | Ga0466968_0241135 | 3300044735 | Bacteria | 856 |
| 648 | Ga0466957_0834350 | 3300044842 | Bacteria | 656 |
| 649 | Ga0466957_1447120 | 3300044842 | Bacteria | 501 |
| 650 | Ga0466960_0038323 | 3300044901 | Bacteria | 2253 |
| 651 | Ga0466960_0110797 | 3300044901 | Bacteria | 1426 |
| 652 | Ga0466960_0418190 | 3300044901 | Bacteria | 774 |
| 653 | Ga0466960_0612666 | 3300044901 | Bacteria | 647 |
| 654 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 655 | Ga0451576_0000113 | 3300045051 | Bacteria | 208644 |
| 656 | Ga0451576_0001103 | 3300045051 | Bacteria | 49329 |
| 657 | Ga0451576_0017828 | 3300045051 | Bacteria | 7799 |
| 658 | Ga0451576_0067033 | 3300045051 | Bacteria | 3736 |
| 659 | Ga0451576_0163274 | 3300045051 | Bacteria | 2324 |
| 660 | Ga0451576_0208325 | 3300045051 | Bacteria | 2042 |
| 661 | Ga0451576_0257261 | 3300045051 | Bacteria | 1825 |
| 662 | Ga0451576_0524010 | 3300045051 | Bacteria | 1245 |
| 663 | Ga0451576_0720739 | 3300045051 | Bacteria | 1048 |
| 664 | Ga0451576_1642384 | 3300045051 | Bacteria | 666 |
| 665 | Ga0466967_1001337 | 3300045976 | Bacteria | 832 |
| 666 | Ga0495592_0000015 | 3300046454 | Bacteria | 145683 |
| 667 | Ga0495592_0043671 | 3300046454 | Bacteria | 3352 |
| 668 | Ga0495592_0051472 | 3300046454 | Bacteria | 3059 |
| 669 | Ga0495592_0059446 | 3300046454 | Bacteria | 2815 |
| 670 | Ga0495592_0116904 | 3300046454 | Bacteria | 1881 |
| 671 | Ga0495592_0118228 | 3300046454 | Bacteria | 1868 |
| 672 | Ga0495629_0491777 | 3300046459 | Bacteria | 828 |
| 673 | Ga0495641_0147058 | 3300046461 | Bacteria | 1053 |
| 674 | Ga0495651_0036587 | 3300046462 | Bacteria | 3822 |
| 675 | Ga0495651_0055165 | 3300046462 | Bacteria | 3054 |
| 676 | Ga0495651_0072417 | 3300046462 | Bacteria | 2617 |
| 677 | Ga0495653_0014747 | 3300046463 | Bacteria | 6373 |
| 678 | Ga0495653_0168461 | 3300046463 | Bacteria | 1514 |
| 679 | Ga0495650_0000121 | 3300046471 | Bacteria | 183055 |
| 680 | Ga0495580_0054728 | 3300046472 | Bacteria | 2813 |
| 681 | Ga0495580_0258517 | 3300046472 | Bacteria | 1191 |
| 682 | Ga0495582_0258942 | 3300046473 | Bacteria | 998 |
| 683 | Ga0495639_0404316 | 3300046475 | Bacteria | 690 |
| 684 | Ga0495639_0489934 | 3300046475 | Bacteria | 627 |
| 685 | Ga0495662_0011984 | 3300046476 | Bacteria | 4237 |
| 686 | Ga0495664_0060251 | 3300046477 | Bacteria | 2260 |
| 687 | Ga0495664_0124483 | 3300046477 | Bacteria | 1559 |
| 688 | Ga0495664_0133073 | 3300046477 | Bacteria | 1506 |
| 689 | Ga0495594_0158317 | 3300046499 | Bacteria | 1287 |
| 690 | Ga0495608_0008358 | 3300046511 | Bacteria | 7258 |
| 691 | Ga0495608_0028526 | 3300046511 | Bacteria | 3793 |
| 692 | Ga0495608_0082753 | 3300046511 | Bacteria | 2084 |
| 693 | Ga0495618_0004868 | 3300046514 | Bacteria | 8201 |
| 694 | Ga0495618_0247707 | 3300046514 | Bacteria | 1118 |
| 695 | Ga0495618_0431316 | 3300046514 | Bacteria | 802 |
| 696 | Ga0495628_0000140 | 3300046516 | Bacteria | 62202 |
| 697 | Ga0495628_0001930 | 3300046516 | Bacteria | 18824 |
| 698 | Ga0495628_0108928 | 3300046516 | Bacteria | 2132 |
| 699 | Ga0495628_0131261 | 3300046516 | Bacteria | 1916 |
| 700 | Ga0495628_0398014 | 3300046516 | Bacteria | 1006 |
| 701 | Ga0495628_0894785 | 3300046516 | Bacteria | 616 |
| 702 | Ga0495628_0983104 | 3300046516 | Bacteria | 581 |
| 703 | Ga0495630_0004677 | 3300046517 | Bacteria | 9607 |
| 704 | Ga0495630_0008269 | 3300046517 | Bacteria | 7472 |
| 705 | Ga0495630_0052655 | 3300046517 | Bacteria | 3048 |
| 706 | Ga0495630_0091375 | 3300046517 | Bacteria | 2300 |
| 707 | Ga0495630_1530036 | 3300046517 | Bacteria | 500 |
| 708 | Ga0495666_0051031 | 3300046526 | Bacteria | 1988 |
| 709 | Ga0495666_0064047 | 3300046526 | Bacteria | 1755 |
| 710 | Ga0495652_0014402 | 3300046529 | Bacteria | 7100 |
| 711 | Ga0495652_0104883 | 3300046529 | Bacteria | 2285 |
| 712 | Ga0495652_0186269 | 3300046529 | Bacteria | 1588 |
| 713 | Ga0495652_0659315 | 3300046529 | Bacteria | 708 |
| 714 | Ga0495665_0003304 | 3300046531 | Bacteria | 8738 |
| 715 | Ga0495665_0498767 | 3300046531 | Bacteria | 613 |
| 716 | Ga0495640_0016376 | 3300046533 | Bacteria | 5546 |
| 717 | Ga0495640_0319729 | 3300046533 | Bacteria | 961 |
| 718 | Ga0495640_0847254 | 3300046533 | Bacteria | 543 |
| 719 | Ga0495586_0000942 | 3300046535 | Bacteria | 16500 |
| 720 | Ga0495586_0035973 | 3300046535 | Bacteria | 2659 |
| 721 | Ga0495586_0492190 | 3300046535 | Bacteria | 707 |
| 722 | Ga0495587_0002155 | 3300046536 | Bacteria | 13171 |
| 723 | Ga0495587_0020580 | 3300046536 | Bacteria | 4071 |
| 724 | Ga0495645_0002009 | 3300046543 | Bacteria | 13855 |
| 725 | Ga0495645_0121158 | 3300046543 | Bacteria | 1841 |
| 726 | Ga0495645_0247946 | 3300046543 | Bacteria | 1185 |
| 727 | Ga0495622_0509001 | 3300046557 | Bacteria | 514 |
| 728 | Ga0495667_0017783 | 3300046559 | Bacteria | 4802 |
| 729 | Ga0495667_0125252 | 3300046559 | Bacteria | 1658 |
| 730 | Ga0495667_0359202 | 3300046559 | Bacteria | 920 |
| 731 | Ga0495634_0081968 | 3300046642 | Bacteria | 2109 |
| 732 | Ga0495635_0049231 | 3300046663 | Bacteria | 2904 |
| 733 | Ga0495635_0131153 | 3300046663 | Bacteria | 1708 |
| 734 | Ga0495635_0181088 | 3300046663 | Bacteria | 1432 |
| 735 | Ga0495588_0270336 | 3300046674 | Bacteria | 895 |
| 736 | Ga0495657_0066320 | 3300046675 | Bacteria | 2371 |
| 737 | Ga0495657_0110556 | 3300046675 | Bacteria | 1741 |
| 738 | Ga0495657_0151267 | 3300046675 | Bacteria | 1441 |
| 739 | Ga0495657_0335417 | 3300046675 | Bacteria | 897 |
| 740 | Ga0495599_0021784 | 3300046678 | Bacteria | 4000 |
| 741 | Ga0495599_0098721 | 3300046678 | Bacteria | 1820 |
| 742 | Ga0495599_0177850 | 3300046678 | Bacteria | 1312 |
| 743 | Ga0495623_0015674 | 3300046679 | Bacteria | 4898 |
| 744 | Ga0495623_0137933 | 3300046679 | Bacteria | 1454 |
| 745 | Ga0495623_0269529 | 3300046679 | Bacteria | 951 |
| 746 | Ga0495646_0014717 | 3300046680 | Bacteria | 4972 |
| 747 | Ga0495646_0046689 | 3300046680 | Bacteria | 2639 |
| 748 | Ga0495658_0002307 | 3300046683 | Bacteria | 9627 |
| 749 | Ga0495658_0091811 | 3300046683 | Bacteria | 1799 |
| 750 | Ga0495613_0180121 | 3300046689 | Bacteria | 1497 |
| 751 | Ga0495613_0253462 | 3300046689 | Bacteria | 1228 |
| 752 | Ga0495624_0016372 | 3300046690 | Bacteria | 4990 |
| 753 | Ga0495624_0146504 | 3300046690 | Bacteria | 1445 |
| 754 | Ga0495600_0303358 | 3300046809 | Bacteria | 1007 |
| 755 | Ga0495600_0378201 | 3300046809 | Bacteria | 884 |
| 756 | Ga0495604_0002807 | 3300047317 | Bacteria | 13979 |
| 757 | Ga0495604_0019334 | 3300047317 | Bacteria | 5452 |
| 758 | Ga0495604_0081209 | 3300047317 | Bacteria | 2427 |
| 759 | Ga0495604_0270715 | 3300047317 | Bacteria | 1151 |
| 760 | Ga0495604_0506652 | 3300047317 | Bacteria | 782 |
| 761 | Ga0495674_0000992 | 3300047319 | Bacteria | 27284 |
| 762 | Ga0495674_0015976 | 3300047319 | Bacteria | 7007 |
| 763 | Ga0495674_0049324 | 3300047319 | Bacteria | 3721 |
| 764 | Ga0495674_0072689 | 3300047319 | Bacteria | 2966 |
| 765 | Ga0495674_0213133 | 3300047319 | Bacteria | 1599 |
| 766 | Ga0495676_0026951 | 3300047321 | Bacteria | 4936 |
| 767 | Ga0495680_0010376 | 3300047322 | Bacteria | 8313 |
| 768 | Ga0495680_0037174 | 3300047322 | Bacteria | 3902 |
| 769 | Ga0495680_0134879 | 3300047322 | Bacteria | 1811 |
| 770 | Ga0495680_0161336 | 3300047322 | Bacteria | 1628 |
| 771 | Ga0495675_0002873 | 3300047444 | Bacteria | 10333 |
| 772 | Ga0495675_0004854 | 3300047444 | Bacteria | 8180 |
| 773 | Ga0495684_0005513 | 3300047471 | Bacteria | 9853 |
| 774 | Ga0495684_0036919 | 3300047471 | Bacteria | 3746 |
| 775 | Ga0495684_0077651 | 3300047471 | Bacteria | 2520 |
| 776 | Ga0495684_0111921 | 3300047471 | Bacteria | 2059 |
| 777 | Ga0495593_0010826 | 3300047673 | Bacteria | 5259 |
| 778 | Ga0495602_0090783 | 3300048088 | Bacteria | 2536 |
| 779 | Ga0495602_0126705 | 3300048088 | Bacteria | 2044 |
| 780 | Ga0495602_0262442 | 3300048088 | Bacteria | 1280 |
| 781 | Ga0495614_0058406 | 3300048089 | Bacteria | 1656 |
| 782 | Ga0495614_0174547 | 3300048089 | Bacteria | 965 |
| 783 | Ga0495615_0283139 | 3300048090 | Bacteria | 533 |
| 784 | Ga0496102_0463485 | 3300048905 | Bacteria | 1188 |
| 785 | Ga0496103_0358492 | 3300048906 | Bacteria | 937 |
| 786 | Ga0496104_0639534 | 3300048907 | Bacteria | 973 |
| 787 | Ga0496104_1690417 | 3300048907 | Bacteria | 535 |
| 788 | Ga0496107_0590638 | 3300048910 | Bacteria | 821 |
| 789 | Ga0496107_0630963 | 3300048910 | Bacteria | 791 |
| 790 | Ga0496109_1297456 | 3300048912 | Bacteria | 664 |
| 791 | Ga0496112_0000516 | 3300048915 | Bacteria | 26268 |
| 792 | Ga0496112_0256546 | 3300048915 | Bacteria | 1699 |
| 793 | Ga0496112_0394878 | 3300048915 | Bacteria | 1323 |
| 794 | Ga0496113_0032155 | 3300048916 | Bacteria | 3812 |
| 795 | Ga0496115_0333657 | 3300048918 | Bacteria | 1239 |
| 796 | Ga0496115_0730131 | 3300048918 | Bacteria | 776 |
| 797 | Ga0496119_0381322 | 3300048922 | Bacteria | 676 |
| 798 | Ga0496121_0006505 | 3300048924 | Bacteria | 14454 |
| 799 | Ga0496125_0004021 | 3300048928 | Bacteria | 17262 |
| 800 | Ga0496125_0010850 | 3300048928 | Bacteria | 9171 |
| 801 | Ga0501306_003070 | 3300049127 | Bacteria | 1770 |
| 802 | Ga0501306_104614 | 3300049127 | Bacteria | 509 |
| 803 | Ga0501308_007513 | 3300049128 | Bacteria | 1143 |
| 804 | Ga0501308_034137 | 3300049128 | Bacteria | 694 |
| 805 | Ga0501308_052445 | 3300049128 | Bacteria | 600 |
| 806 | Ga0501309_064488 | 3300049129 | Bacteria | 594 |
| 807 | Ga0501304_001315 | 3300049160 | Bacteria | 1570 |
| 808 | Ga0501305_116230 | 3300049161 | Bacteria | 510 |
| 809 | Ga0501305_116248 | 3300049161 | Bacteria | 510 |
| 810 | Ga0501307_018937 | 3300049162 | Bacteria | 879 |
| 811 | Ga0501292_042392 | 3300049515 | Bacteria | 789 |
| 812 | Ga0501311_026839 | 3300049527 | Bacteria | 814 |
| 813 | Ga0501311_032212 | 3300049527 | Bacteria | 764 |
| 814 | Ga0501312_045365 | 3300049528 | Bacteria | 728 |
| 815 | Ga0501313_031423 | 3300049529 | Bacteria | 690 |
| 816 | Ga0501318_084511 | 3300049534 | Bacteria | 518 |
| 817 | Ga0501319_031007 | 3300049535 | Bacteria | 514 |
| 818 | Ga0501320_030333 | 3300049536 | Bacteria | 670 |
| 819 | Ga0501320_036925 | 3300049536 | Bacteria | 628 |
| 820 | Ga0501320_066742 | 3300049536 | Bacteria | 514 |
| 821 | Ga0501031_0009956 | 3300049568 | Bacteria | 6190 |
| 822 | Ga0501032_0199597 | 3300049569 | Bacteria | 1305 |
| 823 | Ga0501033_0029262 | 3300049570 | Bacteria | 4139 |
| 824 | Ga0501034_0095132 | 3300049571 | Bacteria | 2975 |
| 825 | Ga0501034_0408012 | 3300049571 | Bacteria | 1281 |
| 826 | Ga0501034_0990356 | 3300049571 | Bacteria | 725 |
| 827 | Ga0501036_0014384 | 3300049572 | Bacteria | 6589 |
| 828 | Ga0501037_0108066 | 3300049573 | Bacteria | 2004 |
| 829 | Ga0501038_0005590 | 3300049574 | Bacteria | 11667 |
| 830 | Ga0501038_1259750 | 3300049574 | Bacteria | 535 |
| 831 | Ga0501039_0121352 | 3300049575 | Bacteria | 2048 |
| 832 | Ga0501040_0359091 | 3300049576 | Bacteria | 1044 |
| 833 | Ga0501043_0440364 | 3300049579 | Bacteria | 980 |
| 834 | Ga0501043_0695671 | 3300049579 | Bacteria | 743 |
| 835 | Ga0501046_0034880 | 3300049580 | Bacteria | 4057 |
| 836 | Ga0501046_0778081 | 3300049580 | Bacteria | 671 |
| 837 | Ga0501047_0308480 | 3300049581 | Bacteria | 1423 |
| 838 | Ga0501048_0008581 | 3300049582 | Bacteria | 7716 |
| 839 | Ga0501048_0169189 | 3300049582 | Bacteria | 1548 |
| 840 | Ga0501067_0006705 | 3300049583 | Bacteria | 6392 |
| 841 | Ga0501067_0009843 | 3300049583 | Bacteria | 5294 |
| 842 | Ga0501067_0391562 | 3300049583 | Bacteria | 775 |
| 843 | Ga0501069_0090513 | 3300049585 | Bacteria | 1730 |
| 844 | Ga0501071_0061932 | 3300049587 | Bacteria | 2710 |
| 845 | Ga0501071_0477217 | 3300049587 | Bacteria | 956 |
| 846 | Ga0501071_0988280 | 3300049587 | Bacteria | 650 |
| 847 | Ga0501072_1174545 | 3300049588 | Bacteria | 596 |
| 848 | Ga0501073_0159025 | 3300049589 | Bacteria | 1565 |
| 849 | Ga0501074_0013273 | 3300049590 | Bacteria | 5989 |
| 850 | Ga0501074_0130988 | 3300049590 | Bacteria | 1794 |
| 851 | Ga0501074_0146862 | 3300049590 | Bacteria | 1686 |
| 852 | Ga0501075_0220466 | 3300049591 | Bacteria | 1447 |
| 853 | Ga0501075_0469804 | 3300049591 | Bacteria | 959 |
| 854 | Ga0501077_0230973 | 3300049593 | Bacteria | 1176 |
| 855 | Ga0501242_026540 | 3300049674 | Bacteria | 767 |
| 856 | Ga0501257_097188 | 3300049686 | Bacteria | 770 |
| 857 | Ga0501079_0665848 | 3300049741 | Bacteria | 819 |
| 858 | Ga0501079_1217808 | 3300049741 | Bacteria | 593 |
| 859 | Ga0501080_0191461 | 3300049742 | Bacteria | 1879 |
| 860 | Ga0501080_1091273 | 3300049742 | Bacteria | 689 |
| 861 | Ga0501083_0041703 | 3300049744 | Bacteria | 3112 |
| 862 | Ga0501083_0520694 | 3300049744 | Bacteria | 774 |
| 863 | Ga0501035_0040785 | 3300049822 | Bacteria | 4193 |
| 864 | Ga0501035_1115667 | 3300049822 | Bacteria | 615 |
| 865 | Ga0501044_0013375 | 3300049823 | Bacteria | 8874 |
| 866 | Ga0501044_0078916 | 3300049823 | Bacteria | 3336 |
| 867 | Ga0501045_1230145 | 3300049824 | Bacteria | 546 |
| 868 | nmdc:mga06z11_301313_c1 | 3300050494 | Bacteria | 953 |
| 869 | nmdc:mga05p37_1927286_c1 | 3300050507 | Bacteria | 563 |
| 870 | nmdc:mga09592_172694_c1 | 3300050508 | Bacteria | 1869 |
| 871 | nmdc:mga09592_185333_c1 | 3300050508 | Bacteria | 1801 |
| 872 | nmdc:mga09592_458615_c1 | 3300050508 | Bacteria | 1099 |
| 873 | nmdc:mga09592_926227_c1 | 3300050508 | Unclassified | 731 |
| 874 | nmdc:mga0qj67_281355_c1 | 3300050509 | Bacteria | 1348 |
| 875 | nmdc:mga0qj67_3985_c2 | 3300050509 | Bacteria | 4055 |
| 876 | nmdc:mga06r32_268624_c1 | 3300050510 | Bacteria | 1693 |
| 877 | nmdc:mga06r32_319969_c1 | 3300050510 | Bacteria | 1537 |
| 878 | nmdc:mga06r32_54362_c1 | 3300050510 | Bacteria | 3839 |
| 879 | nmdc:mga08y16_18794_c1 | 3300050511 | Bacteria | 7281 |
| 880 | nmdc:mga08y16_468499_c1 | 3300050511 | Bacteria | 1283 |
| 881 | nmdc:mga08y16_932106_c1 | 3300050511 | Bacteria | 853 |
| 882 | nmdc:mga0n895_2004878_c1 | 3300050512 | Bacteria | 536 |
| 883 | nmdc:mga0rr50_382368_c1 | 3300050513 | Bacteria | 1187 |
| 884 | nmdc:mga08x19_22048_c1 | 3300050514 | Bacteria | 3940 |
| 885 | nmdc:mga0a205_116758_c1 | 3300050515 | Bacteria | 2567 |
| 886 | nmdc:mga0a205_232987_c1 | 3300050515 | Bacteria | 1724 |
| 887 | nmdc:mga0a205_602712_c1 | 3300050515 | Bacteria | 951 |
| 888 | nmdc:mga0a205_69251_c1 | 3300050515 | Bacteria | 3408 |
| 889 | nmdc:mga0a205_968698_c1 | 3300050515 | Bacteria | 697 |
| 890 | Ga0495601_0230599 | 3300053077 | Bacteria | 1209 |
| 891 | Ga0495601_0394008 | 3300053077 | Bacteria | 898 |
| 892 | Ga0495612_0328643 | 3300053078 | Bacteria | 688 |
| 893 | Ga0495595_0156992 | 3300053084 | Bacteria | 1121 |
| 894 | Ga0495595_0197946 | 3300053084 | Bacteria | 1000 |
| 895 | Ga0495619_0010291 | 3300053085 | Bacteria | 5888 |
| 896 | Ga0501084_0045171 | 3300054114 | Bacteria | 3689 |
| 897 | Ga0501084_0824520 | 3300054114 | Bacteria | 781 |
| 898 | Ga0501084_1281179 | 3300054114 | Bacteria | 614 |
| 899 | Ga0587080_081379 | 3300059503 | Bacteria | 665 |
| 900 | Ga0587086_030397 | 3300059507 | Bacteria | 791 |
| 901 | Ga0587090_127125 | 3300059510 | Bacteria | 558 |
| 902 | Ga0587109_133264 | 3300059624 | Bacteria | 601 |
| 903 | Ga0587062_081960 | 3300059639 | Bacteria | 601 |
| 904 | Ga0587072_134023 | 3300059643 | Bacteria | 585 |
| 905 | Ga0587072_201303 | 3300059643 | Bacteria | 506 |
| 906 | Ga0587078_078141 | 3300059646 | Bacteria | 527 |
| 907 | Ga0501082_0142204 | 3300060353 | Bacteria | 2082 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_1495669 | Ga0395901_1495669_13_354 | 104 |
| 2 | 3300044901 | Ga0466960_0418190 | Ga0466960_0418190_12_353 | 104 |
| 3 | 3300044901 | Ga0466960_0612666 | Ga0466960_0612666_285_626 | 104 |
| 4 | 3300048907 | Ga0496104_1690417 | Ga0496104_1690417_18_359 | 104 |
| 5 | 3300048922 | Ga0496119_0381322 | Ga0496119_0381322_187_528 | 104 |
| 6 | 3300049741 | Ga0501079_1217808 | Ga0501079_1217808_13_345 | 110 |
| 7 | 3300049824 | Ga0501045_1230145 | Ga0501045_1230145_32_406 | 110 |
| 8 | 3300049576 | Ga0501040_0359091 | Ga0501040_0359091_505_885 | 112 |
| 9 | 3300049591 | Ga0501075_0469804 | Ga0501075_0469804_274_654 | 112 |
| 10 | 3300054114 | Ga0501084_0824520 | Ga0501084_0824520_289_669 | 112 |
| 11 | 3300009092 | Ga0105250_10425161 | Ga0105250_104251612 | 113 |
| 12 | 3300005437 | Ga0070710_11159375 | Ga0070710_111593752 | 115 |
| 13 | 3300046674 | Ga0495588_0270336 | Ga0495588_0270336_16_390 | 115 |
| 14 | 3300048910 | Ga0496107_0630963 | Ga0496107_0630963_404_778 | 115 |
| 15 | 3300031728 | Ga0316578_10105859 | Ga0316578_101058591 | 116 |
| 16 | 3300032168 | Ga0316593_10064218 | Ga0316593_100642181 | 116 |
| 17 | 3300049536 | Ga0501320_030333 | Ga0501320_030333_257_607 | 116 |
| 18 | 3300005434 | Ga0070709_10068471 | Ga0070709_100684713 | 119 |
| 19 | 3300005436 | Ga0070713_100428436 | Ga0070713_1004284361 | 119 |
| 20 | 3300005437 | Ga0070710_10043474 | Ga0070710_100434743 | 119 |
| 21 | 3300005467 | Ga0070706_100027065 | Ga0070706_1000270654 | 119 |
| 22 | 3300005467 | Ga0070706_100233626 | Ga0070706_1002336261 | 119 |
| 23 | 3300005471 | Ga0070698_100480315 | Ga0070698_1004803151 | 119 |
| 24 | 3300005471 | Ga0070698_100911535 | Ga0070698_1009115351 | 119 |
| 25 | 3300005530 | Ga0070679_100024467 | Ga0070679_1000244673 | 119 |
| 26 | 3300005545 | Ga0070695_100027795 | Ga0070695_1000277954 | 119 |
| 27 | 3300005546 | Ga0070696_100003003 | Ga0070696_1000030037 | 119 |
| 28 | 3300005547 | Ga0070693_100000994 | Ga0070693_1000009944 | 119 |
| 29 | 3300005549 | Ga0070704_100003283 | Ga0070704_1000032833 | 119 |
| 30 | 3300005843 | Ga0068860_100509204 | Ga0068860_1005092042 | 119 |
| 31 | 3300006163 | Ga0070715_10208809 | Ga0070715_102088091 | 119 |
| 32 | 3300006163 | Ga0070715_10212958 | Ga0070715_102129581 | 119 |
| 33 | 3300006175 | Ga0070712_100351408 | Ga0070712_1003514082 | 119 |
| 34 | 3300006358 | Ga0068871_100022756 | Ga0068871_1000227562 | 119 |
| 35 | 3300006871 | Ga0075434_100084572 | Ga0075434_1000845724 | 119 |
| 36 | 3300006881 | Ga0068865_100072446 | Ga0068865_1000724462 | 119 |
| 37 | 3300006881 | Ga0068865_100712783 | Ga0068865_1007127832 | 119 |
| 38 | 3300007076 | Ga0075435_100140998 | Ga0075435_1001409983 | 119 |
| 39 | 3300007076 | Ga0075435_100805145 | Ga0075435_1008051452 | 119 |
| 40 | 3300007076 | Ga0075435_101405799 | Ga0075435_1014057992 | 119 |
| 41 | 3300007265 | Ga0099794_10113447 | Ga0099794_101134472 | 119 |
| 42 | 3300007788 | Ga0099795_10030072 | Ga0099795_100300722 | 119 |
| 43 | 3300007788 | Ga0099795_10086438 | Ga0099795_100864381 | 119 |
| 44 | 3300009101 | Ga0105247_10279487 | Ga0105247_102794872 | 119 |
| 45 | 3300009177 | Ga0105248_11056173 | Ga0105248_110561731 | 119 |
| 46 | 3300009177 | Ga0105248_11706920 | Ga0105248_117069202 | 119 |
| 47 | 3300009545 | Ga0105237_10072778 | Ga0105237_100727783 | 119 |
| 48 | 3300010375 | Ga0105239_10022622 | Ga0105239_100226226 | 119 |
| 49 | 3300010375 | Ga0105239_10544717 | Ga0105239_105447172 | 119 |
| 50 | 3300013296 | Ga0157374_10119097 | Ga0157374_101190972 | 119 |
| 51 | 3300013297 | Ga0157378_10000272 | Ga0157378_1000027237 | 119 |
| 52 | 3300013297 | Ga0157378_10010996 | Ga0157378_100109963 | 119 |
| 53 | 3300013306 | Ga0163162_10374288 | Ga0163162_103742882 | 119 |
| 54 | 3300013306 | Ga0163162_11107878 | Ga0163162_111078781 | 119 |
| 55 | 3300013307 | Ga0157372_10098714 | Ga0157372_100987143 | 119 |
| 56 | 3300013308 | Ga0157375_11315401 | Ga0157375_113154011 | 119 |
| 57 | 3300014968 | Ga0157379_10056214 | Ga0157379_100562142 | 119 |
| 58 | 3300014969 | Ga0157376_10000075 | Ga0157376_1000007566 | 119 |
| 59 | 3300014969 | Ga0157376_10002707 | Ga0157376_100027073 | 119 |
| 60 | 3300025905 | Ga0207685_10274449 | Ga0207685_102744491 | 119 |
| 61 | 3300025906 | Ga0207699_10175452 | Ga0207699_101754521 | 119 |
| 62 | 3300025906 | Ga0207699_10186348 | Ga0207699_101863481 | 119 |
| 63 | 3300025916 | Ga0207663_10076628 | Ga0207663_100766281 | 119 |
| 64 | 3300025928 | Ga0207700_10067895 | Ga0207700_100678951 | 119 |
| 65 | 3300035086 | Ga0373934_0116127 | Ga0373934_0116127_160_522 | 119 |
| 66 | 3300035111 | Ga0373923_0105810 | Ga0373923_0105810_163_525 | 119 |
| 67 | 3300035117 | Ga0373953_0012646 | Ga0373953_0012646_2204_2566 | 119 |
| 68 | 3300035118 | Ga0373954_0004146 | Ga0373954_0004146_5228_5590 | 119 |
| 69 | 3300035119 | Ga0373956_0001921 | Ga0373956_0001921_3231_3593 | 119 |
| 70 | 3300035119 | Ga0373956_0588856 | Ga0373956_0588856_92_454 | 119 |
| 71 | 3300035120 | Ga0373957_0000289 | Ga0373957_0000289_6149_6511 | 119 |
| 72 | 3300035172 | Ga0373955_0005175 | Ga0373955_0005175_1302_1664 | 119 |
| 73 | 3300035692 | Ga0373935_0482747 | Ga0373935_0482747_440_802 | 119 |
| 74 | 3300035695 | Ga0373927_0091563 | Ga0373927_0091563_588_950 | 119 |
| 75 | 3300035724 | Ga0373933_0008697 | Ga0373933_0008697_311_673 | 119 |
| 76 | 3300036401 | Ga0373937_0053565 | Ga0373937_0053565_2661_3023 | 119 |
| 77 | 3300046454 | Ga0495592_0043671 | Ga0495592_0043671_2197_2559 | 119 |
| 78 | 3300046462 | Ga0495651_0072417 | Ga0495651_0072417_643_1005 | 119 |
| 79 | 3300046511 | Ga0495608_0082753 | Ga0495608_0082753_598_960 | 119 |
| 80 | 3300046514 | Ga0495618_0431316 | Ga0495618_0431316_397_759 | 119 |
| 81 | 3300046516 | Ga0495628_0108928 | Ga0495628_0108928_1279_1641 | 119 |
| 82 | 3300046529 | Ga0495652_0186269 | Ga0495652_0186269_526_888 | 119 |
| 83 | 3300046536 | Ga0495587_0020580 | Ga0495587_0020580_2318_2680 | 119 |
| 84 | 3300046675 | Ga0495657_0151267 | Ga0495657_0151267_531_893 | 119 |
| 85 | 3300046679 | Ga0495623_0137933 | Ga0495623_0137933_809_1171 | 119 |
| 86 | 3300046679 | Ga0495623_0269529 | Ga0495623_0269529_482_844 | 119 |
| 87 | 3300046809 | Ga0495600_0303358 | Ga0495600_0303358_216_578 | 119 |
| 88 | 3300047317 | Ga0495604_0002807 | Ga0495604_0002807_10512_10874 | 119 |
| 89 | 3300047471 | Ga0495684_0111921 | Ga0495684_0111921_549_911 | 119 |
| 90 | 3300048088 | Ga0495602_0126705 | Ga0495602_0126705_326_688 | 119 |
| 91 | 3300050513 | nmdc:mga0rr50_382368_c1 | nmdc:mga0rr50_382368_c1_634_996 | 119 |
| 92 | 3300050514 | nmdc:mga08x19_22048_c1 | nmdc:mga08x19_22048_c1_319_681 | 119 |
| 93 | 3300053084 | Ga0495595_0156992 | Ga0495595_0156992_156_518 | 119 |
| 94 | 3300053084 | Ga0495595_0197946 | Ga0495595_0197946_507_869 | 119 |
| 95 | 3300053085 | Ga0495619_0010291 | Ga0495619_0010291_2028_2390 | 119 |
| 96 | 3300028654 | Ga0265322_10079760 | Ga0265322_100797602 | 120 |
| 97 | 3300028800 | Ga0265338_10065699 | Ga0265338_100656993 | 120 |
| 98 | 3300046454 | Ga0495592_0000015 | Ga0495592_0000015_78347_78772 | 121 |
| 99 | 3300046476 | Ga0495662_0011984 | Ga0495662_0011984_1947_2372 | 121 |
| 100 | 3300046477 | Ga0495664_0133073 | Ga0495664_0133073_945_1370 | 121 |
| 101 | 3300046514 | Ga0495618_0004868 | Ga0495618_0004868_4906_5331 | 121 |
| 102 | 3300046516 | Ga0495628_0000140 | Ga0495628_0000140_8067_8492 | 121 |
| 103 | 3300046517 | Ga0495630_0004677 | Ga0495630_0004677_742_1167 | 121 |
| 104 | 3300046526 | Ga0495666_0051031 | Ga0495666_0051031_13_438 | 121 |
| 105 | 3300046533 | Ga0495640_0016376 | Ga0495640_0016376_2788_3213 | 121 |
| 106 | 3300046535 | Ga0495586_0000942 | Ga0495586_0000942_3389_3814 | 121 |
| 107 | 3300046543 | Ga0495645_0002009 | Ga0495645_0002009_10256_10681 | 121 |
| 108 | 3300046678 | Ga0495599_0021784 | Ga0495599_0021784_769_1194 | 121 |
| 109 | 3300046683 | Ga0495658_0091811 | Ga0495658_0091811_1147_1572 | 121 |
| 110 | 3300046690 | Ga0495624_0146504 | Ga0495624_0146504_711_1136 | 121 |
| 111 | 3300047319 | Ga0495674_0000992 | Ga0495674_0000992_10434_10859 | 121 |
| 112 | 3300049161 | Ga0501305_116248 | Ga0501305_116248_19_384 | 121 |
| 113 | 3300049536 | Ga0501320_036925 | Ga0501320_036925_250_618 | 121 |
| 114 | 3300053077 | Ga0495601_0394008 | Ga0495601_0394008_338_763 | 121 |
| 115 | iso_pu_bacteria | 2511231119 | 2511697993 | 121 |
| 116 | iso_pu_bacteria | 2545555800 | 2545559768 | 121 |
| 117 | iso_pu_bacteria | 2576861599 | 2578930725 | 121 |
| 118 | iso_pu_bacteria | 2630968484 | 2631982472 | 121 |
| 119 | iso_pu_bacteria | 2648501850 | 2651530336 | 121 |
| 120 | iso_pu_bacteria | 2671180844 | 2674421109 | 121 |
| 121 | iso_pu_bacteria | 2695420354 | 2695629913 | 121 |
| 122 | iso_pu_bacteria | 2716884898 | 2717918188 | 121 |
| 123 | iso_pu_bacteria | 2808606399 | 2809057194 | 121 |
| 124 | iso_pu_bacteria | 2816332295 | 2817478182 | 121 |
| 125 | iso_pu_bacteria | 2860837431 | 2860837572 | 121 |
| 126 | iso_pu_bacteria | 2877768649 | 2877768791 | 121 |
| 127 | iso_pu_bacteria | 2880169592 | 2880169733 | 121 |
| 128 | iso_pu_bacteria | 2897109615 | 2897109760 | 121 |
| 129 | iso_pu_bacteria | 2904560550 | 2904564582 | 121 |
| 130 | iso_pu_bacteria | 2962290636 | 2962290783 | 121 |
| 131 | iso_pu_bacteria | 2969136845 | 2969136990 | 121 |
| 132 | iso_pu_bacteria | 2969141011 | 2969141159 | 121 |
| 133 | iso_pu_bacteria | 2969765954 | 2969766261 | 121 |
| 134 | iso_pu_bacteria | 2969770375 | 2969774929 | 121 |
| 135 | iso_pu_bacteria | 2971893375 | 2971893520 | 121 |
| 136 | iso_pu_bacteria | 2980492589 | 2980492734 | 121 |
| 137 | iso_pu_bacteria | 3006858327 | 3006858510 | 121 |
| 138 | iso_pu_bacteria | 3006879489 | 3006883621 | 121 |
| 139 | iso_pu_bacteria | 8022630665 | 8022631648 | 121 |
| 140 | iso_pu_bacteria | 8022653035 | 8022655870 | 121 |
| 141 | iso_pu_bacteria | 8051952484 | 8051956503 | 121 |
| 142 | iso_pu_bacteria | 8052174270 | 8052174979 | 121 |
| 143 | 3300005439 | Ga0070711_100045540 | Ga0070711_1000455401 | 122 |
| 144 | 3300005439 | Ga0070711_101221300 | Ga0070711_1012213002 | 122 |
| 145 | 3300005440 | Ga0070705_101040583 | Ga0070705_1010405831 | 122 |
| 146 | 3300025915 | Ga0207693_10118572 | Ga0207693_101185723 | 122 |
| 147 | 3300025916 | Ga0207663_10026105 | Ga0207663_100261052 | 122 |
| 148 | 3300025934 | Ga0207686_10250328 | Ga0207686_102503282 | 122 |
| 149 | 3300026118 | Ga0207675_100097252 | Ga0207675_1000972523 | 122 |
| 150 | 3300028558 | Ga0265326_10057163 | Ga0265326_100571632 | 122 |
| 151 | 3300028563 | Ga0265319_1000006 | Ga0265319_1000006190 | 122 |
| 152 | 3300028563 | Ga0265319_1005558 | Ga0265319_10055587 | 122 |
| 153 | 3300028563 | Ga0265319_1025804 | Ga0265319_10258041 | 122 |
| 154 | 3300028577 | Ga0265318_10002149 | Ga0265318_100021492 | 122 |
| 155 | 3300028800 | Ga0265338_10051864 | Ga0265338_100518643 | 122 |
| 156 | 3300029957 | Ga0265324_10325219 | Ga0265324_103252191 | 122 |
| 157 | 3300031239 | Ga0265328_10048044 | Ga0265328_100480442 | 122 |
| 158 | 3300031240 | Ga0265320_10033071 | Ga0265320_100330713 | 122 |
| 159 | 3300031240 | Ga0265320_10354462 | Ga0265320_103544622 | 122 |
| 160 | 3300031344 | Ga0265316_10357170 | Ga0265316_103571702 | 122 |
| 161 | 3300031595 | Ga0265313_10102933 | Ga0265313_101029332 | 122 |
| 162 | 3300031595 | Ga0265313_10156241 | Ga0265313_101562411 | 122 |
| 163 | 3300031711 | Ga0265314_10000087 | Ga0265314_1000008744 | 122 |
| 164 | 3300031711 | Ga0265314_10118535 | Ga0265314_101185353 | 122 |
| 165 | 3300035112 | Ga0373932_0362169 | Ga0373932_0362169_110_478 | 122 |
| 166 | 3300035171 | Ga0373946_0104855 | Ga0373946_0104855_388_783 | 122 |
| 167 | 3300035725 | Ga0373947_0212700 | Ga0373947_0212700_177_572 | 122 |
| 168 | 3300036401 | Ga0373937_0885021 | Ga0373937_0885021_271_693 | 122 |
| 169 | 3300037068 | Ga0373925_0248932 | Ga0373925_0248932_662_1057 | 122 |
| 170 | 3300037312 | Ga0395899_0326214 | Ga0395899_0326214_119_514 | 122 |
| 171 | 3300037418 | Ga0395900_0964913 | Ga0395900_0964913_57_452 | 122 |
| 172 | 3300037466 | Ga0395898_0240331 | Ga0395898_0240331_485_880 | 122 |
| 173 | 3300037466 | Ga0395898_0958273 | Ga0395898_0958273_348_743 | 122 |
| 174 | 3300037471 | Ga0395905_1233340 | Ga0395905_1233340_113_508 | 122 |
| 175 | 3300039062 | Ga0400483_024254 | Ga0400483_024254_748_1164 | 122 |
| 176 | 3300039437 | Ga0436365_0074160 | Ga0436365_0074160_87_455 | 122 |
| 177 | 3300041456 | Ga0451795_0631926 | Ga0451795_0631926_279_647 | 122 |
| 178 | 3300041494 | Ga0451837_0887641 | Ga0451837_0887641_189_584 | 122 |
| 179 | 3300041509 | Ga0451843_1239513 | Ga0451843_1239513_622_990 | 122 |
| 180 | 3300044842 | Ga0466957_0834350 | Ga0466957_0834350_206_601 | 122 |
| 181 | 3300044842 | Ga0466957_1447120 | Ga0466957_1447120_94_489 | 122 |
| 182 | 3300044901 | Ga0466960_0110797 | Ga0466960_0110797_822_1217 | 122 |
| 183 | 3300045976 | Ga0466967_1001337 | Ga0466967_1001337_149_544 | 122 |
| 184 | 3300046454 | Ga0495592_0118228 | Ga0495592_0118228_1261_1683 | 122 |
| 185 | 3300046461 | Ga0495641_0147058 | Ga0495641_0147058_394_789 | 122 |
| 186 | 3300046471 | Ga0495650_0000121 | Ga0495650_0000121_77885_78280 | 122 |
| 187 | 3300046475 | Ga0495639_0489934 | Ga0495639_0489934_18_413 | 122 |
| 188 | 3300046516 | Ga0495628_0131261 | Ga0495628_0131261_705_1127 | 122 |
| 189 | 3300046529 | Ga0495652_0659315 | Ga0495652_0659315_205_600 | 122 |
| 190 | 3300046543 | Ga0495645_0247946 | Ga0495645_0247946_290_712 | 122 |
| 191 | 3300047317 | Ga0495604_0270715 | Ga0495604_0270715_476_871 | 122 |
| 192 | 3300047321 | Ga0495676_0026951 | Ga0495676_0026951_2544_2939 | 122 |
| 193 | 3300047322 | Ga0495680_0134879 | Ga0495680_0134879_624_1019 | 122 |
| 194 | 3300048089 | Ga0495614_0174547 | Ga0495614_0174547_297_692 | 122 |
| 195 | 3300048907 | Ga0496104_0639534 | Ga0496104_0639534_62_457 | 122 |
| 196 | 3300048912 | Ga0496109_1297456 | Ga0496109_1297456_66_461 | 122 |
| 197 | 3300048915 | Ga0496112_0000516 | Ga0496112_0000516_25118_25513 | 122 |
| 198 | 3300048916 | Ga0496113_0032155 | Ga0496113_0032155_2863_3258 | 122 |
| 199 | 3300049534 | Ga0501318_084511 | Ga0501318_084511_70_438 | 122 |
| 200 | 3300049568 | Ga0501031_0009956 | Ga0501031_0009956_1667_2062 | 122 |
| 201 | 3300049569 | Ga0501032_0199597 | Ga0501032_0199597_21_416 | 122 |
| 202 | 3300049570 | Ga0501033_0029262 | Ga0501033_0029262_2774_3169 | 122 |
| 203 | 3300049571 | Ga0501034_0095132 | Ga0501034_0095132_867_1262 | 122 |
| 204 | 3300049572 | Ga0501036_0014384 | Ga0501036_0014384_5099_5494 | 122 |
| 205 | 3300049573 | Ga0501037_0108066 | Ga0501037_0108066_1051_1446 | 122 |
| 206 | 3300049574 | Ga0501038_0005590 | Ga0501038_0005590_927_1322 | 122 |
| 207 | 3300049575 | Ga0501039_0121352 | Ga0501039_0121352_934_1329 | 122 |
| 208 | 3300049579 | Ga0501043_0440364 | Ga0501043_0440364_414_809 | 122 |
| 209 | 3300049580 | Ga0501046_0034880 | Ga0501046_0034880_812_1207 | 122 |
| 210 | 3300049582 | Ga0501048_0008581 | Ga0501048_0008581_1466_1861 | 122 |
| 211 | 3300049583 | Ga0501067_0006705 | Ga0501067_0006705_882_1277 | 122 |
| 212 | 3300049587 | Ga0501071_0061932 | Ga0501071_0061932_1048_1443 | 122 |
| 213 | 3300049588 | Ga0501072_1174545 | Ga0501072_1174545_28_423 | 122 |
| 214 | 3300049589 | Ga0501073_0159025 | Ga0501073_0159025_21_416 | 122 |
| 215 | 3300049590 | Ga0501074_0013273 | Ga0501074_0013273_4298_4693 | 122 |
| 216 | 3300049591 | Ga0501075_0220466 | Ga0501075_0220466_547_915 | 122 |
| 217 | 3300049741 | Ga0501079_0665848 | Ga0501079_0665848_105_500 | 122 |
| 218 | 3300049742 | Ga0501080_0191461 | Ga0501080_0191461_325_720 | 122 |
| 219 | 3300049744 | Ga0501083_0041703 | Ga0501083_0041703_370_765 | 122 |
| 220 | 3300049822 | Ga0501035_0040785 | Ga0501035_0040785_140_535 | 122 |
| 221 | 3300049823 | Ga0501044_0013375 | Ga0501044_0013375_6103_6498 | 122 |
| 222 | 3300053077 | Ga0495601_0230599 | Ga0495601_0230599_796_1191 | 122 |
| 223 | 3300053078 | Ga0495612_0328643 | Ga0495612_0328643_66_461 | 122 |
| 224 | 3300054114 | Ga0501084_0045171 | Ga0501084_0045171_1707_2102 | 122 |
| 225 | 3300059503 | Ga0587080_081379 | Ga0587080_081379_230_598 | 122 |
| 226 | 3300059507 | Ga0587086_030397 | Ga0587086_030397_372_740 | 122 |
| 227 | 3300059510 | Ga0587090_127125 | Ga0587090_127125_73_441 | 122 |
| 228 | 3300060353 | Ga0501082_0142204 | Ga0501082_0142204_1246_1641 | 122 |
| 229 | iso_pu_bacteria | 2786546940 | 2788433934 | 122 |
| 230 | iso_pu_bacteria | 2916971899 | 2916972069 | 122 |
| 231 | iso_pu_bacteria | 3006969106 | 3006973804 | 122 |
| 232 | 3300003323 | rootH1_10069712 | rootH1_100697122 | 123 |
| 233 | 3300005328 | Ga0070676_11259696 | Ga0070676_112596961 | 123 |
| 234 | 3300005329 | Ga0070683_100648598 | Ga0070683_1006485981 | 123 |
| 235 | 3300005331 | Ga0070670_100590010 | Ga0070670_1005900102 | 123 |
| 236 | 3300005334 | Ga0068869_100099622 | Ga0068869_1000996222 | 123 |
| 237 | 3300005336 | Ga0070680_100355547 | Ga0070680_1003555472 | 123 |
| 238 | 3300005337 | Ga0070682_100791466 | Ga0070682_1007914661 | 123 |
| 239 | 3300005340 | Ga0070689_101343123 | Ga0070689_1013431231 | 123 |
| 240 | 3300005356 | Ga0070674_100068400 | Ga0070674_1000684002 | 123 |
| 241 | 3300005445 | Ga0070708_100807413 | Ga0070708_1008074132 | 123 |
| 242 | 3300005456 | Ga0070678_100070409 | Ga0070678_1000704092 | 123 |
| 243 | 3300005458 | Ga0070681_10700340 | Ga0070681_107003402 | 123 |
| 244 | 3300005467 | Ga0070706_100090069 | Ga0070706_1000900692 | 123 |
| 245 | 3300005471 | Ga0070698_100003219 | Ga0070698_10000321910 | 123 |
| 246 | 3300005471 | Ga0070698_101394679 | Ga0070698_1013946791 | 123 |
| 247 | 3300005518 | Ga0070699_100063431 | Ga0070699_1000634313 | 123 |
| 248 | 3300005530 | Ga0070679_100685245 | Ga0070679_1006852452 | 123 |
| 249 | 3300005536 | Ga0070697_101315149 | Ga0070697_1013151491 | 123 |
| 250 | 3300005549 | Ga0070704_101517299 | Ga0070704_1015172991 | 123 |
| 251 | 3300005578 | Ga0068854_100489662 | Ga0068854_1004896622 | 123 |
| 252 | 3300005844 | Ga0068862_100333204 | Ga0068862_1003332041 | 123 |
| 253 | 3300005937 | Ga0081455_10002585 | Ga0081455_100025852 | 123 |
| 254 | 3300005981 | Ga0081538_10000250 | Ga0081538_1000025064 | 123 |
| 255 | 3300005981 | Ga0081538_10002047 | Ga0081538_100020473 | 123 |
| 256 | 3300005981 | Ga0081538_10019032 | Ga0081538_100190324 | 123 |
| 257 | 3300005981 | Ga0081538_10138015 | Ga0081538_101380152 | 123 |
| 258 | 3300006237 | Ga0097621_100332534 | Ga0097621_1003325342 | 123 |
| 259 | 3300006358 | Ga0068871_100716246 | Ga0068871_1007162462 | 123 |
| 260 | 3300006844 | Ga0075428_101151503 | Ga0075428_1011515032 | 123 |
| 261 | 3300006844 | Ga0075428_102356328 | Ga0075428_1023563281 | 123 |
| 262 | 3300006846 | Ga0075430_100039669 | Ga0075430_1000396692 | 123 |
| 263 | 3300006846 | Ga0075430_100829049 | Ga0075430_1008290491 | 123 |
| 264 | 3300006847 | Ga0075431_100063276 | Ga0075431_1000632762 | 123 |
| 265 | 3300006847 | Ga0075431_101034084 | Ga0075431_1010340842 | 123 |
| 266 | 3300006847 | Ga0075431_101113721 | Ga0075431_1011137212 | 123 |
| 267 | 3300006852 | Ga0075433_11130862 | Ga0075433_111308622 | 123 |
| 268 | 3300006880 | Ga0075429_100284342 | Ga0075429_1002843422 | 123 |
| 269 | 3300006880 | Ga0075429_100672111 | Ga0075429_1006721112 | 123 |
| 270 | 3300009147 | Ga0114129_10814565 | Ga0114129_108145652 | 123 |
| 271 | 3300009176 | Ga0105242_10912622 | Ga0105242_109126221 | 123 |
| 272 | 3300009545 | Ga0105237_10150945 | Ga0105237_101509452 | 123 |
| 273 | 3300012473 | Ga0157340_1008626 | Ga0157340_10086261 | 123 |
| 274 | 3300013102 | Ga0157371_10272231 | Ga0157371_102722312 | 123 |
| 275 | 3300013297 | Ga0157378_10888802 | Ga0157378_108888022 | 123 |
| 276 | 3300013297 | Ga0157378_11598577 | Ga0157378_115985772 | 123 |
| 277 | 3300013307 | Ga0157372_12959194 | Ga0157372_129591941 | 123 |
| 278 | 3300014745 | Ga0157377_10540728 | Ga0157377_105407282 | 123 |
| 279 | 3300014969 | Ga0157376_10438194 | Ga0157376_104381942 | 123 |
| 280 | 3300021384 | Ga0213876_10135418 | Ga0213876_101354182 | 123 |
| 281 | 3300023438 | Ga0256720_139491 | Ga0256720_1394911 | 123 |
| 282 | 3300025901 | Ga0207688_10661977 | Ga0207688_106619771 | 123 |
| 283 | 3300025909 | Ga0207705_10162926 | Ga0207705_101629262 | 123 |
| 284 | 3300025910 | Ga0207684_10021082 | Ga0207684_100210823 | 123 |
| 285 | 3300025912 | Ga0207707_11559912 | Ga0207707_115599121 | 123 |
| 286 | 3300025914 | Ga0207671_10767804 | Ga0207671_107678042 | 123 |
| 287 | 3300025917 | Ga0207660_10288355 | Ga0207660_102883552 | 123 |
| 288 | 3300025936 | Ga0207670_10384233 | Ga0207670_103842331 | 123 |
| 289 | 3300025936 | Ga0207670_11160662 | Ga0207670_111606622 | 123 |
| 290 | 3300025942 | Ga0207689_10183463 | Ga0207689_101834632 | 123 |
| 291 | 3300025944 | Ga0207661_10938254 | Ga0207661_109382541 | 123 |
| 292 | 3300025944 | Ga0207661_11042659 | Ga0207661_110426591 | 123 |
| 293 | 3300025960 | Ga0207651_10788706 | Ga0207651_107887062 | 123 |
| 294 | 3300026078 | Ga0207702_11581631 | Ga0207702_115816311 | 123 |
| 295 | 3300026088 | Ga0207641_12459694 | Ga0207641_124596941 | 123 |
| 296 | 3300026121 | Ga0207683_10030943 | Ga0207683_100309432 | 123 |
| 297 | 3300029277 | Ga0311001_1083056 | Ga0311001_10830562 | 123 |
| 298 | 3300029285 | Ga0310981_1060993 | Ga0310981_10609932 | 123 |
| 299 | 3300031507 | Ga0307509_10043415 | Ga0307509_100434154 | 123 |
| 300 | 3300031901 | Ga0307406_10062091 | Ga0307406_100620913 | 123 |
| 301 | 3300031901 | Ga0307406_11341423 | Ga0307406_113414231 | 123 |
| 302 | 3300031911 | Ga0307412_10845582 | Ga0307412_108455822 | 123 |
| 303 | 3300031995 | Ga0307409_101197534 | Ga0307409_1011975342 | 123 |
| 304 | 3300032002 | Ga0307416_100951267 | Ga0307416_1009512672 | 123 |
| 305 | 3300032004 | Ga0307414_12323689 | Ga0307414_123236891 | 123 |
| 306 | 3300032126 | Ga0307415_100241717 | Ga0307415_1002417172 | 123 |
| 307 | 3300035117 | Ga0373953_0249313 | Ga0373953_0249313_376_747 | 123 |
| 308 | 3300036647 | Ga0316582_0401048 | Ga0316582_0401048_544_915 | 123 |
| 309 | 3300037312 | Ga0395899_0007266 | Ga0395899_0007266_2827_3198 | 123 |
| 310 | 3300037418 | Ga0395900_0037779 | Ga0395900_0037779_2648_3019 | 123 |
| 311 | 3300037418 | Ga0395900_0660692 | Ga0395900_0660692_525_896 | 123 |
| 312 | 3300037466 | Ga0395898_0684801 | Ga0395898_0684801_509_880 | 123 |
| 313 | 3300037471 | Ga0395905_0563765 | Ga0395905_0563765_178_549 | 123 |
| 314 | 3300038443 | Ga0395901_0116510 | Ga0395901_0116510_942_1313 | 123 |
| 315 | 3300038443 | Ga0395901_0329662 | Ga0395901_0329662_568_939 | 123 |
| 316 | 3300039062 | Ga0400483_121213 | Ga0400483_121213_414_785 | 123 |
| 317 | 3300039437 | Ga0436365_1256045 | Ga0436365_1256045_1322_1693 | 123 |
| 318 | 3300039453 | Ga0436362_0113140 | Ga0436362_0113140_12_383 | 123 |
| 319 | 3300039453 | Ga0436362_1100490 | Ga0436362_1100490_363_761 | 123 |
| 320 | 3300041508 | Ga0451852_16322 | Ga0451852_16322_55_432 | 123 |
| 321 | 3300042876 | Ga0451577_0898726 | Ga0451577_0898726_65_436 | 123 |
| 322 | 3300042876 | Ga0451577_1002833 | Ga0451577_1002833_27_398 | 123 |
| 323 | 3300044712 | Ga0453684_0070061 | Ga0453684_0070061_3140_3511 | 123 |
| 324 | 3300045051 | Ga0451576_0000003 | Ga0451576_0000003_951767_952174 | 123 |
| 325 | 3300046533 | Ga0495640_0847254 | Ga0495640_0847254_130_501 | 123 |
| 326 | 3300048915 | Ga0496112_0256546 | Ga0496112_0256546_529_900 | 123 |
| 327 | 3300048924 | Ga0496121_0006505 | Ga0496121_0006505_11131_11529 | 123 |
| 328 | 3300049127 | Ga0501306_104614 | Ga0501306_104614_17_388 | 123 |
| 329 | 3300049128 | Ga0501308_052445 | Ga0501308_052445_21_392 | 123 |
| 330 | 3300049515 | Ga0501292_042392 | Ga0501292_042392_292_663 | 123 |
| 331 | 3300049527 | Ga0501311_032212 | Ga0501311_032212_11_382 | 123 |
| 332 | 3300049574 | Ga0501038_1259750 | Ga0501038_1259750_69_440 | 123 |
| 333 | 3300049579 | Ga0501043_0695671 | Ga0501043_0695671_159_530 | 123 |
| 334 | 3300049580 | Ga0501046_0778081 | Ga0501046_0778081_286_657 | 123 |
| 335 | 3300049581 | Ga0501047_0308480 | Ga0501047_0308480_279_650 | 123 |
| 336 | 3300049582 | Ga0501048_0169189 | Ga0501048_0169189_954_1325 | 123 |
| 337 | 3300049583 | Ga0501067_0009843 | Ga0501067_0009843_4263_4634 | 123 |
| 338 | 3300049583 | Ga0501067_0391562 | Ga0501067_0391562_273_644 | 123 |
| 339 | 3300049585 | Ga0501069_0090513 | Ga0501069_0090513_476_847 | 123 |
| 340 | 3300049587 | Ga0501071_0477217 | Ga0501071_0477217_50_421 | 123 |
| 341 | 3300049587 | Ga0501071_0988280 | Ga0501071_0988280_187_558 | 123 |
| 342 | 3300049590 | Ga0501074_0130988 | Ga0501074_0130988_1029_1400 | 123 |
| 343 | 3300049590 | Ga0501074_0146862 | Ga0501074_0146862_819_1190 | 123 |
| 344 | 3300049593 | Ga0501077_0230973 | Ga0501077_0230973_697_1068 | 123 |
| 345 | 3300049742 | Ga0501080_1091273 | Ga0501080_1091273_123_494 | 123 |
| 346 | 3300049822 | Ga0501035_1115667 | Ga0501035_1115667_76_447 | 123 |
| 347 | 3300049823 | Ga0501044_0078916 | Ga0501044_0078916_2480_2851 | 123 |
| 348 | 3300050508 | nmdc:mga09592_172694_c1 | nmdc:mga09592_172694_c1_75_446 | 123 |
| 349 | 3300050508 | nmdc:mga09592_185333_c1 | nmdc:mga09592_185333_c1_1390_1761 | 123 |
| 350 | 3300050509 | nmdc:mga0qj67_3985_c2 | nmdc:mga0qj67_3985_c2_3329_3700 | 123 |
| 351 | 3300050510 | nmdc:mga06r32_54362_c1 | nmdc:mga06r32_54362_c1_3103_3474 | 123 |
| 352 | 3300050515 | nmdc:mga0a205_968698_c1 | nmdc:mga0a205_968698_c1_165_536 | 123 |
| 353 | 3300054114 | Ga0501084_1281179 | Ga0501084_1281179_158_529 | 123 |
| 354 | 3300059643 | Ga0587072_134023 | Ga0587072_134023_203_574 | 123 |
| 355 | 3300059646 | Ga0587078_078141 | Ga0587078_078141_114_485 | 123 |
| 356 | iso_pu_bacteria | 2857604169 | 2857608878 | 123 |
| 357 | iso_pu_bacteria | 3006826541 | 3006828577 | 123 |
| 358 | 3300003323 | rootH1_10403485 | rootH1_104034851 | 124 |
| 359 | 3300005345 | Ga0070692_10380746 | Ga0070692_103807462 | 124 |
| 360 | 3300005367 | Ga0070667_101407232 | Ga0070667_1014072322 | 124 |
| 361 | 3300005438 | Ga0070701_10184773 | Ga0070701_101847732 | 124 |
| 362 | 3300005543 | Ga0070672_100013159 | Ga0070672_1000131593 | 124 |
| 363 | 3300005546 | Ga0070696_100044176 | Ga0070696_1000441762 | 124 |
| 364 | 3300005549 | Ga0070704_100615286 | Ga0070704_1006152861 | 124 |
| 365 | 3300005719 | Ga0068861_101020095 | Ga0068861_1010200951 | 124 |
| 366 | 3300006844 | Ga0075428_100263152 | Ga0075428_1002631522 | 124 |
| 367 | 3300006852 | Ga0075433_10060259 | Ga0075433_100602592 | 124 |
| 368 | 3300006852 | Ga0075433_10688173 | Ga0075433_106881732 | 124 |
| 369 | 3300006880 | Ga0075429_100048515 | Ga0075429_1000485152 | 124 |
| 370 | 3300009094 | Ga0111539_10456351 | Ga0111539_104563513 | 124 |
| 371 | 3300013308 | Ga0157375_12673585 | Ga0157375_126735851 | 124 |
| 372 | 3300014326 | Ga0157380_13475935 | Ga0157380_134759351 | 124 |
| 373 | 3300021358 | Ga0213873_10179721 | Ga0213873_101797212 | 124 |
| 374 | 3300025940 | Ga0207691_10479356 | Ga0207691_104793562 | 124 |
| 375 | 3300031250 | Ga0265331_10016846 | Ga0265331_100168462 | 124 |
| 376 | 3300031691 | Ga0316579_10019575 | Ga0316579_100195752 | 124 |
| 377 | 3300031691 | Ga0316579_10033104 | Ga0316579_100331042 | 124 |
| 378 | 3300031691 | Ga0316579_10057060 | Ga0316579_100570603 | 124 |
| 379 | 3300031691 | Ga0316579_10102736 | Ga0316579_101027362 | 124 |
| 380 | 3300031691 | Ga0316579_10109614 | Ga0316579_101096141 | 124 |
| 381 | 3300031691 | Ga0316579_10254432 | Ga0316579_102544322 | 124 |
| 382 | 3300031727 | Ga0316576_10000859 | Ga0316576_100008596 | 124 |
| 383 | 3300031727 | Ga0316576_10050533 | Ga0316576_100505333 | 124 |
| 384 | 3300031727 | Ga0316576_10114440 | Ga0316576_101144403 | 124 |
| 385 | 3300031727 | Ga0316576_10277870 | Ga0316576_102778701 | 124 |
| 386 | 3300031727 | Ga0316576_10447642 | Ga0316576_104476422 | 124 |
| 387 | 3300031727 | Ga0316576_10495153 | Ga0316576_104951532 | 124 |
| 388 | 3300031727 | Ga0316576_10631927 | Ga0316576_106319271 | 124 |
| 389 | 3300031727 | Ga0316576_10849366 | Ga0316576_108493662 | 124 |
| 390 | 3300031727 | Ga0316576_11060207 | Ga0316576_110602071 | 124 |
| 391 | 3300031728 | Ga0316578_10000241 | Ga0316578_1000024111 | 124 |
| 392 | 3300031728 | Ga0316578_10004865 | Ga0316578_100048652 | 124 |
| 393 | 3300031728 | Ga0316578_10022633 | Ga0316578_100226332 | 124 |
| 394 | 3300031728 | Ga0316578_10395493 | Ga0316578_103954932 | 124 |
| 395 | 3300031733 | Ga0316577_10000447 | Ga0316577_100004474 | 124 |
| 396 | 3300032133 | Ga0316583_10305313 | Ga0316583_103053131 | 124 |
| 397 | 3300032137 | Ga0316585_10004899 | Ga0316585_100048992 | 124 |
| 398 | 3300032137 | Ga0316585_10111936 | Ga0316585_101119362 | 124 |
| 399 | 3300032139 | Ga0316580_10002598 | Ga0316580_100025981 | 124 |
| 400 | 3300032139 | Ga0316580_10102712 | Ga0316580_101027122 | 124 |
| 401 | 3300032168 | Ga0316593_10000417 | Ga0316593_100004174 | 124 |
| 402 | 3300032168 | Ga0316593_10000589 | Ga0316593_100005894 | 124 |
| 403 | 3300032168 | Ga0316593_10000698 | Ga0316593_100006982 | 124 |
| 404 | 3300032168 | Ga0316593_10000765 | Ga0316593_100007659 | 124 |
| 405 | 3300032168 | Ga0316593_10001578 | Ga0316593_100015782 | 124 |
| 406 | 3300032168 | Ga0316593_10001601 | Ga0316593_100016012 | 124 |
| 407 | 3300032168 | Ga0316593_10001733 | Ga0316593_100017332 | 124 |
| 408 | 3300032168 | Ga0316593_10003549 | Ga0316593_100035492 | 124 |
| 409 | 3300032168 | Ga0316593_10004947 | Ga0316593_100049473 | 124 |
| 410 | 3300032168 | Ga0316593_10008436 | Ga0316593_100084361 | 124 |
| 411 | 3300032168 | Ga0316593_10018658 | Ga0316593_100186583 | 124 |
| 412 | 3300032168 | Ga0316593_10019627 | Ga0316593_100196272 | 124 |
| 413 | 3300032168 | Ga0316593_10032306 | Ga0316593_100323062 | 124 |
| 414 | 3300032168 | Ga0316593_10058392 | Ga0316593_100583923 | 124 |
| 415 | 3300032168 | Ga0316593_10062765 | Ga0316593_100627653 | 124 |
| 416 | 3300032168 | Ga0316593_10067967 | Ga0316593_100679671 | 124 |
| 417 | 3300032168 | Ga0316593_10094507 | Ga0316593_100945071 | 124 |
| 418 | 3300032168 | Ga0316593_10095358 | Ga0316593_100953581 | 124 |
| 419 | 3300032168 | Ga0316593_10108047 | Ga0316593_101080471 | 124 |
| 420 | 3300032168 | Ga0316593_10341679 | Ga0316593_103416792 | 124 |
| 421 | 3300032168 | Ga0316593_10386520 | Ga0316593_103865201 | 124 |
| 422 | 3300033524 | Ga0316592_1000662 | Ga0316592_10006623 | 124 |
| 423 | 3300033524 | Ga0316592_1000955 | Ga0316592_10009551 | 124 |
| 424 | 3300033524 | Ga0316592_1001027 | Ga0316592_10010274 | 124 |
| 425 | 3300033524 | Ga0316592_1001802 | Ga0316592_10018024 | 124 |
| 426 | 3300033524 | Ga0316592_1002156 | Ga0316592_10021564 | 124 |
| 427 | 3300033524 | Ga0316592_1002445 | Ga0316592_10024451 | 124 |
| 428 | 3300033524 | Ga0316592_1007962 | Ga0316592_10079621 | 124 |
| 429 | 3300033524 | Ga0316592_1039484 | Ga0316592_10394842 | 124 |
| 430 | 3300033524 | Ga0316592_1054794 | Ga0316592_10547942 | 124 |
| 431 | 3300033524 | Ga0316592_1067077 | Ga0316592_10670771 | 124 |
| 432 | 3300033524 | Ga0316592_1126026 | Ga0316592_11260261 | 124 |
| 433 | 3300033527 | Ga0316586_1000181 | Ga0316586_10001816 | 124 |
| 434 | 3300033527 | Ga0316586_1000255 | Ga0316586_10002551 | 124 |
| 435 | 3300033527 | Ga0316586_1008483 | Ga0316586_10084833 | 124 |
| 436 | 3300033527 | Ga0316586_1008737 | Ga0316586_10087373 | 124 |
| 437 | 3300033527 | Ga0316586_1071432 | Ga0316586_10714321 | 124 |
| 438 | 3300033528 | Ga0316588_1000659 | Ga0316588_10006591 | 124 |
| 439 | 3300033528 | Ga0316588_1000759 | Ga0316588_10007592 | 124 |
| 440 | 3300033528 | Ga0316588_1000948 | Ga0316588_10009484 | 124 |
| 441 | 3300033528 | Ga0316588_1001472 | Ga0316588_10014724 | 124 |
| 442 | 3300033528 | Ga0316588_1002494 | Ga0316588_10024941 | 124 |
| 443 | 3300033528 | Ga0316588_1005683 | Ga0316588_10056832 | 124 |
| 444 | 3300033528 | Ga0316588_1029418 | Ga0316588_10294182 | 124 |
| 445 | 3300033529 | Ga0316587_1000871 | Ga0316587_10008711 | 124 |
| 446 | 3300033529 | Ga0316587_1001166 | Ga0316587_10011661 | 124 |
| 447 | 3300033529 | Ga0316587_1002730 | Ga0316587_10027301 | 124 |
| 448 | 3300033529 | Ga0316587_1022964 | Ga0316587_10229642 | 124 |
| 449 | 3300033529 | Ga0316587_1025453 | Ga0316587_10254531 | 124 |
| 450 | 3300033529 | Ga0316587_1025912 | Ga0316587_10259122 | 124 |
| 451 | 3300033529 | Ga0316587_1044150 | Ga0316587_10441502 | 124 |
| 452 | 3300033529 | Ga0316587_1054006 | Ga0316587_10540061 | 124 |
| 453 | 3300033529 | Ga0316587_1095463 | Ga0316587_10954631 | 124 |
| 454 | 3300033541 | Ga0316596_1000015 | Ga0316596_100001511 | 124 |
| 455 | 3300033541 | Ga0316596_1000019 | Ga0316596_10000194 | 124 |
| 456 | 3300033541 | Ga0316596_1000051 | Ga0316596_10000513 | 124 |
| 457 | 3300033541 | Ga0316596_1003186 | Ga0316596_10031862 | 124 |
| 458 | 3300033541 | Ga0316596_1003324 | Ga0316596_10033244 | 124 |
| 459 | 3300033541 | Ga0316596_1003362 | Ga0316596_10033621 | 124 |
| 460 | 3300033541 | Ga0316596_1004711 | Ga0316596_10047113 | 124 |
| 461 | 3300033541 | Ga0316596_1004760 | Ga0316596_10047601 | 124 |
| 462 | 3300033541 | Ga0316596_1038286 | Ga0316596_10382863 | 124 |
| 463 | 3300033541 | Ga0316596_1040097 | Ga0316596_10400971 | 124 |
| 464 | 3300033541 | Ga0316596_1052486 | Ga0316596_10524862 | 124 |
| 465 | 3300033541 | Ga0316596_1087267 | Ga0316596_10872671 | 124 |
| 466 | 3300033541 | Ga0316596_1090373 | Ga0316596_10903731 | 124 |
| 467 | 3300033541 | Ga0316596_1106758 | Ga0316596_11067582 | 124 |
| 468 | 3300033541 | Ga0316596_1110717 | Ga0316596_11107172 | 124 |
| 469 | 3300033541 | Ga0316596_1166113 | Ga0316596_11661131 | 124 |
| 470 | 3300035398 | Ga0316574_0129363 | Ga0316574_0129363_106_480 | 124 |
| 471 | 3300035398 | Ga0316574_0165133 | Ga0316574_0165133_1022_1396 | 124 |
| 472 | 3300036647 | Ga0316582_0002761 | Ga0316582_0002761_2945_3319 | 124 |
| 473 | 3300036647 | Ga0316582_0010159 | Ga0316582_0010159_811_1185 | 124 |
| 474 | 3300036647 | Ga0316582_1247372 | Ga0316582_1247372_24_398 | 124 |
| 475 | 3300036712 | Ga0316584_0001067 | Ga0316584_0001067_2779_3153 | 124 |
| 476 | 3300036712 | Ga0316584_0027859 | Ga0316584_0027859_1484_1858 | 124 |
| 477 | 3300036712 | Ga0316584_0087558 | Ga0316584_0087558_1283_1657 | 124 |
| 478 | 3300036712 | Ga0316584_0167910 | Ga0316584_0167910_40_414 | 124 |
| 479 | 3300036712 | Ga0316584_0542668 | Ga0316584_0542668_178_552 | 124 |
| 480 | 3300039062 | Ga0400483_016634 | Ga0400483_016634_639_1013 | 124 |
| 481 | 3300039062 | Ga0400483_145883 | Ga0400483_145883_1663_2037 | 124 |
| 482 | 3300039062 | Ga0400483_266032 | Ga0400483_266032_683_1060 | 124 |
| 483 | 3300042876 | Ga0451577_0155638 | Ga0451577_0155638_513_887 | 124 |
| 484 | 3300044673 | Ga0453683_0661052 | Ga0453683_0661052_31_405 | 124 |
| 485 | 3300044712 | Ga0453684_0001193 | Ga0453684_0001193_76986_77360 | 124 |
| 486 | 3300044712 | Ga0453684_0087736 | Ga0453684_0087736_2942_3316 | 124 |
| 487 | 3300045051 | Ga0451576_0257261 | Ga0451576_0257261_966_1340 | 124 |
| 488 | 3300045051 | Ga0451576_0524010 | Ga0451576_0524010_649_1023 | 124 |
| 489 | 3300047322 | Ga0495680_0161336 | Ga0495680_0161336_1037_1438 | 124 |
| 490 | 3300048928 | Ga0496125_0004021 | Ga0496125_0004021_12428_12802 | 124 |
| 491 | 3300048928 | Ga0496125_0010850 | Ga0496125_0010850_2992_3366 | 124 |
| 492 | 3300050511 | nmdc:mga08y16_468499_c1 | nmdc:mga08y16_468499_c1_106_516 | 124 |
| 493 | 3300050515 | nmdc:mga0a205_116758_c1 | nmdc:mga0a205_116758_c1_1418_1792 | 124 |
| 494 | 3300050515 | nmdc:mga0a205_232987_c1 | nmdc:mga0a205_232987_c1_265_639 | 124 |
| 495 | 3300050515 | nmdc:mga0a205_602712_c1 | nmdc:mga0a205_602712_c1_261_677 | 124 |
| 496 | 3300059643 | Ga0587072_201303 | Ga0587072_201303_118_492 | 124 |
| 497 | 3300005468 | Ga0070707_101011500 | Ga0070707_1010115002 | 125 |
| 498 | 3300005518 | Ga0070699_100186526 | Ga0070699_1001865263 | 125 |
| 499 | 3300005536 | Ga0070697_100130858 | Ga0070697_1001308582 | 125 |
| 500 | 3300005536 | Ga0070697_101102441 | Ga0070697_1011024412 | 125 |
| 501 | 3300005545 | Ga0070695_100124337 | Ga0070695_1001243372 | 125 |
| 502 | 3300005546 | Ga0070696_100648192 | Ga0070696_1006481922 | 125 |
| 503 | 3300005548 | Ga0070665_100004237 | Ga0070665_1000042376 | 125 |
| 504 | 3300006852 | Ga0075433_10024717 | Ga0075433_100247172 | 125 |
| 505 | 3300006871 | Ga0075434_100063706 | Ga0075434_1000637063 | 125 |
| 506 | 3300006881 | Ga0068865_101932220 | Ga0068865_1019322201 | 125 |
| 507 | 3300009093 | Ga0105240_10004245 | Ga0105240_100042458 | 125 |
| 508 | 3300010375 | Ga0105239_10030499 | Ga0105239_100304993 | 125 |
| 509 | 3300015262 | Ga0182007_10392064 | Ga0182007_103920641 | 125 |
| 510 | 3300025913 | Ga0207695_10104798 | Ga0207695_101047982 | 125 |
| 511 | 3300025922 | Ga0207646_10242931 | Ga0207646_102429311 | 125 |
| 512 | 3300026023 | Ga0207677_10206493 | Ga0207677_102064933 | 125 |
| 513 | 3300028379 | Ga0268266_10016375 | Ga0268266_100163758 | 125 |
| 514 | 3300031242 | Ga0265329_10006079 | Ga0265329_100060793 | 125 |
| 515 | 3300031250 | Ga0265331_10277030 | Ga0265331_102770302 | 125 |
| 516 | 3300031711 | Ga0265314_10063634 | Ga0265314_100636342 | 125 |
| 517 | 3300031727 | Ga0316576_10341683 | Ga0316576_103416832 | 125 |
| 518 | 3300031727 | Ga0316576_10419265 | Ga0316576_104192651 | 125 |
| 519 | 3300031727 | Ga0316576_10453360 | Ga0316576_104533602 | 125 |
| 520 | 3300033524 | Ga0316592_1099061 | Ga0316592_10990612 | 125 |
| 521 | 3300033528 | Ga0316588_1001353 | Ga0316588_10013532 | 125 |
| 522 | 3300033528 | Ga0316588_1013709 | Ga0316588_10137091 | 125 |
| 523 | 3300033528 | Ga0316588_1149495 | Ga0316588_11494952 | 125 |
| 524 | 3300033529 | Ga0316587_1019796 | Ga0316587_10197962 | 125 |
| 525 | 3300033541 | Ga0316596_1014132 | Ga0316596_10141323 | 125 |
| 526 | 3300039447 | Ga0436361_0557259 | Ga0436361_0557259_247_624 | 125 |
| 527 | 3300042876 | Ga0451577_0000092 | Ga0451577_0000092_155238_155684 | 125 |
| 528 | 3300042876 | Ga0451577_0002251 | Ga0451577_0002251_3132_3512 | 125 |
| 529 | 3300042876 | Ga0451577_0037725 | Ga0451577_0037725_1325_1705 | 125 |
| 530 | 3300042876 | Ga0451577_0418106 | Ga0451577_0418106_480_860 | 125 |
| 531 | 3300044673 | Ga0453683_0000522 | Ga0453683_0000522_3947_4393 | 125 |
| 532 | 3300044673 | Ga0453683_0000935 | Ga0453683_0000935_8681_9061 | 125 |
| 533 | 3300044673 | Ga0453683_0025793 | Ga0453683_0025793_527_907 | 125 |
| 534 | 3300044673 | Ga0453683_1056882 | Ga0453683_1056882_16_393 | 125 |
| 535 | 3300044712 | Ga0453684_0000432 | Ga0453684_0000432_167185_167565 | 125 |
| 536 | 3300044712 | Ga0453684_0002324 | Ga0453684_0002324_3222_3668 | 125 |
| 537 | 3300044712 | Ga0453684_0058446 | Ga0453684_0058446_4465_4845 | 125 |
| 538 | 3300044712 | Ga0453684_0141642 | Ga0453684_0141642_1729_2106 | 125 |
| 539 | 3300044712 | Ga0453684_0219846 | Ga0453684_0219846_1768_2148 | 125 |
| 540 | 3300044712 | Ga0453684_0479027 | Ga0453684_0479027_597_974 | 125 |
| 541 | 3300044712 | Ga0453684_0589068 | Ga0453684_0589068_656_1036 | 125 |
| 542 | 3300044712 | Ga0453684_1309569 | Ga0453684_1309569_87_467 | 125 |
| 543 | 3300044712 | Ga0453684_2291792 | Ga0453684_2291792_48_425 | 125 |
| 544 | 3300045051 | Ga0451576_0000113 | Ga0451576_0000113_167431_167811 | 125 |
| 545 | 3300045051 | Ga0451576_0001103 | Ga0451576_0001103_5906_6352 | 125 |
| 546 | 3300045051 | Ga0451576_0017828 | Ga0451576_0017828_1433_1813 | 125 |
| 547 | 3300045051 | Ga0451576_0163274 | Ga0451576_0163274_1093_1473 | 125 |
| 548 | 3300045051 | Ga0451576_0208325 | Ga0451576_0208325_738_1115 | 125 |
| 549 | 3300045051 | Ga0451576_1642384 | Ga0451576_1642384_190_570 | 125 |
| 550 | 3300050515 | nmdc:mga0a205_69251_c1 | nmdc:mga0a205_69251_c1_2751_3128 | 125 |
| 551 | 3300005340 | Ga0070689_101065984 | Ga0070689_1010659842 | 126 |
| 552 | 3300005458 | Ga0070681_10198635 | Ga0070681_101986352 | 126 |
| 553 | 3300009176 | Ga0105242_10654675 | Ga0105242_106546752 | 126 |
| 554 | 3300009176 | Ga0105242_11090234 | Ga0105242_110902342 | 126 |
| 555 | 3300013102 | Ga0157371_10410538 | Ga0157371_104105381 | 126 |
| 556 | 3300013308 | Ga0157375_12507451 | Ga0157375_125074511 | 126 |
| 557 | 3300025922 | Ga0207646_10317494 | Ga0207646_103174942 | 126 |
| 558 | 3300025936 | Ga0207670_10954623 | Ga0207670_109546231 | 126 |
| 559 | 3300031090 | Ga0265760_10000026 | Ga0265760_1000002657 | 126 |
| 560 | 3300031344 | Ga0265316_10031378 | Ga0265316_100313783 | 126 |
| 561 | 3300031665 | Ga0316575_10108542 | Ga0316575_101085422 | 126 |
| 562 | 3300032133 | Ga0316583_10000319 | Ga0316583_1000031914 | 126 |
| 563 | 3300035691 | Ga0373931_0596196 | Ga0373931_0596196_103_525 | 126 |
| 564 | 3300037471 | Ga0395905_0000376 | Ga0395905_0000376_35975_36379 | 126 |
| 565 | 3300048905 | Ga0496102_0463485 | Ga0496102_0463485_302_682 | 126 |
| 566 | 3300048906 | Ga0496103_0358492 | Ga0496103_0358492_386_766 | 126 |
| 567 | 3300048910 | Ga0496107_0590638 | Ga0496107_0590638_252_632 | 126 |
| 568 | 3300049528 | Ga0501312_045365 | Ga0501312_045365_165_545 | 126 |
| 569 | 3300005436 | Ga0070713_100016190 | Ga0070713_1000161906 | 127 |
| 570 | 3300005437 | Ga0070710_10166147 | Ga0070710_101661472 | 127 |
| 571 | 3300005439 | Ga0070711_100090240 | Ga0070711_1000902402 | 127 |
| 572 | 3300005445 | Ga0070708_100974040 | Ga0070708_1009740402 | 127 |
| 573 | 3300005467 | Ga0070706_100038479 | Ga0070706_1000384792 | 127 |
| 574 | 3300005468 | Ga0070707_100010443 | Ga0070707_1000104433 | 127 |
| 575 | 3300005468 | Ga0070707_100014471 | Ga0070707_1000144713 | 127 |
| 576 | 3300005471 | Ga0070698_100065898 | Ga0070698_1000658983 | 127 |
| 577 | 3300005471 | Ga0070698_100068156 | Ga0070698_1000681561 | 127 |
| 578 | 3300005518 | Ga0070699_100334911 | Ga0070699_1003349112 | 127 |
| 579 | 3300005840 | Ga0068870_10529830 | Ga0068870_105298301 | 127 |
| 580 | 3300005937 | Ga0081455_10157276 | Ga0081455_101572761 | 127 |
| 581 | 3300006358 | Ga0068871_101560463 | Ga0068871_1015604631 | 127 |
| 582 | 3300006881 | Ga0068865_100204745 | Ga0068865_1002047452 | 127 |
| 583 | 3300007265 | Ga0099794_10014076 | Ga0099794_100140763 | 127 |
| 584 | 3300007265 | Ga0099794_10023888 | Ga0099794_100238882 | 127 |
| 585 | 3300007265 | Ga0099794_10035542 | Ga0099794_100355421 | 127 |
| 586 | 3300007788 | Ga0099795_10004417 | Ga0099795_100044172 | 127 |
| 587 | 3300009093 | Ga0105240_10121109 | Ga0105240_101211093 | 127 |
| 588 | 3300009093 | Ga0105240_10274511 | Ga0105240_102745112 | 127 |
| 589 | 3300009098 | Ga0105245_10033891 | Ga0105245_100338916 | 127 |
| 590 | 3300010159 | Ga0099796_10063694 | Ga0099796_100636941 | 127 |
| 591 | 3300013105 | Ga0157369_11202069 | Ga0157369_112020691 | 127 |
| 592 | 3300013296 | Ga0157374_10000801 | Ga0157374_1000080128 | 127 |
| 593 | 3300013297 | Ga0157378_10000886 | Ga0157378_1000088625 | 127 |
| 594 | 3300013297 | Ga0157378_10438127 | Ga0157378_104381272 | 127 |
| 595 | 3300014969 | Ga0157376_10226962 | Ga0157376_102269622 | 127 |
| 596 | 3300019192 | Ga0184603_100407 | Ga0184603_1004071 | 127 |
| 597 | 3300024227 | Ga0228598_1004458 | Ga0228598_10044582 | 127 |
| 598 | 3300025906 | Ga0207699_10059947 | Ga0207699_100599473 | 127 |
| 599 | 3300025906 | Ga0207699_10674165 | Ga0207699_106741651 | 127 |
| 600 | 3300025910 | Ga0207684_10010612 | Ga0207684_100106126 | 127 |
| 601 | 3300025913 | Ga0207695_10184944 | Ga0207695_101849442 | 127 |
| 602 | 3300025913 | Ga0207695_10861390 | Ga0207695_108613901 | 127 |
| 603 | 3300025916 | Ga0207663_10546106 | Ga0207663_105461062 | 127 |
| 604 | 3300025918 | Ga0207662_10723882 | Ga0207662_107238821 | 127 |
| 605 | 3300025922 | Ga0207646_10016678 | Ga0207646_100166782 | 127 |
| 606 | 3300025927 | Ga0207687_10777486 | Ga0207687_107774862 | 127 |
| 607 | 3300025928 | Ga0207700_10220042 | Ga0207700_102200423 | 127 |
| 608 | 3300025939 | Ga0207665_10559080 | Ga0207665_105590802 | 127 |
| 609 | 3300027512 | Ga0209179_1030480 | Ga0209179_10304801 | 127 |
| 610 | 3300027671 | Ga0209588_1013299 | Ga0209588_10132991 | 127 |
| 611 | 3300027671 | Ga0209588_1023729 | Ga0209588_10237292 | 127 |
| 612 | 3300028563 | Ga0265319_1004383 | Ga0265319_10043834 | 127 |
| 613 | 3300028577 | Ga0265318_10000466 | Ga0265318_1000046642 | 127 |
| 614 | 3300028800 | Ga0265338_10650042 | Ga0265338_106500422 | 127 |
| 615 | 3300030879 | Ga0265765_1006543 | Ga0265765_10065431 | 127 |
| 616 | 3300030882 | Ga0265764_102136 | Ga0265764_1021362 | 127 |
| 617 | 3300031090 | Ga0265760_10019572 | Ga0265760_100195722 | 127 |
| 618 | 3300031235 | Ga0265330_10044087 | Ga0265330_100440873 | 127 |
| 619 | 3300031238 | Ga0265332_10011115 | Ga0265332_100111151 | 127 |
| 620 | 3300031239 | Ga0265328_10189103 | Ga0265328_101891031 | 127 |
| 621 | 3300031240 | Ga0265320_10001540 | Ga0265320_100015408 | 127 |
| 622 | 3300031242 | Ga0265329_10004500 | Ga0265329_100045005 | 127 |
| 623 | 3300031247 | Ga0265340_10017605 | Ga0265340_100176053 | 127 |
| 624 | 3300031249 | Ga0265339_10001807 | Ga0265339_100018075 | 127 |
| 625 | 3300031250 | Ga0265331_10000025 | Ga0265331_10000025138 | 127 |
| 626 | 3300031344 | Ga0265316_10000784 | Ga0265316_1000078439 | 127 |
| 627 | 3300031595 | Ga0265313_10001605 | Ga0265313_100016056 | 127 |
| 628 | 3300031712 | Ga0265342_10000362 | Ga0265342_100003628 | 127 |
| 629 | 3300032120 | Ga0316053_104592 | Ga0316053_1045921 | 127 |
| 630 | 3300035083 | Ga0373926_0174374 | Ga0373926_0174374_26_409 | 127 |
| 631 | 3300035086 | Ga0373934_0224577 | Ga0373934_0224577_10_393 | 127 |
| 632 | 3300035111 | Ga0373923_0021564 | Ga0373923_0021564_1572_1955 | 127 |
| 633 | 3300035118 | Ga0373954_0054945 | Ga0373954_0054945_228_611 | 127 |
| 634 | 3300035119 | Ga0373956_0262775 | Ga0373956_0262775_366_749 | 127 |
| 635 | 3300035172 | Ga0373955_0158603 | Ga0373955_0158603_217_600 | 127 |
| 636 | 3300035172 | Ga0373955_0353005 | Ga0373955_0353005_307_690 | 127 |
| 637 | 3300035172 | Ga0373955_0582717 | Ga0373955_0582717_95_478 | 127 |
| 638 | 3300035410 | Ga0373924_0036091 | Ga0373924_0036091_391_774 | 127 |
| 639 | 3300035692 | Ga0373935_0036026 | Ga0373935_0036026_1699_2082 | 127 |
| 640 | 3300035695 | Ga0373927_0014376 | Ga0373927_0014376_1680_2063 | 127 |
| 641 | 3300035724 | Ga0373933_0056998 | Ga0373933_0056998_432_815 | 127 |
| 642 | 3300035725 | Ga0373947_0000905 | Ga0373947_0000905_409_792 | 127 |
| 643 | 3300036401 | Ga0373937_0024810 | Ga0373937_0024810_4054_4437 | 127 |
| 644 | 3300036401 | Ga0373937_0185079 | Ga0373937_0185079_1252_1635 | 127 |
| 645 | 3300041446 | Ga0451794_33567 | Ga0451794_33567_154_537 | 127 |
| 646 | 3300042876 | Ga0451577_0017091 | Ga0451577_0017091_344_727 | 127 |
| 647 | 3300042876 | Ga0451577_0225538 | Ga0451577_0225538_449_832 | 127 |
| 648 | 3300042876 | Ga0451577_0239036 | Ga0451577_0239036_997_1380 | 127 |
| 649 | 3300042876 | Ga0451577_1273950 | Ga0451577_1273950_107_490 | 127 |
| 650 | 3300044673 | Ga0453683_0006598 | Ga0453683_0006598_4610_4993 | 127 |
| 651 | 3300044673 | Ga0453683_0028929 | Ga0453683_0028929_193_576 | 127 |
| 652 | 3300044673 | Ga0453683_0171760 | Ga0453683_0171760_672_1055 | 127 |
| 653 | 3300044673 | Ga0453683_0310911 | Ga0453683_0310911_469_852 | 127 |
| 654 | 3300044712 | Ga0453684_0048592 | Ga0453684_0048592_2544_2927 | 127 |
| 655 | 3300044712 | Ga0453684_0073743 | Ga0453684_0073743_1464_1847 | 127 |
| 656 | 3300044712 | Ga0453684_0267587 | Ga0453684_0267587_1175_1558 | 127 |
| 657 | 3300044712 | Ga0453684_2108582 | Ga0453684_2108582_35_418 | 127 |
| 658 | 3300044735 | Ga0466968_0241135 | Ga0466968_0241135_138_551 | 127 |
| 659 | 3300044901 | Ga0466960_0038323 | Ga0466960_0038323_787_1200 | 127 |
| 660 | 3300045051 | Ga0451576_0067033 | Ga0451576_0067033_1258_1641 | 127 |
| 661 | 3300045051 | Ga0451576_0720739 | Ga0451576_0720739_363_746 | 127 |
| 662 | 3300046454 | Ga0495592_0051472 | Ga0495592_0051472_1506_1889 | 127 |
| 663 | 3300046454 | Ga0495592_0059446 | Ga0495592_0059446_250_633 | 127 |
| 664 | 3300046454 | Ga0495592_0116904 | Ga0495592_0116904_95_478 | 127 |
| 665 | 3300046459 | Ga0495629_0491777 | Ga0495629_0491777_192_575 | 127 |
| 666 | 3300046462 | Ga0495651_0036587 | Ga0495651_0036587_526_909 | 127 |
| 667 | 3300046462 | Ga0495651_0055165 | Ga0495651_0055165_1095_1478 | 127 |
| 668 | 3300046463 | Ga0495653_0014747 | Ga0495653_0014747_5024_5407 | 127 |
| 669 | 3300046463 | Ga0495653_0168461 | Ga0495653_0168461_352_735 | 127 |
| 670 | 3300046472 | Ga0495580_0054728 | Ga0495580_0054728_1288_1671 | 127 |
| 671 | 3300046472 | Ga0495580_0258517 | Ga0495580_0258517_49_432 | 127 |
| 672 | 3300046473 | Ga0495582_0258942 | Ga0495582_0258942_365_748 | 127 |
| 673 | 3300046475 | Ga0495639_0404316 | Ga0495639_0404316_150_533 | 127 |
| 674 | 3300046477 | Ga0495664_0060251 | Ga0495664_0060251_1346_1729 | 127 |
| 675 | 3300046477 | Ga0495664_0124483 | Ga0495664_0124483_597_980 | 127 |
| 676 | 3300046499 | Ga0495594_0158317 | Ga0495594_0158317_243_626 | 127 |
| 677 | 3300046511 | Ga0495608_0008358 | Ga0495608_0008358_3958_4341 | 127 |
| 678 | 3300046511 | Ga0495608_0028526 | Ga0495608_0028526_176_559 | 127 |
| 679 | 3300046514 | Ga0495618_0247707 | Ga0495618_0247707_298_681 | 127 |
| 680 | 3300046516 | Ga0495628_0001930 | Ga0495628_0001930_15378_15761 | 127 |
| 681 | 3300046516 | Ga0495628_0398014 | Ga0495628_0398014_183_566 | 127 |
| 682 | 3300046516 | Ga0495628_0894785 | Ga0495628_0894785_166_549 | 127 |
| 683 | 3300046517 | Ga0495630_0008269 | Ga0495630_0008269_2953_3336 | 127 |
| 684 | 3300046517 | Ga0495630_0091375 | Ga0495630_0091375_1089_1472 | 127 |
| 685 | 3300046526 | Ga0495666_0064047 | Ga0495666_0064047_634_1017 | 127 |
| 686 | 3300046529 | Ga0495652_0014402 | Ga0495652_0014402_3058_3441 | 127 |
| 687 | 3300046529 | Ga0495652_0104883 | Ga0495652_0104883_816_1199 | 127 |
| 688 | 3300046531 | Ga0495665_0003304 | Ga0495665_0003304_5120_5503 | 127 |
| 689 | 3300046531 | Ga0495665_0498767 | Ga0495665_0498767_169_552 | 127 |
| 690 | 3300046533 | Ga0495640_0319729 | Ga0495640_0319729_366_749 | 127 |
| 691 | 3300046535 | Ga0495586_0035973 | Ga0495586_0035973_1449_1832 | 127 |
| 692 | 3300046535 | Ga0495586_0492190 | Ga0495586_0492190_87_470 | 127 |
| 693 | 3300046536 | Ga0495587_0002155 | Ga0495587_0002155_11922_12305 | 127 |
| 694 | 3300046543 | Ga0495645_0121158 | Ga0495645_0121158_341_724 | 127 |
| 695 | 3300046559 | Ga0495667_0017783 | Ga0495667_0017783_2266_2649 | 127 |
| 696 | 3300046559 | Ga0495667_0125252 | Ga0495667_0125252_1182_1565 | 127 |
| 697 | 3300046559 | Ga0495667_0359202 | Ga0495667_0359202_47_430 | 127 |
| 698 | 3300046642 | Ga0495634_0081968 | Ga0495634_0081968_582_965 | 127 |
| 699 | 3300046663 | Ga0495635_0049231 | Ga0495635_0049231_517_900 | 127 |
| 700 | 3300046663 | Ga0495635_0131153 | Ga0495635_0131153_494_877 | 127 |
| 701 | 3300046663 | Ga0495635_0181088 | Ga0495635_0181088_778_1161 | 127 |
| 702 | 3300046675 | Ga0495657_0066320 | Ga0495657_0066320_701_1084 | 127 |
| 703 | 3300046675 | Ga0495657_0110556 | Ga0495657_0110556_559_942 | 127 |
| 704 | 3300046675 | Ga0495657_0335417 | Ga0495657_0335417_234_617 | 127 |
| 705 | 3300046678 | Ga0495599_0098721 | Ga0495599_0098721_548_931 | 127 |
| 706 | 3300046678 | Ga0495599_0177850 | Ga0495599_0177850_749_1132 | 127 |
| 707 | 3300046679 | Ga0495623_0015674 | Ga0495623_0015674_3236_3619 | 127 |
| 708 | 3300046680 | Ga0495646_0014717 | Ga0495646_0014717_3073_3456 | 127 |
| 709 | 3300046680 | Ga0495646_0046689 | Ga0495646_0046689_57_440 | 127 |
| 710 | 3300046689 | Ga0495613_0180121 | Ga0495613_0180121_287_670 | 127 |
| 711 | 3300046689 | Ga0495613_0253462 | Ga0495613_0253462_22_405 | 127 |
| 712 | 3300046690 | Ga0495624_0016372 | Ga0495624_0016372_3652_4035 | 127 |
| 713 | 3300046809 | Ga0495600_0378201 | Ga0495600_0378201_53_436 | 127 |
| 714 | 3300047317 | Ga0495604_0019334 | Ga0495604_0019334_959_1342 | 127 |
| 715 | 3300047317 | Ga0495604_0081209 | Ga0495604_0081209_551_934 | 127 |
| 716 | 3300047319 | Ga0495674_0015976 | Ga0495674_0015976_2954_3337 | 127 |
| 717 | 3300047319 | Ga0495674_0049324 | Ga0495674_0049324_1378_1761 | 127 |
| 718 | 3300047319 | Ga0495674_0072689 | Ga0495674_0072689_2501_2884 | 127 |
| 719 | 3300047319 | Ga0495674_0213133 | Ga0495674_0213133_391_774 | 127 |
| 720 | 3300047322 | Ga0495680_0010376 | Ga0495680_0010376_373_756 | 127 |
| 721 | 3300047322 | Ga0495680_0037174 | Ga0495680_0037174_2687_3070 | 127 |
| 722 | 3300047444 | Ga0495675_0002873 | Ga0495675_0002873_5782_6165 | 127 |
| 723 | 3300047444 | Ga0495675_0004854 | Ga0495675_0004854_6931_7314 | 127 |
| 724 | 3300047471 | Ga0495684_0005513 | Ga0495684_0005513_6412_6795 | 127 |
| 725 | 3300047471 | Ga0495684_0036919 | Ga0495684_0036919_3067_3450 | 127 |
| 726 | 3300047471 | Ga0495684_0077651 | Ga0495684_0077651_1085_1468 | 127 |
| 727 | 3300047673 | Ga0495593_0010826 | Ga0495593_0010826_3065_3448 | 127 |
| 728 | 3300048088 | Ga0495602_0090783 | Ga0495602_0090783_93_476 | 127 |
| 729 | 3300048088 | Ga0495602_0262442 | Ga0495602_0262442_176_559 | 127 |
| 730 | 3300048089 | Ga0495614_0058406 | Ga0495614_0058406_11_394 | 127 |
| 731 | 3300048918 | Ga0496115_0333657 | Ga0496115_0333657_84_467 | 127 |
| 732 | 3300048918 | Ga0496115_0730131 | Ga0496115_0730131_255_638 | 127 |
| 733 | 3300050494 | nmdc:mga06z11_301313_c1 | nmdc:mga06z11_301313_c1_290_673 | 127 |
| 734 | iso_pu_bacteria | 2964375228 | 2964375278 | 127 |
| 735 | 3300005295 | Ga0065707_10167338 | Ga0065707_101673381 | 128 |
| 736 | 3300005330 | Ga0070690_100530485 | Ga0070690_1005304851 | 128 |
| 737 | 3300005340 | Ga0070689_101454326 | Ga0070689_1014543261 | 128 |
| 738 | 3300005406 | Ga0070703_10037289 | Ga0070703_100372892 | 128 |
| 739 | 3300005434 | Ga0070709_10006493 | Ga0070709_100064939 | 128 |
| 740 | 3300005435 | Ga0070714_100506323 | Ga0070714_1005063231 | 128 |
| 741 | 3300005435 | Ga0070714_100758792 | Ga0070714_1007587922 | 128 |
| 742 | 3300005436 | Ga0070713_100002365 | Ga0070713_10000236510 | 128 |
| 743 | 3300005436 | Ga0070713_100242785 | Ga0070713_1002427852 | 128 |
| 744 | 3300005436 | Ga0070713_100854865 | Ga0070713_1008548652 | 128 |
| 745 | 3300005437 | Ga0070710_10273875 | Ga0070710_102738752 | 128 |
| 746 | 3300005439 | Ga0070711_100001449 | Ga0070711_1000014494 | 128 |
| 747 | 3300005439 | Ga0070711_100130525 | Ga0070711_1001305252 | 128 |
| 748 | 3300005440 | Ga0070705_100086727 | Ga0070705_1000867273 | 128 |
| 749 | 3300005444 | Ga0070694_100008757 | Ga0070694_1000087575 | 128 |
| 750 | 3300005445 | Ga0070708_100004769 | Ga0070708_1000047692 | 128 |
| 751 | 3300005445 | Ga0070708_100016611 | Ga0070708_1000166113 | 128 |
| 752 | 3300005459 | Ga0068867_100257994 | Ga0068867_1002579942 | 128 |
| 753 | 3300005467 | Ga0070706_100045252 | Ga0070706_1000452524 | 128 |
| 754 | 3300005468 | Ga0070707_100012413 | Ga0070707_1000124137 | 128 |
| 755 | 3300005518 | Ga0070699_100037932 | Ga0070699_1000379324 | 128 |
| 756 | 3300005536 | Ga0070697_100593093 | Ga0070697_1005930932 | 128 |
| 757 | 3300005536 | Ga0070697_101446656 | Ga0070697_1014466561 | 128 |
| 758 | 3300005536 | Ga0070697_101554003 | Ga0070697_1015540031 | 128 |
| 759 | 3300005544 | Ga0070686_100356003 | Ga0070686_1003560031 | 128 |
| 760 | 3300005546 | Ga0070696_102020260 | Ga0070696_1020202601 | 128 |
| 761 | 3300005548 | Ga0070665_100000700 | Ga0070665_10000070033 | 128 |
| 762 | 3300005548 | Ga0070665_102085204 | Ga0070665_1020852041 | 128 |
| 763 | 3300005549 | Ga0070704_100377124 | Ga0070704_1003771241 | 128 |
| 764 | 3300005614 | Ga0068856_100465458 | Ga0068856_1004654583 | 128 |
| 765 | 3300005841 | Ga0068863_100014791 | Ga0068863_1000147919 | 128 |
| 766 | 3300005842 | Ga0068858_100088230 | Ga0068858_1000882303 | 128 |
| 767 | 3300005843 | Ga0068860_100010580 | Ga0068860_1000105805 | 128 |
| 768 | 3300006163 | Ga0070715_10082874 | Ga0070715_100828743 | 128 |
| 769 | 3300006173 | Ga0070716_100041393 | Ga0070716_1000413931 | 128 |
| 770 | 3300006173 | Ga0070716_100604165 | Ga0070716_1006041652 | 128 |
| 771 | 3300006173 | Ga0070716_101367341 | Ga0070716_1013673411 | 128 |
| 772 | 3300006175 | Ga0070712_100072105 | Ga0070712_1000721052 | 128 |
| 773 | 3300006175 | Ga0070712_100255026 | Ga0070712_1002550263 | 128 |
| 774 | 3300006175 | Ga0070712_100452968 | Ga0070712_1004529681 | 128 |
| 775 | 3300006175 | Ga0070712_101024728 | Ga0070712_1010247281 | 128 |
| 776 | 3300006237 | Ga0097621_100171453 | Ga0097621_1001714531 | 128 |
| 777 | 3300006237 | Ga0097621_100689135 | Ga0097621_1006891352 | 128 |
| 778 | 3300006237 | Ga0097621_100726987 | Ga0097621_1007269871 | 128 |
| 779 | 3300006871 | Ga0075434_101387012 | Ga0075434_1013870122 | 128 |
| 780 | 3300006914 | Ga0075436_100005799 | Ga0075436_1000057992 | 128 |
| 781 | 3300006914 | Ga0075436_100009783 | Ga0075436_1000097834 | 128 |
| 782 | 3300006914 | Ga0075436_100800916 | Ga0075436_1008009162 | 128 |
| 783 | 3300009093 | Ga0105240_10922690 | Ga0105240_109226901 | 128 |
| 784 | 3300009176 | Ga0105242_10247762 | Ga0105242_102477622 | 128 |
| 785 | 3300009176 | Ga0105242_12148188 | Ga0105242_121481881 | 128 |
| 786 | 3300009545 | Ga0105237_10222663 | Ga0105237_102226632 | 128 |
| 787 | 3300014968 | Ga0157379_11034308 | Ga0157379_110343081 | 128 |
| 788 | 3300021384 | Ga0213876_10024420 | Ga0213876_100244204 | 128 |
| 789 | 3300024227 | Ga0228598_1004932 | Ga0228598_10049322 | 128 |
| 790 | 3300025885 | Ga0207653_10022350 | Ga0207653_100223501 | 128 |
| 791 | 3300025899 | Ga0207642_10082809 | Ga0207642_100828092 | 128 |
| 792 | 3300025905 | Ga0207685_10053011 | Ga0207685_100530111 | 128 |
| 793 | 3300025906 | Ga0207699_10022332 | Ga0207699_100223323 | 128 |
| 794 | 3300025906 | Ga0207699_10317275 | Ga0207699_103172751 | 128 |
| 795 | 3300025906 | Ga0207699_10339564 | Ga0207699_103395642 | 128 |
| 796 | 3300025910 | Ga0207684_10027856 | Ga0207684_100278563 | 128 |
| 797 | 3300025910 | Ga0207684_10126378 | Ga0207684_101263782 | 128 |
| 798 | 3300025910 | Ga0207684_10424447 | Ga0207684_104244471 | 128 |
| 799 | 3300025914 | Ga0207671_10094363 | Ga0207671_100943633 | 128 |
| 800 | 3300025914 | Ga0207671_11231216 | Ga0207671_112312161 | 128 |
| 801 | 3300025915 | Ga0207693_10043266 | Ga0207693_100432664 | 128 |
| 802 | 3300025915 | Ga0207693_10159441 | Ga0207693_101594413 | 128 |
| 803 | 3300025915 | Ga0207693_10413993 | Ga0207693_104139931 | 128 |
| 804 | 3300025916 | Ga0207663_10125904 | Ga0207663_101259041 | 128 |
| 805 | 3300025916 | Ga0207663_10465398 | Ga0207663_104653982 | 128 |
| 806 | 3300025916 | Ga0207663_10496103 | Ga0207663_104961031 | 128 |
| 807 | 3300025918 | Ga0207662_10876025 | Ga0207662_108760251 | 128 |
| 808 | 3300025921 | Ga0207652_10032823 | Ga0207652_100328233 | 128 |
| 809 | 3300025922 | Ga0207646_10001996 | Ga0207646_1000199620 | 128 |
| 810 | 3300025922 | Ga0207646_10093840 | Ga0207646_100938401 | 128 |
| 811 | 3300025922 | Ga0207646_10669651 | Ga0207646_106696512 | 128 |
| 812 | 3300025928 | Ga0207700_10002600 | Ga0207700_100026003 | 128 |
| 813 | 3300025928 | Ga0207700_10167004 | Ga0207700_101670043 | 128 |
| 814 | 3300025929 | Ga0207664_10482958 | Ga0207664_104829581 | 128 |
| 815 | 3300025934 | Ga0207686_10698442 | Ga0207686_106984421 | 128 |
| 816 | 3300025939 | Ga0207665_10005811 | Ga0207665_100058112 | 128 |
| 817 | 3300025939 | Ga0207665_10031807 | Ga0207665_100318072 | 128 |
| 818 | 3300025939 | Ga0207665_10090757 | Ga0207665_100907573 | 128 |
| 819 | 3300025939 | Ga0207665_10135097 | Ga0207665_101350971 | 128 |
| 820 | 3300025939 | Ga0207665_10138823 | Ga0207665_101388232 | 128 |
| 821 | 3300025939 | Ga0207665_10695306 | Ga0207665_106953061 | 128 |
| 822 | 3300025941 | Ga0207711_10306284 | Ga0207711_103062841 | 128 |
| 823 | 3300025942 | Ga0207689_10612955 | Ga0207689_106129551 | 128 |
| 824 | 3300026035 | Ga0207703_10017399 | Ga0207703_100173992 | 128 |
| 825 | 3300026088 | Ga0207641_10006158 | Ga0207641_100061582 | 128 |
| 826 | 3300026089 | Ga0207648_10339454 | Ga0207648_103394542 | 128 |
| 827 | 3300027512 | Ga0209179_1017684 | Ga0209179_10176842 | 128 |
| 828 | 3300027671 | Ga0209588_1009968 | Ga0209588_10099682 | 128 |
| 829 | 3300028016 | Ga0265354_1000344 | Ga0265354_10003443 | 128 |
| 830 | 3300028379 | Ga0268266_10000259 | Ga0268266_1000025951 | 128 |
| 831 | 3300028381 | Ga0268264_10016281 | Ga0268264_100162813 | 128 |
| 832 | 3300028381 | Ga0268264_10019364 | Ga0268264_100193643 | 128 |
| 833 | 3300028573 | Ga0265334_10062672 | Ga0265334_100626722 | 128 |
| 834 | 3300028666 | Ga0265336_10026034 | Ga0265336_100260342 | 128 |
| 835 | 3300028800 | Ga0265338_10070235 | Ga0265338_100702353 | 128 |
| 836 | 3300028800 | Ga0265338_10219663 | Ga0265338_102196631 | 128 |
| 837 | 3300028800 | Ga0265338_10426682 | Ga0265338_104266821 | 128 |
| 838 | 3300028800 | Ga0265338_10912176 | Ga0265338_109121762 | 128 |
| 839 | 3300030878 | Ga0265770_1003693 | Ga0265770_10036932 | 128 |
| 840 | 3300031018 | Ga0265773_1001638 | Ga0265773_10016382 | 128 |
| 841 | 3300031090 | Ga0265760_10021342 | Ga0265760_100213422 | 128 |
| 842 | 3300031090 | Ga0265760_10051624 | Ga0265760_100516242 | 128 |
| 843 | 3300031238 | Ga0265332_10125373 | Ga0265332_101253732 | 128 |
| 844 | 3300031239 | Ga0265328_10154371 | Ga0265328_101543711 | 128 |
| 845 | 3300031239 | Ga0265328_10192958 | Ga0265328_101929581 | 128 |
| 846 | 3300031241 | Ga0265325_10012503 | Ga0265325_100125032 | 128 |
| 847 | 3300031241 | Ga0265325_10111536 | Ga0265325_101115362 | 128 |
| 848 | 3300031242 | Ga0265329_10008477 | Ga0265329_100084773 | 128 |
| 849 | 3300031242 | Ga0265329_10100232 | Ga0265329_101002322 | 128 |
| 850 | 3300031247 | Ga0265340_10102258 | Ga0265340_101022581 | 128 |
| 851 | 3300031250 | Ga0265331_10002674 | Ga0265331_100026744 | 128 |
| 852 | 3300031344 | Ga0265316_10001106 | Ga0265316_1000110626 | 128 |
| 853 | 3300031344 | Ga0265316_10124722 | Ga0265316_101247222 | 128 |
| 854 | 3300031344 | Ga0265316_10612981 | Ga0265316_106129812 | 128 |
| 855 | 3300031595 | Ga0265313_10018591 | Ga0265313_100185913 | 128 |
| 856 | 3300031711 | Ga0265314_10038233 | Ga0265314_100382331 | 128 |
| 857 | 3300031712 | Ga0265342_10026417 | Ga0265342_100264174 | 128 |
| 858 | 3300031712 | Ga0265342_10038414 | Ga0265342_100384143 | 128 |
| 859 | 3300033547 | Ga0316212_1002571 | Ga0316212_10025712 | 128 |
| 860 | 3300033547 | Ga0316212_1006236 | Ga0316212_10062362 | 128 |
| 861 | 3300035724 | Ga0373933_0746621 | Ga0373933_0746621_13_465 | 128 |
| 862 | 3300046516 | Ga0495628_0983104 | Ga0495628_0983104_81_467 | 128 |
| 863 | 3300046517 | Ga0495630_0052655 | Ga0495630_0052655_2567_2953 | 128 |
| 864 | 3300046557 | Ga0495622_0509001 | Ga0495622_0509001_40_429 | 128 |
| 865 | 3300047317 | Ga0495604_0506652 | Ga0495604_0506652_47_499 | 128 |
| 866 | 3300048915 | Ga0496112_0394878 | Ga0496112_0394878_798_1184 | 128 |
| 867 | 3300049535 | Ga0501319_031007 | Ga0501319_031007_74_463 | 128 |
| 868 | 3300049571 | Ga0501034_0990356 | Ga0501034_0990356_174_608 | 128 |
| 869 | 3300049674 | Ga0501242_026540 | Ga0501242_026540_57_443 | 128 |
| 870 | 3300049744 | Ga0501083_0520694 | Ga0501083_0520694_298_684 | 128 |
| 871 | 3300050512 | nmdc:mga0n895_2004878_c1 | nmdc:mga0n895_2004878_c1_47_436 | 128 |
| 872 | 3300005536 | Ga0070697_100414395 | Ga0070697_1004143952 | 129 |
| 873 | 3300006880 | Ga0075429_100267299 | Ga0075429_1002672992 | 129 |
| 874 | 3300032002 | Ga0307416_100407877 | Ga0307416_1004078772 | 129 |
| 875 | 3300044712 | Ga0453684_1075362 | Ga0453684_1075362_391_792 | 129 |
| 876 | 3300046517 | Ga0495630_1530036 | Ga0495630_1530036_80_469 | 129 |
| 877 | 3300048090 | Ga0495615_0283139 | Ga0495615_0283139_132_521 | 129 |
| 878 | 3300050508 | nmdc:mga09592_458615_c1 | nmdc:mga09592_458615_c1_346_735 | 129 |
| 879 | 3300059624 | Ga0587109_133264 | Ga0587109_133264_15_419 | 129 |
| 880 | 3300059639 | Ga0587062_081960 | Ga0587062_081960_15_419 | 129 |
| 881 | 3300005364 | Ga0070673_100506945 | Ga0070673_1005069451 | 130 |
| 882 | 3300006844 | Ga0075428_100269384 | Ga0075428_1002693843 | 130 |
| 883 | 3300006846 | Ga0075430_100225464 | Ga0075430_1002254641 | 130 |
| 884 | 3300006880 | Ga0075429_100602085 | Ga0075429_1006020852 | 130 |
| 885 | 3300009094 | Ga0111539_10140216 | Ga0111539_101402162 | 130 |
| 886 | 3300014969 | Ga0157376_12354466 | Ga0157376_123544661 | 130 |
| 887 | 3300025923 | Ga0207681_10887101 | Ga0207681_108871011 | 130 |
| 888 | 3300025924 | Ga0207694_10482770 | Ga0207694_104827702 | 130 |
| 889 | 3300025960 | Ga0207651_11465341 | Ga0207651_114653411 | 130 |
| 890 | 3300027907 | Ga0207428_10687091 | Ga0207428_106870912 | 130 |
| 891 | 3300049571 | Ga0501034_0408012 | Ga0501034_0408012_135_527 | 130 |
| 892 | 3300050508 | nmdc:mga09592_926227_c1 | nmdc:mga09592_926227_c1_182_574 | 130 |
| 893 | 3300050509 | nmdc:mga0qj67_281355_c1 | nmdc:mga0qj67_281355_c1_844_1236 | 130 |
| 894 | 3300050511 | nmdc:mga08y16_932106_c1 | nmdc:mga08y16_932106_c1_297_689 | 130 |
| 895 | 3300005440 | Ga0070705_100925381 | Ga0070705_1009253812 | 131 |
| 896 | 3300005440 | Ga0070705_101487901 | Ga0070705_1014879011 | 131 |
| 897 | 3300006847 | Ga0075431_100452149 | Ga0075431_1004521492 | 131 |
| 898 | 3300009094 | Ga0111539_10023538 | Ga0111539_100235383 | 131 |
| 899 | 3300009177 | Ga0105248_10373894 | Ga0105248_103738941 | 131 |
| 900 | 3300013308 | Ga0157375_10313280 | Ga0157375_103132803 | 131 |
| 901 | 3300025960 | Ga0207651_11330940 | Ga0207651_113309402 | 131 |
| 902 | 3300031548 | Ga0307408_100071079 | Ga0307408_1000710792 | 131 |
| 903 | 3300031731 | Ga0307405_10222748 | Ga0307405_102227481 | 131 |
| 904 | 3300031824 | Ga0307413_10748047 | Ga0307413_107480471 | 131 |
| 905 | 3300031852 | Ga0307410_10231950 | Ga0307410_102319502 | 131 |
| 906 | 3300031903 | Ga0307407_10357030 | Ga0307407_103570302 | 131 |
| 907 | 3300031995 | Ga0307409_100265902 | Ga0307409_1002659022 | 131 |
| 908 | 3300032005 | Ga0307411_11352474 | Ga0307411_113524741 | 131 |
| 909 | 3300032005 | Ga0307411_11786736 | Ga0307411_117867361 | 131 |
| 910 | 3300033524 | Ga0316592_1145451 | Ga0316592_11454511 | 131 |
| 911 | 3300035171 | Ga0373946_0041980 | Ga0373946_0041980_1274_1669 | 131 |
| 912 | 3300037068 | Ga0373925_0571442 | Ga0373925_0571442_396_791 | 131 |
| 913 | 3300041461 | Ga0451805_008458 | Ga0451805_008458_39_434 | 131 |
| 914 | 3300046683 | Ga0495658_0002307 | Ga0495658_0002307_7837_8232 | 131 |
| 915 | 3300049127 | Ga0501306_003070 | Ga0501306_003070_229_627 | 131 |
| 916 | 3300049128 | Ga0501308_007513 | Ga0501308_007513_522_920 | 131 |
| 917 | 3300049128 | Ga0501308_034137 | Ga0501308_034137_80_478 | 131 |
| 918 | 3300049129 | Ga0501309_064488 | Ga0501309_064488_33_431 | 131 |
| 919 | 3300049160 | Ga0501304_001315 | Ga0501304_001315_893_1291 | 131 |
| 920 | 3300049162 | Ga0501307_018937 | Ga0501307_018937_202_600 | 131 |
| 921 | 3300049527 | Ga0501311_026839 | Ga0501311_026839_197_595 | 131 |
| 922 | 3300049529 | Ga0501313_031423 | Ga0501313_031423_44_442 | 131 |
| 923 | 3300049536 | Ga0501320_066742 | Ga0501320_066742_13_411 | 131 |
| 924 | 3300049686 | Ga0501257_097188 | Ga0501257_097188_228_626 | 131 |
| 925 | 3300050507 | nmdc:mga05p37_1927286_c1 | nmdc:mga05p37_1927286_c1_33_428 | 131 |
| 926 | 3300050510 | nmdc:mga06r32_268624_c1 | nmdc:mga06r32_268624_c1_711_1106 | 131 |
| 927 | 3300050511 | nmdc:mga08y16_18794_c1 | nmdc:mga08y16_18794_c1_4236_4631 | 131 |
| 928 | 3300005459 | Ga0068867_100259979 | Ga0068867_1002599793 | 132 |
| 929 | 3300005535 | Ga0070684_101702750 | Ga0070684_1017027501 | 132 |
| 930 | 3300005578 | Ga0068854_100906868 | Ga0068854_1009068682 | 132 |
| 931 | 3300005618 | Ga0068864_101268011 | Ga0068864_1012680112 | 132 |
| 932 | 3300025908 | Ga0207643_10554156 | Ga0207643_105541562 | 132 |
| 933 | 3300026088 | Ga0207641_10924854 | Ga0207641_109248542 | 132 |
| 934 | 3300026089 | Ga0207648_10286078 | Ga0207648_102860783 | 132 |
| 935 | 3300026095 | Ga0207676_11250965 | Ga0207676_112509652 | 132 |
| 936 | 3300003163 | Ga0006759J45824_1150259 | Ga0006759J45824_11502591 | 133 |
| 937 | 3300014326 | Ga0157380_11062915 | Ga0157380_110629151 | 133 |
| 938 | 3300025936 | Ga0207670_10288920 | Ga0207670_102889202 | 133 |
| 939 | 3300044712 | Ga0453684_0055571 | Ga0453684_0055571_4196_4606 | 133 |
| 940 | 3300049161 | Ga0501305_116230 | Ga0501305_116230_47_454 | 133 |
| 941 | 3300050510 | nmdc:mga06r32_319969_c1 | nmdc:mga06r32_319969_c1_369_785 | 133 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar