F486335

General Info

Members Datasets Scaffolds Average Seq Length
941 399 907 126

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_266032|Ga0400483_266032_683_1060
Length 125
Sequence MPTIQQLVRKGRSKQVYKSKAPALDACPQKRGVCVRVYTTTPKKPNSAMRKVARVRITKSGKEVNAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHLIRGALDTAGVEGRTQRRSKYGAKRPKK

Samples

Sample ID Description Type Environment
1 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
2 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
3 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
4 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
5 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
6 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
7 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
8 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
9 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
10 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
11 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
12 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
13 2860837431 Bacillus sp. WR11 Isolate Unclassified
14 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
15 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
16 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
17 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
18 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
19 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
20 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
21 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
22 2969141011 Bacillus velezensis MH25 Isolate Unclassified
23 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
24 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
25 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
26 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
27 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
28 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
29 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
30 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
31 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
32 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
33 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
124 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
128 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
174 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
175 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
176 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
177 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
178 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
181 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
182 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
183 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
189 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
190 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
191 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
192 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
193 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
194 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
195 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
196 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
197 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
198 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
201 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
202 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
205 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
206 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
207 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
208 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
219 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
220 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
221 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
222 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
223 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
230 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
231 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
232 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
233 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
234 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
235 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
236 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
237 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
238 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
239 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
240 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
241 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
243 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
246 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
249 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
250 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
252 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
253 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
257 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
258 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
259 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
260 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
261 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
262 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
263 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
264 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
265 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
266 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
267 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
268 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
269 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
274 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
275 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
276 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
277 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
278 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
279 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
280 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
281 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
282 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
283 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
284 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
285 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
286 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
287 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
288 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
289 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
290 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
291 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
292 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
293 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
294 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
295 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
296 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
297 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
298 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
299 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
300 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
301 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
302 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
303 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
304 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
305 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
306 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
307 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
308 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
309 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
310 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
311 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
312 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
313 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
314 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
315 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
316 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
317 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
318 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
319 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
320 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
321 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
322 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
323 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
324 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
328 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
329 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
338 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
358 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
359 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
360 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
361 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
362 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
363 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
364 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
365 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
366 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
367 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
368 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
369 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
370 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
373 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
374 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
375 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
376 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
377 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
378 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
379 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
380 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
381 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
382 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
383 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
384 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
385 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
386 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
387 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
388 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
396 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
397 8022653035 Bacillus sp. Rc4 Isolate Unclassified
398 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
399 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.53
Metatranscriptomes 12.86
Isolates 3.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 1.7
Rhizosphere 94.79
Stem 0
Stem Tuber 0
Unclassified 3.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006759J45824_1150259 3300003163 Bacteria 616
2 rootH1_10069712 3300003323 Bacteria 4000
3 rootH1_10403485 3300003323 Bacteria 1254
4 Ga0065707_10167338 3300005295 Bacteria 1512
5 Ga0070676_11259696 3300005328 Bacteria 564
6 Ga0070683_100648598 3300005329 Bacteria 1011
7 Ga0070690_100530485 3300005330 Bacteria 885
8 Ga0070670_100590010 3300005331 Bacteria 994
9 Ga0068869_100099622 3300005334 Bacteria 2196
10 Ga0070680_100355547 3300005336 Bacteria 1246
11 Ga0070682_100791466 3300005337 Bacteria 769
12 Ga0070689_101065984 3300005340 Bacteria 721
13 Ga0070689_101343123 3300005340 Bacteria 645
14 Ga0070689_101454326 3300005340 Bacteria 620
15 Ga0070692_10380746 3300005345 Bacteria 885
16 Ga0070674_100068400 3300005356 Bacteria 2502
17 Ga0070673_100506945 3300005364 Bacteria 1092
18 Ga0070667_101407232 3300005367 Bacteria 654
19 Ga0070703_10037289 3300005406 Bacteria 1497
20 Ga0070709_10006493 3300005434 Bacteria 6375
21 Ga0070709_10068471 3300005434 Bacteria 2283
22 Ga0070714_100506323 3300005435 Bacteria 1152
23 Ga0070714_100758792 3300005435 Bacteria 938
24 Ga0070713_100002365 3300005436 Bacteria 12304
25 Ga0070713_100016190 3300005436 Bacteria 5604
26 Ga0070713_100242785 3300005436 Bacteria 1641
27 Ga0070713_100428436 3300005436 Bacteria 1239
28 Ga0070713_100854865 3300005436 Bacteria 874
29 Ga0070710_10043474 3300005437 Bacteria 2488
30 Ga0070710_10166147 3300005437 Bacteria 1372
31 Ga0070710_10273875 3300005437 Bacteria 1093
32 Ga0070710_11159375 3300005437 Bacteria 570
33 Ga0070701_10184773 3300005438 Bacteria 1223
34 Ga0070711_100001449 3300005439 Bacteria 13051
35 Ga0070711_100045540 3300005439 Bacteria 2985
36 Ga0070711_100090240 3300005439 Bacteria 2207
37 Ga0070711_100130525 3300005439 Bacteria 1871
38 Ga0070711_101221300 3300005439 Bacteria 651
39 Ga0070705_100086727 3300005440 Bacteria 1939
40 Ga0070705_100925381 3300005440 Bacteria 703
41 Ga0070705_101040583 3300005440 Bacteria 667
42 Ga0070705_101487901 3300005440 Bacteria 567
43 Ga0070694_100008757 3300005444 Bacteria 6199
44 Ga0070708_100004769 3300005445 Bacteria 10687
45 Ga0070708_100016611 3300005445 Bacteria 6112
46 Ga0070708_100807413 3300005445 Bacteria 882
47 Ga0070708_100974040 3300005445 Bacteria 795
48 Ga0070678_100070409 3300005456 Bacteria 2614
49 Ga0070681_10198635 3300005458 Bacteria 1924
50 Ga0070681_10700340 3300005458 Bacteria 929
51 Ga0068867_100257994 3300005459 Bacteria 1420
52 Ga0068867_100259979 3300005459 Bacteria 1415
53 Ga0070706_100027065 3300005467 Bacteria 5277
54 Ga0070706_100038479 3300005467 Bacteria 4414
55 Ga0070706_100045252 3300005467 Bacteria 4066
56 Ga0070706_100090069 3300005467 Bacteria 2845
57 Ga0070706_100233626 3300005467 Bacteria 1716
58 Ga0070707_100010443 3300005468 Bacteria 8648
59 Ga0070707_100012413 3300005468 Bacteria 7956
60 Ga0070707_100014471 3300005468 Bacteria 7393
61 Ga0070707_101011500 3300005468 Bacteria 797
62 Ga0070698_100003219 3300005471 Bacteria 17992
63 Ga0070698_100065898 3300005471 Bacteria 3647
64 Ga0070698_100068156 3300005471 Bacteria 3577
65 Ga0070698_100480315 3300005471 Bacteria 1180
66 Ga0070698_100911535 3300005471 Bacteria 825
67 Ga0070698_101394679 3300005471 Bacteria 651
68 Ga0070699_100037932 3300005518 Bacteria 4171
69 Ga0070699_100063431 3300005518 Bacteria 3204
70 Ga0070699_100186526 3300005518 Bacteria 1842
71 Ga0070699_100334911 3300005518 Bacteria 1361
72 Ga0070679_100024467 3300005530 Bacteria 5917
73 Ga0070679_100685245 3300005530 Bacteria 968
74 Ga0070684_101702750 3300005535 Bacteria 595
75 Ga0070697_100130858 3300005536 Bacteria 2104
76 Ga0070697_100414395 3300005536 Bacteria 1170
77 Ga0070697_100593093 3300005536 Bacteria 973
78 Ga0070697_101102441 3300005536 Bacteria 707
79 Ga0070697_101315149 3300005536 Bacteria 645
80 Ga0070697_101446656 3300005536 Bacteria 614
81 Ga0070697_101554003 3300005536 Bacteria 592
82 Ga0070672_100013159 3300005543 Bacteria 5834
83 Ga0070686_100356003 3300005544 Bacteria 1101
84 Ga0070695_100027795 3300005545 Bacteria 3506
85 Ga0070695_100124337 3300005545 Bacteria 1769
86 Ga0070696_100003003 3300005546 Bacteria 11197
87 Ga0070696_100044176 3300005546 Bacteria 3085
88 Ga0070696_100648192 3300005546 Bacteria 856
89 Ga0070696_102020260 3300005546 Bacteria 501
90 Ga0070693_100000994 3300005547 Bacteria 12639
91 Ga0070665_100000700 3300005548 Bacteria 44692
92 Ga0070665_100004237 3300005548 Bacteria 15097
93 Ga0070665_102085204 3300005548 Bacteria 572
94 Ga0070704_100003283 3300005549 Bacteria 9244
95 Ga0070704_100377124 3300005549 Bacteria 1204
96 Ga0070704_100615286 3300005549 Bacteria 956
97 Ga0070704_101517299 3300005549 Bacteria 617
98 Ga0068854_100489662 3300005578 Bacteria 1034
99 Ga0068854_100906868 3300005578 Bacteria 775
100 Ga0068856_100465458 3300005614 Bacteria 1285
101 Ga0068864_101268011 3300005618 Bacteria 737
102 Ga0068861_101020095 3300005719 Bacteria 791
103 Ga0068870_10529830 3300005840 Bacteria 790
104 Ga0068863_100014791 3300005841 Bacteria 7503
105 Ga0068858_100088230 3300005842 Bacteria 2885
106 Ga0068860_100010580 3300005843 Bacteria 9113
107 Ga0068860_100509204 3300005843 Bacteria 1202
108 Ga0068862_100333204 3300005844 Bacteria 1404
109 Ga0081455_10002585 3300005937 Bacteria 21454
110 Ga0081455_10157276 3300005937 Bacteria 1746
111 Ga0081538_10000250 3300005981 Bacteria 60946
112 Ga0081538_10002047 3300005981 Bacteria 20127
113 Ga0081538_10019032 3300005981 Bacteria 5126
114 Ga0081538_10138015 3300005981 Bacteria 1131
115 Ga0070715_10082874 3300006163 Bacteria 1459
116 Ga0070715_10208809 3300006163 Bacteria 997
117 Ga0070715_10212958 3300006163 Bacteria 989
118 Ga0070716_100041393 3300006173 Bacteria 2566
119 Ga0070716_100604165 3300006173 Bacteria 825
120 Ga0070716_101367341 3300006173 Bacteria 575
121 Ga0070712_100072105 3300006175 Bacteria 2473
122 Ga0070712_100255026 3300006175 Bacteria 1403
123 Ga0070712_100351408 3300006175 Bacteria 1207
124 Ga0070712_100452968 3300006175 Bacteria 1069
125 Ga0070712_101024728 3300006175 Bacteria 715
126 Ga0097621_100171453 3300006237 Bacteria 1870
127 Ga0097621_100332534 3300006237 Bacteria 1348
128 Ga0097621_100689135 3300006237 Bacteria 940
129 Ga0097621_100726987 3300006237 Bacteria 916
130 Ga0068871_100022756 3300006358 Bacteria 4836
131 Ga0068871_100716246 3300006358 Bacteria 918
132 Ga0068871_101560463 3300006358 Bacteria 625
133 Ga0075428_100263152 3300006844 Bacteria 1857
134 Ga0075428_100269384 3300006844 Bacteria 1832
135 Ga0075428_101151503 3300006844 Bacteria 818
136 Ga0075428_102356328 3300006844 Bacteria 547
137 Ga0075430_100039669 3300006846 Bacteria 3986
138 Ga0075430_100225464 3300006846 Bacteria 1554
139 Ga0075430_100829049 3300006846 Bacteria 762
140 Ga0075431_100063276 3300006847 Bacteria 3818
141 Ga0075431_100452149 3300006847 Bacteria 1280
142 Ga0075431_101034084 3300006847 Bacteria 787
143 Ga0075431_101113721 3300006847 Bacteria 754
144 Ga0075433_10024717 3300006852 Bacteria 5073
145 Ga0075433_10060259 3300006852 Bacteria 3322
146 Ga0075433_10688173 3300006852 Bacteria 896
147 Ga0075433_11130862 3300006852 Bacteria 681
148 Ga0075434_100063706 3300006871 Bacteria 3670
149 Ga0075434_100084572 3300006871 Bacteria 3171
150 Ga0075434_101387012 3300006871 Bacteria 713
151 Ga0075429_100048515 3300006880 Bacteria 3693
152 Ga0075429_100267299 3300006880 Bacteria 1498
153 Ga0075429_100284342 3300006880 Bacteria 1448
154 Ga0075429_100602085 3300006880 Bacteria 963
155 Ga0075429_100672111 3300006880 Bacteria 907
156 Ga0068865_100072446 3300006881 Bacteria 2447
157 Ga0068865_100204745 3300006881 Bacteria 1534
158 Ga0068865_100712783 3300006881 Bacteria 858
159 Ga0068865_101932220 3300006881 Bacteria 535
160 Ga0075436_100005799 3300006914 Bacteria 8480
161 Ga0075436_100009783 3300006914 Bacteria 6556
162 Ga0075436_100800916 3300006914 Bacteria 701
163 Ga0075435_100140998 3300007076 Bacteria 2022
164 Ga0075435_100805145 3300007076 Bacteria 818
165 Ga0075435_101405799 3300007076 Bacteria 611
166 Ga0099794_10014076 3300007265 Bacteria 3497
167 Ga0099794_10023888 3300007265 Bacteria 2801
168 Ga0099794_10035542 3300007265 Bacteria 2352
169 Ga0099794_10113447 3300007265 Bacteria 1359
170 Ga0099795_10004417 3300007788 Bacteria 3627
171 Ga0099795_10030072 3300007788 Bacteria 1862
172 Ga0099795_10086438 3300007788 Bacteria 1209
173 Ga0105250_10425161 3300009092 Bacteria 593
174 Ga0105240_10004245 3300009093 Bacteria 21913
175 Ga0105240_10121109 3300009093 Bacteria 3150
176 Ga0105240_10274511 3300009093 Bacteria 1940
177 Ga0105240_10922690 3300009093 Bacteria 938
178 Ga0111539_10023538 3300009094 Bacteria 7567
179 Ga0111539_10140216 3300009094 Bacteria 2830
180 Ga0111539_10456351 3300009094 Bacteria 1488
181 Ga0105245_10033891 3300009098 Bacteria 4526
182 Ga0105247_10279487 3300009101 Bacteria 1151
183 Ga0114129_10814565 3300009147 Bacteria 1190
184 Ga0105242_10247762 3300009176 Bacteria 1604
185 Ga0105242_10654675 3300009176 Bacteria 1022
186 Ga0105242_10912622 3300009176 Bacteria 879
187 Ga0105242_11090234 3300009176 Bacteria 812
188 Ga0105242_12148188 3300009176 Bacteria 603
189 Ga0105248_10373894 3300009177 Bacteria 1604
190 Ga0105248_11056173 3300009177 Bacteria 918
191 Ga0105248_11706920 3300009177 Bacteria 714
192 Ga0105237_10072778 3300009545 Bacteria 3431
193 Ga0105237_10150945 3300009545 Bacteria 2320
194 Ga0105237_10222663 3300009545 Bacteria 1887
195 Ga0099796_10063694 3300010159 Bacteria 1314
196 Ga0105239_10022622 3300010375 Bacteria 6930
197 Ga0105239_10030499 3300010375 Bacteria 5928
198 Ga0105239_10544717 3300010375 Bacteria 1321
199 Ga0157340_1008626 3300012473 Bacteria 685
200 Ga0157371_10272231 3300013102 Bacteria 1222
201 Ga0157371_10410538 3300013102 Bacteria 992
202 Ga0157369_11202069 3300013105 Bacteria 774
203 Ga0157374_10000801 3300013296 Bacteria 27561
204 Ga0157374_10119097 3300013296 Bacteria 2547
205 Ga0157378_10000272 3300013297 Bacteria 50377
206 Ga0157378_10000886 3300013297 Bacteria 27619
207 Ga0157378_10010996 3300013297 Bacteria 7921
208 Ga0157378_10438127 3300013297 Bacteria 1295
209 Ga0157378_10888802 3300013297 Bacteria 921
210 Ga0157378_11598577 3300013297 Bacteria 698
211 Ga0163162_10374288 3300013306 Bacteria 1557
212 Ga0163162_11107878 3300013306 Bacteria 897
213 Ga0157372_10098714 3300013307 Bacteria 3332
214 Ga0157372_12959194 3300013307 Bacteria 543
215 Ga0157375_10313280 3300013308 Bacteria 1733
216 Ga0157375_11315401 3300013308 Bacteria 850
217 Ga0157375_12507451 3300013308 Bacteria 616
218 Ga0157375_12673585 3300013308 Bacteria 597
219 Ga0157380_11062915 3300014326 Bacteria 846
220 Ga0157380_13475935 3300014326 Bacteria 504
221 Ga0157377_10540728 3300014745 Bacteria 821
222 Ga0157379_10056214 3300014968 Bacteria 3516
223 Ga0157379_11034308 3300014968 Bacteria 784
224 Ga0157376_10000075 3300014969 Bacteria 75560
225 Ga0157376_10002707 3300014969 Bacteria 12069
226 Ga0157376_10226962 3300014969 Bacteria 1733
227 Ga0157376_10438194 3300014969 Bacteria 1272
228 Ga0157376_12354466 3300014969 Bacteria 572
229 Ga0182007_10392064 3300015262 Bacteria 528
230 Ga0184603_100407 3300019192 Bacteria 633
231 Ga0213873_10179721 3300021358 Bacteria 649
232 Ga0213876_10024420 3300021384 Bacteria 3191
233 Ga0213876_10135418 3300021384 Bacteria 1310
234 Ga0256720_139491 3300023438 Bacteria 598
235 Ga0228598_1004458 3300024227 Bacteria 2965
236 Ga0228598_1004932 3300024227 Bacteria 2808
237 Ga0207653_10022350 3300025885 Bacteria 2008
238 Ga0207642_10082809 3300025899 Bacteria 1563
239 Ga0207688_10661977 3300025901 Bacteria 659
240 Ga0207685_10053011 3300025905 Bacteria 1573
241 Ga0207685_10274449 3300025905 Bacteria 825
242 Ga0207699_10022332 3300025906 Bacteria 3427
243 Ga0207699_10059947 3300025906 Bacteria 2283
244 Ga0207699_10175452 3300025906 Bacteria 1437
245 Ga0207699_10186348 3300025906 Bacteria 1398
246 Ga0207699_10317275 3300025906 Bacteria 1092
247 Ga0207699_10339564 3300025906 Bacteria 1058
248 Ga0207699_10674165 3300025906 Bacteria 756
249 Ga0207643_10554156 3300025908 Bacteria 738
250 Ga0207705_10162926 3300025909 Bacteria 1676
251 Ga0207684_10010612 3300025910 Bacteria 8097
252 Ga0207684_10021082 3300025910 Bacteria 5564
253 Ga0207684_10027856 3300025910 Bacteria 4813
254 Ga0207684_10126378 3300025910 Bacteria 2194
255 Ga0207684_10424447 3300025910 Bacteria 1142
256 Ga0207707_11559912 3300025912 Bacteria 521
257 Ga0207695_10104798 3300025913 Bacteria 2816
258 Ga0207695_10184944 3300025913 Bacteria 2003
259 Ga0207695_10861390 3300025913 Bacteria 786
260 Ga0207671_10094363 3300025914 Bacteria 2258
261 Ga0207671_10767804 3300025914 Bacteria 765
262 Ga0207671_11231216 3300025914 Bacteria 585
263 Ga0207693_10043266 3300025915 Bacteria 3543
264 Ga0207693_10118572 3300025915 Bacteria 2078
265 Ga0207693_10159441 3300025915 Bacteria 1775
266 Ga0207693_10413993 3300025915 Bacteria 1054
267 Ga0207663_10026105 3300025916 Bacteria 3387
268 Ga0207663_10076628 3300025916 Bacteria 2174
269 Ga0207663_10125904 3300025916 Bacteria 1762
270 Ga0207663_10465398 3300025916 Bacteria 977
271 Ga0207663_10496103 3300025916 Bacteria 948
272 Ga0207663_10546106 3300025916 Bacteria 905
273 Ga0207660_10288355 3300025917 Bacteria 1305
274 Ga0207662_10723882 3300025918 Bacteria 698
275 Ga0207662_10876025 3300025918 Bacteria 635
276 Ga0207652_10032823 3300025921 Bacteria 4368
277 Ga0207646_10001996 3300025922 Bacteria 24533
278 Ga0207646_10016678 3300025922 Bacteria 6889
279 Ga0207646_10093840 3300025922 Bacteria 2687
280 Ga0207646_10242931 3300025922 Bacteria 1627
281 Ga0207646_10317494 3300025922 Bacteria 1408
282 Ga0207646_10669651 3300025922 Bacteria 929
283 Ga0207681_10887101 3300025923 Bacteria 747
284 Ga0207694_10482770 3300025924 Bacteria 1037
285 Ga0207687_10777486 3300025927 Bacteria 816
286 Ga0207700_10002600 3300025928 Bacteria 10384
287 Ga0207700_10067895 3300025928 Bacteria 2731
288 Ga0207700_10167004 3300025928 Bacteria 1832
289 Ga0207700_10220042 3300025928 Bacteria 1609
290 Ga0207664_10482958 3300025929 Bacteria 1108
291 Ga0207686_10250328 3300025934 Bacteria 1294
292 Ga0207686_10698442 3300025934 Bacteria 806
293 Ga0207670_10288920 3300025936 Bacteria 1280
294 Ga0207670_10384233 3300025936 Bacteria 1119
295 Ga0207670_10954623 3300025936 Bacteria 720
296 Ga0207670_11160662 3300025936 Bacteria 653
297 Ga0207665_10005811 3300025939 Bacteria 8207
298 Ga0207665_10031807 3300025939 Bacteria 3492
299 Ga0207665_10090757 3300025939 Bacteria 2117
300 Ga0207665_10135097 3300025939 Bacteria 1754
301 Ga0207665_10138823 3300025939 Bacteria 1731
302 Ga0207665_10559080 3300025939 Bacteria 890
303 Ga0207665_10695306 3300025939 Bacteria 799
304 Ga0207691_10479356 3300025940 Bacteria 1057
305 Ga0207711_10306284 3300025941 Bacteria 1466
306 Ga0207689_10183463 3300025942 Bacteria 1726
307 Ga0207689_10612955 3300025942 Bacteria 916
308 Ga0207661_10938254 3300025944 Bacteria 797
309 Ga0207661_11042659 3300025944 Bacteria 753
310 Ga0207651_10788706 3300025960 Bacteria 842
311 Ga0207651_11330940 3300025960 Bacteria 646
312 Ga0207651_11465341 3300025960 Bacteria 615
313 Ga0207677_10206493 3300026023 Bacteria 1565
314 Ga0207703_10017399 3300026035 Bacteria 5611
315 Ga0207702_11581631 3300026078 Bacteria 649
316 Ga0207641_10006158 3300026088 Bacteria 10152
317 Ga0207641_10924854 3300026088 Bacteria 867
318 Ga0207641_12459694 3300026088 Bacteria 519
319 Ga0207648_10286078 3300026089 Bacteria 1475
320 Ga0207648_10339454 3300026089 Bacteria 1352
321 Ga0207676_11250965 3300026095 Bacteria 736
322 Ga0207675_100097252 3300026118 Bacteria 2772
323 Ga0207683_10030943 3300026121 Bacteria 4642
324 Ga0209179_1017684 3300027512 Bacteria 1354
325 Ga0209179_1030480 3300027512 Bacteria 1103
326 Ga0209588_1009968 3300027671 Bacteria 2850
327 Ga0209588_1013299 3300027671 Bacteria 2509
328 Ga0209588_1023729 3300027671 Bacteria 1935
329 Ga0207428_10687091 3300027907 Bacteria 733
330 Ga0265354_1000344 3300028016 Bacteria 8226
331 Ga0268266_10000259 3300028379 Bacteria 88660
332 Ga0268266_10016375 3300028379 Bacteria 6339
333 Ga0268264_10016281 3300028381 Bacteria 6088
334 Ga0268264_10019364 3300028381 Bacteria 5563
335 Ga0265326_10057163 3300028558 Bacteria 1104
336 Ga0265319_1000006 3300028563 Bacteria 228868
337 Ga0265319_1004383 3300028563 Bacteria 6996
338 Ga0265319_1005558 3300028563 Bacteria 6010
339 Ga0265319_1025804 3300028563 Bacteria 2099
340 Ga0265334_10062672 3300028573 Bacteria 1399
341 Ga0265318_10000466 3300028577 Bacteria 30068
342 Ga0265318_10002149 3300028577 Bacteria 10711
343 Ga0265322_10079760 3300028654 Bacteria 929
344 Ga0265336_10026034 3300028666 Bacteria 1839
345 Ga0265338_10051864 3300028800 Bacteria 3688
346 Ga0265338_10065699 3300028800 Bacteria 3144
347 Ga0265338_10070235 3300028800 Bacteria 3004
348 Ga0265338_10219663 3300028800 Bacteria 1420
349 Ga0265338_10426682 3300028800 Bacteria 942
350 Ga0265338_10650042 3300028800 Bacteria 731
351 Ga0265338_10912176 3300028800 Bacteria 598
352 Ga0311001_1083056 3300029277 Bacteria 1199
353 Ga0310981_1060993 3300029285 Bacteria 1104
354 Ga0265324_10325219 3300029957 Bacteria 524
355 Ga0265770_1003693 3300030878 Bacteria 2080
356 Ga0265765_1006543 3300030879 Bacteria 1242
357 Ga0265764_102136 3300030882 Bacteria 944
358 Ga0265773_1001638 3300031018 Bacteria 1243
359 Ga0265760_10000026 3300031090 Bacteria 63601
360 Ga0265760_10019572 3300031090 Bacteria 1951
361 Ga0265760_10021342 3300031090 Bacteria 1873
362 Ga0265760_10051624 3300031090 Bacteria 1239
363 Ga0265330_10044087 3300031235 Bacteria 1971
364 Ga0265332_10011115 3300031238 Bacteria 4001
365 Ga0265332_10125373 3300031238 Bacteria 1078
366 Ga0265328_10048044 3300031239 Bacteria 1568
367 Ga0265328_10154371 3300031239 Bacteria 864
368 Ga0265328_10189103 3300031239 Bacteria 780
369 Ga0265328_10192958 3300031239 Bacteria 772
370 Ga0265320_10001540 3300031240 Bacteria 16675
371 Ga0265320_10033071 3300031240 Bacteria 2642
372 Ga0265320_10354462 3300031240 Bacteria 648
373 Ga0265325_10012503 3300031241 Bacteria 4853
374 Ga0265325_10111536 3300031241 Bacteria 1328
375 Ga0265329_10004500 3300031242 Bacteria 5784
376 Ga0265329_10006079 3300031242 Bacteria 4821
377 Ga0265329_10008477 3300031242 Bacteria 3895
378 Ga0265329_10100232 3300031242 Bacteria 922
379 Ga0265340_10017605 3300031247 Bacteria 3696
380 Ga0265340_10102258 3300031247 Bacteria 1331
381 Ga0265339_10001807 3300031249 Bacteria 15694
382 Ga0265331_10000025 3300031250 Bacteria 229346
383 Ga0265331_10002674 3300031250 Bacteria 11903
384 Ga0265331_10016846 3300031250 Bacteria 3825
385 Ga0265331_10277030 3300031250 Bacteria 752
386 Ga0265316_10000784 3300031344 Bacteria 35048
387 Ga0265316_10001106 3300031344 Bacteria 29252
388 Ga0265316_10031378 3300031344 Bacteria 4346
389 Ga0265316_10124722 3300031344 Bacteria 1943
390 Ga0265316_10357170 3300031344 Bacteria 1057
391 Ga0265316_10612981 3300031344 Bacteria 771
392 Ga0307509_10043415 3300031507 Bacteria 4865
393 Ga0307408_100071079 3300031548 Bacteria 2572
394 Ga0265313_10001605 3300031595 Bacteria 21001
395 Ga0265313_10018591 3300031595 Bacteria 3896
396 Ga0265313_10102933 3300031595 Bacteria 1265
397 Ga0265313_10156241 3300031595 Bacteria 971
398 Ga0316575_10108542 3300031665 Bacteria 1132
399 Ga0316579_10019575 3300031691 Bacteria 2992
400 Ga0316579_10033104 3300031691 Bacteria 2372
401 Ga0316579_10057060 3300031691 Bacteria 1834
402 Ga0316579_10102736 3300031691 Bacteria 1369
403 Ga0316579_10109614 3300031691 Bacteria 1325
404 Ga0316579_10254432 3300031691 Bacteria 849
405 Ga0265314_10000087 3300031711 Bacteria 138681
406 Ga0265314_10038233 3300031711 Bacteria 3470
407 Ga0265314_10063634 3300031711 Bacteria 2502
408 Ga0265314_10118535 3300031711 Bacteria 1670
409 Ga0265342_10000362 3300031712 Bacteria 50260
410 Ga0265342_10026417 3300031712 Bacteria 3638
411 Ga0265342_10038414 3300031712 Bacteria 2916
412 Ga0316576_10000859 3300031727 Bacteria 15370
413 Ga0316576_10050533 3300031727 Bacteria 3024
414 Ga0316576_10114440 3300031727 Bacteria 2023
415 Ga0316576_10277870 3300031727 Bacteria 1254
416 Ga0316576_10341683 3300031727 Bacteria 1115
417 Ga0316576_10419265 3300031727 Bacteria 991
418 Ga0316576_10447642 3300031727 Bacteria 954
419 Ga0316576_10453360 3300031727 Bacteria 947
420 Ga0316576_10495153 3300031727 Bacteria 899
421 Ga0316576_10631927 3300031727 Bacteria 780
422 Ga0316576_10849366 3300031727 Bacteria 655
423 Ga0316576_11060207 3300031727 Bacteria 576
424 Ga0316578_10000241 3300031728 Bacteria 16205
425 Ga0316578_10004865 3300031728 Bacteria 6418
426 Ga0316578_10022633 3300031728 Bacteria 3507
427 Ga0316578_10105859 3300031728 Bacteria 1688
428 Ga0316578_10395493 3300031728 Bacteria 819
429 Ga0307405_10222748 3300031731 Bacteria 1385
430 Ga0316577_10000447 3300031733 Bacteria 16151
431 Ga0307413_10748047 3300031824 Bacteria 817
432 Ga0307410_10231950 3300031852 Bacteria 1426
433 Ga0307406_10062091 3300031901 Bacteria 2416
434 Ga0307406_11341423 3300031901 Bacteria 625
435 Ga0307407_10357030 3300031903 Bacteria 1037
436 Ga0307412_10845582 3300031911 Bacteria 798
437 Ga0307409_100265902 3300031995 Bacteria 1577
438 Ga0307409_101197534 3300031995 Bacteria 783
439 Ga0307416_100407877 3300032002 Bacteria 1399
440 Ga0307416_100951267 3300032002 Bacteria 961
441 Ga0307414_12323689 3300032004 Bacteria 501
442 Ga0307411_11352474 3300032005 Bacteria 650
443 Ga0307411_11786736 3300032005 Bacteria 570
444 Ga0316053_104592 3300032120 Bacteria 855
445 Ga0307415_100241717 3300032126 Bacteria 1461
446 Ga0316583_10000319 3300032133 Bacteria 13537
447 Ga0316583_10305313 3300032133 Bacteria 550
448 Ga0316585_10004899 3300032137 Bacteria 3761
449 Ga0316585_10111936 3300032137 Bacteria 897
450 Ga0316580_10002598 3300032139 Bacteria 5004
451 Ga0316580_10102712 3300032139 Bacteria 875
452 Ga0316593_10000417 3300032168 Bacteria 7701
453 Ga0316593_10000589 3300032168 Bacteria 6877
454 Ga0316593_10000698 3300032168 Bacteria 6551
455 Ga0316593_10000765 3300032168 Bacteria 6363
456 Ga0316593_10001578 3300032168 Bacteria 5079
457 Ga0316593_10001601 3300032168 Bacteria 5053
458 Ga0316593_10001733 3300032168 Bacteria 4942
459 Ga0316593_10003549 3300032168 Bacteria 3891
460 Ga0316593_10004947 3300032168 Bacteria 3470
461 Ga0316593_10008436 3300032168 Bacteria 2873
462 Ga0316593_10018658 3300032168 Bacteria 2135
463 Ga0316593_10019627 3300032168 Bacteria 2091
464 Ga0316593_10032306 3300032168 Bacteria 1709
465 Ga0316593_10058392 3300032168 Bacteria 1315
466 Ga0316593_10062765 3300032168 Bacteria 1273
467 Ga0316593_10064218 3300032168 Bacteria 1260
468 Ga0316593_10067967 3300032168 Bacteria 1229
469 Ga0316593_10094507 3300032168 Bacteria 1055
470 Ga0316593_10095358 3300032168 Bacteria 1051
471 Ga0316593_10108047 3300032168 Bacteria 992
472 Ga0316593_10341679 3300032168 Bacteria 572
473 Ga0316593_10386520 3300032168 Bacteria 539
474 Ga0316592_1000662 3300033524 Bacteria 5022
475 Ga0316592_1000955 3300033524 Bacteria 4438
476 Ga0316592_1001027 3300033524 Bacteria 4334
477 Ga0316592_1001802 3300033524 Bacteria 3568
478 Ga0316592_1002156 3300033524 Bacteria 3355
479 Ga0316592_1002445 3300033524 Bacteria 3211
480 Ga0316592_1007962 3300033524 Bacteria 2080
481 Ga0316592_1039484 3300033524 Bacteria 1043
482 Ga0316592_1054794 3300033524 Bacteria 892
483 Ga0316592_1067077 3300033524 Bacteria 809
484 Ga0316592_1099061 3300033524 Bacteria 670
485 Ga0316592_1126026 3300033524 Bacteria 596
486 Ga0316592_1145451 3300033524 Bacteria 558
487 Ga0316586_1000181 3300033527 Bacteria 5262
488 Ga0316586_1000255 3300033527 Bacteria 4665
489 Ga0316586_1008483 3300033527 Bacteria 1525
490 Ga0316586_1008737 3300033527 Bacteria 1506
491 Ga0316586_1071432 3300033527 Bacteria 640
492 Ga0316588_1000659 3300033528 Bacteria 5008
493 Ga0316588_1000759 3300033528 Bacteria 4790
494 Ga0316588_1000948 3300033528 Bacteria 4477
495 Ga0316588_1001353 3300033528 Bacteria 3982
496 Ga0316588_1001472 3300033528 Bacteria 3874
497 Ga0316588_1002494 3300033528 Bacteria 3210
498 Ga0316588_1005683 3300033528 Bacteria 2447
499 Ga0316588_1013709 3300033528 Bacteria 1763
500 Ga0316588_1029418 3300033528 Bacteria 1284
501 Ga0316588_1149495 3300033528 Bacteria 599
502 Ga0316587_1000871 3300033529 Bacteria 3412
503 Ga0316587_1001166 3300033529 Bacteria 3129
504 Ga0316587_1002730 3300033529 Bacteria 2393
505 Ga0316587_1019796 3300033529 Bacteria 1140
506 Ga0316587_1022964 3300033529 Bacteria 1072
507 Ga0316587_1025453 3300033529 Bacteria 1028
508 Ga0316587_1025912 3300033529 Bacteria 1020
509 Ga0316587_1044150 3300033529 Bacteria 809
510 Ga0316587_1054006 3300033529 Bacteria 739
511 Ga0316587_1095463 3300033529 Bacteria 570
512 Ga0316596_1000015 3300033541 Bacteria 16015
513 Ga0316596_1000019 3300033541 Bacteria 14934
514 Ga0316596_1000051 3300033541 Bacteria 12718
515 Ga0316596_1003186 3300033541 Bacteria 3575
516 Ga0316596_1003324 3300033541 Bacteria 3511
517 Ga0316596_1003362 3300033541 Bacteria 3499
518 Ga0316596_1004711 3300033541 Bacteria 3079
519 Ga0316596_1004760 3300033541 Bacteria 3065
520 Ga0316596_1014132 3300033541 Bacteria 1977
521 Ga0316596_1038286 3300033541 Bacteria 1256
522 Ga0316596_1040097 3300033541 Bacteria 1229
523 Ga0316596_1052486 3300033541 Bacteria 1081
524 Ga0316596_1087267 3300033541 Bacteria 840
525 Ga0316596_1090373 3300033541 Bacteria 825
526 Ga0316596_1106758 3300033541 Bacteria 759
527 Ga0316596_1110717 3300033541 Bacteria 745
528 Ga0316596_1166113 3300033541 Bacteria 608
529 Ga0316212_1002571 3300033547 Bacteria 2593
530 Ga0316212_1006236 3300033547 Bacteria 1729
531 Ga0373926_0174374 3300035083 Bacteria 823
532 Ga0373934_0116127 3300035086 Bacteria 1087
533 Ga0373934_0224577 3300035086 Bacteria 775
534 Ga0373923_0021564 3300035111 Bacteria 2516
535 Ga0373923_0105810 3300035111 Bacteria 1245
536 Ga0373932_0362169 3300035112 Bacteria 554
537 Ga0373953_0012646 3300035117 Bacteria 2995
538 Ga0373953_0249313 3300035117 Bacteria 772
539 Ga0373954_0004146 3300035118 Bacteria 6209
540 Ga0373954_0054945 3300035118 Bacteria 1873
541 Ga0373956_0001921 3300035119 Bacteria 8573
542 Ga0373956_0262775 3300035119 Bacteria 821
543 Ga0373956_0588856 3300035119 Bacteria 531
544 Ga0373957_0000289 3300035120 Bacteria 12644
545 Ga0373946_0041980 3300035171 Bacteria 1878
546 Ga0373946_0104855 3300035171 Bacteria 1272
547 Ga0373955_0005175 3300035172 Bacteria 5836
548 Ga0373955_0158603 3300035172 Bacteria 1334
549 Ga0373955_0353005 3300035172 Bacteria 891
550 Ga0373955_0582717 3300035172 Bacteria 685
551 Ga0316574_0129363 3300035398 Bacteria 1624
552 Ga0316574_0165133 3300035398 Bacteria 1426
553 Ga0373924_0036091 3300035410 Bacteria 2007
554 Ga0373931_0596196 3300035691 Bacteria 722
555 Ga0373935_0036026 3300035692 Bacteria 3091
556 Ga0373935_0482747 3300035692 Bacteria 898
557 Ga0373927_0014376 3300035695 Bacteria 5240
558 Ga0373927_0091563 3300035695 Bacteria 1975
559 Ga0373933_0008697 3300035724 Bacteria 5535
560 Ga0373933_0056998 3300035724 Bacteria 2347
561 Ga0373933_0746621 3300035724 Bacteria 644
562 Ga0373947_0000905 3300035725 Bacteria 17957
563 Ga0373947_0212700 3300035725 Bacteria 1269
564 Ga0373937_0024810 3300036401 Bacteria 5411
565 Ga0373937_0053565 3300036401 Bacteria 3700
566 Ga0373937_0185079 3300036401 Bacteria 1956
567 Ga0373937_0885021 3300036401 Bacteria 842
568 Ga0316582_0002761 3300036647 Bacteria 8355
569 Ga0316582_0010159 3300036647 Bacteria 5144
570 Ga0316582_0401048 3300036647 Bacteria 945
571 Ga0316582_1247372 3300036647 Bacteria 506
572 Ga0316584_0001067 3300036712 Bacteria 15995
573 Ga0316584_0027859 3300036712 Bacteria 4160
574 Ga0316584_0087558 3300036712 Bacteria 2331
575 Ga0316584_0167910 3300036712 Bacteria 1629
576 Ga0316584_0542668 3300036712 Bacteria 813
577 Ga0373925_0248932 3300037068 Bacteria 1425
578 Ga0373925_0571442 3300037068 Bacteria 930
579 Ga0395899_0007266 3300037312 Bacteria 8568
580 Ga0395899_0326214 3300037312 Bacteria 1033
581 Ga0395900_0037779 3300037418 Bacteria 4977
582 Ga0395900_0660692 3300037418 Bacteria 981
583 Ga0395900_0964913 3300037418 Bacteria 773
584 Ga0395898_0240331 3300037466 Bacteria 1727
585 Ga0395898_0684801 3300037466 Bacteria 967
586 Ga0395898_0958273 3300037466 Bacteria 792
587 Ga0395905_0000376 3300037471 Bacteria 63695
588 Ga0395905_0563765 3300037471 Bacteria 1040
589 Ga0395905_1233340 3300037471 Bacteria 651
590 Ga0395901_0116510 3300038443 Bacteria 2806
591 Ga0395901_0329662 3300038443 Bacteria 1578
592 Ga0395901_1495669 3300038443 Bacteria 631
593 Ga0400483_016634 3300039062 Bacteria 3272
594 Ga0400483_024254 3300039062 Bacteria 2169
595 Ga0400483_121213 3300039062 Bacteria 1059
596 Ga0400483_145883 3300039062 Bacteria 4531
597 Ga0400483_266032 3300039062 Bacteria 1622
598 Ga0436365_0074160 3300039437 Bacteria 506
599 Ga0436365_1256045 3300039437 Bacteria 3452
600 Ga0436361_0557259 3300039447 Bacteria 1151
601 Ga0436362_0113140 3300039453 Bacteria 598
602 Ga0436362_1100490 3300039453 Bacteria 850
603 Ga0451794_33567 3300041446 Bacteria 593
604 Ga0451795_0631926 3300041456 Bacteria 942
605 Ga0451805_008458 3300041461 Bacteria 653
606 Ga0451837_0887641 3300041494 Bacteria 727
607 Ga0451852_16322 3300041508 Bacteria 501
608 Ga0451843_1239513 3300041509 Bacteria 1088
609 Ga0451577_0000092 3300042876 Bacteria 198898
610 Ga0451577_0002251 3300042876 Bacteria 23422
611 Ga0451577_0017091 3300042876 Bacteria 6708
612 Ga0451577_0037725 3300042876 Bacteria 4349
613 Ga0451577_0155638 3300042876 Bacteria 2057
614 Ga0451577_0225538 3300042876 Bacteria 1694
615 Ga0451577_0239036 3300042876 Bacteria 1643
616 Ga0451577_0418106 3300042876 Bacteria 1217
617 Ga0451577_0898726 3300042876 Bacteria 797
618 Ga0451577_1002833 3300042876 Bacteria 750
619 Ga0451577_1273950 3300042876 Bacteria 654
620 Ga0453683_0000522 3300044673 Bacteria 43145
621 Ga0453683_0000935 3300044673 Bacteria 27791
622 Ga0453683_0006598 3300044673 Bacteria 7948
623 Ga0453683_0025793 3300044673 Bacteria 3731
624 Ga0453683_0028929 3300044673 Bacteria 3506
625 Ga0453683_0171760 3300044673 Bacteria 1373
626 Ga0453683_0310911 3300044673 Bacteria 1009
627 Ga0453683_0661052 3300044673 Bacteria 683
628 Ga0453683_1056882 3300044673 Bacteria 540
629 Ga0453684_0000432 3300044712 Bacteria 170746
630 Ga0453684_0001193 3300044712 Bacteria 80343
631 Ga0453684_0002324 3300044712 Bacteria 46610
632 Ga0453684_0048592 3300044712 Bacteria 5606
633 Ga0453684_0055571 3300044712 Bacteria 5146
634 Ga0453684_0058446 3300044712 Bacteria 4981
635 Ga0453684_0070061 3300044712 Bacteria 4443
636 Ga0453684_0073743 3300044712 Bacteria 4301
637 Ga0453684_0087736 3300044712 Bacteria 3854
638 Ga0453684_0141642 3300044712 Bacteria 2870
639 Ga0453684_0219846 3300044712 Bacteria 2201
640 Ga0453684_0267587 3300044712 Bacteria 1955
641 Ga0453684_0479027 3300044712 Bacteria 1381
642 Ga0453684_0589068 3300044712 Bacteria 1220
643 Ga0453684_1075362 3300044712 Bacteria 851
644 Ga0453684_1309569 3300044712 Bacteria 755
645 Ga0453684_2108582 3300044712 Bacteria 565
646 Ga0453684_2291792 3300044712 Bacteria 537
647 Ga0466968_0241135 3300044735 Bacteria 856
648 Ga0466957_0834350 3300044842 Bacteria 656
649 Ga0466957_1447120 3300044842 Bacteria 501
650 Ga0466960_0038323 3300044901 Bacteria 2253
651 Ga0466960_0110797 3300044901 Bacteria 1426
652 Ga0466960_0418190 3300044901 Bacteria 774
653 Ga0466960_0612666 3300044901 Bacteria 647
654 Ga0451576_0000003 3300045051 Bacteria 1550573
655 Ga0451576_0000113 3300045051 Bacteria 208644
656 Ga0451576_0001103 3300045051 Bacteria 49329
657 Ga0451576_0017828 3300045051 Bacteria 7799
658 Ga0451576_0067033 3300045051 Bacteria 3736
659 Ga0451576_0163274 3300045051 Bacteria 2324
660 Ga0451576_0208325 3300045051 Bacteria 2042
661 Ga0451576_0257261 3300045051 Bacteria 1825
662 Ga0451576_0524010 3300045051 Bacteria 1245
663 Ga0451576_0720739 3300045051 Bacteria 1048
664 Ga0451576_1642384 3300045051 Bacteria 666
665 Ga0466967_1001337 3300045976 Bacteria 832
666 Ga0495592_0000015 3300046454 Bacteria 145683
667 Ga0495592_0043671 3300046454 Bacteria 3352
668 Ga0495592_0051472 3300046454 Bacteria 3059
669 Ga0495592_0059446 3300046454 Bacteria 2815
670 Ga0495592_0116904 3300046454 Bacteria 1881
671 Ga0495592_0118228 3300046454 Bacteria 1868
672 Ga0495629_0491777 3300046459 Bacteria 828
673 Ga0495641_0147058 3300046461 Bacteria 1053
674 Ga0495651_0036587 3300046462 Bacteria 3822
675 Ga0495651_0055165 3300046462 Bacteria 3054
676 Ga0495651_0072417 3300046462 Bacteria 2617
677 Ga0495653_0014747 3300046463 Bacteria 6373
678 Ga0495653_0168461 3300046463 Bacteria 1514
679 Ga0495650_0000121 3300046471 Bacteria 183055
680 Ga0495580_0054728 3300046472 Bacteria 2813
681 Ga0495580_0258517 3300046472 Bacteria 1191
682 Ga0495582_0258942 3300046473 Bacteria 998
683 Ga0495639_0404316 3300046475 Bacteria 690
684 Ga0495639_0489934 3300046475 Bacteria 627
685 Ga0495662_0011984 3300046476 Bacteria 4237
686 Ga0495664_0060251 3300046477 Bacteria 2260
687 Ga0495664_0124483 3300046477 Bacteria 1559
688 Ga0495664_0133073 3300046477 Bacteria 1506
689 Ga0495594_0158317 3300046499 Bacteria 1287
690 Ga0495608_0008358 3300046511 Bacteria 7258
691 Ga0495608_0028526 3300046511 Bacteria 3793
692 Ga0495608_0082753 3300046511 Bacteria 2084
693 Ga0495618_0004868 3300046514 Bacteria 8201
694 Ga0495618_0247707 3300046514 Bacteria 1118
695 Ga0495618_0431316 3300046514 Bacteria 802
696 Ga0495628_0000140 3300046516 Bacteria 62202
697 Ga0495628_0001930 3300046516 Bacteria 18824
698 Ga0495628_0108928 3300046516 Bacteria 2132
699 Ga0495628_0131261 3300046516 Bacteria 1916
700 Ga0495628_0398014 3300046516 Bacteria 1006
701 Ga0495628_0894785 3300046516 Bacteria 616
702 Ga0495628_0983104 3300046516 Bacteria 581
703 Ga0495630_0004677 3300046517 Bacteria 9607
704 Ga0495630_0008269 3300046517 Bacteria 7472
705 Ga0495630_0052655 3300046517 Bacteria 3048
706 Ga0495630_0091375 3300046517 Bacteria 2300
707 Ga0495630_1530036 3300046517 Bacteria 500
708 Ga0495666_0051031 3300046526 Bacteria 1988
709 Ga0495666_0064047 3300046526 Bacteria 1755
710 Ga0495652_0014402 3300046529 Bacteria 7100
711 Ga0495652_0104883 3300046529 Bacteria 2285
712 Ga0495652_0186269 3300046529 Bacteria 1588
713 Ga0495652_0659315 3300046529 Bacteria 708
714 Ga0495665_0003304 3300046531 Bacteria 8738
715 Ga0495665_0498767 3300046531 Bacteria 613
716 Ga0495640_0016376 3300046533 Bacteria 5546
717 Ga0495640_0319729 3300046533 Bacteria 961
718 Ga0495640_0847254 3300046533 Bacteria 543
719 Ga0495586_0000942 3300046535 Bacteria 16500
720 Ga0495586_0035973 3300046535 Bacteria 2659
721 Ga0495586_0492190 3300046535 Bacteria 707
722 Ga0495587_0002155 3300046536 Bacteria 13171
723 Ga0495587_0020580 3300046536 Bacteria 4071
724 Ga0495645_0002009 3300046543 Bacteria 13855
725 Ga0495645_0121158 3300046543 Bacteria 1841
726 Ga0495645_0247946 3300046543 Bacteria 1185
727 Ga0495622_0509001 3300046557 Bacteria 514
728 Ga0495667_0017783 3300046559 Bacteria 4802
729 Ga0495667_0125252 3300046559 Bacteria 1658
730 Ga0495667_0359202 3300046559 Bacteria 920
731 Ga0495634_0081968 3300046642 Bacteria 2109
732 Ga0495635_0049231 3300046663 Bacteria 2904
733 Ga0495635_0131153 3300046663 Bacteria 1708
734 Ga0495635_0181088 3300046663 Bacteria 1432
735 Ga0495588_0270336 3300046674 Bacteria 895
736 Ga0495657_0066320 3300046675 Bacteria 2371
737 Ga0495657_0110556 3300046675 Bacteria 1741
738 Ga0495657_0151267 3300046675 Bacteria 1441
739 Ga0495657_0335417 3300046675 Bacteria 897
740 Ga0495599_0021784 3300046678 Bacteria 4000
741 Ga0495599_0098721 3300046678 Bacteria 1820
742 Ga0495599_0177850 3300046678 Bacteria 1312
743 Ga0495623_0015674 3300046679 Bacteria 4898
744 Ga0495623_0137933 3300046679 Bacteria 1454
745 Ga0495623_0269529 3300046679 Bacteria 951
746 Ga0495646_0014717 3300046680 Bacteria 4972
747 Ga0495646_0046689 3300046680 Bacteria 2639
748 Ga0495658_0002307 3300046683 Bacteria 9627
749 Ga0495658_0091811 3300046683 Bacteria 1799
750 Ga0495613_0180121 3300046689 Bacteria 1497
751 Ga0495613_0253462 3300046689 Bacteria 1228
752 Ga0495624_0016372 3300046690 Bacteria 4990
753 Ga0495624_0146504 3300046690 Bacteria 1445
754 Ga0495600_0303358 3300046809 Bacteria 1007
755 Ga0495600_0378201 3300046809 Bacteria 884
756 Ga0495604_0002807 3300047317 Bacteria 13979
757 Ga0495604_0019334 3300047317 Bacteria 5452
758 Ga0495604_0081209 3300047317 Bacteria 2427
759 Ga0495604_0270715 3300047317 Bacteria 1151
760 Ga0495604_0506652 3300047317 Bacteria 782
761 Ga0495674_0000992 3300047319 Bacteria 27284
762 Ga0495674_0015976 3300047319 Bacteria 7007
763 Ga0495674_0049324 3300047319 Bacteria 3721
764 Ga0495674_0072689 3300047319 Bacteria 2966
765 Ga0495674_0213133 3300047319 Bacteria 1599
766 Ga0495676_0026951 3300047321 Bacteria 4936
767 Ga0495680_0010376 3300047322 Bacteria 8313
768 Ga0495680_0037174 3300047322 Bacteria 3902
769 Ga0495680_0134879 3300047322 Bacteria 1811
770 Ga0495680_0161336 3300047322 Bacteria 1628
771 Ga0495675_0002873 3300047444 Bacteria 10333
772 Ga0495675_0004854 3300047444 Bacteria 8180
773 Ga0495684_0005513 3300047471 Bacteria 9853
774 Ga0495684_0036919 3300047471 Bacteria 3746
775 Ga0495684_0077651 3300047471 Bacteria 2520
776 Ga0495684_0111921 3300047471 Bacteria 2059
777 Ga0495593_0010826 3300047673 Bacteria 5259
778 Ga0495602_0090783 3300048088 Bacteria 2536
779 Ga0495602_0126705 3300048088 Bacteria 2044
780 Ga0495602_0262442 3300048088 Bacteria 1280
781 Ga0495614_0058406 3300048089 Bacteria 1656
782 Ga0495614_0174547 3300048089 Bacteria 965
783 Ga0495615_0283139 3300048090 Bacteria 533
784 Ga0496102_0463485 3300048905 Bacteria 1188
785 Ga0496103_0358492 3300048906 Bacteria 937
786 Ga0496104_0639534 3300048907 Bacteria 973
787 Ga0496104_1690417 3300048907 Bacteria 535
788 Ga0496107_0590638 3300048910 Bacteria 821
789 Ga0496107_0630963 3300048910 Bacteria 791
790 Ga0496109_1297456 3300048912 Bacteria 664
791 Ga0496112_0000516 3300048915 Bacteria 26268
792 Ga0496112_0256546 3300048915 Bacteria 1699
793 Ga0496112_0394878 3300048915 Bacteria 1323
794 Ga0496113_0032155 3300048916 Bacteria 3812
795 Ga0496115_0333657 3300048918 Bacteria 1239
796 Ga0496115_0730131 3300048918 Bacteria 776
797 Ga0496119_0381322 3300048922 Bacteria 676
798 Ga0496121_0006505 3300048924 Bacteria 14454
799 Ga0496125_0004021 3300048928 Bacteria 17262
800 Ga0496125_0010850 3300048928 Bacteria 9171
801 Ga0501306_003070 3300049127 Bacteria 1770
802 Ga0501306_104614 3300049127 Bacteria 509
803 Ga0501308_007513 3300049128 Bacteria 1143
804 Ga0501308_034137 3300049128 Bacteria 694
805 Ga0501308_052445 3300049128 Bacteria 600
806 Ga0501309_064488 3300049129 Bacteria 594
807 Ga0501304_001315 3300049160 Bacteria 1570
808 Ga0501305_116230 3300049161 Bacteria 510
809 Ga0501305_116248 3300049161 Bacteria 510
810 Ga0501307_018937 3300049162 Bacteria 879
811 Ga0501292_042392 3300049515 Bacteria 789
812 Ga0501311_026839 3300049527 Bacteria 814
813 Ga0501311_032212 3300049527 Bacteria 764
814 Ga0501312_045365 3300049528 Bacteria 728
815 Ga0501313_031423 3300049529 Bacteria 690
816 Ga0501318_084511 3300049534 Bacteria 518
817 Ga0501319_031007 3300049535 Bacteria 514
818 Ga0501320_030333 3300049536 Bacteria 670
819 Ga0501320_036925 3300049536 Bacteria 628
820 Ga0501320_066742 3300049536 Bacteria 514
821 Ga0501031_0009956 3300049568 Bacteria 6190
822 Ga0501032_0199597 3300049569 Bacteria 1305
823 Ga0501033_0029262 3300049570 Bacteria 4139
824 Ga0501034_0095132 3300049571 Bacteria 2975
825 Ga0501034_0408012 3300049571 Bacteria 1281
826 Ga0501034_0990356 3300049571 Bacteria 725
827 Ga0501036_0014384 3300049572 Bacteria 6589
828 Ga0501037_0108066 3300049573 Bacteria 2004
829 Ga0501038_0005590 3300049574 Bacteria 11667
830 Ga0501038_1259750 3300049574 Bacteria 535
831 Ga0501039_0121352 3300049575 Bacteria 2048
832 Ga0501040_0359091 3300049576 Bacteria 1044
833 Ga0501043_0440364 3300049579 Bacteria 980
834 Ga0501043_0695671 3300049579 Bacteria 743
835 Ga0501046_0034880 3300049580 Bacteria 4057
836 Ga0501046_0778081 3300049580 Bacteria 671
837 Ga0501047_0308480 3300049581 Bacteria 1423
838 Ga0501048_0008581 3300049582 Bacteria 7716
839 Ga0501048_0169189 3300049582 Bacteria 1548
840 Ga0501067_0006705 3300049583 Bacteria 6392
841 Ga0501067_0009843 3300049583 Bacteria 5294
842 Ga0501067_0391562 3300049583 Bacteria 775
843 Ga0501069_0090513 3300049585 Bacteria 1730
844 Ga0501071_0061932 3300049587 Bacteria 2710
845 Ga0501071_0477217 3300049587 Bacteria 956
846 Ga0501071_0988280 3300049587 Bacteria 650
847 Ga0501072_1174545 3300049588 Bacteria 596
848 Ga0501073_0159025 3300049589 Bacteria 1565
849 Ga0501074_0013273 3300049590 Bacteria 5989
850 Ga0501074_0130988 3300049590 Bacteria 1794
851 Ga0501074_0146862 3300049590 Bacteria 1686
852 Ga0501075_0220466 3300049591 Bacteria 1447
853 Ga0501075_0469804 3300049591 Bacteria 959
854 Ga0501077_0230973 3300049593 Bacteria 1176
855 Ga0501242_026540 3300049674 Bacteria 767
856 Ga0501257_097188 3300049686 Bacteria 770
857 Ga0501079_0665848 3300049741 Bacteria 819
858 Ga0501079_1217808 3300049741 Bacteria 593
859 Ga0501080_0191461 3300049742 Bacteria 1879
860 Ga0501080_1091273 3300049742 Bacteria 689
861 Ga0501083_0041703 3300049744 Bacteria 3112
862 Ga0501083_0520694 3300049744 Bacteria 774
863 Ga0501035_0040785 3300049822 Bacteria 4193
864 Ga0501035_1115667 3300049822 Bacteria 615
865 Ga0501044_0013375 3300049823 Bacteria 8874
866 Ga0501044_0078916 3300049823 Bacteria 3336
867 Ga0501045_1230145 3300049824 Bacteria 546
868 nmdc:mga06z11_301313_c1 3300050494 Bacteria 953
869 nmdc:mga05p37_1927286_c1 3300050507 Bacteria 563
870 nmdc:mga09592_172694_c1 3300050508 Bacteria 1869
871 nmdc:mga09592_185333_c1 3300050508 Bacteria 1801
872 nmdc:mga09592_458615_c1 3300050508 Bacteria 1099
873 nmdc:mga09592_926227_c1 3300050508 Unclassified 731
874 nmdc:mga0qj67_281355_c1 3300050509 Bacteria 1348
875 nmdc:mga0qj67_3985_c2 3300050509 Bacteria 4055
876 nmdc:mga06r32_268624_c1 3300050510 Bacteria 1693
877 nmdc:mga06r32_319969_c1 3300050510 Bacteria 1537
878 nmdc:mga06r32_54362_c1 3300050510 Bacteria 3839
879 nmdc:mga08y16_18794_c1 3300050511 Bacteria 7281
880 nmdc:mga08y16_468499_c1 3300050511 Bacteria 1283
881 nmdc:mga08y16_932106_c1 3300050511 Bacteria 853
882 nmdc:mga0n895_2004878_c1 3300050512 Bacteria 536
883 nmdc:mga0rr50_382368_c1 3300050513 Bacteria 1187
884 nmdc:mga08x19_22048_c1 3300050514 Bacteria 3940
885 nmdc:mga0a205_116758_c1 3300050515 Bacteria 2567
886 nmdc:mga0a205_232987_c1 3300050515 Bacteria 1724
887 nmdc:mga0a205_602712_c1 3300050515 Bacteria 951
888 nmdc:mga0a205_69251_c1 3300050515 Bacteria 3408
889 nmdc:mga0a205_968698_c1 3300050515 Bacteria 697
890 Ga0495601_0230599 3300053077 Bacteria 1209
891 Ga0495601_0394008 3300053077 Bacteria 898
892 Ga0495612_0328643 3300053078 Bacteria 688
893 Ga0495595_0156992 3300053084 Bacteria 1121
894 Ga0495595_0197946 3300053084 Bacteria 1000
895 Ga0495619_0010291 3300053085 Bacteria 5888
896 Ga0501084_0045171 3300054114 Bacteria 3689
897 Ga0501084_0824520 3300054114 Bacteria 781
898 Ga0501084_1281179 3300054114 Bacteria 614
899 Ga0587080_081379 3300059503 Bacteria 665
900 Ga0587086_030397 3300059507 Bacteria 791
901 Ga0587090_127125 3300059510 Bacteria 558
902 Ga0587109_133264 3300059624 Bacteria 601
903 Ga0587062_081960 3300059639 Bacteria 601
904 Ga0587072_134023 3300059643 Bacteria 585
905 Ga0587072_201303 3300059643 Bacteria 506
906 Ga0587078_078141 3300059646 Bacteria 527
907 Ga0501082_0142204 3300060353 Bacteria 2082

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_1495669 Ga0395901_1495669_13_354 104
2 3300044901 Ga0466960_0418190 Ga0466960_0418190_12_353 104
3 3300044901 Ga0466960_0612666 Ga0466960_0612666_285_626 104
4 3300048907 Ga0496104_1690417 Ga0496104_1690417_18_359 104
5 3300048922 Ga0496119_0381322 Ga0496119_0381322_187_528 104
6 3300049741 Ga0501079_1217808 Ga0501079_1217808_13_345 110
7 3300049824 Ga0501045_1230145 Ga0501045_1230145_32_406 110
8 3300049576 Ga0501040_0359091 Ga0501040_0359091_505_885 112
9 3300049591 Ga0501075_0469804 Ga0501075_0469804_274_654 112
10 3300054114 Ga0501084_0824520 Ga0501084_0824520_289_669 112
11 3300009092 Ga0105250_10425161 Ga0105250_104251612 113
12 3300005437 Ga0070710_11159375 Ga0070710_111593752 115
13 3300046674 Ga0495588_0270336 Ga0495588_0270336_16_390 115
14 3300048910 Ga0496107_0630963 Ga0496107_0630963_404_778 115
15 3300031728 Ga0316578_10105859 Ga0316578_101058591 116
16 3300032168 Ga0316593_10064218 Ga0316593_100642181 116
17 3300049536 Ga0501320_030333 Ga0501320_030333_257_607 116
18 3300005434 Ga0070709_10068471 Ga0070709_100684713 119
19 3300005436 Ga0070713_100428436 Ga0070713_1004284361 119
20 3300005437 Ga0070710_10043474 Ga0070710_100434743 119
21 3300005467 Ga0070706_100027065 Ga0070706_1000270654 119
22 3300005467 Ga0070706_100233626 Ga0070706_1002336261 119
23 3300005471 Ga0070698_100480315 Ga0070698_1004803151 119
24 3300005471 Ga0070698_100911535 Ga0070698_1009115351 119
25 3300005530 Ga0070679_100024467 Ga0070679_1000244673 119
26 3300005545 Ga0070695_100027795 Ga0070695_1000277954 119
27 3300005546 Ga0070696_100003003 Ga0070696_1000030037 119
28 3300005547 Ga0070693_100000994 Ga0070693_1000009944 119
29 3300005549 Ga0070704_100003283 Ga0070704_1000032833 119
30 3300005843 Ga0068860_100509204 Ga0068860_1005092042 119
31 3300006163 Ga0070715_10208809 Ga0070715_102088091 119
32 3300006163 Ga0070715_10212958 Ga0070715_102129581 119
33 3300006175 Ga0070712_100351408 Ga0070712_1003514082 119
34 3300006358 Ga0068871_100022756 Ga0068871_1000227562 119
35 3300006871 Ga0075434_100084572 Ga0075434_1000845724 119
36 3300006881 Ga0068865_100072446 Ga0068865_1000724462 119
37 3300006881 Ga0068865_100712783 Ga0068865_1007127832 119
38 3300007076 Ga0075435_100140998 Ga0075435_1001409983 119
39 3300007076 Ga0075435_100805145 Ga0075435_1008051452 119
40 3300007076 Ga0075435_101405799 Ga0075435_1014057992 119
41 3300007265 Ga0099794_10113447 Ga0099794_101134472 119
42 3300007788 Ga0099795_10030072 Ga0099795_100300722 119
43 3300007788 Ga0099795_10086438 Ga0099795_100864381 119
44 3300009101 Ga0105247_10279487 Ga0105247_102794872 119
45 3300009177 Ga0105248_11056173 Ga0105248_110561731 119
46 3300009177 Ga0105248_11706920 Ga0105248_117069202 119
47 3300009545 Ga0105237_10072778 Ga0105237_100727783 119
48 3300010375 Ga0105239_10022622 Ga0105239_100226226 119
49 3300010375 Ga0105239_10544717 Ga0105239_105447172 119
50 3300013296 Ga0157374_10119097 Ga0157374_101190972 119
51 3300013297 Ga0157378_10000272 Ga0157378_1000027237 119
52 3300013297 Ga0157378_10010996 Ga0157378_100109963 119
53 3300013306 Ga0163162_10374288 Ga0163162_103742882 119
54 3300013306 Ga0163162_11107878 Ga0163162_111078781 119
55 3300013307 Ga0157372_10098714 Ga0157372_100987143 119
56 3300013308 Ga0157375_11315401 Ga0157375_113154011 119
57 3300014968 Ga0157379_10056214 Ga0157379_100562142 119
58 3300014969 Ga0157376_10000075 Ga0157376_1000007566 119
59 3300014969 Ga0157376_10002707 Ga0157376_100027073 119
60 3300025905 Ga0207685_10274449 Ga0207685_102744491 119
61 3300025906 Ga0207699_10175452 Ga0207699_101754521 119
62 3300025906 Ga0207699_10186348 Ga0207699_101863481 119
63 3300025916 Ga0207663_10076628 Ga0207663_100766281 119
64 3300025928 Ga0207700_10067895 Ga0207700_100678951 119
65 3300035086 Ga0373934_0116127 Ga0373934_0116127_160_522 119
66 3300035111 Ga0373923_0105810 Ga0373923_0105810_163_525 119
67 3300035117 Ga0373953_0012646 Ga0373953_0012646_2204_2566 119
68 3300035118 Ga0373954_0004146 Ga0373954_0004146_5228_5590 119
69 3300035119 Ga0373956_0001921 Ga0373956_0001921_3231_3593 119
70 3300035119 Ga0373956_0588856 Ga0373956_0588856_92_454 119
71 3300035120 Ga0373957_0000289 Ga0373957_0000289_6149_6511 119
72 3300035172 Ga0373955_0005175 Ga0373955_0005175_1302_1664 119
73 3300035692 Ga0373935_0482747 Ga0373935_0482747_440_802 119
74 3300035695 Ga0373927_0091563 Ga0373927_0091563_588_950 119
75 3300035724 Ga0373933_0008697 Ga0373933_0008697_311_673 119
76 3300036401 Ga0373937_0053565 Ga0373937_0053565_2661_3023 119
77 3300046454 Ga0495592_0043671 Ga0495592_0043671_2197_2559 119
78 3300046462 Ga0495651_0072417 Ga0495651_0072417_643_1005 119
79 3300046511 Ga0495608_0082753 Ga0495608_0082753_598_960 119
80 3300046514 Ga0495618_0431316 Ga0495618_0431316_397_759 119
81 3300046516 Ga0495628_0108928 Ga0495628_0108928_1279_1641 119
82 3300046529 Ga0495652_0186269 Ga0495652_0186269_526_888 119
83 3300046536 Ga0495587_0020580 Ga0495587_0020580_2318_2680 119
84 3300046675 Ga0495657_0151267 Ga0495657_0151267_531_893 119
85 3300046679 Ga0495623_0137933 Ga0495623_0137933_809_1171 119
86 3300046679 Ga0495623_0269529 Ga0495623_0269529_482_844 119
87 3300046809 Ga0495600_0303358 Ga0495600_0303358_216_578 119
88 3300047317 Ga0495604_0002807 Ga0495604_0002807_10512_10874 119
89 3300047471 Ga0495684_0111921 Ga0495684_0111921_549_911 119
90 3300048088 Ga0495602_0126705 Ga0495602_0126705_326_688 119
91 3300050513 nmdc:mga0rr50_382368_c1 nmdc:mga0rr50_382368_c1_634_996 119
92 3300050514 nmdc:mga08x19_22048_c1 nmdc:mga08x19_22048_c1_319_681 119
93 3300053084 Ga0495595_0156992 Ga0495595_0156992_156_518 119
94 3300053084 Ga0495595_0197946 Ga0495595_0197946_507_869 119
95 3300053085 Ga0495619_0010291 Ga0495619_0010291_2028_2390 119
96 3300028654 Ga0265322_10079760 Ga0265322_100797602 120
97 3300028800 Ga0265338_10065699 Ga0265338_100656993 120
98 3300046454 Ga0495592_0000015 Ga0495592_0000015_78347_78772 121
99 3300046476 Ga0495662_0011984 Ga0495662_0011984_1947_2372 121
100 3300046477 Ga0495664_0133073 Ga0495664_0133073_945_1370 121
101 3300046514 Ga0495618_0004868 Ga0495618_0004868_4906_5331 121
102 3300046516 Ga0495628_0000140 Ga0495628_0000140_8067_8492 121
103 3300046517 Ga0495630_0004677 Ga0495630_0004677_742_1167 121
104 3300046526 Ga0495666_0051031 Ga0495666_0051031_13_438 121
105 3300046533 Ga0495640_0016376 Ga0495640_0016376_2788_3213 121
106 3300046535 Ga0495586_0000942 Ga0495586_0000942_3389_3814 121
107 3300046543 Ga0495645_0002009 Ga0495645_0002009_10256_10681 121
108 3300046678 Ga0495599_0021784 Ga0495599_0021784_769_1194 121
109 3300046683 Ga0495658_0091811 Ga0495658_0091811_1147_1572 121
110 3300046690 Ga0495624_0146504 Ga0495624_0146504_711_1136 121
111 3300047319 Ga0495674_0000992 Ga0495674_0000992_10434_10859 121
112 3300049161 Ga0501305_116248 Ga0501305_116248_19_384 121
113 3300049536 Ga0501320_036925 Ga0501320_036925_250_618 121
114 3300053077 Ga0495601_0394008 Ga0495601_0394008_338_763 121
115 iso_pu_bacteria 2511231119 2511697993 121
116 iso_pu_bacteria 2545555800 2545559768 121
117 iso_pu_bacteria 2576861599 2578930725 121
118 iso_pu_bacteria 2630968484 2631982472 121
119 iso_pu_bacteria 2648501850 2651530336 121
120 iso_pu_bacteria 2671180844 2674421109 121
121 iso_pu_bacteria 2695420354 2695629913 121
122 iso_pu_bacteria 2716884898 2717918188 121
123 iso_pu_bacteria 2808606399 2809057194 121
124 iso_pu_bacteria 2816332295 2817478182 121
125 iso_pu_bacteria 2860837431 2860837572 121
126 iso_pu_bacteria 2877768649 2877768791 121
127 iso_pu_bacteria 2880169592 2880169733 121
128 iso_pu_bacteria 2897109615 2897109760 121
129 iso_pu_bacteria 2904560550 2904564582 121
130 iso_pu_bacteria 2962290636 2962290783 121
131 iso_pu_bacteria 2969136845 2969136990 121
132 iso_pu_bacteria 2969141011 2969141159 121
133 iso_pu_bacteria 2969765954 2969766261 121
134 iso_pu_bacteria 2969770375 2969774929 121
135 iso_pu_bacteria 2971893375 2971893520 121
136 iso_pu_bacteria 2980492589 2980492734 121
137 iso_pu_bacteria 3006858327 3006858510 121
138 iso_pu_bacteria 3006879489 3006883621 121
139 iso_pu_bacteria 8022630665 8022631648 121
140 iso_pu_bacteria 8022653035 8022655870 121
141 iso_pu_bacteria 8051952484 8051956503 121
142 iso_pu_bacteria 8052174270 8052174979 121
143 3300005439 Ga0070711_100045540 Ga0070711_1000455401 122
144 3300005439 Ga0070711_101221300 Ga0070711_1012213002 122
145 3300005440 Ga0070705_101040583 Ga0070705_1010405831 122
146 3300025915 Ga0207693_10118572 Ga0207693_101185723 122
147 3300025916 Ga0207663_10026105 Ga0207663_100261052 122
148 3300025934 Ga0207686_10250328 Ga0207686_102503282 122
149 3300026118 Ga0207675_100097252 Ga0207675_1000972523 122
150 3300028558 Ga0265326_10057163 Ga0265326_100571632 122
151 3300028563 Ga0265319_1000006 Ga0265319_1000006190 122
152 3300028563 Ga0265319_1005558 Ga0265319_10055587 122
153 3300028563 Ga0265319_1025804 Ga0265319_10258041 122
154 3300028577 Ga0265318_10002149 Ga0265318_100021492 122
155 3300028800 Ga0265338_10051864 Ga0265338_100518643 122
156 3300029957 Ga0265324_10325219 Ga0265324_103252191 122
157 3300031239 Ga0265328_10048044 Ga0265328_100480442 122
158 3300031240 Ga0265320_10033071 Ga0265320_100330713 122
159 3300031240 Ga0265320_10354462 Ga0265320_103544622 122
160 3300031344 Ga0265316_10357170 Ga0265316_103571702 122
161 3300031595 Ga0265313_10102933 Ga0265313_101029332 122
162 3300031595 Ga0265313_10156241 Ga0265313_101562411 122
163 3300031711 Ga0265314_10000087 Ga0265314_1000008744 122
164 3300031711 Ga0265314_10118535 Ga0265314_101185353 122
165 3300035112 Ga0373932_0362169 Ga0373932_0362169_110_478 122
166 3300035171 Ga0373946_0104855 Ga0373946_0104855_388_783 122
167 3300035725 Ga0373947_0212700 Ga0373947_0212700_177_572 122
168 3300036401 Ga0373937_0885021 Ga0373937_0885021_271_693 122
169 3300037068 Ga0373925_0248932 Ga0373925_0248932_662_1057 122
170 3300037312 Ga0395899_0326214 Ga0395899_0326214_119_514 122
171 3300037418 Ga0395900_0964913 Ga0395900_0964913_57_452 122
172 3300037466 Ga0395898_0240331 Ga0395898_0240331_485_880 122
173 3300037466 Ga0395898_0958273 Ga0395898_0958273_348_743 122
174 3300037471 Ga0395905_1233340 Ga0395905_1233340_113_508 122
175 3300039062 Ga0400483_024254 Ga0400483_024254_748_1164 122
176 3300039437 Ga0436365_0074160 Ga0436365_0074160_87_455 122
177 3300041456 Ga0451795_0631926 Ga0451795_0631926_279_647 122
178 3300041494 Ga0451837_0887641 Ga0451837_0887641_189_584 122
179 3300041509 Ga0451843_1239513 Ga0451843_1239513_622_990 122
180 3300044842 Ga0466957_0834350 Ga0466957_0834350_206_601 122
181 3300044842 Ga0466957_1447120 Ga0466957_1447120_94_489 122
182 3300044901 Ga0466960_0110797 Ga0466960_0110797_822_1217 122
183 3300045976 Ga0466967_1001337 Ga0466967_1001337_149_544 122
184 3300046454 Ga0495592_0118228 Ga0495592_0118228_1261_1683 122
185 3300046461 Ga0495641_0147058 Ga0495641_0147058_394_789 122
186 3300046471 Ga0495650_0000121 Ga0495650_0000121_77885_78280 122
187 3300046475 Ga0495639_0489934 Ga0495639_0489934_18_413 122
188 3300046516 Ga0495628_0131261 Ga0495628_0131261_705_1127 122
189 3300046529 Ga0495652_0659315 Ga0495652_0659315_205_600 122
190 3300046543 Ga0495645_0247946 Ga0495645_0247946_290_712 122
191 3300047317 Ga0495604_0270715 Ga0495604_0270715_476_871 122
192 3300047321 Ga0495676_0026951 Ga0495676_0026951_2544_2939 122
193 3300047322 Ga0495680_0134879 Ga0495680_0134879_624_1019 122
194 3300048089 Ga0495614_0174547 Ga0495614_0174547_297_692 122
195 3300048907 Ga0496104_0639534 Ga0496104_0639534_62_457 122
196 3300048912 Ga0496109_1297456 Ga0496109_1297456_66_461 122
197 3300048915 Ga0496112_0000516 Ga0496112_0000516_25118_25513 122
198 3300048916 Ga0496113_0032155 Ga0496113_0032155_2863_3258 122
199 3300049534 Ga0501318_084511 Ga0501318_084511_70_438 122
200 3300049568 Ga0501031_0009956 Ga0501031_0009956_1667_2062 122
201 3300049569 Ga0501032_0199597 Ga0501032_0199597_21_416 122
202 3300049570 Ga0501033_0029262 Ga0501033_0029262_2774_3169 122
203 3300049571 Ga0501034_0095132 Ga0501034_0095132_867_1262 122
204 3300049572 Ga0501036_0014384 Ga0501036_0014384_5099_5494 122
205 3300049573 Ga0501037_0108066 Ga0501037_0108066_1051_1446 122
206 3300049574 Ga0501038_0005590 Ga0501038_0005590_927_1322 122
207 3300049575 Ga0501039_0121352 Ga0501039_0121352_934_1329 122
208 3300049579 Ga0501043_0440364 Ga0501043_0440364_414_809 122
209 3300049580 Ga0501046_0034880 Ga0501046_0034880_812_1207 122
210 3300049582 Ga0501048_0008581 Ga0501048_0008581_1466_1861 122
211 3300049583 Ga0501067_0006705 Ga0501067_0006705_882_1277 122
212 3300049587 Ga0501071_0061932 Ga0501071_0061932_1048_1443 122
213 3300049588 Ga0501072_1174545 Ga0501072_1174545_28_423 122
214 3300049589 Ga0501073_0159025 Ga0501073_0159025_21_416 122
215 3300049590 Ga0501074_0013273 Ga0501074_0013273_4298_4693 122
216 3300049591 Ga0501075_0220466 Ga0501075_0220466_547_915 122
217 3300049741 Ga0501079_0665848 Ga0501079_0665848_105_500 122
218 3300049742 Ga0501080_0191461 Ga0501080_0191461_325_720 122
219 3300049744 Ga0501083_0041703 Ga0501083_0041703_370_765 122
220 3300049822 Ga0501035_0040785 Ga0501035_0040785_140_535 122
221 3300049823 Ga0501044_0013375 Ga0501044_0013375_6103_6498 122
222 3300053077 Ga0495601_0230599 Ga0495601_0230599_796_1191 122
223 3300053078 Ga0495612_0328643 Ga0495612_0328643_66_461 122
224 3300054114 Ga0501084_0045171 Ga0501084_0045171_1707_2102 122
225 3300059503 Ga0587080_081379 Ga0587080_081379_230_598 122
226 3300059507 Ga0587086_030397 Ga0587086_030397_372_740 122
227 3300059510 Ga0587090_127125 Ga0587090_127125_73_441 122
228 3300060353 Ga0501082_0142204 Ga0501082_0142204_1246_1641 122
229 iso_pu_bacteria 2786546940 2788433934 122
230 iso_pu_bacteria 2916971899 2916972069 122
231 iso_pu_bacteria 3006969106 3006973804 122
232 3300003323 rootH1_10069712 rootH1_100697122 123
233 3300005328 Ga0070676_11259696 Ga0070676_112596961 123
234 3300005329 Ga0070683_100648598 Ga0070683_1006485981 123
235 3300005331 Ga0070670_100590010 Ga0070670_1005900102 123
236 3300005334 Ga0068869_100099622 Ga0068869_1000996222 123
237 3300005336 Ga0070680_100355547 Ga0070680_1003555472 123
238 3300005337 Ga0070682_100791466 Ga0070682_1007914661 123
239 3300005340 Ga0070689_101343123 Ga0070689_1013431231 123
240 3300005356 Ga0070674_100068400 Ga0070674_1000684002 123
241 3300005445 Ga0070708_100807413 Ga0070708_1008074132 123
242 3300005456 Ga0070678_100070409 Ga0070678_1000704092 123
243 3300005458 Ga0070681_10700340 Ga0070681_107003402 123
244 3300005467 Ga0070706_100090069 Ga0070706_1000900692 123
245 3300005471 Ga0070698_100003219 Ga0070698_10000321910 123
246 3300005471 Ga0070698_101394679 Ga0070698_1013946791 123
247 3300005518 Ga0070699_100063431 Ga0070699_1000634313 123
248 3300005530 Ga0070679_100685245 Ga0070679_1006852452 123
249 3300005536 Ga0070697_101315149 Ga0070697_1013151491 123
250 3300005549 Ga0070704_101517299 Ga0070704_1015172991 123
251 3300005578 Ga0068854_100489662 Ga0068854_1004896622 123
252 3300005844 Ga0068862_100333204 Ga0068862_1003332041 123
253 3300005937 Ga0081455_10002585 Ga0081455_100025852 123
254 3300005981 Ga0081538_10000250 Ga0081538_1000025064 123
255 3300005981 Ga0081538_10002047 Ga0081538_100020473 123
256 3300005981 Ga0081538_10019032 Ga0081538_100190324 123
257 3300005981 Ga0081538_10138015 Ga0081538_101380152 123
258 3300006237 Ga0097621_100332534 Ga0097621_1003325342 123
259 3300006358 Ga0068871_100716246 Ga0068871_1007162462 123
260 3300006844 Ga0075428_101151503 Ga0075428_1011515032 123
261 3300006844 Ga0075428_102356328 Ga0075428_1023563281 123
262 3300006846 Ga0075430_100039669 Ga0075430_1000396692 123
263 3300006846 Ga0075430_100829049 Ga0075430_1008290491 123
264 3300006847 Ga0075431_100063276 Ga0075431_1000632762 123
265 3300006847 Ga0075431_101034084 Ga0075431_1010340842 123
266 3300006847 Ga0075431_101113721 Ga0075431_1011137212 123
267 3300006852 Ga0075433_11130862 Ga0075433_111308622 123
268 3300006880 Ga0075429_100284342 Ga0075429_1002843422 123
269 3300006880 Ga0075429_100672111 Ga0075429_1006721112 123
270 3300009147 Ga0114129_10814565 Ga0114129_108145652 123
271 3300009176 Ga0105242_10912622 Ga0105242_109126221 123
272 3300009545 Ga0105237_10150945 Ga0105237_101509452 123
273 3300012473 Ga0157340_1008626 Ga0157340_10086261 123
274 3300013102 Ga0157371_10272231 Ga0157371_102722312 123
275 3300013297 Ga0157378_10888802 Ga0157378_108888022 123
276 3300013297 Ga0157378_11598577 Ga0157378_115985772 123
277 3300013307 Ga0157372_12959194 Ga0157372_129591941 123
278 3300014745 Ga0157377_10540728 Ga0157377_105407282 123
279 3300014969 Ga0157376_10438194 Ga0157376_104381942 123
280 3300021384 Ga0213876_10135418 Ga0213876_101354182 123
281 3300023438 Ga0256720_139491 Ga0256720_1394911 123
282 3300025901 Ga0207688_10661977 Ga0207688_106619771 123
283 3300025909 Ga0207705_10162926 Ga0207705_101629262 123
284 3300025910 Ga0207684_10021082 Ga0207684_100210823 123
285 3300025912 Ga0207707_11559912 Ga0207707_115599121 123
286 3300025914 Ga0207671_10767804 Ga0207671_107678042 123
287 3300025917 Ga0207660_10288355 Ga0207660_102883552 123
288 3300025936 Ga0207670_10384233 Ga0207670_103842331 123
289 3300025936 Ga0207670_11160662 Ga0207670_111606622 123
290 3300025942 Ga0207689_10183463 Ga0207689_101834632 123
291 3300025944 Ga0207661_10938254 Ga0207661_109382541 123
292 3300025944 Ga0207661_11042659 Ga0207661_110426591 123
293 3300025960 Ga0207651_10788706 Ga0207651_107887062 123
294 3300026078 Ga0207702_11581631 Ga0207702_115816311 123
295 3300026088 Ga0207641_12459694 Ga0207641_124596941 123
296 3300026121 Ga0207683_10030943 Ga0207683_100309432 123
297 3300029277 Ga0311001_1083056 Ga0311001_10830562 123
298 3300029285 Ga0310981_1060993 Ga0310981_10609932 123
299 3300031507 Ga0307509_10043415 Ga0307509_100434154 123
300 3300031901 Ga0307406_10062091 Ga0307406_100620913 123
301 3300031901 Ga0307406_11341423 Ga0307406_113414231 123
302 3300031911 Ga0307412_10845582 Ga0307412_108455822 123
303 3300031995 Ga0307409_101197534 Ga0307409_1011975342 123
304 3300032002 Ga0307416_100951267 Ga0307416_1009512672 123
305 3300032004 Ga0307414_12323689 Ga0307414_123236891 123
306 3300032126 Ga0307415_100241717 Ga0307415_1002417172 123
307 3300035117 Ga0373953_0249313 Ga0373953_0249313_376_747 123
308 3300036647 Ga0316582_0401048 Ga0316582_0401048_544_915 123
309 3300037312 Ga0395899_0007266 Ga0395899_0007266_2827_3198 123
310 3300037418 Ga0395900_0037779 Ga0395900_0037779_2648_3019 123
311 3300037418 Ga0395900_0660692 Ga0395900_0660692_525_896 123
312 3300037466 Ga0395898_0684801 Ga0395898_0684801_509_880 123
313 3300037471 Ga0395905_0563765 Ga0395905_0563765_178_549 123
314 3300038443 Ga0395901_0116510 Ga0395901_0116510_942_1313 123
315 3300038443 Ga0395901_0329662 Ga0395901_0329662_568_939 123
316 3300039062 Ga0400483_121213 Ga0400483_121213_414_785 123
317 3300039437 Ga0436365_1256045 Ga0436365_1256045_1322_1693 123
318 3300039453 Ga0436362_0113140 Ga0436362_0113140_12_383 123
319 3300039453 Ga0436362_1100490 Ga0436362_1100490_363_761 123
320 3300041508 Ga0451852_16322 Ga0451852_16322_55_432 123
321 3300042876 Ga0451577_0898726 Ga0451577_0898726_65_436 123
322 3300042876 Ga0451577_1002833 Ga0451577_1002833_27_398 123
323 3300044712 Ga0453684_0070061 Ga0453684_0070061_3140_3511 123
324 3300045051 Ga0451576_0000003 Ga0451576_0000003_951767_952174 123
325 3300046533 Ga0495640_0847254 Ga0495640_0847254_130_501 123
326 3300048915 Ga0496112_0256546 Ga0496112_0256546_529_900 123
327 3300048924 Ga0496121_0006505 Ga0496121_0006505_11131_11529 123
328 3300049127 Ga0501306_104614 Ga0501306_104614_17_388 123
329 3300049128 Ga0501308_052445 Ga0501308_052445_21_392 123
330 3300049515 Ga0501292_042392 Ga0501292_042392_292_663 123
331 3300049527 Ga0501311_032212 Ga0501311_032212_11_382 123
332 3300049574 Ga0501038_1259750 Ga0501038_1259750_69_440 123
333 3300049579 Ga0501043_0695671 Ga0501043_0695671_159_530 123
334 3300049580 Ga0501046_0778081 Ga0501046_0778081_286_657 123
335 3300049581 Ga0501047_0308480 Ga0501047_0308480_279_650 123
336 3300049582 Ga0501048_0169189 Ga0501048_0169189_954_1325 123
337 3300049583 Ga0501067_0009843 Ga0501067_0009843_4263_4634 123
338 3300049583 Ga0501067_0391562 Ga0501067_0391562_273_644 123
339 3300049585 Ga0501069_0090513 Ga0501069_0090513_476_847 123
340 3300049587 Ga0501071_0477217 Ga0501071_0477217_50_421 123
341 3300049587 Ga0501071_0988280 Ga0501071_0988280_187_558 123
342 3300049590 Ga0501074_0130988 Ga0501074_0130988_1029_1400 123
343 3300049590 Ga0501074_0146862 Ga0501074_0146862_819_1190 123
344 3300049593 Ga0501077_0230973 Ga0501077_0230973_697_1068 123
345 3300049742 Ga0501080_1091273 Ga0501080_1091273_123_494 123
346 3300049822 Ga0501035_1115667 Ga0501035_1115667_76_447 123
347 3300049823 Ga0501044_0078916 Ga0501044_0078916_2480_2851 123
348 3300050508 nmdc:mga09592_172694_c1 nmdc:mga09592_172694_c1_75_446 123
349 3300050508 nmdc:mga09592_185333_c1 nmdc:mga09592_185333_c1_1390_1761 123
350 3300050509 nmdc:mga0qj67_3985_c2 nmdc:mga0qj67_3985_c2_3329_3700 123
351 3300050510 nmdc:mga06r32_54362_c1 nmdc:mga06r32_54362_c1_3103_3474 123
352 3300050515 nmdc:mga0a205_968698_c1 nmdc:mga0a205_968698_c1_165_536 123
353 3300054114 Ga0501084_1281179 Ga0501084_1281179_158_529 123
354 3300059643 Ga0587072_134023 Ga0587072_134023_203_574 123
355 3300059646 Ga0587078_078141 Ga0587078_078141_114_485 123
356 iso_pu_bacteria 2857604169 2857608878 123
357 iso_pu_bacteria 3006826541 3006828577 123
358 3300003323 rootH1_10403485 rootH1_104034851 124
359 3300005345 Ga0070692_10380746 Ga0070692_103807462 124
360 3300005367 Ga0070667_101407232 Ga0070667_1014072322 124
361 3300005438 Ga0070701_10184773 Ga0070701_101847732 124
362 3300005543 Ga0070672_100013159 Ga0070672_1000131593 124
363 3300005546 Ga0070696_100044176 Ga0070696_1000441762 124
364 3300005549 Ga0070704_100615286 Ga0070704_1006152861 124
365 3300005719 Ga0068861_101020095 Ga0068861_1010200951 124
366 3300006844 Ga0075428_100263152 Ga0075428_1002631522 124
367 3300006852 Ga0075433_10060259 Ga0075433_100602592 124
368 3300006852 Ga0075433_10688173 Ga0075433_106881732 124
369 3300006880 Ga0075429_100048515 Ga0075429_1000485152 124
370 3300009094 Ga0111539_10456351 Ga0111539_104563513 124
371 3300013308 Ga0157375_12673585 Ga0157375_126735851 124
372 3300014326 Ga0157380_13475935 Ga0157380_134759351 124
373 3300021358 Ga0213873_10179721 Ga0213873_101797212 124
374 3300025940 Ga0207691_10479356 Ga0207691_104793562 124
375 3300031250 Ga0265331_10016846 Ga0265331_100168462 124
376 3300031691 Ga0316579_10019575 Ga0316579_100195752 124
377 3300031691 Ga0316579_10033104 Ga0316579_100331042 124
378 3300031691 Ga0316579_10057060 Ga0316579_100570603 124
379 3300031691 Ga0316579_10102736 Ga0316579_101027362 124
380 3300031691 Ga0316579_10109614 Ga0316579_101096141 124
381 3300031691 Ga0316579_10254432 Ga0316579_102544322 124
382 3300031727 Ga0316576_10000859 Ga0316576_100008596 124
383 3300031727 Ga0316576_10050533 Ga0316576_100505333 124
384 3300031727 Ga0316576_10114440 Ga0316576_101144403 124
385 3300031727 Ga0316576_10277870 Ga0316576_102778701 124
386 3300031727 Ga0316576_10447642 Ga0316576_104476422 124
387 3300031727 Ga0316576_10495153 Ga0316576_104951532 124
388 3300031727 Ga0316576_10631927 Ga0316576_106319271 124
389 3300031727 Ga0316576_10849366 Ga0316576_108493662 124
390 3300031727 Ga0316576_11060207 Ga0316576_110602071 124
391 3300031728 Ga0316578_10000241 Ga0316578_1000024111 124
392 3300031728 Ga0316578_10004865 Ga0316578_100048652 124
393 3300031728 Ga0316578_10022633 Ga0316578_100226332 124
394 3300031728 Ga0316578_10395493 Ga0316578_103954932 124
395 3300031733 Ga0316577_10000447 Ga0316577_100004474 124
396 3300032133 Ga0316583_10305313 Ga0316583_103053131 124
397 3300032137 Ga0316585_10004899 Ga0316585_100048992 124
398 3300032137 Ga0316585_10111936 Ga0316585_101119362 124
399 3300032139 Ga0316580_10002598 Ga0316580_100025981 124
400 3300032139 Ga0316580_10102712 Ga0316580_101027122 124
401 3300032168 Ga0316593_10000417 Ga0316593_100004174 124
402 3300032168 Ga0316593_10000589 Ga0316593_100005894 124
403 3300032168 Ga0316593_10000698 Ga0316593_100006982 124
404 3300032168 Ga0316593_10000765 Ga0316593_100007659 124
405 3300032168 Ga0316593_10001578 Ga0316593_100015782 124
406 3300032168 Ga0316593_10001601 Ga0316593_100016012 124
407 3300032168 Ga0316593_10001733 Ga0316593_100017332 124
408 3300032168 Ga0316593_10003549 Ga0316593_100035492 124
409 3300032168 Ga0316593_10004947 Ga0316593_100049473 124
410 3300032168 Ga0316593_10008436 Ga0316593_100084361 124
411 3300032168 Ga0316593_10018658 Ga0316593_100186583 124
412 3300032168 Ga0316593_10019627 Ga0316593_100196272 124
413 3300032168 Ga0316593_10032306 Ga0316593_100323062 124
414 3300032168 Ga0316593_10058392 Ga0316593_100583923 124
415 3300032168 Ga0316593_10062765 Ga0316593_100627653 124
416 3300032168 Ga0316593_10067967 Ga0316593_100679671 124
417 3300032168 Ga0316593_10094507 Ga0316593_100945071 124
418 3300032168 Ga0316593_10095358 Ga0316593_100953581 124
419 3300032168 Ga0316593_10108047 Ga0316593_101080471 124
420 3300032168 Ga0316593_10341679 Ga0316593_103416792 124
421 3300032168 Ga0316593_10386520 Ga0316593_103865201 124
422 3300033524 Ga0316592_1000662 Ga0316592_10006623 124
423 3300033524 Ga0316592_1000955 Ga0316592_10009551 124
424 3300033524 Ga0316592_1001027 Ga0316592_10010274 124
425 3300033524 Ga0316592_1001802 Ga0316592_10018024 124
426 3300033524 Ga0316592_1002156 Ga0316592_10021564 124
427 3300033524 Ga0316592_1002445 Ga0316592_10024451 124
428 3300033524 Ga0316592_1007962 Ga0316592_10079621 124
429 3300033524 Ga0316592_1039484 Ga0316592_10394842 124
430 3300033524 Ga0316592_1054794 Ga0316592_10547942 124
431 3300033524 Ga0316592_1067077 Ga0316592_10670771 124
432 3300033524 Ga0316592_1126026 Ga0316592_11260261 124
433 3300033527 Ga0316586_1000181 Ga0316586_10001816 124
434 3300033527 Ga0316586_1000255 Ga0316586_10002551 124
435 3300033527 Ga0316586_1008483 Ga0316586_10084833 124
436 3300033527 Ga0316586_1008737 Ga0316586_10087373 124
437 3300033527 Ga0316586_1071432 Ga0316586_10714321 124
438 3300033528 Ga0316588_1000659 Ga0316588_10006591 124
439 3300033528 Ga0316588_1000759 Ga0316588_10007592 124
440 3300033528 Ga0316588_1000948 Ga0316588_10009484 124
441 3300033528 Ga0316588_1001472 Ga0316588_10014724 124
442 3300033528 Ga0316588_1002494 Ga0316588_10024941 124
443 3300033528 Ga0316588_1005683 Ga0316588_10056832 124
444 3300033528 Ga0316588_1029418 Ga0316588_10294182 124
445 3300033529 Ga0316587_1000871 Ga0316587_10008711 124
446 3300033529 Ga0316587_1001166 Ga0316587_10011661 124
447 3300033529 Ga0316587_1002730 Ga0316587_10027301 124
448 3300033529 Ga0316587_1022964 Ga0316587_10229642 124
449 3300033529 Ga0316587_1025453 Ga0316587_10254531 124
450 3300033529 Ga0316587_1025912 Ga0316587_10259122 124
451 3300033529 Ga0316587_1044150 Ga0316587_10441502 124
452 3300033529 Ga0316587_1054006 Ga0316587_10540061 124
453 3300033529 Ga0316587_1095463 Ga0316587_10954631 124
454 3300033541 Ga0316596_1000015 Ga0316596_100001511 124
455 3300033541 Ga0316596_1000019 Ga0316596_10000194 124
456 3300033541 Ga0316596_1000051 Ga0316596_10000513 124
457 3300033541 Ga0316596_1003186 Ga0316596_10031862 124
458 3300033541 Ga0316596_1003324 Ga0316596_10033244 124
459 3300033541 Ga0316596_1003362 Ga0316596_10033621 124
460 3300033541 Ga0316596_1004711 Ga0316596_10047113 124
461 3300033541 Ga0316596_1004760 Ga0316596_10047601 124
462 3300033541 Ga0316596_1038286 Ga0316596_10382863 124
463 3300033541 Ga0316596_1040097 Ga0316596_10400971 124
464 3300033541 Ga0316596_1052486 Ga0316596_10524862 124
465 3300033541 Ga0316596_1087267 Ga0316596_10872671 124
466 3300033541 Ga0316596_1090373 Ga0316596_10903731 124
467 3300033541 Ga0316596_1106758 Ga0316596_11067582 124
468 3300033541 Ga0316596_1110717 Ga0316596_11107172 124
469 3300033541 Ga0316596_1166113 Ga0316596_11661131 124
470 3300035398 Ga0316574_0129363 Ga0316574_0129363_106_480 124
471 3300035398 Ga0316574_0165133 Ga0316574_0165133_1022_1396 124
472 3300036647 Ga0316582_0002761 Ga0316582_0002761_2945_3319 124
473 3300036647 Ga0316582_0010159 Ga0316582_0010159_811_1185 124
474 3300036647 Ga0316582_1247372 Ga0316582_1247372_24_398 124
475 3300036712 Ga0316584_0001067 Ga0316584_0001067_2779_3153 124
476 3300036712 Ga0316584_0027859 Ga0316584_0027859_1484_1858 124
477 3300036712 Ga0316584_0087558 Ga0316584_0087558_1283_1657 124
478 3300036712 Ga0316584_0167910 Ga0316584_0167910_40_414 124
479 3300036712 Ga0316584_0542668 Ga0316584_0542668_178_552 124
480 3300039062 Ga0400483_016634 Ga0400483_016634_639_1013 124
481 3300039062 Ga0400483_145883 Ga0400483_145883_1663_2037 124
482 3300039062 Ga0400483_266032 Ga0400483_266032_683_1060 124
483 3300042876 Ga0451577_0155638 Ga0451577_0155638_513_887 124
484 3300044673 Ga0453683_0661052 Ga0453683_0661052_31_405 124
485 3300044712 Ga0453684_0001193 Ga0453684_0001193_76986_77360 124
486 3300044712 Ga0453684_0087736 Ga0453684_0087736_2942_3316 124
487 3300045051 Ga0451576_0257261 Ga0451576_0257261_966_1340 124
488 3300045051 Ga0451576_0524010 Ga0451576_0524010_649_1023 124
489 3300047322 Ga0495680_0161336 Ga0495680_0161336_1037_1438 124
490 3300048928 Ga0496125_0004021 Ga0496125_0004021_12428_12802 124
491 3300048928 Ga0496125_0010850 Ga0496125_0010850_2992_3366 124
492 3300050511 nmdc:mga08y16_468499_c1 nmdc:mga08y16_468499_c1_106_516 124
493 3300050515 nmdc:mga0a205_116758_c1 nmdc:mga0a205_116758_c1_1418_1792 124
494 3300050515 nmdc:mga0a205_232987_c1 nmdc:mga0a205_232987_c1_265_639 124
495 3300050515 nmdc:mga0a205_602712_c1 nmdc:mga0a205_602712_c1_261_677 124
496 3300059643 Ga0587072_201303 Ga0587072_201303_118_492 124
497 3300005468 Ga0070707_101011500 Ga0070707_1010115002 125
498 3300005518 Ga0070699_100186526 Ga0070699_1001865263 125
499 3300005536 Ga0070697_100130858 Ga0070697_1001308582 125
500 3300005536 Ga0070697_101102441 Ga0070697_1011024412 125
501 3300005545 Ga0070695_100124337 Ga0070695_1001243372 125
502 3300005546 Ga0070696_100648192 Ga0070696_1006481922 125
503 3300005548 Ga0070665_100004237 Ga0070665_1000042376 125
504 3300006852 Ga0075433_10024717 Ga0075433_100247172 125
505 3300006871 Ga0075434_100063706 Ga0075434_1000637063 125
506 3300006881 Ga0068865_101932220 Ga0068865_1019322201 125
507 3300009093 Ga0105240_10004245 Ga0105240_100042458 125
508 3300010375 Ga0105239_10030499 Ga0105239_100304993 125
509 3300015262 Ga0182007_10392064 Ga0182007_103920641 125
510 3300025913 Ga0207695_10104798 Ga0207695_101047982 125
511 3300025922 Ga0207646_10242931 Ga0207646_102429311 125
512 3300026023 Ga0207677_10206493 Ga0207677_102064933 125
513 3300028379 Ga0268266_10016375 Ga0268266_100163758 125
514 3300031242 Ga0265329_10006079 Ga0265329_100060793 125
515 3300031250 Ga0265331_10277030 Ga0265331_102770302 125
516 3300031711 Ga0265314_10063634 Ga0265314_100636342 125
517 3300031727 Ga0316576_10341683 Ga0316576_103416832 125
518 3300031727 Ga0316576_10419265 Ga0316576_104192651 125
519 3300031727 Ga0316576_10453360 Ga0316576_104533602 125
520 3300033524 Ga0316592_1099061 Ga0316592_10990612 125
521 3300033528 Ga0316588_1001353 Ga0316588_10013532 125
522 3300033528 Ga0316588_1013709 Ga0316588_10137091 125
523 3300033528 Ga0316588_1149495 Ga0316588_11494952 125
524 3300033529 Ga0316587_1019796 Ga0316587_10197962 125
525 3300033541 Ga0316596_1014132 Ga0316596_10141323 125
526 3300039447 Ga0436361_0557259 Ga0436361_0557259_247_624 125
527 3300042876 Ga0451577_0000092 Ga0451577_0000092_155238_155684 125
528 3300042876 Ga0451577_0002251 Ga0451577_0002251_3132_3512 125
529 3300042876 Ga0451577_0037725 Ga0451577_0037725_1325_1705 125
530 3300042876 Ga0451577_0418106 Ga0451577_0418106_480_860 125
531 3300044673 Ga0453683_0000522 Ga0453683_0000522_3947_4393 125
532 3300044673 Ga0453683_0000935 Ga0453683_0000935_8681_9061 125
533 3300044673 Ga0453683_0025793 Ga0453683_0025793_527_907 125
534 3300044673 Ga0453683_1056882 Ga0453683_1056882_16_393 125
535 3300044712 Ga0453684_0000432 Ga0453684_0000432_167185_167565 125
536 3300044712 Ga0453684_0002324 Ga0453684_0002324_3222_3668 125
537 3300044712 Ga0453684_0058446 Ga0453684_0058446_4465_4845 125
538 3300044712 Ga0453684_0141642 Ga0453684_0141642_1729_2106 125
539 3300044712 Ga0453684_0219846 Ga0453684_0219846_1768_2148 125
540 3300044712 Ga0453684_0479027 Ga0453684_0479027_597_974 125
541 3300044712 Ga0453684_0589068 Ga0453684_0589068_656_1036 125
542 3300044712 Ga0453684_1309569 Ga0453684_1309569_87_467 125
543 3300044712 Ga0453684_2291792 Ga0453684_2291792_48_425 125
544 3300045051 Ga0451576_0000113 Ga0451576_0000113_167431_167811 125
545 3300045051 Ga0451576_0001103 Ga0451576_0001103_5906_6352 125
546 3300045051 Ga0451576_0017828 Ga0451576_0017828_1433_1813 125
547 3300045051 Ga0451576_0163274 Ga0451576_0163274_1093_1473 125
548 3300045051 Ga0451576_0208325 Ga0451576_0208325_738_1115 125
549 3300045051 Ga0451576_1642384 Ga0451576_1642384_190_570 125
550 3300050515 nmdc:mga0a205_69251_c1 nmdc:mga0a205_69251_c1_2751_3128 125
551 3300005340 Ga0070689_101065984 Ga0070689_1010659842 126
552 3300005458 Ga0070681_10198635 Ga0070681_101986352 126
553 3300009176 Ga0105242_10654675 Ga0105242_106546752 126
554 3300009176 Ga0105242_11090234 Ga0105242_110902342 126
555 3300013102 Ga0157371_10410538 Ga0157371_104105381 126
556 3300013308 Ga0157375_12507451 Ga0157375_125074511 126
557 3300025922 Ga0207646_10317494 Ga0207646_103174942 126
558 3300025936 Ga0207670_10954623 Ga0207670_109546231 126
559 3300031090 Ga0265760_10000026 Ga0265760_1000002657 126
560 3300031344 Ga0265316_10031378 Ga0265316_100313783 126
561 3300031665 Ga0316575_10108542 Ga0316575_101085422 126
562 3300032133 Ga0316583_10000319 Ga0316583_1000031914 126
563 3300035691 Ga0373931_0596196 Ga0373931_0596196_103_525 126
564 3300037471 Ga0395905_0000376 Ga0395905_0000376_35975_36379 126
565 3300048905 Ga0496102_0463485 Ga0496102_0463485_302_682 126
566 3300048906 Ga0496103_0358492 Ga0496103_0358492_386_766 126
567 3300048910 Ga0496107_0590638 Ga0496107_0590638_252_632 126
568 3300049528 Ga0501312_045365 Ga0501312_045365_165_545 126
569 3300005436 Ga0070713_100016190 Ga0070713_1000161906 127
570 3300005437 Ga0070710_10166147 Ga0070710_101661472 127
571 3300005439 Ga0070711_100090240 Ga0070711_1000902402 127
572 3300005445 Ga0070708_100974040 Ga0070708_1009740402 127
573 3300005467 Ga0070706_100038479 Ga0070706_1000384792 127
574 3300005468 Ga0070707_100010443 Ga0070707_1000104433 127
575 3300005468 Ga0070707_100014471 Ga0070707_1000144713 127
576 3300005471 Ga0070698_100065898 Ga0070698_1000658983 127
577 3300005471 Ga0070698_100068156 Ga0070698_1000681561 127
578 3300005518 Ga0070699_100334911 Ga0070699_1003349112 127
579 3300005840 Ga0068870_10529830 Ga0068870_105298301 127
580 3300005937 Ga0081455_10157276 Ga0081455_101572761 127
581 3300006358 Ga0068871_101560463 Ga0068871_1015604631 127
582 3300006881 Ga0068865_100204745 Ga0068865_1002047452 127
583 3300007265 Ga0099794_10014076 Ga0099794_100140763 127
584 3300007265 Ga0099794_10023888 Ga0099794_100238882 127
585 3300007265 Ga0099794_10035542 Ga0099794_100355421 127
586 3300007788 Ga0099795_10004417 Ga0099795_100044172 127
587 3300009093 Ga0105240_10121109 Ga0105240_101211093 127
588 3300009093 Ga0105240_10274511 Ga0105240_102745112 127
589 3300009098 Ga0105245_10033891 Ga0105245_100338916 127
590 3300010159 Ga0099796_10063694 Ga0099796_100636941 127
591 3300013105 Ga0157369_11202069 Ga0157369_112020691 127
592 3300013296 Ga0157374_10000801 Ga0157374_1000080128 127
593 3300013297 Ga0157378_10000886 Ga0157378_1000088625 127
594 3300013297 Ga0157378_10438127 Ga0157378_104381272 127
595 3300014969 Ga0157376_10226962 Ga0157376_102269622 127
596 3300019192 Ga0184603_100407 Ga0184603_1004071 127
597 3300024227 Ga0228598_1004458 Ga0228598_10044582 127
598 3300025906 Ga0207699_10059947 Ga0207699_100599473 127
599 3300025906 Ga0207699_10674165 Ga0207699_106741651 127
600 3300025910 Ga0207684_10010612 Ga0207684_100106126 127
601 3300025913 Ga0207695_10184944 Ga0207695_101849442 127
602 3300025913 Ga0207695_10861390 Ga0207695_108613901 127
603 3300025916 Ga0207663_10546106 Ga0207663_105461062 127
604 3300025918 Ga0207662_10723882 Ga0207662_107238821 127
605 3300025922 Ga0207646_10016678 Ga0207646_100166782 127
606 3300025927 Ga0207687_10777486 Ga0207687_107774862 127
607 3300025928 Ga0207700_10220042 Ga0207700_102200423 127
608 3300025939 Ga0207665_10559080 Ga0207665_105590802 127
609 3300027512 Ga0209179_1030480 Ga0209179_10304801 127
610 3300027671 Ga0209588_1013299 Ga0209588_10132991 127
611 3300027671 Ga0209588_1023729 Ga0209588_10237292 127
612 3300028563 Ga0265319_1004383 Ga0265319_10043834 127
613 3300028577 Ga0265318_10000466 Ga0265318_1000046642 127
614 3300028800 Ga0265338_10650042 Ga0265338_106500422 127
615 3300030879 Ga0265765_1006543 Ga0265765_10065431 127
616 3300030882 Ga0265764_102136 Ga0265764_1021362 127
617 3300031090 Ga0265760_10019572 Ga0265760_100195722 127
618 3300031235 Ga0265330_10044087 Ga0265330_100440873 127
619 3300031238 Ga0265332_10011115 Ga0265332_100111151 127
620 3300031239 Ga0265328_10189103 Ga0265328_101891031 127
621 3300031240 Ga0265320_10001540 Ga0265320_100015408 127
622 3300031242 Ga0265329_10004500 Ga0265329_100045005 127
623 3300031247 Ga0265340_10017605 Ga0265340_100176053 127
624 3300031249 Ga0265339_10001807 Ga0265339_100018075 127
625 3300031250 Ga0265331_10000025 Ga0265331_10000025138 127
626 3300031344 Ga0265316_10000784 Ga0265316_1000078439 127
627 3300031595 Ga0265313_10001605 Ga0265313_100016056 127
628 3300031712 Ga0265342_10000362 Ga0265342_100003628 127
629 3300032120 Ga0316053_104592 Ga0316053_1045921 127
630 3300035083 Ga0373926_0174374 Ga0373926_0174374_26_409 127
631 3300035086 Ga0373934_0224577 Ga0373934_0224577_10_393 127
632 3300035111 Ga0373923_0021564 Ga0373923_0021564_1572_1955 127
633 3300035118 Ga0373954_0054945 Ga0373954_0054945_228_611 127
634 3300035119 Ga0373956_0262775 Ga0373956_0262775_366_749 127
635 3300035172 Ga0373955_0158603 Ga0373955_0158603_217_600 127
636 3300035172 Ga0373955_0353005 Ga0373955_0353005_307_690 127
637 3300035172 Ga0373955_0582717 Ga0373955_0582717_95_478 127
638 3300035410 Ga0373924_0036091 Ga0373924_0036091_391_774 127
639 3300035692 Ga0373935_0036026 Ga0373935_0036026_1699_2082 127
640 3300035695 Ga0373927_0014376 Ga0373927_0014376_1680_2063 127
641 3300035724 Ga0373933_0056998 Ga0373933_0056998_432_815 127
642 3300035725 Ga0373947_0000905 Ga0373947_0000905_409_792 127
643 3300036401 Ga0373937_0024810 Ga0373937_0024810_4054_4437 127
644 3300036401 Ga0373937_0185079 Ga0373937_0185079_1252_1635 127
645 3300041446 Ga0451794_33567 Ga0451794_33567_154_537 127
646 3300042876 Ga0451577_0017091 Ga0451577_0017091_344_727 127
647 3300042876 Ga0451577_0225538 Ga0451577_0225538_449_832 127
648 3300042876 Ga0451577_0239036 Ga0451577_0239036_997_1380 127
649 3300042876 Ga0451577_1273950 Ga0451577_1273950_107_490 127
650 3300044673 Ga0453683_0006598 Ga0453683_0006598_4610_4993 127
651 3300044673 Ga0453683_0028929 Ga0453683_0028929_193_576 127
652 3300044673 Ga0453683_0171760 Ga0453683_0171760_672_1055 127
653 3300044673 Ga0453683_0310911 Ga0453683_0310911_469_852 127
654 3300044712 Ga0453684_0048592 Ga0453684_0048592_2544_2927 127
655 3300044712 Ga0453684_0073743 Ga0453684_0073743_1464_1847 127
656 3300044712 Ga0453684_0267587 Ga0453684_0267587_1175_1558 127
657 3300044712 Ga0453684_2108582 Ga0453684_2108582_35_418 127
658 3300044735 Ga0466968_0241135 Ga0466968_0241135_138_551 127
659 3300044901 Ga0466960_0038323 Ga0466960_0038323_787_1200 127
660 3300045051 Ga0451576_0067033 Ga0451576_0067033_1258_1641 127
661 3300045051 Ga0451576_0720739 Ga0451576_0720739_363_746 127
662 3300046454 Ga0495592_0051472 Ga0495592_0051472_1506_1889 127
663 3300046454 Ga0495592_0059446 Ga0495592_0059446_250_633 127
664 3300046454 Ga0495592_0116904 Ga0495592_0116904_95_478 127
665 3300046459 Ga0495629_0491777 Ga0495629_0491777_192_575 127
666 3300046462 Ga0495651_0036587 Ga0495651_0036587_526_909 127
667 3300046462 Ga0495651_0055165 Ga0495651_0055165_1095_1478 127
668 3300046463 Ga0495653_0014747 Ga0495653_0014747_5024_5407 127
669 3300046463 Ga0495653_0168461 Ga0495653_0168461_352_735 127
670 3300046472 Ga0495580_0054728 Ga0495580_0054728_1288_1671 127
671 3300046472 Ga0495580_0258517 Ga0495580_0258517_49_432 127
672 3300046473 Ga0495582_0258942 Ga0495582_0258942_365_748 127
673 3300046475 Ga0495639_0404316 Ga0495639_0404316_150_533 127
674 3300046477 Ga0495664_0060251 Ga0495664_0060251_1346_1729 127
675 3300046477 Ga0495664_0124483 Ga0495664_0124483_597_980 127
676 3300046499 Ga0495594_0158317 Ga0495594_0158317_243_626 127
677 3300046511 Ga0495608_0008358 Ga0495608_0008358_3958_4341 127
678 3300046511 Ga0495608_0028526 Ga0495608_0028526_176_559 127
679 3300046514 Ga0495618_0247707 Ga0495618_0247707_298_681 127
680 3300046516 Ga0495628_0001930 Ga0495628_0001930_15378_15761 127
681 3300046516 Ga0495628_0398014 Ga0495628_0398014_183_566 127
682 3300046516 Ga0495628_0894785 Ga0495628_0894785_166_549 127
683 3300046517 Ga0495630_0008269 Ga0495630_0008269_2953_3336 127
684 3300046517 Ga0495630_0091375 Ga0495630_0091375_1089_1472 127
685 3300046526 Ga0495666_0064047 Ga0495666_0064047_634_1017 127
686 3300046529 Ga0495652_0014402 Ga0495652_0014402_3058_3441 127
687 3300046529 Ga0495652_0104883 Ga0495652_0104883_816_1199 127
688 3300046531 Ga0495665_0003304 Ga0495665_0003304_5120_5503 127
689 3300046531 Ga0495665_0498767 Ga0495665_0498767_169_552 127
690 3300046533 Ga0495640_0319729 Ga0495640_0319729_366_749 127
691 3300046535 Ga0495586_0035973 Ga0495586_0035973_1449_1832 127
692 3300046535 Ga0495586_0492190 Ga0495586_0492190_87_470 127
693 3300046536 Ga0495587_0002155 Ga0495587_0002155_11922_12305 127
694 3300046543 Ga0495645_0121158 Ga0495645_0121158_341_724 127
695 3300046559 Ga0495667_0017783 Ga0495667_0017783_2266_2649 127
696 3300046559 Ga0495667_0125252 Ga0495667_0125252_1182_1565 127
697 3300046559 Ga0495667_0359202 Ga0495667_0359202_47_430 127
698 3300046642 Ga0495634_0081968 Ga0495634_0081968_582_965 127
699 3300046663 Ga0495635_0049231 Ga0495635_0049231_517_900 127
700 3300046663 Ga0495635_0131153 Ga0495635_0131153_494_877 127
701 3300046663 Ga0495635_0181088 Ga0495635_0181088_778_1161 127
702 3300046675 Ga0495657_0066320 Ga0495657_0066320_701_1084 127
703 3300046675 Ga0495657_0110556 Ga0495657_0110556_559_942 127
704 3300046675 Ga0495657_0335417 Ga0495657_0335417_234_617 127
705 3300046678 Ga0495599_0098721 Ga0495599_0098721_548_931 127
706 3300046678 Ga0495599_0177850 Ga0495599_0177850_749_1132 127
707 3300046679 Ga0495623_0015674 Ga0495623_0015674_3236_3619 127
708 3300046680 Ga0495646_0014717 Ga0495646_0014717_3073_3456 127
709 3300046680 Ga0495646_0046689 Ga0495646_0046689_57_440 127
710 3300046689 Ga0495613_0180121 Ga0495613_0180121_287_670 127
711 3300046689 Ga0495613_0253462 Ga0495613_0253462_22_405 127
712 3300046690 Ga0495624_0016372 Ga0495624_0016372_3652_4035 127
713 3300046809 Ga0495600_0378201 Ga0495600_0378201_53_436 127
714 3300047317 Ga0495604_0019334 Ga0495604_0019334_959_1342 127
715 3300047317 Ga0495604_0081209 Ga0495604_0081209_551_934 127
716 3300047319 Ga0495674_0015976 Ga0495674_0015976_2954_3337 127
717 3300047319 Ga0495674_0049324 Ga0495674_0049324_1378_1761 127
718 3300047319 Ga0495674_0072689 Ga0495674_0072689_2501_2884 127
719 3300047319 Ga0495674_0213133 Ga0495674_0213133_391_774 127
720 3300047322 Ga0495680_0010376 Ga0495680_0010376_373_756 127
721 3300047322 Ga0495680_0037174 Ga0495680_0037174_2687_3070 127
722 3300047444 Ga0495675_0002873 Ga0495675_0002873_5782_6165 127
723 3300047444 Ga0495675_0004854 Ga0495675_0004854_6931_7314 127
724 3300047471 Ga0495684_0005513 Ga0495684_0005513_6412_6795 127
725 3300047471 Ga0495684_0036919 Ga0495684_0036919_3067_3450 127
726 3300047471 Ga0495684_0077651 Ga0495684_0077651_1085_1468 127
727 3300047673 Ga0495593_0010826 Ga0495593_0010826_3065_3448 127
728 3300048088 Ga0495602_0090783 Ga0495602_0090783_93_476 127
729 3300048088 Ga0495602_0262442 Ga0495602_0262442_176_559 127
730 3300048089 Ga0495614_0058406 Ga0495614_0058406_11_394 127
731 3300048918 Ga0496115_0333657 Ga0496115_0333657_84_467 127
732 3300048918 Ga0496115_0730131 Ga0496115_0730131_255_638 127
733 3300050494 nmdc:mga06z11_301313_c1 nmdc:mga06z11_301313_c1_290_673 127
734 iso_pu_bacteria 2964375228 2964375278 127
735 3300005295 Ga0065707_10167338 Ga0065707_101673381 128
736 3300005330 Ga0070690_100530485 Ga0070690_1005304851 128
737 3300005340 Ga0070689_101454326 Ga0070689_1014543261 128
738 3300005406 Ga0070703_10037289 Ga0070703_100372892 128
739 3300005434 Ga0070709_10006493 Ga0070709_100064939 128
740 3300005435 Ga0070714_100506323 Ga0070714_1005063231 128
741 3300005435 Ga0070714_100758792 Ga0070714_1007587922 128
742 3300005436 Ga0070713_100002365 Ga0070713_10000236510 128
743 3300005436 Ga0070713_100242785 Ga0070713_1002427852 128
744 3300005436 Ga0070713_100854865 Ga0070713_1008548652 128
745 3300005437 Ga0070710_10273875 Ga0070710_102738752 128
746 3300005439 Ga0070711_100001449 Ga0070711_1000014494 128
747 3300005439 Ga0070711_100130525 Ga0070711_1001305252 128
748 3300005440 Ga0070705_100086727 Ga0070705_1000867273 128
749 3300005444 Ga0070694_100008757 Ga0070694_1000087575 128
750 3300005445 Ga0070708_100004769 Ga0070708_1000047692 128
751 3300005445 Ga0070708_100016611 Ga0070708_1000166113 128
752 3300005459 Ga0068867_100257994 Ga0068867_1002579942 128
753 3300005467 Ga0070706_100045252 Ga0070706_1000452524 128
754 3300005468 Ga0070707_100012413 Ga0070707_1000124137 128
755 3300005518 Ga0070699_100037932 Ga0070699_1000379324 128
756 3300005536 Ga0070697_100593093 Ga0070697_1005930932 128
757 3300005536 Ga0070697_101446656 Ga0070697_1014466561 128
758 3300005536 Ga0070697_101554003 Ga0070697_1015540031 128
759 3300005544 Ga0070686_100356003 Ga0070686_1003560031 128
760 3300005546 Ga0070696_102020260 Ga0070696_1020202601 128
761 3300005548 Ga0070665_100000700 Ga0070665_10000070033 128
762 3300005548 Ga0070665_102085204 Ga0070665_1020852041 128
763 3300005549 Ga0070704_100377124 Ga0070704_1003771241 128
764 3300005614 Ga0068856_100465458 Ga0068856_1004654583 128
765 3300005841 Ga0068863_100014791 Ga0068863_1000147919 128
766 3300005842 Ga0068858_100088230 Ga0068858_1000882303 128
767 3300005843 Ga0068860_100010580 Ga0068860_1000105805 128
768 3300006163 Ga0070715_10082874 Ga0070715_100828743 128
769 3300006173 Ga0070716_100041393 Ga0070716_1000413931 128
770 3300006173 Ga0070716_100604165 Ga0070716_1006041652 128
771 3300006173 Ga0070716_101367341 Ga0070716_1013673411 128
772 3300006175 Ga0070712_100072105 Ga0070712_1000721052 128
773 3300006175 Ga0070712_100255026 Ga0070712_1002550263 128
774 3300006175 Ga0070712_100452968 Ga0070712_1004529681 128
775 3300006175 Ga0070712_101024728 Ga0070712_1010247281 128
776 3300006237 Ga0097621_100171453 Ga0097621_1001714531 128
777 3300006237 Ga0097621_100689135 Ga0097621_1006891352 128
778 3300006237 Ga0097621_100726987 Ga0097621_1007269871 128
779 3300006871 Ga0075434_101387012 Ga0075434_1013870122 128
780 3300006914 Ga0075436_100005799 Ga0075436_1000057992 128
781 3300006914 Ga0075436_100009783 Ga0075436_1000097834 128
782 3300006914 Ga0075436_100800916 Ga0075436_1008009162 128
783 3300009093 Ga0105240_10922690 Ga0105240_109226901 128
784 3300009176 Ga0105242_10247762 Ga0105242_102477622 128
785 3300009176 Ga0105242_12148188 Ga0105242_121481881 128
786 3300009545 Ga0105237_10222663 Ga0105237_102226632 128
787 3300014968 Ga0157379_11034308 Ga0157379_110343081 128
788 3300021384 Ga0213876_10024420 Ga0213876_100244204 128
789 3300024227 Ga0228598_1004932 Ga0228598_10049322 128
790 3300025885 Ga0207653_10022350 Ga0207653_100223501 128
791 3300025899 Ga0207642_10082809 Ga0207642_100828092 128
792 3300025905 Ga0207685_10053011 Ga0207685_100530111 128
793 3300025906 Ga0207699_10022332 Ga0207699_100223323 128
794 3300025906 Ga0207699_10317275 Ga0207699_103172751 128
795 3300025906 Ga0207699_10339564 Ga0207699_103395642 128
796 3300025910 Ga0207684_10027856 Ga0207684_100278563 128
797 3300025910 Ga0207684_10126378 Ga0207684_101263782 128
798 3300025910 Ga0207684_10424447 Ga0207684_104244471 128
799 3300025914 Ga0207671_10094363 Ga0207671_100943633 128
800 3300025914 Ga0207671_11231216 Ga0207671_112312161 128
801 3300025915 Ga0207693_10043266 Ga0207693_100432664 128
802 3300025915 Ga0207693_10159441 Ga0207693_101594413 128
803 3300025915 Ga0207693_10413993 Ga0207693_104139931 128
804 3300025916 Ga0207663_10125904 Ga0207663_101259041 128
805 3300025916 Ga0207663_10465398 Ga0207663_104653982 128
806 3300025916 Ga0207663_10496103 Ga0207663_104961031 128
807 3300025918 Ga0207662_10876025 Ga0207662_108760251 128
808 3300025921 Ga0207652_10032823 Ga0207652_100328233 128
809 3300025922 Ga0207646_10001996 Ga0207646_1000199620 128
810 3300025922 Ga0207646_10093840 Ga0207646_100938401 128
811 3300025922 Ga0207646_10669651 Ga0207646_106696512 128
812 3300025928 Ga0207700_10002600 Ga0207700_100026003 128
813 3300025928 Ga0207700_10167004 Ga0207700_101670043 128
814 3300025929 Ga0207664_10482958 Ga0207664_104829581 128
815 3300025934 Ga0207686_10698442 Ga0207686_106984421 128
816 3300025939 Ga0207665_10005811 Ga0207665_100058112 128
817 3300025939 Ga0207665_10031807 Ga0207665_100318072 128
818 3300025939 Ga0207665_10090757 Ga0207665_100907573 128
819 3300025939 Ga0207665_10135097 Ga0207665_101350971 128
820 3300025939 Ga0207665_10138823 Ga0207665_101388232 128
821 3300025939 Ga0207665_10695306 Ga0207665_106953061 128
822 3300025941 Ga0207711_10306284 Ga0207711_103062841 128
823 3300025942 Ga0207689_10612955 Ga0207689_106129551 128
824 3300026035 Ga0207703_10017399 Ga0207703_100173992 128
825 3300026088 Ga0207641_10006158 Ga0207641_100061582 128
826 3300026089 Ga0207648_10339454 Ga0207648_103394542 128
827 3300027512 Ga0209179_1017684 Ga0209179_10176842 128
828 3300027671 Ga0209588_1009968 Ga0209588_10099682 128
829 3300028016 Ga0265354_1000344 Ga0265354_10003443 128
830 3300028379 Ga0268266_10000259 Ga0268266_1000025951 128
831 3300028381 Ga0268264_10016281 Ga0268264_100162813 128
832 3300028381 Ga0268264_10019364 Ga0268264_100193643 128
833 3300028573 Ga0265334_10062672 Ga0265334_100626722 128
834 3300028666 Ga0265336_10026034 Ga0265336_100260342 128
835 3300028800 Ga0265338_10070235 Ga0265338_100702353 128
836 3300028800 Ga0265338_10219663 Ga0265338_102196631 128
837 3300028800 Ga0265338_10426682 Ga0265338_104266821 128
838 3300028800 Ga0265338_10912176 Ga0265338_109121762 128
839 3300030878 Ga0265770_1003693 Ga0265770_10036932 128
840 3300031018 Ga0265773_1001638 Ga0265773_10016382 128
841 3300031090 Ga0265760_10021342 Ga0265760_100213422 128
842 3300031090 Ga0265760_10051624 Ga0265760_100516242 128
843 3300031238 Ga0265332_10125373 Ga0265332_101253732 128
844 3300031239 Ga0265328_10154371 Ga0265328_101543711 128
845 3300031239 Ga0265328_10192958 Ga0265328_101929581 128
846 3300031241 Ga0265325_10012503 Ga0265325_100125032 128
847 3300031241 Ga0265325_10111536 Ga0265325_101115362 128
848 3300031242 Ga0265329_10008477 Ga0265329_100084773 128
849 3300031242 Ga0265329_10100232 Ga0265329_101002322 128
850 3300031247 Ga0265340_10102258 Ga0265340_101022581 128
851 3300031250 Ga0265331_10002674 Ga0265331_100026744 128
852 3300031344 Ga0265316_10001106 Ga0265316_1000110626 128
853 3300031344 Ga0265316_10124722 Ga0265316_101247222 128
854 3300031344 Ga0265316_10612981 Ga0265316_106129812 128
855 3300031595 Ga0265313_10018591 Ga0265313_100185913 128
856 3300031711 Ga0265314_10038233 Ga0265314_100382331 128
857 3300031712 Ga0265342_10026417 Ga0265342_100264174 128
858 3300031712 Ga0265342_10038414 Ga0265342_100384143 128
859 3300033547 Ga0316212_1002571 Ga0316212_10025712 128
860 3300033547 Ga0316212_1006236 Ga0316212_10062362 128
861 3300035724 Ga0373933_0746621 Ga0373933_0746621_13_465 128
862 3300046516 Ga0495628_0983104 Ga0495628_0983104_81_467 128
863 3300046517 Ga0495630_0052655 Ga0495630_0052655_2567_2953 128
864 3300046557 Ga0495622_0509001 Ga0495622_0509001_40_429 128
865 3300047317 Ga0495604_0506652 Ga0495604_0506652_47_499 128
866 3300048915 Ga0496112_0394878 Ga0496112_0394878_798_1184 128
867 3300049535 Ga0501319_031007 Ga0501319_031007_74_463 128
868 3300049571 Ga0501034_0990356 Ga0501034_0990356_174_608 128
869 3300049674 Ga0501242_026540 Ga0501242_026540_57_443 128
870 3300049744 Ga0501083_0520694 Ga0501083_0520694_298_684 128
871 3300050512 nmdc:mga0n895_2004878_c1 nmdc:mga0n895_2004878_c1_47_436 128
872 3300005536 Ga0070697_100414395 Ga0070697_1004143952 129
873 3300006880 Ga0075429_100267299 Ga0075429_1002672992 129
874 3300032002 Ga0307416_100407877 Ga0307416_1004078772 129
875 3300044712 Ga0453684_1075362 Ga0453684_1075362_391_792 129
876 3300046517 Ga0495630_1530036 Ga0495630_1530036_80_469 129
877 3300048090 Ga0495615_0283139 Ga0495615_0283139_132_521 129
878 3300050508 nmdc:mga09592_458615_c1 nmdc:mga09592_458615_c1_346_735 129
879 3300059624 Ga0587109_133264 Ga0587109_133264_15_419 129
880 3300059639 Ga0587062_081960 Ga0587062_081960_15_419 129
881 3300005364 Ga0070673_100506945 Ga0070673_1005069451 130
882 3300006844 Ga0075428_100269384 Ga0075428_1002693843 130
883 3300006846 Ga0075430_100225464 Ga0075430_1002254641 130
884 3300006880 Ga0075429_100602085 Ga0075429_1006020852 130
885 3300009094 Ga0111539_10140216 Ga0111539_101402162 130
886 3300014969 Ga0157376_12354466 Ga0157376_123544661 130
887 3300025923 Ga0207681_10887101 Ga0207681_108871011 130
888 3300025924 Ga0207694_10482770 Ga0207694_104827702 130
889 3300025960 Ga0207651_11465341 Ga0207651_114653411 130
890 3300027907 Ga0207428_10687091 Ga0207428_106870912 130
891 3300049571 Ga0501034_0408012 Ga0501034_0408012_135_527 130
892 3300050508 nmdc:mga09592_926227_c1 nmdc:mga09592_926227_c1_182_574 130
893 3300050509 nmdc:mga0qj67_281355_c1 nmdc:mga0qj67_281355_c1_844_1236 130
894 3300050511 nmdc:mga08y16_932106_c1 nmdc:mga08y16_932106_c1_297_689 130
895 3300005440 Ga0070705_100925381 Ga0070705_1009253812 131
896 3300005440 Ga0070705_101487901 Ga0070705_1014879011 131
897 3300006847 Ga0075431_100452149 Ga0075431_1004521492 131
898 3300009094 Ga0111539_10023538 Ga0111539_100235383 131
899 3300009177 Ga0105248_10373894 Ga0105248_103738941 131
900 3300013308 Ga0157375_10313280 Ga0157375_103132803 131
901 3300025960 Ga0207651_11330940 Ga0207651_113309402 131
902 3300031548 Ga0307408_100071079 Ga0307408_1000710792 131
903 3300031731 Ga0307405_10222748 Ga0307405_102227481 131
904 3300031824 Ga0307413_10748047 Ga0307413_107480471 131
905 3300031852 Ga0307410_10231950 Ga0307410_102319502 131
906 3300031903 Ga0307407_10357030 Ga0307407_103570302 131
907 3300031995 Ga0307409_100265902 Ga0307409_1002659022 131
908 3300032005 Ga0307411_11352474 Ga0307411_113524741 131
909 3300032005 Ga0307411_11786736 Ga0307411_117867361 131
910 3300033524 Ga0316592_1145451 Ga0316592_11454511 131
911 3300035171 Ga0373946_0041980 Ga0373946_0041980_1274_1669 131
912 3300037068 Ga0373925_0571442 Ga0373925_0571442_396_791 131
913 3300041461 Ga0451805_008458 Ga0451805_008458_39_434 131
914 3300046683 Ga0495658_0002307 Ga0495658_0002307_7837_8232 131
915 3300049127 Ga0501306_003070 Ga0501306_003070_229_627 131
916 3300049128 Ga0501308_007513 Ga0501308_007513_522_920 131
917 3300049128 Ga0501308_034137 Ga0501308_034137_80_478 131
918 3300049129 Ga0501309_064488 Ga0501309_064488_33_431 131
919 3300049160 Ga0501304_001315 Ga0501304_001315_893_1291 131
920 3300049162 Ga0501307_018937 Ga0501307_018937_202_600 131
921 3300049527 Ga0501311_026839 Ga0501311_026839_197_595 131
922 3300049529 Ga0501313_031423 Ga0501313_031423_44_442 131
923 3300049536 Ga0501320_066742 Ga0501320_066742_13_411 131
924 3300049686 Ga0501257_097188 Ga0501257_097188_228_626 131
925 3300050507 nmdc:mga05p37_1927286_c1 nmdc:mga05p37_1927286_c1_33_428 131
926 3300050510 nmdc:mga06r32_268624_c1 nmdc:mga06r32_268624_c1_711_1106 131
927 3300050511 nmdc:mga08y16_18794_c1 nmdc:mga08y16_18794_c1_4236_4631 131
928 3300005459 Ga0068867_100259979 Ga0068867_1002599793 132
929 3300005535 Ga0070684_101702750 Ga0070684_1017027501 132
930 3300005578 Ga0068854_100906868 Ga0068854_1009068682 132
931 3300005618 Ga0068864_101268011 Ga0068864_1012680112 132
932 3300025908 Ga0207643_10554156 Ga0207643_105541562 132
933 3300026088 Ga0207641_10924854 Ga0207641_109248542 132
934 3300026089 Ga0207648_10286078 Ga0207648_102860783 132
935 3300026095 Ga0207676_11250965 Ga0207676_112509652 132
936 3300003163 Ga0006759J45824_1150259 Ga0006759J45824_11502591 133
937 3300014326 Ga0157380_11062915 Ga0157380_110629151 133
938 3300025936 Ga0207670_10288920 Ga0207670_102889202 133
939 3300044712 Ga0453684_0055571 Ga0453684_0055571_4196_4606 133
940 3300049161 Ga0501305_116230 Ga0501305_116230_47_454 133
941 3300050510 nmdc:mga06r32_319969_c1 nmdc:mga06r32_319969_c1_369_785 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00164

Ribosom_S12_S23

Ribosomal protein S12/S23

12

124

0.97

Feature Viewer

pLDDT pTM Quality
57.22 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map