F486084
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 933 | 397 | 903 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100064201|Ga0070670_1000642014 |
| Length | 346 |
| Sequence | MLDKAIPTAYRNGDNKNERIFDMAQAGSALDRVLVLEMVRVTEAAAIAASKLIGRGDEKAADAAAVEAMRLAFNDLYMDGTVVIGEGERDEAPMLYIGEKVGNAIGTGPRIDIALDPLEGTTITAKAGPNALAVLAISEEGGLLNAPDVYMEKLAIGPGYPEGIIDLKKSVKDNVEAVAAHKGVAPSDIIVCVLDRPRHEKLIGELRAIGCGIMLIPDGDVAGVIATTDPETTIDMYMGSGGAPEGVLACAALRCVGGQFKGRLLFRNEDEKQRAYKWGITDLDKVYDLKELAIGDCIFAATGVTDGSLLDGVKRLPGGKLTTESVVMRASTGTVRWVKGEHKTAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 4 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 5 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 6 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 7 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 8 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 9 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 10 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 11 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 12 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 13 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 14 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 15 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 16 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 17 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 18 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 19 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 20 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 21 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 22 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 23 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 24 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 25 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 26 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 27 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 28 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 29 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 30 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 31 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 32 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 33 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 34 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 35 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 36 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 37 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 38 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 39 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 40 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 41 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 42 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 43 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 44 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 45 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 46 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 49 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 50 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 52 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 53 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 54 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 62 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 69 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 88 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 97 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 98 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 99 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 100 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 105 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 106 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 107 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 108 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 110 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 112 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 113 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 114 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 115 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 117 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 118 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 119 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 122 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 123 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 135 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 136 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 148 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 149 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 150 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 151 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 225 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 226 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 227 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 228 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 229 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 230 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 231 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 232 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 233 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 234 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 235 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 236 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 237 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 238 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 239 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 240 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 241 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 242 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 243 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 244 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 246 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 248 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 249 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 250 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 251 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 252 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 253 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 254 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 255 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 256 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 257 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 258 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 259 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 260 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 261 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 262 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 264 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 265 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 266 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 267 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 268 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 269 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 270 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 271 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 272 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 273 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 274 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 319 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 320 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 321 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 324 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 325 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 326 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 327 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 328 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 329 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 330 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 331 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 332 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 333 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 334 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 335 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 336 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 337 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 338 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 339 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 345 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 346 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 347 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 348 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 349 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 350 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 351 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 352 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 353 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 354 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 356 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 357 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 358 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 359 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 360 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 361 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 362 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 365 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 367 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 370 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 371 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 372 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 373 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 374 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 375 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 376 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 377 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 378 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 379 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 380 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 381 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 382 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 383 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 384 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 385 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 386 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 387 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 389 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 390 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 391 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 392 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 393 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 394 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 395 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 396 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 397 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.68 |
| Metatranscriptomes | 0.11 |
| Isolates | 3.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.5 |
| Nodule | 0.11 |
| Rhizoplane | 4.93 |
| Rhizosphere | 76.31 |
| Stem | 0 |
| Stem Tuber | 0.11 |
| Unclassified | 8.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1168444 | 2162886007 | Bacteria | 3598 |
| 2 | SwRhRL2b_contig_3124566 | 2162886007 | Bacteria | 2009 |
| 3 | SwRhRL2b_contig_3755818 | 2162886007 | Bacteria | 1834 |
| 4 | JGI24736J21556_1000004 | 3300001904 | Bacteria | 55308 |
| 5 | JGI24736J21556_1000307 | 3300001904 | Bacteria | 9005 |
| 6 | JGI24741J21665_1000198 | 3300001915 | Bacteria | 17758 |
| 7 | JGI24741J21665_1001068 | 3300001915 | Bacteria | 8189 |
| 8 | JGI24752J21851_1002724 | 3300001976 | Bacteria | 2348 |
| 9 | JGI24740J21852_10000826 | 3300001979 | Bacteria | 13630 |
| 10 | JGI24740J21852_10002539 | 3300001979 | Bacteria | 8232 |
| 11 | JGI24740J21852_10011202 | 3300001979 | Bacteria | 3422 |
| 12 | JGI24739J22299_10007439 | 3300001989 | Bacteria | 4110 |
| 13 | JGI24739J22299_10014124 | 3300001989 | Bacteria | 2907 |
| 14 | JGI24739J22299_10014975 | 3300001989 | Bacteria | 2820 |
| 15 | JGI24737J22298_10009329 | 3300001990 | Bacteria | 3267 |
| 16 | JGI24737J22298_10011369 | 3300001990 | Bacteria | 2918 |
| 17 | JGI24735J21928_10000294 | 3300002067 | Bacteria | 17391 |
| 18 | JGI24735J21928_10003797 | 3300002067 | Bacteria | 5117 |
| 19 | JGI24750J21931_1000167 | 3300002070 | Bacteria | 10935 |
| 20 | JGI24750J21931_1013782 | 3300002070 | Bacteria | 1083 |
| 21 | JGI24748J21848_1000032 | 3300002074 | Bacteria | 79791 |
| 22 | JGI24738J21930_10001664 | 3300002075 | Bacteria | 6089 |
| 23 | JGI24738J21930_10002788 | 3300002075 | Bacteria | 4488 |
| 24 | JGI24749J21850_1000751 | 3300002076 | Bacteria | 4684 |
| 25 | JGI24034J26672_10000022 | 3300002239 | Bacteria | 116342 |
| 26 | JGI24742J22300_10002170 | 3300002244 | Bacteria | 3126 |
| 27 | JGI24751J29686_10000481 | 3300002459 | Bacteria | 11844 |
| 28 | JGI24751J29686_10009441 | 3300002459 | Bacteria | 2005 |
| 29 | JGI24751J29686_10022625 | 3300002459 | Bacteria | 1304 |
| 30 | JGI25153J46596_10000119 | 3300003215 | Bacteria | 89604 |
| 31 | JGI25153J46596_10044147 | 3300003215 | Bacteria | 1343 |
| 32 | Ga0055525_1000070 | 3300003759 | Bacteria | 183047 |
| 33 | Ga0055542_1000102 | 3300003762 | Bacteria | 115614 |
| 34 | Ga0055529_1000520 | 3300003763 | Bacteria | 33667 |
| 35 | Ga0055524_1000155 | 3300003775 | Bacteria | 79672 |
| 36 | Ga0055530_10000202 | 3300003791 | Bacteria | 53648 |
| 37 | Ga0055530_10015115 | 3300003791 | Bacteria | 2540 |
| 38 | Ga0055531_10000090 | 3300003794 | Bacteria | 100342 |
| 39 | Ga0055531_10001103 | 3300003794 | Bacteria | 21032 |
| 40 | Ga0065165_1008857 | 3300005262 | Bacteria | 4620 |
| 41 | Ga0065704_10004352 | 3300005289 | Bacteria | 6496 |
| 42 | Ga0065704_10076327 | 3300005289 | Bacteria | 5135 |
| 43 | Ga0065704_10098162 | 3300005289 | Bacteria | 2363 |
| 44 | Ga0065707_10082164 | 3300005295 | Bacteria | 20479 |
| 45 | Ga0070658_10003391 | 3300005327 | Bacteria | 13120 |
| 46 | Ga0070658_10016648 | 3300005327 | Bacteria | 5884 |
| 47 | Ga0070658_10021169 | 3300005327 | Bacteria | 5209 |
| 48 | Ga0070658_10112831 | 3300005327 | Bacteria | 2253 |
| 49 | Ga0070658_10153388 | 3300005327 | Bacteria | 1929 |
| 50 | Ga0070658_10283690 | 3300005327 | Bacteria | 1410 |
| 51 | Ga0070676_10027030 | 3300005328 | Bacteria | 3252 |
| 52 | Ga0070683_100026014 | 3300005329 | Bacteria | 5263 |
| 53 | Ga0070690_100000056 | 3300005330 | Bacteria | 54517 |
| 54 | Ga0070670_100001143 | 3300005331 | Bacteria | 21059 |
| 55 | Ga0070670_100012295 | 3300005331 | Bacteria | 7324 |
| 56 | Ga0070670_100016761 | 3300005331 | Bacteria | 6288 |
| 57 | Ga0070670_100030233 | 3300005331 | Bacteria | 4664 |
| 58 | Ga0070670_100064201 | 3300005331 | Bacteria | 3151 |
| 59 | Ga0070670_100095651 | 3300005331 | Bacteria | 2555 |
| 60 | Ga0070670_100440177 | 3300005331 | Bacteria | 1154 |
| 61 | Ga0070666_10000002 | 3300005335 | Bacteria | 478684 |
| 62 | Ga0070666_10000177 | 3300005335 | Bacteria | 43707 |
| 63 | Ga0070666_10005062 | 3300005335 | Bacteria | 8066 |
| 64 | Ga0070666_10015560 | 3300005335 | Bacteria | 4854 |
| 65 | Ga0070680_100209111 | 3300005336 | Bacteria | 1646 |
| 66 | Ga0068868_100000182 | 3300005338 | Bacteria | 42019 |
| 67 | Ga0070660_100000364 | 3300005339 | Bacteria | 30100 |
| 68 | Ga0070660_100007526 | 3300005339 | Bacteria | 7591 |
| 69 | Ga0070689_100003288 | 3300005340 | Bacteria | 10735 |
| 70 | Ga0070689_100074859 | 3300005340 | Bacteria | 2650 |
| 71 | Ga0070668_100000031 | 3300005347 | Bacteria | 87761 |
| 72 | Ga0070668_100000158 | 3300005347 | Bacteria | 43238 |
| 73 | Ga0070668_100003381 | 3300005347 | Bacteria | 11768 |
| 74 | Ga0070668_100018199 | 3300005347 | Bacteria | 5272 |
| 75 | Ga0070668_100166226 | 3300005347 | Bacteria | 1793 |
| 76 | Ga0070668_100201825 | 3300005347 | Bacteria | 1632 |
| 77 | Ga0070668_100273853 | 3300005347 | Bacteria | 1408 |
| 78 | Ga0070669_100000052 | 3300005353 | Bacteria | 114467 |
| 79 | Ga0070669_100000136 | 3300005353 | Bacteria | 66350 |
| 80 | Ga0070669_100000170 | 3300005353 | Bacteria | 57161 |
| 81 | Ga0070669_100031436 | 3300005353 | Bacteria | 3835 |
| 82 | Ga0070669_100120461 | 3300005353 | Bacteria | 2001 |
| 83 | Ga0070669_100218277 | 3300005353 | Bacteria | 1507 |
| 84 | Ga0070669_100361247 | 3300005353 | Bacteria | 1181 |
| 85 | Ga0070671_100000005 | 3300005355 | Bacteria | 256547 |
| 86 | Ga0070671_100000081 | 3300005355 | Bacteria | 60882 |
| 87 | Ga0070671_100017013 | 3300005355 | Bacteria | 5881 |
| 88 | Ga0070671_100021128 | 3300005355 | Bacteria | 5315 |
| 89 | Ga0070671_100021681 | 3300005355 | Bacteria | 5247 |
| 90 | Ga0070671_100059830 | 3300005355 | Bacteria | 3171 |
| 91 | Ga0070674_100001545 | 3300005356 | Bacteria | 12316 |
| 92 | Ga0070674_100003399 | 3300005356 | Bacteria | 8923 |
| 93 | Ga0070688_100002242 | 3300005365 | Bacteria | 9749 |
| 94 | Ga0070659_100000022 | 3300005366 | Bacteria | 154091 |
| 95 | Ga0070659_100002729 | 3300005366 | Bacteria | 12564 |
| 96 | Ga0070659_100219976 | 3300005366 | Bacteria | 1567 |
| 97 | Ga0070667_100000004 | 3300005367 | Bacteria | 444091 |
| 98 | Ga0070667_100000081 | 3300005367 | Bacteria | 118819 |
| 99 | Ga0070667_100001233 | 3300005367 | Bacteria | 23231 |
| 100 | Ga0070667_100009025 | 3300005367 | Bacteria | 8252 |
| 101 | Ga0070667_100031993 | 3300005367 | Bacteria | 4386 |
| 102 | Ga0070709_10039814 | 3300005434 | Bacteria | 2886 |
| 103 | Ga0070714_100038777 | 3300005435 | Bacteria | 4007 |
| 104 | Ga0070713_100085122 | 3300005436 | Bacteria | 2707 |
| 105 | Ga0070713_100498344 | 3300005436 | Bacteria | 1149 |
| 106 | Ga0070710_10042976 | 3300005437 | Bacteria | 2501 |
| 107 | Ga0070711_100370614 | 3300005439 | Bacteria | 1155 |
| 108 | Ga0070708_100019929 | 3300005445 | Bacteria | 5645 |
| 109 | Ga0070708_100170630 | 3300005445 | Bacteria | 2031 |
| 110 | Ga0070708_100523055 | 3300005445 | Bacteria | 1119 |
| 111 | Ga0070663_100001009 | 3300005455 | Bacteria | 15347 |
| 112 | Ga0070663_100005371 | 3300005455 | Bacteria | 7609 |
| 113 | Ga0070663_100040887 | 3300005455 | Bacteria | 3248 |
| 114 | Ga0070663_100182250 | 3300005455 | Bacteria | 1630 |
| 115 | Ga0070663_100238032 | 3300005455 | Bacteria | 1436 |
| 116 | Ga0070678_100000139 | 3300005456 | Bacteria | 29667 |
| 117 | Ga0070662_100008659 | 3300005457 | Bacteria | 6638 |
| 118 | Ga0070662_100010089 | 3300005457 | Bacteria | 6187 |
| 119 | Ga0070662_100026714 | 3300005457 | Bacteria | 4000 |
| 120 | Ga0070681_10030096 | 3300005458 | Bacteria | 5447 |
| 121 | Ga0070681_10175057 | 3300005458 | Bacteria | 2067 |
| 122 | Ga0070681_10260837 | 3300005458 | Bacteria | 1645 |
| 123 | Ga0070685_10031819 | 3300005466 | Bacteria | 2950 |
| 124 | Ga0070706_100000006 | 3300005467 | Bacteria | 262251 |
| 125 | Ga0070698_100004136 | 3300005471 | Bacteria | 15959 |
| 126 | Ga0070698_100163773 | 3300005471 | Bacteria | 2167 |
| 127 | Ga0070699_100238274 | 3300005518 | Bacteria | 1623 |
| 128 | Ga0070679_100002476 | 3300005530 | Bacteria | 16722 |
| 129 | Ga0070679_100054902 | 3300005530 | Bacteria | 3967 |
| 130 | Ga0070679_100083331 | 3300005530 | Bacteria | 3186 |
| 131 | Ga0070679_100175843 | 3300005530 | Bacteria | 2113 |
| 132 | Ga0070697_100008183 | 3300005536 | Bacteria | 8163 |
| 133 | Ga0070697_100071394 | 3300005536 | Bacteria | 2847 |
| 134 | Ga0068853_100002599 | 3300005539 | Bacteria | 13574 |
| 135 | Ga0068853_100025281 | 3300005539 | Bacteria | 4983 |
| 136 | Ga0068853_100042414 | 3300005539 | Bacteria | 3890 |
| 137 | Ga0068853_100202371 | 3300005539 | Bacteria | 1807 |
| 138 | Ga0070672_100357351 | 3300005543 | Bacteria | 1246 |
| 139 | Ga0070686_100000003 | 3300005544 | Bacteria | 308397 |
| 140 | Ga0070665_100000011 | 3300005548 | Bacteria | 525539 |
| 141 | Ga0070665_100000036 | 3300005548 | Bacteria | 314603 |
| 142 | Ga0070665_100012821 | 3300005548 | Bacteria | 8441 |
| 143 | Ga0070665_100103386 | 3300005548 | Bacteria | 2852 |
| 144 | Ga0068855_100000573 | 3300005563 | Bacteria | 45131 |
| 145 | Ga0068855_100022640 | 3300005563 | Bacteria | 7529 |
| 146 | Ga0068855_100052109 | 3300005563 | Bacteria | 4818 |
| 147 | Ga0068855_100067455 | 3300005563 | Bacteria | 4167 |
| 148 | Ga0070664_100027493 | 3300005564 | Bacteria | 4727 |
| 149 | Ga0070664_100253726 | 3300005564 | Bacteria | 1582 |
| 150 | Ga0070664_100302327 | 3300005564 | Bacteria | 1446 |
| 151 | Ga0068857_100065537 | 3300005577 | Bacteria | 3230 |
| 152 | Ga0068857_100251598 | 3300005577 | Bacteria | 1620 |
| 153 | Ga0068854_100100486 | 3300005578 | Bacteria | 2168 |
| 154 | Ga0068856_100007034 | 3300005614 | Bacteria | 10991 |
| 155 | Ga0068856_100308578 | 3300005614 | Bacteria | 1600 |
| 156 | Ga0068852_100089119 | 3300005616 | Bacteria | 2756 |
| 157 | Ga0068852_100212345 | 3300005616 | Bacteria | 1836 |
| 158 | Ga0068852_100272948 | 3300005616 | Bacteria | 1628 |
| 159 | Ga0068852_100359962 | 3300005616 | Bacteria | 1423 |
| 160 | Ga0068859_100000484 | 3300005617 | Bacteria | 39271 |
| 161 | Ga0068859_100006473 | 3300005617 | Bacteria | 11885 |
| 162 | Ga0068859_100138192 | 3300005617 | Bacteria | 2510 |
| 163 | Ga0068864_100000017 | 3300005618 | Bacteria | 285607 |
| 164 | Ga0068864_100000114 | 3300005618 | Bacteria | 79636 |
| 165 | Ga0068864_100006151 | 3300005618 | Bacteria | 9843 |
| 166 | Ga0068864_100020255 | 3300005618 | Bacteria | 5564 |
| 167 | Ga0068864_100028618 | 3300005618 | Bacteria | 4712 |
| 168 | Ga0068864_100184524 | 3300005618 | Bacteria | 1909 |
| 169 | Ga0068864_100368589 | 3300005618 | Bacteria | 1359 |
| 170 | Ga0068861_100000391 | 3300005719 | Bacteria | 25251 |
| 171 | Ga0068861_100004430 | 3300005719 | Bacteria | 9420 |
| 172 | Ga0068861_100007195 | 3300005719 | Bacteria | 7624 |
| 173 | Ga0068861_100008877 | 3300005719 | Bacteria | 6928 |
| 174 | Ga0068851_10010455 | 3300005834 | Bacteria | 4335 |
| 175 | Ga0068851_10034883 | 3300005834 | Bacteria | 2513 |
| 176 | Ga0068863_100000018 | 3300005841 | Bacteria | 206948 |
| 177 | Ga0068863_100000028 | 3300005841 | Bacteria | 181662 |
| 178 | Ga0068863_100000095 | 3300005841 | Bacteria | 96080 |
| 179 | Ga0068863_100000103 | 3300005841 | Bacteria | 91380 |
| 180 | Ga0068863_100000459 | 3300005841 | Bacteria | 41571 |
| 181 | Ga0068863_100007873 | 3300005841 | Bacteria | 10421 |
| 182 | Ga0068863_100028365 | 3300005841 | Bacteria | 5345 |
| 183 | Ga0068863_100155059 | 3300005841 | Bacteria | 2193 |
| 184 | Ga0068858_100000332 | 3300005842 | Bacteria | 50007 |
| 185 | Ga0068858_100000953 | 3300005842 | Bacteria | 29927 |
| 186 | Ga0068858_100006139 | 3300005842 | Bacteria | 11719 |
| 187 | Ga0068858_100025093 | 3300005842 | Bacteria | 5547 |
| 188 | Ga0068858_100125046 | 3300005842 | Bacteria | 2407 |
| 189 | Ga0068858_100282254 | 3300005842 | Bacteria | 1581 |
| 190 | Ga0068860_100000001 | 3300005843 | Bacteria | 703043 |
| 191 | Ga0068860_100000002 | 3300005843 | Bacteria | 627849 |
| 192 | Ga0068860_100000093 | 3300005843 | Bacteria | 150034 |
| 193 | Ga0068860_100002238 | 3300005843 | Bacteria | 20365 |
| 194 | Ga0068860_100007641 | 3300005843 | Bacteria | 10816 |
| 195 | Ga0068860_100022488 | 3300005843 | Bacteria | 6097 |
| 196 | Ga0068860_100022991 | 3300005843 | Bacteria | 6029 |
| 197 | Ga0068860_100046017 | 3300005843 | Bacteria | 4161 |
| 198 | Ga0068860_100056603 | 3300005843 | Bacteria | 3727 |
| 199 | Ga0068862_100000010 | 3300005844 | Bacteria | 285607 |
| 200 | Ga0068862_100000099 | 3300005844 | Bacteria | 103870 |
| 201 | Ga0068862_100000721 | 3300005844 | Bacteria | 33533 |
| 202 | Ga0068862_100000924 | 3300005844 | Bacteria | 28406 |
| 203 | Ga0068862_100001440 | 3300005844 | Bacteria | 21979 |
| 204 | Ga0068862_100007519 | 3300005844 | Bacteria | 9027 |
| 205 | Ga0068862_100127906 | 3300005844 | Bacteria | 2244 |
| 206 | Ga0068862_100168856 | 3300005844 | Bacteria | 1957 |
| 207 | Ga0068862_100250749 | 3300005844 | Bacteria | 1613 |
| 208 | Ga0068862_100542078 | 3300005844 | Bacteria | 1110 |
| 209 | Ga0081455_10001105 | 3300005937 | Bacteria | 33920 |
| 210 | Ga0081538_10003537 | 3300005981 | Bacteria | 14695 |
| 211 | Ga0081540_1008827 | 3300005983 | Bacteria | 6998 |
| 212 | Ga0070717_10004405 | 3300006028 | Bacteria | 10165 |
| 213 | Ga0070717_10259400 | 3300006028 | Bacteria | 1537 |
| 214 | Ga0075368_10000448 | 3300006042 | Bacteria | 12173 |
| 215 | Ga0075368_10003888 | 3300006042 | Bacteria | 5028 |
| 216 | Ga0070712_100031989 | 3300006175 | Bacteria | 3549 |
| 217 | Ga0075362_10000497 | 3300006177 | Bacteria | 11481 |
| 218 | Ga0075367_10001865 | 3300006178 | Bacteria | 9310 |
| 219 | Ga0075367_10032537 | 3300006178 | Bacteria | 3002 |
| 220 | Ga0075369_10021161 | 3300006186 | Bacteria | 2670 |
| 221 | Ga0075369_10050434 | 3300006186 | Bacteria | 1800 |
| 222 | Ga0075366_10003329 | 3300006195 | Bacteria | 8458 |
| 223 | Ga0097621_100060411 | 3300006237 | Bacteria | 3107 |
| 224 | Ga0097621_100122775 | 3300006237 | Bacteria | 2205 |
| 225 | Ga0075370_10014121 | 3300006353 | Bacteria | 4254 |
| 226 | Ga0075430_100020444 | 3300006846 | Bacteria | 5631 |
| 227 | Ga0075431_100066774 | 3300006847 | Bacteria | 3714 |
| 228 | Ga0068865_100061812 | 3300006881 | Bacteria | 2627 |
| 229 | Ga0068865_100277114 | 3300006881 | Bacteria | 1334 |
| 230 | Ga0097620_100000484 | 3300006931 | Bacteria | 39271 |
| 231 | Ga0097620_100006473 | 3300006931 | Bacteria | 11885 |
| 232 | Ga0097620_100138184 | 3300006931 | Bacteria | 2510 |
| 233 | Ga0099794_10000021 | 3300007265 | Bacteria | 66385 |
| 234 | Ga0099795_10048486 | 3300007788 | Bacteria | 1538 |
| 235 | Ga0105251_10000568 | 3300009011 | Bacteria | 34626 |
| 236 | Ga0105240_10056443 | 3300009093 | Bacteria | 4914 |
| 237 | Ga0105240_10100638 | 3300009093 | Bacteria | 3516 |
| 238 | Ga0105240_10728524 | 3300009093 | Bacteria | 1080 |
| 239 | Ga0111539_10175324 | 3300009094 | Bacteria | 2505 |
| 240 | Ga0105245_10183139 | 3300009098 | Bacteria | 2002 |
| 241 | Ga0105247_10000201 | 3300009101 | Bacteria | 58586 |
| 242 | Ga0105247_10001097 | 3300009101 | Bacteria | 20134 |
| 243 | Ga0105243_10000367 | 3300009148 | Bacteria | 48386 |
| 244 | Ga0105243_10016334 | 3300009148 | Bacteria | 5616 |
| 245 | Ga0105241_10001357 | 3300009174 | Bacteria | 18634 |
| 246 | Ga0105241_10007520 | 3300009174 | Bacteria | 8014 |
| 247 | Ga0105241_10229759 | 3300009174 | Bacteria | 1563 |
| 248 | Ga0105241_10252634 | 3300009174 | Bacteria | 1495 |
| 249 | Ga0105248_10000128 | 3300009177 | Bacteria | 87735 |
| 250 | Ga0105248_10001723 | 3300009177 | Bacteria | 24308 |
| 251 | Ga0105248_10006900 | 3300009177 | Bacteria | 12444 |
| 252 | Ga0105248_10008146 | 3300009177 | Bacteria | 11508 |
| 253 | Ga0105248_10049162 | 3300009177 | Bacteria | 4730 |
| 254 | Ga0105248_10081893 | 3300009177 | Bacteria | 3629 |
| 255 | Ga0105248_10283150 | 3300009177 | Bacteria | 1866 |
| 256 | Ga0105248_10489999 | 3300009177 | Bacteria | 1386 |
| 257 | Ga0105237_10017796 | 3300009545 | Bacteria | 7368 |
| 258 | Ga0105237_10376154 | 3300009545 | Bacteria | 1425 |
| 259 | Ga0105238_10193088 | 3300009551 | Bacteria | 2012 |
| 260 | Ga0105238_10259608 | 3300009551 | Bacteria | 1717 |
| 261 | Ga0105249_10000026 | 3300009553 | Bacteria | 232053 |
| 262 | Ga0105249_10000173 | 3300009553 | Bacteria | 75519 |
| 263 | Ga0105249_10000797 | 3300009553 | Bacteria | 28324 |
| 264 | Ga0105249_10001541 | 3300009553 | Bacteria | 20225 |
| 265 | Ga0105148_100001 | 3300009978 | Bacteria | 58900 |
| 266 | Ga0105147_100489 | 3300009982 | Bacteria | 3239 |
| 267 | Ga0157373_10007763 | 3300013100 | Bacteria | 7975 |
| 268 | Ga0157373_10129087 | 3300013100 | Bacteria | 1777 |
| 269 | Ga0157373_10175173 | 3300013100 | Bacteria | 1510 |
| 270 | Ga0157371_10000793 | 3300013102 | Bacteria | 36288 |
| 271 | Ga0157371_10002588 | 3300013102 | Bacteria | 17163 |
| 272 | Ga0157371_10037986 | 3300013102 | Bacteria | 3445 |
| 273 | Ga0157370_10007620 | 3300013104 | Bacteria | 11758 |
| 274 | Ga0157370_10025526 | 3300013104 | Bacteria | 5850 |
| 275 | Ga0157370_10068145 | 3300013104 | Bacteria | 3363 |
| 276 | Ga0157369_10053991 | 3300013105 | Bacteria | 4339 |
| 277 | Ga0157369_10272486 | 3300013105 | Bacteria | 1763 |
| 278 | Ga0157378_10017918 | 3300013297 | Bacteria | 6216 |
| 279 | Ga0163162_10005464 | 3300013306 | Bacteria | 12280 |
| 280 | Ga0163162_10022371 | 3300013306 | Bacteria | 6230 |
| 281 | Ga0163162_10037199 | 3300013306 | Bacteria | 4855 |
| 282 | Ga0163162_10076303 | 3300013306 | Bacteria | 3413 |
| 283 | Ga0163162_10835823 | 3300013306 | Bacteria | 1037 |
| 284 | Ga0157372_10229429 | 3300013307 | Bacteria | 2152 |
| 285 | Ga0163163_10133816 | 3300014325 | Bacteria | 2519 |
| 286 | Ga0163163_10486080 | 3300014325 | Bacteria | 1296 |
| 287 | Ga0157380_10002745 | 3300014326 | Bacteria | 11947 |
| 288 | Ga0157380_10002769 | 3300014326 | Bacteria | 11907 |
| 289 | Ga0157380_10012455 | 3300014326 | Bacteria | 6171 |
| 290 | Ga0157379_10005857 | 3300014968 | Bacteria | 10572 |
| 291 | Ga0157379_10195244 | 3300014968 | Bacteria | 1829 |
| 292 | Ga0163161_10000008 | 3300017792 | Bacteria | 294642 |
| 293 | Ga0163161_10000848 | 3300017792 | Bacteria | 23837 |
| 294 | Ga0163161_10023698 | 3300017792 | Bacteria | 4332 |
| 295 | Ga0163161_10038545 | 3300017792 | Bacteria | 3428 |
| 296 | Ga0163161_10141345 | 3300017792 | Bacteria | 1823 |
| 297 | Ga0213873_10000021 | 3300021358 | Bacteria | 113830 |
| 298 | Ga0213876_10000050 | 3300021384 | Bacteria | 144836 |
| 299 | Ga0213876_10068527 | 3300021384 | Bacteria | 1874 |
| 300 | Ga0213875_10000970 | 3300021388 | Bacteria | 20525 |
| 301 | Ga0228598_1008452 | 3300024227 | Bacteria | 2078 |
| 302 | Ga0207672_1000347 | 3300025223 | Bacteria | 6111 |
| 303 | Ga0209147_103087 | 3300025229 | Bacteria | 3482 |
| 304 | Ga0209563_100053 | 3300025230 | Bacteria | 332370 |
| 305 | Ga0207425_1014330 | 3300025245 | Bacteria | 1802 |
| 306 | Ga0209677_108087 | 3300025253 | Bacteria | 2102 |
| 307 | Ga0209148_1000159 | 3300025254 | Bacteria | 139560 |
| 308 | Ga0209565_1000011 | 3300025263 | Bacteria | 637062 |
| 309 | Ga0209455_1000045 | 3300025272 | Bacteria | 383329 |
| 310 | Ga0209673_1003151 | 3300025273 | Bacteria | 10073 |
| 311 | Ga0209564_1022143 | 3300025295 | Bacteria | 2255 |
| 312 | Ga0209758_1000328 | 3300025297 | Bacteria | 89656 |
| 313 | Ga0209758_1006749 | 3300025297 | Bacteria | 8074 |
| 314 | Ga0209050_1000051 | 3300025298 | Bacteria | 353153 |
| 315 | Ga0209050_1019568 | 3300025298 | Bacteria | 2564 |
| 316 | Ga0209256_1000016 | 3300025299 | Bacteria | 599092 |
| 317 | Ga0209257_1000028 | 3300025304 | Bacteria | 699493 |
| 318 | Ga0209257_1002691 | 3300025304 | Bacteria | 16999 |
| 319 | Ga0207656_10001389 | 3300025321 | Bacteria | 7995 |
| 320 | Ga0207656_10002248 | 3300025321 | Bacteria | 6472 |
| 321 | Ga0207656_10035337 | 3300025321 | Bacteria | 2092 |
| 322 | Ga0207656_10036837 | 3300025321 | Bacteria | 2055 |
| 323 | Ga0207656_10139628 | 3300025321 | Bacteria | 1141 |
| 324 | Ga0207713_1006583 | 3300025735 | Bacteria | 7052 |
| 325 | Ga0207682_10002753 | 3300025893 | Bacteria | 7791 |
| 326 | Ga0207710_10001219 | 3300025900 | Bacteria | 13064 |
| 327 | Ga0207680_10000004 | 3300025903 | Bacteria | 827324 |
| 328 | Ga0207680_10009261 | 3300025903 | Bacteria | 4876 |
| 329 | Ga0207680_10031024 | 3300025903 | Bacteria | 3024 |
| 330 | Ga0207680_10173349 | 3300025903 | Bacteria | 1454 |
| 331 | Ga0207647_10000861 | 3300025904 | Bacteria | 23527 |
| 332 | Ga0207647_10019099 | 3300025904 | Bacteria | 4615 |
| 333 | Ga0207647_10184934 | 3300025904 | Bacteria | 1209 |
| 334 | Ga0207645_10033635 | 3300025907 | Bacteria | 3294 |
| 335 | Ga0207705_10000294 | 3300025909 | Bacteria | 46555 |
| 336 | Ga0207705_10001756 | 3300025909 | Bacteria | 17138 |
| 337 | Ga0207705_10002561 | 3300025909 | Bacteria | 13978 |
| 338 | Ga0207705_10032368 | 3300025909 | Bacteria | 3736 |
| 339 | Ga0207705_10058767 | 3300025909 | Bacteria | 2774 |
| 340 | Ga0207705_10157923 | 3300025909 | Bacteria | 1702 |
| 341 | Ga0207705_10298353 | 3300025909 | Bacteria | 1236 |
| 342 | Ga0207684_10000004 | 3300025910 | Bacteria | 755956 |
| 343 | Ga0207684_10148588 | 3300025910 | Bacteria | 2016 |
| 344 | Ga0207654_10000436 | 3300025911 | Bacteria | 23923 |
| 345 | Ga0207654_10016953 | 3300025911 | Bacteria | 3802 |
| 346 | Ga0207707_10030145 | 3300025912 | Bacteria | 4744 |
| 347 | Ga0207707_10400614 | 3300025912 | Bacteria | 1178 |
| 348 | Ga0207695_10003647 | 3300025913 | Bacteria | 21506 |
| 349 | Ga0207695_10005423 | 3300025913 | Bacteria | 16927 |
| 350 | Ga0207695_10030897 | 3300025913 | Bacteria | 5890 |
| 351 | Ga0207695_10031869 | 3300025913 | Bacteria | 5776 |
| 352 | Ga0207695_10179699 | 3300025913 | Bacteria | 2037 |
| 353 | Ga0207671_10004057 | 3300025914 | Bacteria | 14199 |
| 354 | Ga0207671_10007219 | 3300025914 | Bacteria | 9677 |
| 355 | Ga0207693_10055554 | 3300025915 | Bacteria | 3106 |
| 356 | Ga0207660_10086756 | 3300025917 | Bacteria | 2311 |
| 357 | Ga0207657_10001613 | 3300025919 | Bacteria | 24264 |
| 358 | Ga0207657_10007485 | 3300025919 | Bacteria | 11190 |
| 359 | Ga0207657_10009830 | 3300025919 | Bacteria | 9583 |
| 360 | Ga0207657_10017821 | 3300025919 | Bacteria | 6799 |
| 361 | Ga0207657_10138370 | 3300025919 | Bacteria | 1991 |
| 362 | Ga0207657_10265965 | 3300025919 | Bacteria | 1364 |
| 363 | Ga0207657_10295321 | 3300025919 | Bacteria | 1284 |
| 364 | Ga0207649_10006484 | 3300025920 | Bacteria | 6354 |
| 365 | Ga0207652_10000474 | 3300025921 | Bacteria | 41182 |
| 366 | Ga0207652_10429992 | 3300025921 | Bacteria | 1190 |
| 367 | Ga0207646_10012705 | 3300025922 | Bacteria | 8082 |
| 368 | Ga0207646_10322525 | 3300025922 | Bacteria | 1396 |
| 369 | Ga0207681_10000046 | 3300025923 | Bacteria | 127902 |
| 370 | Ga0207681_10000188 | 3300025923 | Bacteria | 50361 |
| 371 | Ga0207681_10000588 | 3300025923 | Bacteria | 24733 |
| 372 | Ga0207681_10036798 | 3300025923 | Bacteria | 3231 |
| 373 | Ga0207681_10125081 | 3300025923 | Bacteria | 1892 |
| 374 | Ga0207694_10009277 | 3300025924 | Bacteria | 7423 |
| 375 | Ga0207694_10118050 | 3300025924 | Bacteria | 2116 |
| 376 | Ga0207694_10242330 | 3300025924 | Bacteria | 1474 |
| 377 | Ga0207650_10000199 | 3300025925 | Bacteria | 69216 |
| 378 | Ga0207650_10001094 | 3300025925 | Bacteria | 20023 |
| 379 | Ga0207650_10015388 | 3300025925 | Bacteria | 5326 |
| 380 | Ga0207659_10020886 | 3300025926 | Bacteria | 4337 |
| 381 | Ga0207687_10033482 | 3300025927 | Bacteria | 3486 |
| 382 | Ga0207687_10277787 | 3300025927 | Bacteria | 1341 |
| 383 | Ga0207700_10371694 | 3300025928 | Bacteria | 1248 |
| 384 | Ga0207644_10000008 | 3300025931 | Bacteria | 354219 |
| 385 | Ga0207644_10000038 | 3300025931 | Bacteria | 121482 |
| 386 | Ga0207644_10000170 | 3300025931 | Bacteria | 46372 |
| 387 | Ga0207644_10001088 | 3300025931 | Bacteria | 17430 |
| 388 | Ga0207644_10010610 | 3300025931 | Bacteria | 6074 |
| 389 | Ga0207644_10026293 | 3300025931 | Bacteria | 4009 |
| 390 | Ga0207644_10179621 | 3300025931 | Bacteria | 1658 |
| 391 | Ga0207690_10000003 | 3300025932 | Bacteria | 783011 |
| 392 | Ga0207690_10004751 | 3300025932 | Bacteria | 8019 |
| 393 | Ga0207706_10001335 | 3300025933 | Bacteria | 24697 |
| 394 | Ga0207706_10010105 | 3300025933 | Bacteria | 8642 |
| 395 | Ga0207706_10013575 | 3300025933 | Bacteria | 7400 |
| 396 | Ga0207709_10000047 | 3300025935 | Bacteria | 238649 |
| 397 | Ga0207709_10131151 | 3300025935 | Bacteria | 1708 |
| 398 | Ga0207670_10003876 | 3300025936 | Bacteria | 7975 |
| 399 | Ga0207670_10368470 | 3300025936 | Bacteria | 1141 |
| 400 | Ga0207669_10000361 | 3300025937 | Bacteria | 20623 |
| 401 | Ga0207669_10013539 | 3300025937 | Bacteria | 4054 |
| 402 | Ga0207704_10288126 | 3300025938 | Bacteria | 1252 |
| 403 | Ga0207691_10190241 | 3300025940 | Bacteria | 1790 |
| 404 | Ga0207691_10232379 | 3300025940 | Bacteria | 1596 |
| 405 | Ga0207691_10376527 | 3300025940 | Bacteria | 1212 |
| 406 | Ga0207711_10000031 | 3300025941 | Bacteria | 203323 |
| 407 | Ga0207711_10000222 | 3300025941 | Bacteria | 60984 |
| 408 | Ga0207711_10023502 | 3300025941 | Bacteria | 5159 |
| 409 | Ga0207711_10026962 | 3300025941 | Bacteria | 4823 |
| 410 | Ga0207661_10114288 | 3300025944 | Bacteria | 2289 |
| 411 | Ga0207661_10188778 | 3300025944 | Bacteria | 1805 |
| 412 | Ga0207661_10199323 | 3300025944 | Bacteria | 1759 |
| 413 | Ga0207661_10514272 | 3300025944 | Bacteria | 1095 |
| 414 | Ga0207679_10072613 | 3300025945 | Bacteria | 2600 |
| 415 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 416 | Ga0207667_10001495 | 3300025949 | Bacteria | 29331 |
| 417 | Ga0207667_10004469 | 3300025949 | Bacteria | 17115 |
| 418 | Ga0207667_10014622 | 3300025949 | Bacteria | 8937 |
| 419 | Ga0207667_10064711 | 3300025949 | Bacteria | 3816 |
| 420 | Ga0207667_10096985 | 3300025949 | Bacteria | 3043 |
| 421 | Ga0207651_10135531 | 3300025960 | Bacteria | 1893 |
| 422 | Ga0207712_10000001 | 3300025961 | Bacteria | 750309 |
| 423 | Ga0207712_10000026 | 3300025961 | Bacteria | 271237 |
| 424 | Ga0207712_10000541 | 3300025961 | Bacteria | 30768 |
| 425 | Ga0207712_10004100 | 3300025961 | Bacteria | 9195 |
| 426 | Ga0207668_10000024 | 3300025972 | Bacteria | 131871 |
| 427 | Ga0207668_10000616 | 3300025972 | Bacteria | 22155 |
| 428 | Ga0207668_10000626 | 3300025972 | Bacteria | 21905 |
| 429 | Ga0207668_10011041 | 3300025972 | Bacteria | 5477 |
| 430 | Ga0207668_10201593 | 3300025972 | Bacteria | 1585 |
| 431 | Ga0207640_10001051 | 3300025981 | Bacteria | 15254 |
| 432 | Ga0207640_10027744 | 3300025981 | Bacteria | 3453 |
| 433 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 434 | Ga0207658_10000062 | 3300025986 | Bacteria | 118845 |
| 435 | Ga0207658_10000627 | 3300025986 | Bacteria | 31226 |
| 436 | Ga0207658_10000832 | 3300025986 | Bacteria | 25782 |
| 437 | Ga0207658_10001112 | 3300025986 | Bacteria | 21725 |
| 438 | Ga0207658_10003195 | 3300025986 | Bacteria | 11669 |
| 439 | Ga0207658_10139406 | 3300025986 | Bacteria | 1960 |
| 440 | Ga0207703_10002154 | 3300026035 | Bacteria | 17303 |
| 441 | Ga0207703_10003684 | 3300026035 | Bacteria | 12768 |
| 442 | Ga0207703_10004842 | 3300026035 | Bacteria | 10953 |
| 443 | Ga0207703_10114264 | 3300026035 | Bacteria | 2308 |
| 444 | Ga0207703_10145526 | 3300026035 | Bacteria | 2061 |
| 445 | Ga0207639_10000815 | 3300026041 | Bacteria | 21193 |
| 446 | Ga0207639_10004049 | 3300026041 | Bacteria | 9885 |
| 447 | Ga0207639_10028114 | 3300026041 | Bacteria | 4103 |
| 448 | Ga0207639_10050897 | 3300026041 | Bacteria | 3148 |
| 449 | Ga0207639_10057898 | 3300026041 | Bacteria | 2978 |
| 450 | Ga0207639_10242712 | 3300026041 | Bacteria | 1567 |
| 451 | Ga0207678_10000080 | 3300026067 | Bacteria | 78553 |
| 452 | Ga0207678_10009812 | 3300026067 | Bacteria | 8419 |
| 453 | Ga0207678_10010539 | 3300026067 | Bacteria | 8118 |
| 454 | Ga0207678_10234946 | 3300026067 | Bacteria | 1570 |
| 455 | Ga0207702_10003704 | 3300026078 | Bacteria | 13830 |
| 456 | Ga0207702_10004491 | 3300026078 | Bacteria | 12384 |
| 457 | Ga0207702_10004975 | 3300026078 | Bacteria | 11677 |
| 458 | Ga0207702_10480983 | 3300026078 | Bacteria | 1208 |
| 459 | Ga0207641_10000002 | 3300026088 | Bacteria | 981004 |
| 460 | Ga0207641_10000014 | 3300026088 | Bacteria | 336170 |
| 461 | Ga0207641_10000113 | 3300026088 | Bacteria | 119188 |
| 462 | Ga0207641_10000148 | 3300026088 | Bacteria | 99601 |
| 463 | Ga0207641_10000179 | 3300026088 | Bacteria | 88061 |
| 464 | Ga0207641_10001495 | 3300026088 | Bacteria | 22870 |
| 465 | Ga0207641_10002154 | 3300026088 | Bacteria | 18554 |
| 466 | Ga0207641_10004408 | 3300026088 | Bacteria | 12197 |
| 467 | Ga0207641_10046468 | 3300026088 | Bacteria | 3660 |
| 468 | Ga0207676_10000005 | 3300026095 | Bacteria | 698744 |
| 469 | Ga0207676_10000479 | 3300026095 | Bacteria | 33652 |
| 470 | Ga0207676_10001056 | 3300026095 | Bacteria | 20977 |
| 471 | Ga0207676_10001265 | 3300026095 | Bacteria | 18803 |
| 472 | Ga0207676_10006523 | 3300026095 | Bacteria | 8250 |
| 473 | Ga0207676_10017180 | 3300026095 | Bacteria | 5242 |
| 474 | Ga0207676_10031475 | 3300026095 | Bacteria | 3991 |
| 475 | Ga0207676_10221341 | 3300026095 | Bacteria | 1686 |
| 476 | Ga0207676_10352486 | 3300026095 | Bacteria | 1361 |
| 477 | Ga0207674_10005854 | 3300026116 | Bacteria | 14578 |
| 478 | Ga0207674_10011027 | 3300026116 | Bacteria | 10165 |
| 479 | Ga0207674_10011489 | 3300026116 | Bacteria | 9946 |
| 480 | Ga0207674_10020838 | 3300026116 | Bacteria | 7076 |
| 481 | Ga0207675_100000048 | 3300026118 | Bacteria | 84512 |
| 482 | Ga0207675_100000584 | 3300026118 | Bacteria | 35641 |
| 483 | Ga0207675_100004475 | 3300026118 | Bacteria | 13506 |
| 484 | Ga0207675_100016337 | 3300026118 | Bacteria | 6928 |
| 485 | Ga0207683_10001314 | 3300026121 | Bacteria | 22455 |
| 486 | Ga0207698_10002750 | 3300026142 | Bacteria | 10489 |
| 487 | Ga0207698_10012373 | 3300026142 | Bacteria | 5580 |
| 488 | Ga0207698_10012634 | 3300026142 | Bacteria | 5533 |
| 489 | Ga0207698_10069993 | 3300026142 | Bacteria | 2778 |
| 490 | Ga0207698_10203678 | 3300026142 | Bacteria | 1774 |
| 491 | Ga0207698_10224304 | 3300026142 | Bacteria | 1701 |
| 492 | Ga0209970_1009139 | 3300027614 | Bacteria | 1621 |
| 493 | Ga0209588_1000027 | 3300027671 | Bacteria | 80998 |
| 494 | Ga0209813_10000230 | 3300027866 | Bacteria | 17157 |
| 495 | Ga0209813_10000578 | 3300027866 | Bacteria | 8550 |
| 496 | Ga0209974_10002593 | 3300027876 | Bacteria | 6567 |
| 497 | Ga0209974_10011023 | 3300027876 | Bacteria | 3043 |
| 498 | Ga0209974_10014065 | 3300027876 | Bacteria | 2666 |
| 499 | Ga0268266_10000042 | 3300028379 | Bacteria | 316826 |
| 500 | Ga0268266_10000063 | 3300028379 | Bacteria | 253339 |
| 501 | Ga0268266_10000487 | 3300028379 | Bacteria | 56915 |
| 502 | Ga0268266_10002389 | 3300028379 | Bacteria | 20264 |
| 503 | Ga0268266_10080988 | 3300028379 | Bacteria | 2830 |
| 504 | Ga0268265_10000003 | 3300028380 | Bacteria | 949201 |
| 505 | Ga0268265_10000084 | 3300028380 | Bacteria | 119522 |
| 506 | Ga0268265_10000269 | 3300028380 | Bacteria | 58934 |
| 507 | Ga0268265_10000358 | 3300028380 | Bacteria | 49394 |
| 508 | Ga0268265_10001122 | 3300028380 | Bacteria | 23704 |
| 509 | Ga0268265_10007014 | 3300028380 | Bacteria | 7619 |
| 510 | Ga0268265_10030321 | 3300028380 | Bacteria | 3893 |
| 511 | Ga0268265_10032828 | 3300028380 | Bacteria | 3767 |
| 512 | Ga0268265_10230880 | 3300028380 | Bacteria | 1626 |
| 513 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 514 | Ga0268264_10000006 | 3300028381 | Bacteria | 827324 |
| 515 | Ga0268264_10000067 | 3300028381 | Bacteria | 284445 |
| 516 | Ga0268264_10000406 | 3300028381 | Bacteria | 61180 |
| 517 | Ga0268264_10017300 | 3300028381 | Bacteria | 5907 |
| 518 | Ga0268264_10026074 | 3300028381 | Bacteria | 4773 |
| 519 | Ga0268264_10033448 | 3300028381 | Bacteria | 4224 |
| 520 | Ga0268264_10035077 | 3300028381 | Bacteria | 4130 |
| 521 | Ga0268264_10135058 | 3300028381 | Bacteria | 2192 |
| 522 | Ga0307517_10010279 | 3300028786 | Bacteria | 13119 |
| 523 | Ga0307517_10073454 | 3300028786 | Bacteria | 3031 |
| 524 | Ga0316181_1169913 | 3300030744 | Bacteria | 1836 |
| 525 | Ga0316182_1417669 | 3300030745 | Bacteria | 1096 |
| 526 | Ga0265327_10001060 | 3300031251 | Bacteria | 38391 |
| 527 | Ga0307513_10005129 | 3300031456 | Bacteria | 17343 |
| 528 | Ga0307513_10013356 | 3300031456 | Bacteria | 10085 |
| 529 | Ga0307408_100005149 | 3300031548 | Bacteria | 8766 |
| 530 | Ga0307408_100034516 | 3300031548 | Bacteria | 3543 |
| 531 | Ga0307408_100086745 | 3300031548 | Bacteria | 2353 |
| 532 | Ga0307408_100131621 | 3300031548 | Bacteria | 1952 |
| 533 | Ga0307408_100229082 | 3300031548 | Bacteria | 1520 |
| 534 | Ga0307408_100446226 | 3300031548 | Bacteria | 1121 |
| 535 | Ga0307405_10000196 | 3300031731 | Bacteria | 22239 |
| 536 | Ga0307405_10001629 | 3300031731 | Bacteria | 9548 |
| 537 | Ga0307405_10041649 | 3300031731 | Bacteria | 2790 |
| 538 | Ga0307405_10046590 | 3300031731 | Bacteria | 2665 |
| 539 | Ga0307405_10307445 | 3300031731 | Bacteria | 1205 |
| 540 | Ga0307413_10005246 | 3300031824 | Bacteria | 5755 |
| 541 | Ga0307413_10160139 | 3300031824 | Bacteria | 1580 |
| 542 | Ga0307410_10006608 | 3300031852 | Bacteria | 6270 |
| 543 | Ga0307410_10051247 | 3300031852 | Bacteria | 2780 |
| 544 | Ga0307410_10060579 | 3300031852 | Bacteria | 2587 |
| 545 | Ga0307410_10077483 | 3300031852 | Bacteria | 2324 |
| 546 | Ga0307410_10102499 | 3300031852 | Bacteria | 2054 |
| 547 | Ga0307406_10022429 | 3300031901 | Bacteria | 3745 |
| 548 | Ga0307406_10036829 | 3300031901 | Bacteria | 3017 |
| 549 | Ga0307406_10064020 | 3300031901 | Bacteria | 2384 |
| 550 | Ga0307406_10079341 | 3300031901 | Bacteria | 2177 |
| 551 | Ga0307406_10170478 | 3300031901 | Bacteria | 1574 |
| 552 | Ga0307406_10319479 | 3300031901 | Bacteria | 1200 |
| 553 | Ga0307407_10011741 | 3300031903 | Bacteria | 4184 |
| 554 | Ga0307407_10012754 | 3300031903 | Bacteria | 4053 |
| 555 | Ga0307407_10016909 | 3300031903 | Bacteria | 3644 |
| 556 | Ga0307407_10065949 | 3300031903 | Bacteria | 2134 |
| 557 | Ga0307412_10000206 | 3300031911 | Bacteria | 40298 |
| 558 | Ga0307412_10000348 | 3300031911 | Bacteria | 28830 |
| 559 | Ga0307412_10001536 | 3300031911 | Bacteria | 12772 |
| 560 | Ga0307412_10009535 | 3300031911 | Bacteria | 5573 |
| 561 | Ga0307412_10023398 | 3300031911 | Bacteria | 3801 |
| 562 | Ga0307412_10065913 | 3300031911 | Bacteria | 2453 |
| 563 | Ga0307412_10070727 | 3300031911 | Bacteria | 2379 |
| 564 | Ga0307412_10134058 | 3300031911 | Bacteria | 1804 |
| 565 | Ga0307412_10143895 | 3300031911 | Bacteria | 1750 |
| 566 | Ga0307412_10177944 | 3300031911 | Bacteria | 1597 |
| 567 | Ga0307409_100013972 | 3300031995 | Bacteria | 5197 |
| 568 | Ga0307409_100032819 | 3300031995 | Bacteria | 3770 |
| 569 | Ga0307409_100040966 | 3300031995 | Bacteria | 3455 |
| 570 | Ga0307409_100069187 | 3300031995 | Bacteria | 2795 |
| 571 | Ga0307409_100071646 | 3300031995 | Bacteria | 2756 |
| 572 | Ga0307409_100204214 | 3300031995 | Bacteria | 1770 |
| 573 | Ga0307416_100035478 | 3300032002 | Bacteria | 3809 |
| 574 | Ga0307416_100054276 | 3300032002 | Bacteria | 3220 |
| 575 | Ga0307416_100075784 | 3300032002 | Bacteria | 2816 |
| 576 | Ga0307416_100098595 | 3300032002 | Bacteria | 2535 |
| 577 | Ga0307416_100172467 | 3300032002 | Bacteria | 2016 |
| 578 | Ga0307416_100245203 | 3300032002 | Bacteria | 1739 |
| 579 | Ga0307416_100323317 | 3300032002 | Bacteria | 1546 |
| 580 | Ga0307414_10000105 | 3300032004 | Bacteria | 59546 |
| 581 | Ga0307414_10050459 | 3300032004 | Bacteria | 2882 |
| 582 | Ga0307414_10091975 | 3300032004 | Bacteria | 2256 |
| 583 | Ga0307414_10093543 | 3300032004 | Bacteria | 2241 |
| 584 | Ga0307414_10096462 | 3300032004 | Bacteria | 2212 |
| 585 | Ga0307414_10099110 | 3300032004 | Bacteria | 2188 |
| 586 | Ga0307414_10206985 | 3300032004 | Bacteria | 1600 |
| 587 | Ga0307414_10246010 | 3300032004 | Bacteria | 1483 |
| 588 | Ga0307411_10010805 | 3300032005 | Bacteria | 4888 |
| 589 | Ga0307411_10039173 | 3300032005 | Bacteria | 2996 |
| 590 | Ga0307411_10091073 | 3300032005 | Bacteria | 2129 |
| 591 | Ga0307411_10101592 | 3300032005 | Bacteria | 2035 |
| 592 | Ga0307415_100024741 | 3300032126 | Bacteria | 3756 |
| 593 | Ga0307415_100042979 | 3300032126 | Bacteria | 3011 |
| 594 | Ga0307415_100069300 | 3300032126 | Bacteria | 2473 |
| 595 | Ga0307415_100172174 | 3300032126 | Bacteria | 1689 |
| 596 | Ga0307415_100207705 | 3300032126 | Bacteria | 1559 |
| 597 | Ga0307415_100275605 | 3300032126 | Bacteria | 1380 |
| 598 | Ga0307415_100275610 | 3300032126 | Bacteria | 1380 |
| 599 | Ga0316583_10002571 | 3300032133 | Bacteria | 6326 |
| 600 | Ga0307510_10135340 | 3300033180 | Bacteria | 2124 |
| 601 | Ga0373954_0062041 | 3300035118 | Bacteria | 1765 |
| 602 | Ga0373955_0179617 | 3300035172 | Bacteria | 1255 |
| 603 | Ga0373933_0086048 | 3300035724 | Bacteria | 1934 |
| 604 | Ga0373937_0009491 | 3300036401 | Bacteria | 8459 |
| 605 | Ga0373937_0062941 | 3300036401 | Bacteria | 3411 |
| 606 | Ga0316582_0003260 | 3300036647 | Bacteria | 7916 |
| 607 | Ga0316582_0188192 | 3300036647 | Bacteria | 1406 |
| 608 | Ga0316584_0036022 | 3300036712 | Bacteria | 3672 |
| 609 | Ga0316584_0241479 | 3300036712 | Bacteria | 1322 |
| 610 | Ga0395900_0125025 | 3300037418 | Bacteria | 2637 |
| 611 | Ga0395905_0001203 | 3300037471 | Bacteria | 32348 |
| 612 | Ga0436364_0307891 | 3300037853 | Bacteria | 26050 |
| 613 | Ga0436364_1238312 | 3300037853 | Bacteria | 3565 |
| 614 | Ga0436364_1423369 | 3300037853 | Bacteria | 2772 |
| 615 | Ga0395901_0479935 | 3300038443 | Bacteria | 1268 |
| 616 | Ga0400483_136500 | 3300039062 | Bacteria | 13362 |
| 617 | Ga0400483_150385 | 3300039062 | Bacteria | 3970 |
| 618 | Ga0436365_0049397 | 3300039437 | Bacteria | 1786 |
| 619 | Ga0436365_0480912 | 3300039437 | Bacteria | 48758 |
| 620 | Ga0436365_0667467 | 3300039437 | Bacteria | 944 |
| 621 | Ga0436365_0830679 | 3300039437 | Bacteria | 2733 |
| 622 | Ga0436360_1007169 | 3300039438 | Bacteria | 2318 |
| 623 | Ga0436360_1294149 | 3300039438 | Bacteria | 1266 |
| 624 | Ga0436361_0206906 | 3300039447 | Bacteria | 1181 |
| 625 | Ga0436361_0428535 | 3300039447 | Bacteria | 2594 |
| 626 | Ga0436363_0226637 | 3300039450 | Bacteria | 1052 |
| 627 | Ga0436363_0465256 | 3300039450 | Bacteria | 1734 |
| 628 | Ga0436363_0553133 | 3300039450 | Bacteria | 2624 |
| 629 | Ga0436363_1082316 | 3300039450 | Bacteria | 1812 |
| 630 | Ga0436362_0553111 | 3300039453 | Bacteria | 45057 |
| 631 | Ga0436362_0771929 | 3300039453 | Bacteria | 1191 |
| 632 | Ga0436362_0892678 | 3300039453 | Bacteria | 1346 |
| 633 | Ga0439436_0017110 | 3300041404 | Bacteria | 2170 |
| 634 | Ga0439447_033430 | 3300041407 | Bacteria | 1282 |
| 635 | Ga0439461_0000135 | 3300041410 | Bacteria | 9827 |
| 636 | Ga0451807_0405409 | 3300041486 | Bacteria | 1813 |
| 637 | Ga0439431_0009775 | 3300041997 | Bacteria | 2170 |
| 638 | Ga0439432_000988 | 3300042006 | Bacteria | 10744 |
| 639 | Ga0439432_031309 | 3300042006 | Bacteria | 1721 |
| 640 | Ga0439457_018890 | 3300042014 | Bacteria | 1531 |
| 641 | Ga0439462_0001472 | 3300042015 | Bacteria | 5251 |
| 642 | Ga0439434_0010099 | 3300042435 | Bacteria | 2781 |
| 643 | Ga0466963_0009226 | 3300044694 | Bacteria | 5939 |
| 644 | Ga0453684_0128487 | 3300044712 | Bacteria | 3045 |
| 645 | Ga0466968_0042551 | 3300044735 | Bacteria | 1921 |
| 646 | Ga0466957_0174750 | 3300044842 | Bacteria | 1400 |
| 647 | Ga0451576_0012145 | 3300045051 | Bacteria | 9710 |
| 648 | Ga0466967_0142639 | 3300045976 | Bacteria | 2232 |
| 649 | Ga0495627_000036 | 3300046453 | Bacteria | 205589 |
| 650 | Ga0495638_0000014 | 3300046460 | Bacteria | 417060 |
| 651 | Ga0495638_0023112 | 3300046460 | Bacteria | 4072 |
| 652 | Ga0495650_0000644 | 3300046471 | Bacteria | 46276 |
| 653 | Ga0495650_0004373 | 3300046471 | Bacteria | 9726 |
| 654 | Ga0495662_0065167 | 3300046476 | Bacteria | 1761 |
| 655 | Ga0495584_0028431 | 3300046491 | Bacteria | 2833 |
| 656 | Ga0495585_0032475 | 3300046492 | Bacteria | 2957 |
| 657 | Ga0495585_0118799 | 3300046492 | Bacteria | 1400 |
| 658 | Ga0495583_0000557 | 3300046506 | Bacteria | 52013 |
| 659 | Ga0495583_0004151 | 3300046506 | Bacteria | 10587 |
| 660 | Ga0495606_0044411 | 3300046507 | Bacteria | 2955 |
| 661 | Ga0495616_0000013 | 3300046513 | Bacteria | 202334 |
| 662 | Ga0495631_0011352 | 3300046518 | Bacteria | 4383 |
| 663 | Ga0495632_0000047 | 3300046519 | Bacteria | 138951 |
| 664 | Ga0495632_0003550 | 3300046519 | Bacteria | 11029 |
| 665 | Ga0495637_0000367 | 3300046520 | Bacteria | 34078 |
| 666 | Ga0495643_0000031 | 3300046522 | Bacteria | 257820 |
| 667 | Ga0495643_0001349 | 3300046522 | Bacteria | 23106 |
| 668 | Ga0495643_0001424 | 3300046522 | Bacteria | 22149 |
| 669 | Ga0495643_0021191 | 3300046522 | Bacteria | 3733 |
| 670 | Ga0495648_0000021 | 3300046524 | Bacteria | 246945 |
| 671 | Ga0495648_0000122 | 3300046524 | Bacteria | 93823 |
| 672 | Ga0495648_0005850 | 3300046524 | Bacteria | 10123 |
| 673 | Ga0495648_0031987 | 3300046524 | Bacteria | 3459 |
| 674 | Ga0495663_0000017 | 3300046525 | Bacteria | 138955 |
| 675 | Ga0495663_0003969 | 3300046525 | Bacteria | 4209 |
| 676 | Ga0495663_0006746 | 3300046525 | Bacteria | 3165 |
| 677 | Ga0495663_0072641 | 3300046525 | Bacteria | 1097 |
| 678 | Ga0495663_0073598 | 3300046525 | Bacteria | 1091 |
| 679 | Ga0495642_0006607 | 3300046528 | Bacteria | 4452 |
| 680 | Ga0495654_0002327 | 3300046530 | Bacteria | 12278 |
| 681 | Ga0495654_0048080 | 3300046530 | Bacteria | 2095 |
| 682 | Ga0495654_0054284 | 3300046530 | Bacteria | 1944 |
| 683 | Ga0495586_0118873 | 3300046535 | Bacteria | 1475 |
| 684 | Ga0495598_0000694 | 3300046537 | Bacteria | 6402 |
| 685 | Ga0495622_0045033 | 3300046557 | Bacteria | 2050 |
| 686 | Ga0495633_0000952 | 3300046558 | Bacteria | 24068 |
| 687 | Ga0495633_0001585 | 3300046558 | Bacteria | 17325 |
| 688 | Ga0495633_0001728 | 3300046558 | Bacteria | 16325 |
| 689 | Ga0495633_0007320 | 3300046558 | Bacteria | 6365 |
| 690 | Ga0495633_0077274 | 3300046558 | Bacteria | 1550 |
| 691 | Ga0495633_0126817 | 3300046558 | Bacteria | 1181 |
| 692 | Ga0495667_0043052 | 3300046559 | Bacteria | 2993 |
| 693 | Ga0495668_0000377 | 3300046616 | Bacteria | 59127 |
| 694 | Ga0495668_0003835 | 3300046616 | Bacteria | 11002 |
| 695 | Ga0495668_0084335 | 3300046616 | Bacteria | 1742 |
| 696 | Ga0495625_0001416 | 3300046660 | Bacteria | 29318 |
| 697 | Ga0495625_0003783 | 3300046660 | Bacteria | 14689 |
| 698 | Ga0495625_0008470 | 3300046660 | Bacteria | 8776 |
| 699 | Ga0495625_0049042 | 3300046660 | Bacteria | 3036 |
| 700 | Ga0495625_0085991 | 3300046660 | Bacteria | 2182 |
| 701 | Ga0495625_0110874 | 3300046660 | Bacteria | 1875 |
| 702 | Ga0495635_0054879 | 3300046663 | Bacteria | 2744 |
| 703 | Ga0495661_0096820 | 3300046665 | Bacteria | 1668 |
| 704 | Ga0495599_0038391 | 3300046678 | Bacteria | 3009 |
| 705 | Ga0495669_0000773 | 3300046684 | Bacteria | 13683 |
| 706 | Ga0495670_0000029 | 3300046691 | Bacteria | 87662 |
| 707 | Ga0495670_0141657 | 3300046691 | Bacteria | 1257 |
| 708 | Ga0495671_0000021 | 3300046692 | Bacteria | 257820 |
| 709 | Ga0495671_0000028 | 3300046692 | Bacteria | 234938 |
| 710 | Ga0495671_0106235 | 3300046692 | Bacteria | 1371 |
| 711 | Ga0495649_0063274 | 3300046694 | Bacteria | 1988 |
| 712 | Ga0495600_0056689 | 3300046809 | Bacteria | 2560 |
| 713 | Ga0495600_0065668 | 3300046809 | Bacteria | 2372 |
| 714 | Ga0495660_0043737 | 3300046810 | Bacteria | 2468 |
| 715 | Ga0495680_0127214 | 3300047322 | Bacteria | 1875 |
| 716 | Ga0495683_0107496 | 3300047323 | Bacteria | 1335 |
| 717 | Ga0495687_000392 | 3300047443 | Bacteria | 54348 |
| 718 | Ga0495687_005666 | 3300047443 | Bacteria | 7886 |
| 719 | Ga0495677_0000853 | 3300047445 | Bacteria | 12332 |
| 720 | Ga0495673_0000058 | 3300047469 | Bacteria | 235044 |
| 721 | Ga0495681_0000827 | 3300047470 | Bacteria | 23860 |
| 722 | Ga0495686_0000023 | 3300047472 | Bacteria | 400457 |
| 723 | Ga0495686_0004215 | 3300047472 | Bacteria | 11938 |
| 724 | Ga0495686_0009156 | 3300047472 | Bacteria | 7169 |
| 725 | Ga0496101_0011708 | 3300048904 | Bacteria | 5829 |
| 726 | Ga0496101_0076347 | 3300048904 | Bacteria | 2468 |
| 727 | Ga0496101_0275588 | 3300048904 | Bacteria | 1314 |
| 728 | Ga0496101_0275640 | 3300048904 | Bacteria | 1314 |
| 729 | Ga0496102_0001821 | 3300048905 | Bacteria | 18398 |
| 730 | Ga0496102_0016012 | 3300048905 | Bacteria | 6545 |
| 731 | Ga0496102_0246218 | 3300048905 | Bacteria | 1685 |
| 732 | Ga0496102_0557708 | 3300048905 | Bacteria | 1068 |
| 733 | Ga0496103_0000165 | 3300048906 | Bacteria | 69702 |
| 734 | Ga0496103_0003222 | 3300048906 | Bacteria | 10011 |
| 735 | Ga0496103_0140163 | 3300048906 | Bacteria | 1546 |
| 736 | Ga0496103_0272522 | 3300048906 | Bacteria | 1089 |
| 737 | Ga0496104_0020496 | 3300048907 | Bacteria | 6061 |
| 738 | Ga0496104_0020819 | 3300048907 | Bacteria | 6014 |
| 739 | Ga0496104_0023092 | 3300048907 | Bacteria | 5717 |
| 740 | Ga0496105_0000224 | 3300048908 | Bacteria | 38048 |
| 741 | Ga0496105_0000467 | 3300048908 | Bacteria | 26582 |
| 742 | Ga0496105_0077963 | 3300048908 | Bacteria | 2736 |
| 743 | Ga0496105_0288538 | 3300048908 | Bacteria | 1321 |
| 744 | Ga0496106_0000171 | 3300048909 | Bacteria | 47281 |
| 745 | Ga0496106_0083416 | 3300048909 | Bacteria | 2458 |
| 746 | Ga0496106_0373509 | 3300048909 | Bacteria | 1146 |
| 747 | Ga0496106_0460443 | 3300048909 | Bacteria | 1022 |
| 748 | Ga0496107_0000853 | 3300048910 | Bacteria | 17891 |
| 749 | Ga0496107_0080661 | 3300048910 | Bacteria | 2373 |
| 750 | Ga0496107_0094410 | 3300048910 | Bacteria | 2188 |
| 751 | Ga0496108_0012266 | 3300048911 | Bacteria | 6971 |
| 752 | Ga0496108_0021371 | 3300048911 | Bacteria | 5318 |
| 753 | Ga0496109_0049878 | 3300048912 | Bacteria | 3812 |
| 754 | Ga0496109_0116341 | 3300048912 | Bacteria | 2488 |
| 755 | Ga0496109_0130040 | 3300048912 | Bacteria | 2349 |
| 756 | Ga0496109_0173464 | 3300048912 | Bacteria | 2024 |
| 757 | Ga0496109_0491262 | 3300048912 | Bacteria | 1159 |
| 758 | Ga0496110_0062754 | 3300048913 | Bacteria | 3282 |
| 759 | Ga0496110_0190634 | 3300048913 | Bacteria | 1862 |
| 760 | Ga0496111_0003672 | 3300048914 | Bacteria | 9532 |
| 761 | Ga0496111_0078716 | 3300048914 | Bacteria | 2404 |
| 762 | Ga0496111_0087349 | 3300048914 | Bacteria | 2282 |
| 763 | Ga0496113_0012751 | 3300048916 | Bacteria | 5661 |
| 764 | Ga0496113_0104465 | 3300048916 | Bacteria | 2198 |
| 765 | Ga0496114_0077083 | 3300048917 | Bacteria | 2810 |
| 766 | Ga0496114_0088277 | 3300048917 | Bacteria | 2630 |
| 767 | Ga0496115_0000202 | 3300048918 | Bacteria | 55680 |
| 768 | Ga0496115_0063213 | 3300048918 | Bacteria | 2986 |
| 769 | Ga0496116_0004804 | 3300048919 | Bacteria | 12755 |
| 770 | Ga0496116_0022179 | 3300048919 | Bacteria | 4766 |
| 771 | Ga0496116_0172895 | 3300048919 | Bacteria | 1168 |
| 772 | Ga0496117_0000616 | 3300048920 | Bacteria | 57666 |
| 773 | Ga0496117_0011577 | 3300048920 | Bacteria | 7889 |
| 774 | Ga0496117_0024655 | 3300048920 | Bacteria | 4749 |
| 775 | Ga0496117_0028816 | 3300048920 | Bacteria | 4292 |
| 776 | Ga0496118_0000425 | 3300048921 | Bacteria | 70035 |
| 777 | Ga0496118_0004371 | 3300048921 | Bacteria | 16808 |
| 778 | Ga0496118_0006208 | 3300048921 | Bacteria | 13229 |
| 779 | Ga0496118_0013410 | 3300048921 | Bacteria | 7756 |
| 780 | Ga0496118_0030914 | 3300048921 | Bacteria | 4455 |
| 781 | Ga0496119_0007265 | 3300048922 | Bacteria | 10021 |
| 782 | Ga0496119_0080101 | 3300048922 | Bacteria | 1884 |
| 783 | Ga0496119_0180092 | 3300048922 | Bacteria | 1109 |
| 784 | Ga0496120_0068303 | 3300048923 | Bacteria | 1961 |
| 785 | Ga0496121_0000065 | 3300048924 | Bacteria | 269310 |
| 786 | Ga0496121_0000274 | 3300048924 | Bacteria | 107140 |
| 787 | Ga0496121_0000737 | 3300048924 | Bacteria | 60298 |
| 788 | Ga0496121_0000796 | 3300048924 | Bacteria | 57621 |
| 789 | Ga0496121_0019203 | 3300048924 | Bacteria | 6847 |
| 790 | Ga0496121_0062513 | 3300048924 | Bacteria | 3049 |
| 791 | Ga0496122_0007023 | 3300048925 | Bacteria | 12659 |
| 792 | Ga0496122_0030586 | 3300048925 | Bacteria | 4507 |
| 793 | Ga0496122_0043137 | 3300048925 | Bacteria | 3538 |
| 794 | Ga0496122_0085759 | 3300048925 | Bacteria | 2171 |
| 795 | Ga0496123_0012582 | 3300048926 | Bacteria | 7197 |
| 796 | Ga0496123_0015310 | 3300048926 | Bacteria | 6299 |
| 797 | Ga0496124_0000116 | 3300048927 | Bacteria | 164788 |
| 798 | Ga0496124_0000468 | 3300048927 | Bacteria | 69747 |
| 799 | Ga0496124_0020523 | 3300048927 | Bacteria | 6102 |
| 800 | Ga0496124_0112588 | 3300048927 | Bacteria | 2188 |
| 801 | Ga0496124_0240404 | 3300048927 | Bacteria | 1347 |
| 802 | Ga0496125_0000704 | 3300048928 | Bacteria | 55382 |
| 803 | Ga0496125_0012413 | 3300048928 | Bacteria | 8460 |
| 804 | Ga0496125_0022597 | 3300048928 | Bacteria | 5834 |
| 805 | Ga0496125_0101878 | 3300048928 | Bacteria | 2111 |
| 806 | Ga0496125_0109641 | 3300048928 | Bacteria | 2003 |
| 807 | Ga0496125_0127540 | 3300048928 | Bacteria | 1799 |
| 808 | Ga0496126_0000563 | 3300048929 | Bacteria | 71182 |
| 809 | Ga0496126_0003496 | 3300048929 | Bacteria | 19818 |
| 810 | Ga0496126_0079422 | 3300048929 | Bacteria | 2904 |
| 811 | Ga0496126_0093737 | 3300048929 | Bacteria | 2636 |
| 812 | Ga0501314_000892 | 3300049530 | Bacteria | 2006 |
| 813 | Ga0501034_0017114 | 3300049571 | Bacteria | 7437 |
| 814 | Ga0501034_0147720 | 3300049571 | Bacteria | 2327 |
| 815 | Ga0501034_0202474 | 3300049571 | Bacteria | 1943 |
| 816 | Ga0501069_0120875 | 3300049585 | Bacteria | 1496 |
| 817 | Ga0501070_0081129 | 3300049586 | Bacteria | 2683 |
| 818 | Ga0501070_0116310 | 3300049586 | Bacteria | 2209 |
| 819 | Ga0501073_0222245 | 3300049589 | Bacteria | 1305 |
| 820 | Ga0501211_000395 | 3300049658 | Bacteria | 4147 |
| 821 | Ga0501223_000007 | 3300049663 | Bacteria | 132601 |
| 822 | Ga0501223_000043 | 3300049663 | Bacteria | 44137 |
| 823 | Ga0501224_000019 | 3300049664 | Bacteria | 78204 |
| 824 | Ga0501233_000300 | 3300049668 | Bacteria | 7630 |
| 825 | Ga0501235_013626 | 3300049669 | Bacteria | 1790 |
| 826 | Ga0501246_000328 | 3300049676 | Bacteria | 3291 |
| 827 | Ga0501259_015279 | 3300049688 | Bacteria | 1310 |
| 828 | Ga0501225_0000065 | 3300049705 | Bacteria | 34445 |
| 829 | Ga0501225_0000096 | 3300049705 | Bacteria | 28223 |
| 830 | Ga0501225_0000960 | 3300049705 | Bacteria | 9024 |
| 831 | Ga0501225_0006195 | 3300049705 | Bacteria | 3494 |
| 832 | Ga0501268_001367 | 3300049765 | Bacteria | 3029 |
| 833 | Ga0501268_002447 | 3300049765 | Bacteria | 2448 |
| 834 | Ga0501272_001814 | 3300049769 | Bacteria | 2078 |
| 835 | Ga0501044_0094190 | 3300049823 | Bacteria | 3020 |
| 836 | Ga0501044_0418545 | 3300049823 | Bacteria | 1250 |
| 837 | Ga0501226_000080 | 3300049853 | Bacteria | 29131 |
| 838 | nmdc:mga03683_2650_c1 | 3300050489 | Bacteria | 5602 |
| 839 | nmdc:mga03683_61_c1 | 3300050489 | Bacteria | 41527 |
| 840 | nmdc:mga03n38_526_c1 | 3300050490 | Bacteria | 9692 |
| 841 | nmdc:mga0k408_1890_c1 | 3300050493 | Bacteria | 11220 |
| 842 | nmdc:mga06z11_13318_c1 | 3300050494 | Bacteria | 3607 |
| 843 | nmdc:mga06z11_221_c1 | 3300050494 | Bacteria | 22754 |
| 844 | nmdc:mga06z11_73_c1 | 3300050494 | Bacteria | 42058 |
| 845 | nmdc:mga04h51_187_c1 | 3300050495 | Bacteria | 17156 |
| 846 | nmdc:mga04h51_603_c1 | 3300050495 | Bacteria | 8565 |
| 847 | nmdc:mga07m45_14098_c1 | 3300050496 | Bacteria | 4252 |
| 848 | nmdc:mga07m45_9_c1 | 3300050496 | Bacteria | 171776 |
| 849 | nmdc:mga08y16_227938_c1 | 3300050511 | Bacteria | 1927 |
| 850 | nmdc:mga08x19_36419_c1 | 3300050514 | Bacteria | 3116 |
| 851 | nmdc:mga0sz30_1158_c1 | 3300050516 | Bacteria | 9448 |
| 852 | Ga0495601_0187381 | 3300053077 | Bacteria | 1352 |
| 853 | Ga0500610_0001915 | 3300053079 | Bacteria | 7400 |
| 854 | Ga0495595_0131986 | 3300053084 | Bacteria | 1221 |
| 855 | Ga0495619_0006898 | 3300053085 | Bacteria | 7182 |
| 856 | Ga0495619_0363168 | 3300053085 | Bacteria | 1001 |
| 857 | Ga0500643_000005 | 3300053087 | Bacteria | 539775 |
| 858 | Ga0500643_000524 | 3300053087 | Bacteria | 26993 |
| 859 | Ga0500643_001690 | 3300053087 | Bacteria | 12274 |
| 860 | Ga0500643_006775 | 3300053087 | Bacteria | 4727 |
| 861 | Ga0500643_006839 | 3300053087 | Bacteria | 4698 |
| 862 | Ga0500643_006840 | 3300053087 | Bacteria | 4698 |
| 863 | Ga0500643_007854 | 3300053087 | Bacteria | 4251 |
| 864 | Ga0500646_0036775 | 3300053090 | Bacteria | 1365 |
| 865 | Ga0500651_0002015 | 3300053093 | Bacteria | 10544 |
| 866 | Ga0500566_0003816 | 3300053094 | Bacteria | 8982 |
| 867 | Ga0500556_0000027 | 3300053104 | Bacteria | 165855 |
| 868 | Ga0500594_0047825 | 3300053118 | Bacteria | 1194 |
| 869 | Ga0500595_014569 | 3300053119 | Bacteria | 2980 |
| 870 | Ga0500607_000060 | 3300053121 | Bacteria | 77770 |
| 871 | Ga0500608_000381 | 3300053122 | Bacteria | 17140 |
| 872 | Ga0500642_0000003 | 3300053130 | Bacteria | 544899 |
| 873 | Ga0500642_0003426 | 3300053130 | Bacteria | 4796 |
| 874 | Ga0500642_0015101 | 3300053130 | Bacteria | 2892 |
| 875 | Ga0500658_0002039 | 3300053134 | Bacteria | 7881 |
| 876 | Ga0500559_0003528 | 3300053136 | Bacteria | 7662 |
| 877 | Ga0500559_0036418 | 3300053136 | Bacteria | 2128 |
| 878 | Ga0500559_0062232 | 3300053136 | Bacteria | 1666 |
| 879 | Ga0500564_000226 | 3300053138 | Bacteria | 15670 |
| 880 | Ga0500568_0000679 | 3300053139 | Bacteria | 24563 |
| 881 | Ga0500604_0005398 | 3300053151 | Bacteria | 3375 |
| 882 | Ga0500604_0052636 | 3300053151 | Bacteria | 1260 |
| 883 | Ga0500616_0000375 | 3300053153 | Bacteria | 62773 |
| 884 | Ga0500616_0005540 | 3300053153 | Bacteria | 8550 |
| 885 | Ga0500622_0000256 | 3300053156 | Bacteria | 54136 |
| 886 | Ga0500622_0040789 | 3300053156 | Bacteria | 2417 |
| 887 | Ga0500622_0069681 | 3300053156 | Bacteria | 1780 |
| 888 | Ga0500622_0075211 | 3300053156 | Bacteria | 1700 |
| 889 | Ga0500622_0110064 | 3300053156 | Bacteria | 1346 |
| 890 | Ga0500624_000072 | 3300053157 | Bacteria | 57950 |
| 891 | Ga0500624_000073 | 3300053157 | Bacteria | 57630 |
| 892 | Ga0500627_0000624 | 3300053158 | Bacteria | 9436 |
| 893 | Ga0500636_0002804 | 3300053177 | Bacteria | 9727 |
| 894 | Ga0500567_000272 | 3300053723 | Bacteria | 16060 |
| 895 | Ga0500625_000004 | 3300053729 | Bacteria | 245905 |
| 896 | Ga0500645_000034 | 3300053730 | Bacteria | 116363 |
| 897 | Ga0500645_000205 | 3300053730 | Bacteria | 45699 |
| 898 | Ga0500645_010112 | 3300053730 | Bacteria | 3138 |
| 899 | Ga0500645_028998 | 3300053730 | Bacteria | 1672 |
| 900 | Ga0500609_000579 | 3300053731 | Bacteria | 5542 |
| 901 | Ga0500552_001146 | 3300053733 | Bacteria | 2513 |
| 902 | Ga0500596_002547 | 3300053735 | Bacteria | 3583 |
| 903 | Ga0500587_002704 | 3300053739 | Bacteria | 2512 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_0479935 | Ga0395901_0479935_410_1255 | 274 |
| 2 | 3300048909 | Ga0496106_0373509 | Ga0496106_0373509_281_1126 | 274 |
| 3 | 3300039437 | Ga0436365_0667467 | Ga0436365_0667467_23_877 | 275 |
| 4 | 3300048929 | Ga0496126_0093737 | Ga0496126_0093737_12_845 | 277 |
| 5 | 3300001990 | JGI24737J22298_10011369 | JGI24737J22298_100113691 | 281 |
| 6 | 3300046660 | Ga0495625_0049042 | Ga0495625_0049042_2168_3019 | 281 |
| 7 | 3300048923 | Ga0496120_0068303 | Ga0496120_0068303_12_875 | 287 |
| 8 | 3300049589 | Ga0501073_0222245 | Ga0501073_0222245_405_1289 | 287 |
| 9 | 3300005844 | Ga0068862_100001440 | Ga0068862_10000144021 | 290 |
| 10 | 3300028380 | Ga0268265_10007014 | Ga0268265_100070146 | 290 |
| 11 | 3300053130 | Ga0500642_0003426 | Ga0500642_0003426_1275_2246 | 290 |
| 12 | 3300053151 | Ga0500604_0052636 | Ga0500604_0052636_191_1162 | 290 |
| 13 | 3300053731 | Ga0500609_000579 | Ga0500609_000579_4303_5274 | 290 |
| 14 | 3300013306 | Ga0163162_10835823 | Ga0163162_108358232 | 291 |
| 15 | 3300035172 | Ga0373955_0179617 | Ga0373955_0179617_17_919 | 291 |
| 16 | 3300039447 | Ga0436361_0206906 | Ga0436361_0206906_21_923 | 291 |
| 17 | 3300053156 | Ga0500622_0110064 | Ga0500622_0110064_17_919 | 291 |
| 18 | 3300039450 | Ga0436363_0226637 | Ga0436363_0226637_137_1042 | 292 |
| 19 | 3300048909 | Ga0496106_0460443 | Ga0496106_0460443_11_901 | 296 |
| 20 | 3300048919 | Ga0496116_0172895 | Ga0496116_0172895_14_904 | 296 |
| 21 | 3300049586 | Ga0501070_0116310 | Ga0501070_0116310_729_1700 | 296 |
| 22 | 3300044694 | Ga0466963_0009226 | Ga0466963_0009226_605_1588 | 301 |
| 23 | 3300044842 | Ga0466957_0174750 | Ga0466957_0174750_85_1068 | 301 |
| 24 | 3300045976 | Ga0466967_0142639 | Ga0466967_0142639_413_1396 | 301 |
| 25 | 3300006178 | Ga0075367_10032537 | Ga0075367_100325372 | 302 |
| 26 | 3300006186 | Ga0075369_10021161 | Ga0075369_100211612 | 302 |
| 27 | 3300050494 | nmdc:mga06z11_13318_c1 | nmdc:mga06z11_13318_c1_1180_2163 | 302 |
| 28 | 3300053733 | Ga0500552_001146 | Ga0500552_001146_124_1119 | 303 |
| 29 | 3300026142 | Ga0207698_10069993 | Ga0207698_100699933 | 304 |
| 30 | 3300048924 | Ga0496121_0000737 | Ga0496121_0000737_29228_30199 | 304 |
| 31 | 3300053085 | Ga0495619_0363168 | Ga0495619_0363168_33_947 | 304 |
| 32 | 3300013306 | Ga0163162_10022371 | Ga0163162_100223713 | 306 |
| 33 | 3300050489 | nmdc:mga03683_2650_c1 | nmdc:mga03683_2650_c1_2541_3524 | 306 |
| 34 | 3300005536 | Ga0070697_100071394 | Ga0070697_1000713943 | 308 |
| 35 | 3300014968 | Ga0157379_10195244 | Ga0157379_101952442 | 308 |
| 36 | 3300025910 | Ga0207684_10148588 | Ga0207684_101485882 | 308 |
| 37 | 3300031995 | Ga0307409_100013972 | Ga0307409_1000139724 | 308 |
| 38 | 3300032005 | Ga0307411_10091073 | Ga0307411_100910732 | 308 |
| 39 | 3300046530 | Ga0495654_0054284 | Ga0495654_0054284_32_961 | 309 |
| 40 | 3300053122 | Ga0500608_000381 | Ga0500608_000381_9480_10409 | 309 |
| 41 | 3300053136 | Ga0500559_0036418 | Ga0500559_0036418_757_1686 | 309 |
| 42 | 3300053138 | Ga0500564_000226 | Ga0500564_000226_1971_2900 | 309 |
| 43 | 3300053723 | Ga0500567_000272 | Ga0500567_000272_13417_14346 | 309 |
| 44 | 3300053729 | Ga0500625_000004 | Ga0500625_000004_6754_7683 | 309 |
| 45 | iso_pu_bacteria | 2842333319 | 2842334638 | 309 |
| 46 | 3300005467 | Ga0070706_100000006 | Ga0070706_100000006156 | 312 |
| 47 | 3300005471 | Ga0070698_100163773 | Ga0070698_1001637733 | 312 |
| 48 | 3300005518 | Ga0070699_100238274 | Ga0070699_1002382742 | 312 |
| 49 | 3300005536 | Ga0070697_100008183 | Ga0070697_1000081836 | 312 |
| 50 | 3300005844 | Ga0068862_100542078 | Ga0068862_1005420782 | 312 |
| 51 | 3300006846 | Ga0075430_100020444 | Ga0075430_1000204446 | 312 |
| 52 | 3300006847 | Ga0075431_100066774 | Ga0075431_1000667743 | 312 |
| 53 | 3300007265 | Ga0099794_10000021 | Ga0099794_1000002133 | 312 |
| 54 | 3300025910 | Ga0207684_10000004 | Ga0207684_10000004480 | 312 |
| 55 | 3300025922 | Ga0207646_10012705 | Ga0207646_100127053 | 312 |
| 56 | 3300027671 | Ga0209588_1000027 | Ga0209588_10000279 | 312 |
| 57 | 3300028381 | Ga0268264_10035077 | Ga0268264_100350776 | 312 |
| 58 | iso_pu_bacteria | 2919709256 | 2919709374 | 312 |
| 59 | 3300026041 | Ga0207639_10242712 | Ga0207639_102427122 | 313 |
| 60 | 3300041407 | Ga0439447_033430 | Ga0439447_033430_286_1254 | 313 |
| 61 | 3300048925 | Ga0496122_0085759 | Ga0496122_0085759_1137_2102 | 313 |
| 62 | 3300035118 | Ga0373954_0062041 | Ga0373954_0062041_69_1040 | 314 |
| 63 | 3300036401 | Ga0373937_0062941 | Ga0373937_0062941_532_1503 | 314 |
| 64 | 3300037853 | Ga0436364_0307891 | Ga0436364_0307891_9181_10152 | 314 |
| 65 | 3300037853 | Ga0436364_1238312 | Ga0436364_1238312_1682_2653 | 314 |
| 66 | 3300039437 | Ga0436365_0049397 | Ga0436365_0049397_14_985 | 314 |
| 67 | 3300039438 | Ga0436360_1007169 | Ga0436360_1007169_100_1071 | 314 |
| 68 | 3300039438 | Ga0436360_1294149 | Ga0436360_1294149_171_1142 | 314 |
| 69 | 3300039447 | Ga0436361_0428535 | Ga0436361_0428535_820_1791 | 314 |
| 70 | 3300039453 | Ga0436362_0771929 | Ga0436362_0771929_110_1081 | 314 |
| 71 | 3300046476 | Ga0495662_0065167 | Ga0495662_0065167_55_1026 | 314 |
| 72 | 3300046559 | Ga0495667_0043052 | Ga0495667_0043052_1202_2173 | 314 |
| 73 | 3300046663 | Ga0495635_0054879 | Ga0495635_0054879_1173_2144 | 314 |
| 74 | 3300046678 | Ga0495599_0038391 | Ga0495599_0038391_244_1215 | 314 |
| 75 | 3300046809 | Ga0495600_0056689 | Ga0495600_0056689_419_1390 | 314 |
| 76 | 3300053077 | Ga0495601_0187381 | Ga0495601_0187381_274_1245 | 314 |
| 77 | 3300053084 | Ga0495595_0131986 | Ga0495595_0131986_166_1137 | 314 |
| 78 | 3300053085 | Ga0495619_0006898 | Ga0495619_0006898_1596_2567 | 314 |
| 79 | 3300053093 | Ga0500651_0002015 | Ga0500651_0002015_9099_10070 | 314 |
| 80 | 3300047472 | Ga0495686_0000023 | Ga0495686_0000023_265572_266540 | 315 |
| 81 | 3300005436 | Ga0070713_100498344 | Ga0070713_1004983441 | 316 |
| 82 | 3300005458 | Ga0070681_10030096 | Ga0070681_100300963 | 316 |
| 83 | 3300005530 | Ga0070679_100002476 | Ga0070679_1000024763 | 316 |
| 84 | 3300009093 | Ga0105240_10100638 | Ga0105240_101006382 | 316 |
| 85 | 3300013104 | Ga0157370_10007620 | Ga0157370_100076203 | 316 |
| 86 | 3300025912 | Ga0207707_10030145 | Ga0207707_100301452 | 316 |
| 87 | 3300025913 | Ga0207695_10179699 | Ga0207695_101796992 | 316 |
| 88 | 3300025928 | Ga0207700_10371694 | Ga0207700_103716941 | 316 |
| 89 | 3300035724 | Ga0373933_0086048 | Ga0373933_0086048_99_1073 | 316 |
| 90 | 3300036401 | Ga0373937_0009491 | Ga0373937_0009491_1394_2368 | 316 |
| 91 | 3300049585 | Ga0501069_0120875 | Ga0501069_0120875_165_1136 | 316 |
| 92 | iso_pu_bacteria | 2830075706 | 2830078250 | 316 |
| 93 | 3300053153 | Ga0500616_0005540 | Ga0500616_0005540_520_1473 | 317 |
| 94 | iso_pu_bacteria | 8057101203 | 8057103190 | 317 |
| 95 | 3300005355 | Ga0070671_100021681 | Ga0070671_1000216814 | 318 |
| 96 | 3300009177 | Ga0105248_10006900 | Ga0105248_100069009 | 318 |
| 97 | 3300021384 | Ga0213876_10068527 | Ga0213876_100685272 | 318 |
| 98 | 3300025931 | Ga0207644_10010610 | Ga0207644_100106105 | 318 |
| 99 | 3300025941 | Ga0207711_10026962 | Ga0207711_100269627 | 318 |
| 100 | 3300037471 | Ga0395905_0001203 | Ga0395905_0001203_6061_7050 | 318 |
| 101 | 3300046460 | Ga0495638_0023112 | Ga0495638_0023112_19_975 | 318 |
| 102 | 3300048904 | Ga0496101_0011708 | Ga0496101_0011708_3550_4539 | 318 |
| 103 | 3300048909 | Ga0496106_0083416 | Ga0496106_0083416_196_1185 | 318 |
| 104 | 3300048910 | Ga0496107_0094410 | Ga0496107_0094410_1178_2167 | 318 |
| 105 | 3300048918 | Ga0496115_0063213 | Ga0496115_0063213_1904_2893 | 318 |
| 106 | iso_pu_bacteria | 2599185359 | 2600228442 | 318 |
| 107 | iso_pu_bacteria | 2643221622 | 2644125251 | 318 |
| 108 | iso_pu_bacteria | 2818991466 | 2819715236 | 318 |
| 109 | iso_pu_bacteria | 2879163058 | 2879163077 | 318 |
| 110 | iso_pu_bacteria | 2897803580 | 2897807576 | 318 |
| 111 | iso_pu_bacteria | 2928526807 | 2928528024 | 318 |
| 112 | iso_pu_bacteria | 2928968154 | 2928971472 | 318 |
| 113 | iso_pu_bacteria | 8054002106 | 8054006359 | 318 |
| 114 | 3300005445 | Ga0070708_100019929 | Ga0070708_1000199294 | 319 |
| 115 | 3300005445 | Ga0070708_100523055 | Ga0070708_1005230551 | 319 |
| 116 | 3300025919 | Ga0207657_10295321 | Ga0207657_102953211 | 319 |
| 117 | 3300031251 | Ga0265327_10001060 | Ga0265327_100010603 | 319 |
| 118 | 3300039450 | Ga0436363_0465256 | Ga0436363_0465256_644_1651 | 319 |
| 119 | 3300050514 | nmdc:mga08x19_36419_c1 | nmdc:mga08x19_36419_c1_937_1923 | 319 |
| 120 | 3300053090 | Ga0500646_0036775 | Ga0500646_0036775_189_1175 | 319 |
| 121 | 3300053156 | Ga0500622_0069681 | Ga0500622_0069681_466_1452 | 319 |
| 122 | iso_pu_bacteria | 2842694124 | 2842697234 | 319 |
| 123 | iso_pu_bacteria | 2896253425 | 2896255961 | 319 |
| 124 | iso_pu_bacteria | 2919138771 | 2919143214 | 319 |
| 125 | iso_pu_bacteria | 2946787523 | 2946791000 | 319 |
| 126 | 3300005331 | Ga0070670_100440177 | Ga0070670_1004401771 | 320 |
| 127 | 3300005353 | Ga0070669_100361247 | Ga0070669_1003612472 | 320 |
| 128 | 3300005355 | Ga0070671_100017013 | Ga0070671_1000170135 | 320 |
| 129 | 3300005434 | Ga0070709_10039814 | Ga0070709_100398142 | 320 |
| 130 | 3300005435 | Ga0070714_100038777 | Ga0070714_1000387772 | 320 |
| 131 | 3300005436 | Ga0070713_100085122 | Ga0070713_1000851222 | 320 |
| 132 | 3300005437 | Ga0070710_10042976 | Ga0070710_100429761 | 320 |
| 133 | 3300005439 | Ga0070711_100370614 | Ga0070711_1003706141 | 320 |
| 134 | 3300005458 | Ga0070681_10260837 | Ga0070681_102608372 | 320 |
| 135 | 3300005471 | Ga0070698_100004136 | Ga0070698_1000041366 | 320 |
| 136 | 3300005616 | Ga0068852_100212345 | Ga0068852_1002123453 | 320 |
| 137 | 3300005618 | Ga0068864_100020255 | Ga0068864_1000202557 | 320 |
| 138 | 3300005834 | Ga0068851_10034883 | Ga0068851_100348832 | 320 |
| 139 | 3300005843 | Ga0068860_100056603 | Ga0068860_1000566032 | 320 |
| 140 | 3300005844 | Ga0068862_100127906 | Ga0068862_1001279062 | 320 |
| 141 | 3300005981 | Ga0081538_10003537 | Ga0081538_1000353711 | 320 |
| 142 | 3300005983 | Ga0081540_1008827 | Ga0081540_10088271 | 320 |
| 143 | 3300006028 | Ga0070717_10004405 | Ga0070717_100044051 | 320 |
| 144 | 3300006028 | Ga0070717_10259400 | Ga0070717_102594002 | 320 |
| 145 | 3300006175 | Ga0070712_100031989 | Ga0070712_1000319893 | 320 |
| 146 | 3300007788 | Ga0099795_10048486 | Ga0099795_100484862 | 320 |
| 147 | 3300009177 | Ga0105248_10081893 | Ga0105248_100818932 | 320 |
| 148 | 3300017792 | Ga0163161_10000848 | Ga0163161_1000084817 | 320 |
| 149 | 3300021388 | Ga0213875_10000970 | Ga0213875_1000097013 | 320 |
| 150 | 3300024227 | Ga0228598_1008452 | Ga0228598_10084521 | 320 |
| 151 | 3300025321 | Ga0207656_10036837 | Ga0207656_100368372 | 320 |
| 152 | 3300025909 | Ga0207705_10157923 | Ga0207705_101579231 | 320 |
| 153 | 3300025915 | Ga0207693_10055554 | Ga0207693_100555542 | 320 |
| 154 | 3300025922 | Ga0207646_10322525 | Ga0207646_103225252 | 320 |
| 155 | 3300025940 | Ga0207691_10376527 | Ga0207691_103765271 | 320 |
| 156 | 3300025960 | Ga0207651_10135531 | Ga0207651_101355311 | 320 |
| 157 | 3300026095 | Ga0207676_10031475 | Ga0207676_100314752 | 320 |
| 158 | 3300028380 | Ga0268265_10032828 | Ga0268265_100328283 | 320 |
| 159 | 3300031852 | Ga0307410_10102499 | Ga0307410_101024993 | 320 |
| 160 | 3300037418 | Ga0395900_0125025 | Ga0395900_0125025_1097_2092 | 320 |
| 161 | 3300037853 | Ga0436364_1423369 | Ga0436364_1423369_862_1851 | 320 |
| 162 | 3300039450 | Ga0436363_0553133 | Ga0436363_0553133_1586_2575 | 320 |
| 163 | 3300039453 | Ga0436362_0892678 | Ga0436362_0892678_94_1083 | 320 |
| 164 | 3300044735 | Ga0466968_0042551 | Ga0466968_0042551_421_1452 | 320 |
| 165 | 3300046535 | Ga0495586_0118873 | Ga0495586_0118873_402_1445 | 320 |
| 166 | 3300046537 | Ga0495598_0000694 | Ga0495598_0000694_5137_6117 | 320 |
| 167 | 3300047322 | Ga0495680_0127214 | Ga0495680_0127214_26_1015 | 320 |
| 168 | 3300047472 | Ga0495686_0004215 | Ga0495686_0004215_8883_9845 | 320 |
| 169 | 3300048904 | Ga0496101_0076347 | Ga0496101_0076347_901_1896 | 320 |
| 170 | 3300048912 | Ga0496109_0116341 | Ga0496109_0116341_474_1469 | 320 |
| 171 | 3300048914 | Ga0496111_0087349 | Ga0496111_0087349_773_1768 | 320 |
| 172 | iso_pu_bacteria | 2510917021 | 2511130612 | 320 |
| 173 | iso_pu_bacteria | 2848297114 | 2848298168 | 320 |
| 174 | iso_pu_bacteria | 2882806704 | 2882809447 | 320 |
| 175 | iso_pu_bacteria | 2896184354 | 2896186033 | 320 |
| 176 | 3300013102 | Ga0157371_10037986 | Ga0157371_100379862 | 321 |
| 177 | 3300031903 | Ga0307407_10011741 | Ga0307407_100117411 | 321 |
| 178 | 3300032002 | Ga0307416_100323317 | Ga0307416_1003233172 | 321 |
| 179 | 3300039062 | Ga0400483_136500 | Ga0400483_136500_10637_11632 | 321 |
| 180 | 3300039062 | Ga0400483_150385 | Ga0400483_150385_2009_3004 | 321 |
| 181 | 3300039437 | Ga0436365_0830679 | Ga0436365_0830679_1018_2016 | 321 |
| 182 | 3300049571 | Ga0501034_0147720 | Ga0501034_0147720_1292_2275 | 321 |
| 183 | 3300049586 | Ga0501070_0081129 | Ga0501070_0081129_1411_2394 | 321 |
| 184 | iso_pu_bacteria | 2524023250 | 2524611971 | 321 |
| 185 | iso_pu_bacteria | 2739367664 | 2739650762 | 321 |
| 186 | iso_pu_bacteria | 2739367865 | 2740029235 | 321 |
| 187 | iso_pu_bacteria | 2885427238 | 2885427315 | 321 |
| 188 | 3300001915 | JGI24741J21665_1001068 | JGI24741J21665_100106810 | 322 |
| 189 | 3300001979 | JGI24740J21852_10002539 | JGI24740J21852_100025395 | 322 |
| 190 | 3300002459 | JGI24751J29686_10022625 | JGI24751J29686_100226252 | 322 |
| 191 | 3300003215 | JGI25153J46596_10000119 | JGI25153J46596_1000011933 | 322 |
| 192 | 3300003215 | JGI25153J46596_10044147 | JGI25153J46596_100441472 | 322 |
| 193 | 3300003759 | Ga0055525_1000070 | Ga0055525_100007033 | 322 |
| 194 | 3300003762 | Ga0055542_1000102 | Ga0055542_10001027 | 322 |
| 195 | 3300003763 | Ga0055529_1000520 | Ga0055529_100052028 | 322 |
| 196 | 3300003775 | Ga0055524_1000155 | Ga0055524_100015553 | 322 |
| 197 | 3300003791 | Ga0055530_10000202 | Ga0055530_1000020245 | 322 |
| 198 | 3300003791 | Ga0055530_10015115 | Ga0055530_100151152 | 322 |
| 199 | 3300003794 | Ga0055531_10000090 | Ga0055531_1000009056 | 322 |
| 200 | 3300003794 | Ga0055531_10001103 | Ga0055531_100011033 | 322 |
| 201 | 3300005262 | Ga0065165_1008857 | Ga0065165_10088572 | 322 |
| 202 | 3300005327 | Ga0070658_10003391 | Ga0070658_1000339111 | 322 |
| 203 | 3300005327 | Ga0070658_10016648 | Ga0070658_100166485 | 322 |
| 204 | 3300005328 | Ga0070676_10027030 | Ga0070676_100270304 | 322 |
| 205 | 3300005336 | Ga0070680_100209111 | Ga0070680_1002091112 | 322 |
| 206 | 3300005339 | Ga0070660_100007526 | Ga0070660_1000075264 | 322 |
| 207 | 3300005347 | Ga0070668_100003381 | Ga0070668_1000033818 | 322 |
| 208 | 3300005347 | Ga0070668_100273853 | Ga0070668_1002738532 | 322 |
| 209 | 3300005353 | Ga0070669_100218277 | Ga0070669_1002182772 | 322 |
| 210 | 3300005355 | Ga0070671_100059830 | Ga0070671_1000598302 | 322 |
| 211 | 3300005356 | Ga0070674_100001545 | Ga0070674_1000015456 | 322 |
| 212 | 3300005356 | Ga0070674_100003399 | Ga0070674_1000033993 | 322 |
| 213 | 3300005455 | Ga0070663_100005371 | Ga0070663_1000053714 | 322 |
| 214 | 3300005455 | Ga0070663_100040887 | Ga0070663_1000408873 | 322 |
| 215 | 3300005455 | Ga0070663_100182250 | Ga0070663_1001822501 | 322 |
| 216 | 3300005456 | Ga0070678_100000139 | Ga0070678_10000013910 | 322 |
| 217 | 3300005457 | Ga0070662_100010089 | Ga0070662_1000100895 | 322 |
| 218 | 3300005458 | Ga0070681_10175057 | Ga0070681_101750572 | 322 |
| 219 | 3300005530 | Ga0070679_100083331 | Ga0070679_1000833312 | 322 |
| 220 | 3300005543 | Ga0070672_100357351 | Ga0070672_1003573511 | 322 |
| 221 | 3300005548 | Ga0070665_100103386 | Ga0070665_1001033861 | 322 |
| 222 | 3300005563 | Ga0068855_100022640 | Ga0068855_1000226405 | 322 |
| 223 | 3300005563 | Ga0068855_100067455 | Ga0068855_1000674553 | 322 |
| 224 | 3300005617 | Ga0068859_100006473 | Ga0068859_1000064738 | 322 |
| 225 | 3300005618 | Ga0068864_100000114 | Ga0068864_10000011468 | 322 |
| 226 | 3300005618 | Ga0068864_100184524 | Ga0068864_1001845242 | 322 |
| 227 | 3300005719 | Ga0068861_100000391 | Ga0068861_10000039117 | 322 |
| 228 | 3300005842 | Ga0068858_100000332 | Ga0068858_10000033232 | 322 |
| 229 | 3300005843 | Ga0068860_100022991 | Ga0068860_1000229912 | 322 |
| 230 | 3300005844 | Ga0068862_100168856 | Ga0068862_1001688562 | 322 |
| 231 | 3300006237 | Ga0097621_100060411 | Ga0097621_1000604113 | 322 |
| 232 | 3300006881 | Ga0068865_100061812 | Ga0068865_1000618123 | 322 |
| 233 | 3300006881 | Ga0068865_100277114 | Ga0068865_1002771141 | 322 |
| 234 | 3300006931 | Ga0097620_100006473 | Ga0097620_1000064738 | 322 |
| 235 | 3300009148 | Ga0105243_10000367 | Ga0105243_1000036727 | 322 |
| 236 | 3300009174 | Ga0105241_10007520 | Ga0105241_100075206 | 322 |
| 237 | 3300009177 | Ga0105248_10001723 | Ga0105248_100017238 | 322 |
| 238 | 3300009177 | Ga0105248_10283150 | Ga0105248_102831501 | 322 |
| 239 | 3300013100 | Ga0157373_10007763 | Ga0157373_100077634 | 322 |
| 240 | 3300013100 | Ga0157373_10129087 | Ga0157373_101290872 | 322 |
| 241 | 3300013102 | Ga0157371_10000793 | Ga0157371_100007933 | 322 |
| 242 | 3300013102 | Ga0157371_10002588 | Ga0157371_100025882 | 322 |
| 243 | 3300013104 | Ga0157370_10068145 | Ga0157370_100681454 | 322 |
| 244 | 3300013297 | Ga0157378_10017918 | Ga0157378_100179182 | 322 |
| 245 | 3300013307 | Ga0157372_10229429 | Ga0157372_102294293 | 322 |
| 246 | 3300021358 | Ga0213873_10000021 | Ga0213873_10000021112 | 322 |
| 247 | 3300021384 | Ga0213876_10000050 | Ga0213876_1000005011 | 322 |
| 248 | 3300025230 | Ga0209563_100053 | Ga0209563_100053164 | 322 |
| 249 | 3300025245 | Ga0207425_1014330 | Ga0207425_10143302 | 322 |
| 250 | 3300025253 | Ga0209677_108087 | Ga0209677_1080873 | 322 |
| 251 | 3300025254 | Ga0209148_1000159 | Ga0209148_100015927 | 322 |
| 252 | 3300025263 | Ga0209565_1000011 | Ga0209565_1000011101 | 322 |
| 253 | 3300025272 | Ga0209455_1000045 | Ga0209455_1000045116 | 322 |
| 254 | 3300025273 | Ga0209673_1003151 | Ga0209673_100315112 | 322 |
| 255 | 3300025295 | Ga0209564_1022143 | Ga0209564_10221432 | 322 |
| 256 | 3300025297 | Ga0209758_1000328 | Ga0209758_100032857 | 322 |
| 257 | 3300025297 | Ga0209758_1006749 | Ga0209758_10067491 | 322 |
| 258 | 3300025298 | Ga0209050_1000051 | Ga0209050_1000051182 | 322 |
| 259 | 3300025298 | Ga0209050_1019568 | Ga0209050_10195682 | 322 |
| 260 | 3300025299 | Ga0209256_1000016 | Ga0209256_1000016498 | 322 |
| 261 | 3300025304 | Ga0209257_1000028 | Ga0209257_1000028186 | 322 |
| 262 | 3300025304 | Ga0209257_1002691 | Ga0209257_10026916 | 322 |
| 263 | 3300025321 | Ga0207656_10001389 | Ga0207656_100013895 | 322 |
| 264 | 3300025904 | Ga0207647_10019099 | Ga0207647_100190993 | 322 |
| 265 | 3300025904 | Ga0207647_10184934 | Ga0207647_101849342 | 322 |
| 266 | 3300025907 | Ga0207645_10033635 | Ga0207645_100336352 | 322 |
| 267 | 3300025909 | Ga0207705_10000294 | Ga0207705_100002949 | 322 |
| 268 | 3300025909 | Ga0207705_10002561 | Ga0207705_100025617 | 322 |
| 269 | 3300025909 | Ga0207705_10058767 | Ga0207705_100587672 | 322 |
| 270 | 3300025911 | Ga0207654_10000436 | Ga0207654_1000043614 | 322 |
| 271 | 3300025912 | Ga0207707_10400614 | Ga0207707_104006142 | 322 |
| 272 | 3300025913 | Ga0207695_10031869 | Ga0207695_100318696 | 322 |
| 273 | 3300025914 | Ga0207671_10007219 | Ga0207671_100072196 | 322 |
| 274 | 3300025917 | Ga0207660_10086756 | Ga0207660_100867562 | 322 |
| 275 | 3300025919 | Ga0207657_10007485 | Ga0207657_1000748513 | 322 |
| 276 | 3300025919 | Ga0207657_10009830 | Ga0207657_100098304 | 322 |
| 277 | 3300025919 | Ga0207657_10138370 | Ga0207657_101383702 | 322 |
| 278 | 3300025920 | Ga0207649_10006484 | Ga0207649_100064845 | 322 |
| 279 | 3300025921 | Ga0207652_10429992 | Ga0207652_104299921 | 322 |
| 280 | 3300025931 | Ga0207644_10026293 | Ga0207644_100262932 | 322 |
| 281 | 3300025932 | Ga0207690_10004751 | Ga0207690_100047513 | 322 |
| 282 | 3300025933 | Ga0207706_10001335 | Ga0207706_1000133523 | 322 |
| 283 | 3300025935 | Ga0207709_10000047 | Ga0207709_1000004785 | 322 |
| 284 | 3300025935 | Ga0207709_10131151 | Ga0207709_101311511 | 322 |
| 285 | 3300025937 | Ga0207669_10000361 | Ga0207669_1000036111 | 322 |
| 286 | 3300025937 | Ga0207669_10013539 | Ga0207669_100135392 | 322 |
| 287 | 3300025940 | Ga0207691_10232379 | Ga0207691_102323792 | 322 |
| 288 | 3300025941 | Ga0207711_10000222 | Ga0207711_1000022253 | 322 |
| 289 | 3300025944 | Ga0207661_10199323 | Ga0207661_101993231 | 322 |
| 290 | 3300025945 | Ga0207679_10072613 | Ga0207679_100726132 | 322 |
| 291 | 3300025949 | Ga0207667_10000001 | Ga0207667_1000000134 | 322 |
| 292 | 3300025949 | Ga0207667_10064711 | Ga0207667_100647114 | 322 |
| 293 | 3300025981 | Ga0207640_10001051 | Ga0207640_100010512 | 322 |
| 294 | 3300026035 | Ga0207703_10004842 | Ga0207703_100048427 | 322 |
| 295 | 3300026041 | Ga0207639_10004049 | Ga0207639_100040495 | 322 |
| 296 | 3300026067 | Ga0207678_10009812 | Ga0207678_100098125 | 322 |
| 297 | 3300026067 | Ga0207678_10010539 | Ga0207678_100105396 | 322 |
| 298 | 3300026078 | Ga0207702_10004975 | Ga0207702_100049755 | 322 |
| 299 | 3300026095 | Ga0207676_10001056 | Ga0207676_100010566 | 322 |
| 300 | 3300026095 | Ga0207676_10221341 | Ga0207676_102213411 | 322 |
| 301 | 3300026118 | Ga0207675_100000584 | Ga0207675_1000005848 | 322 |
| 302 | 3300026121 | Ga0207683_10001314 | Ga0207683_1000131411 | 322 |
| 303 | 3300026142 | Ga0207698_10002750 | Ga0207698_100027506 | 322 |
| 304 | 3300026142 | Ga0207698_10012373 | Ga0207698_100123733 | 322 |
| 305 | 3300027876 | Ga0209974_10014065 | Ga0209974_100140653 | 322 |
| 306 | 3300028381 | Ga0268264_10135058 | Ga0268264_101350582 | 322 |
| 307 | 3300028786 | Ga0307517_10010279 | Ga0307517_100102794 | 322 |
| 308 | 3300028786 | Ga0307517_10073454 | Ga0307517_100734541 | 322 |
| 309 | 3300031456 | Ga0307513_10013356 | Ga0307513_100133568 | 322 |
| 310 | 3300031548 | Ga0307408_100446226 | Ga0307408_1004462261 | 322 |
| 311 | 3300031731 | Ga0307405_10041649 | Ga0307405_100416493 | 322 |
| 312 | 3300031901 | Ga0307406_10036829 | Ga0307406_100368292 | 322 |
| 313 | 3300031911 | Ga0307412_10000206 | Ga0307412_1000020630 | 322 |
| 314 | 3300031911 | Ga0307412_10000348 | Ga0307412_1000034821 | 322 |
| 315 | 3300031911 | Ga0307412_10023398 | Ga0307412_100233982 | 322 |
| 316 | 3300032002 | Ga0307416_100098595 | Ga0307416_1000985952 | 322 |
| 317 | 3300032004 | Ga0307414_10000105 | Ga0307414_1000010533 | 322 |
| 318 | 3300039437 | Ga0436365_0480912 | Ga0436365_0480912_38492_39475 | 322 |
| 319 | 3300039453 | Ga0436362_0553111 | Ga0436362_0553111_9284_10267 | 322 |
| 320 | 3300041404 | Ga0439436_0017110 | Ga0439436_0017110_656_1624 | 322 |
| 321 | 3300041410 | Ga0439461_0000135 | Ga0439461_0000135_7958_8926 | 322 |
| 322 | 3300041997 | Ga0439431_0009775 | Ga0439431_0009775_1164_2132 | 322 |
| 323 | 3300042006 | Ga0439432_000988 | Ga0439432_000988_8317_9285 | 322 |
| 324 | 3300042014 | Ga0439457_018890 | Ga0439457_018890_155_1123 | 322 |
| 325 | 3300042015 | Ga0439462_0001472 | Ga0439462_0001472_4213_5181 | 322 |
| 326 | 3300042435 | Ga0439434_0010099 | Ga0439434_0010099_928_1896 | 322 |
| 327 | 3300046471 | Ga0495650_0000644 | Ga0495650_0000644_36378_37346 | 322 |
| 328 | 3300046492 | Ga0495585_0032475 | Ga0495585_0032475_222_1190 | 322 |
| 329 | 3300046492 | Ga0495585_0118799 | Ga0495585_0118799_345_1313 | 322 |
| 330 | 3300046506 | Ga0495583_0004151 | Ga0495583_0004151_1353_2321 | 322 |
| 331 | 3300046507 | Ga0495606_0044411 | Ga0495606_0044411_132_1100 | 322 |
| 332 | 3300046518 | Ga0495631_0011352 | Ga0495631_0011352_938_1906 | 322 |
| 333 | 3300046522 | Ga0495643_0001349 | Ga0495643_0001349_7932_8900 | 322 |
| 334 | 3300046522 | Ga0495643_0001424 | Ga0495643_0001424_3137_4105 | 322 |
| 335 | 3300046522 | Ga0495643_0021191 | Ga0495643_0021191_2433_3401 | 322 |
| 336 | 3300046524 | Ga0495648_0000122 | Ga0495648_0000122_57555_58523 | 322 |
| 337 | 3300046525 | Ga0495663_0003969 | Ga0495663_0003969_3082_4050 | 322 |
| 338 | 3300046528 | Ga0495642_0006607 | Ga0495642_0006607_1501_2469 | 322 |
| 339 | 3300046558 | Ga0495633_0001728 | Ga0495633_0001728_10921_11889 | 322 |
| 340 | 3300046558 | Ga0495633_0077274 | Ga0495633_0077274_271_1239 | 322 |
| 341 | 3300046616 | Ga0495668_0000377 | Ga0495668_0000377_37609_38577 | 322 |
| 342 | 3300046660 | Ga0495625_0001416 | Ga0495625_0001416_18006_18974 | 322 |
| 343 | 3300046660 | Ga0495625_0008470 | Ga0495625_0008470_7747_8715 | 322 |
| 344 | 3300046660 | Ga0495625_0110874 | Ga0495625_0110874_861_1829 | 322 |
| 345 | 3300046665 | Ga0495661_0096820 | Ga0495661_0096820_31_999 | 322 |
| 346 | 3300046684 | Ga0495669_0000773 | Ga0495669_0000773_12632_13600 | 322 |
| 347 | 3300046691 | Ga0495670_0000029 | Ga0495670_0000029_10639_11610 | 322 |
| 348 | 3300046694 | Ga0495649_0063274 | Ga0495649_0063274_659_1627 | 322 |
| 349 | 3300046809 | Ga0495600_0065668 | Ga0495600_0065668_829_1797 | 322 |
| 350 | 3300046810 | Ga0495660_0043737 | Ga0495660_0043737_1271_2239 | 322 |
| 351 | 3300047323 | Ga0495683_0107496 | Ga0495683_0107496_35_1003 | 322 |
| 352 | 3300047443 | Ga0495687_000392 | Ga0495687_000392_28680_29648 | 322 |
| 353 | 3300047443 | Ga0495687_005666 | Ga0495687_005666_6880_7848 | 322 |
| 354 | 3300047445 | Ga0495677_0000853 | Ga0495677_0000853_5823_6791 | 322 |
| 355 | 3300048905 | Ga0496102_0001821 | Ga0496102_0001821_11862_12830 | 322 |
| 356 | 3300048906 | Ga0496103_0000165 | Ga0496103_0000165_35600_36568 | 322 |
| 357 | 3300048907 | Ga0496104_0020496 | Ga0496104_0020496_5063_6031 | 322 |
| 358 | 3300048908 | Ga0496105_0000467 | Ga0496105_0000467_6999_7967 | 322 |
| 359 | 3300048914 | Ga0496111_0003672 | Ga0496111_0003672_452_1420 | 322 |
| 360 | 3300048917 | Ga0496114_0088277 | Ga0496114_0088277_350_1318 | 322 |
| 361 | 3300048918 | Ga0496115_0000202 | Ga0496115_0000202_31534_32502 | 322 |
| 362 | 3300048919 | Ga0496116_0004804 | Ga0496116_0004804_3254_4222 | 322 |
| 363 | 3300048920 | Ga0496117_0000616 | Ga0496117_0000616_33019_33987 | 322 |
| 364 | 3300048921 | Ga0496118_0000425 | Ga0496118_0000425_35588_36556 | 322 |
| 365 | 3300048921 | Ga0496118_0013410 | Ga0496118_0013410_3038_4006 | 322 |
| 366 | 3300048922 | Ga0496119_0007265 | Ga0496119_0007265_2069_3037 | 322 |
| 367 | 3300048924 | Ga0496121_0000796 | Ga0496121_0000796_33099_34067 | 322 |
| 368 | 3300048926 | Ga0496123_0015310 | Ga0496123_0015310_1707_2675 | 322 |
| 369 | 3300048927 | Ga0496124_0000116 | Ga0496124_0000116_154675_155643 | 322 |
| 370 | 3300048927 | Ga0496124_0000468 | Ga0496124_0000468_35612_36580 | 322 |
| 371 | 3300048927 | Ga0496124_0020523 | Ga0496124_0020523_2001_2969 | 322 |
| 372 | 3300048927 | Ga0496124_0112588 | Ga0496124_0112588_846_1814 | 322 |
| 373 | 3300048928 | Ga0496125_0000704 | Ga0496125_0000704_23593_24561 | 322 |
| 374 | 3300048929 | Ga0496126_0000563 | Ga0496126_0000563_32997_33965 | 322 |
| 375 | 3300048929 | Ga0496126_0079422 | Ga0496126_0079422_24_998 | 322 |
| 376 | 3300049530 | Ga0501314_000892 | Ga0501314_000892_539_1507 | 322 |
| 377 | 3300049571 | Ga0501034_0017114 | Ga0501034_0017114_4886_5854 | 322 |
| 378 | 3300049663 | Ga0501223_000043 | Ga0501223_000043_7688_8656 | 322 |
| 379 | 3300049664 | Ga0501224_000019 | Ga0501224_000019_69093_70061 | 322 |
| 380 | 3300049668 | Ga0501233_000300 | Ga0501233_000300_5108_6076 | 322 |
| 381 | 3300049705 | Ga0501225_0000065 | Ga0501225_0000065_7578_8546 | 322 |
| 382 | 3300049853 | Ga0501226_000080 | Ga0501226_000080_20592_21560 | 322 |
| 383 | 3300053079 | Ga0500610_0001915 | Ga0500610_0001915_3402_4370 | 322 |
| 384 | 3300053087 | Ga0500643_006775 | Ga0500643_006775_3168_4136 | 322 |
| 385 | 3300053094 | Ga0500566_0003816 | Ga0500566_0003816_6782_7750 | 322 |
| 386 | 3300053130 | Ga0500642_0015101 | Ga0500642_0015101_1837_2805 | 322 |
| 387 | 3300053134 | Ga0500658_0002039 | Ga0500658_0002039_1500_2468 | 322 |
| 388 | 3300053156 | Ga0500622_0075211 | Ga0500622_0075211_218_1189 | 322 |
| 389 | 3300053730 | Ga0500645_000034 | Ga0500645_000034_32713_33681 | 322 |
| 390 | 3300053730 | Ga0500645_010112 | Ga0500645_010112_725_1693 | 322 |
| 391 | 3300053735 | Ga0500596_002547 | Ga0500596_002547_1499_2467 | 322 |
| 392 | 3300002459 | JGI24751J29686_10000481 | JGI24751J29686_100004815 | 323 |
| 393 | 3300005295 | Ga0065707_10082164 | Ga0065707_100821647 | 323 |
| 394 | 3300005327 | Ga0070658_10112831 | Ga0070658_101128313 | 323 |
| 395 | 3300005327 | Ga0070658_10283690 | Ga0070658_102836902 | 323 |
| 396 | 3300005329 | Ga0070683_100026014 | Ga0070683_1000260143 | 323 |
| 397 | 3300005335 | Ga0070666_10005062 | Ga0070666_100050627 | 323 |
| 398 | 3300005340 | Ga0070689_100074859 | Ga0070689_1000748592 | 323 |
| 399 | 3300005347 | Ga0070668_100201825 | Ga0070668_1002018252 | 323 |
| 400 | 3300005353 | Ga0070669_100000052 | Ga0070669_10000005218 | 323 |
| 401 | 3300005355 | Ga0070671_100000005 | Ga0070671_100000005223 | 323 |
| 402 | 3300005366 | Ga0070659_100219976 | Ga0070659_1002199762 | 323 |
| 403 | 3300005530 | Ga0070679_100054902 | Ga0070679_1000549024 | 323 |
| 404 | 3300005539 | Ga0068853_100025281 | Ga0068853_1000252815 | 323 |
| 405 | 3300005563 | Ga0068855_100052109 | Ga0068855_1000521092 | 323 |
| 406 | 3300005578 | Ga0068854_100100486 | Ga0068854_1001004862 | 323 |
| 407 | 3300005616 | Ga0068852_100272948 | Ga0068852_1002729482 | 323 |
| 408 | 3300005618 | Ga0068864_100368589 | Ga0068864_1003685891 | 323 |
| 409 | 3300005841 | Ga0068863_100007873 | Ga0068863_1000078737 | 323 |
| 410 | 3300005841 | Ga0068863_100155059 | Ga0068863_1001550592 | 323 |
| 411 | 3300005842 | Ga0068858_100282254 | Ga0068858_1002822542 | 323 |
| 412 | 3300005843 | Ga0068860_100022488 | Ga0068860_1000224883 | 323 |
| 413 | 3300005844 | Ga0068862_100000099 | Ga0068862_10000009969 | 323 |
| 414 | 3300005937 | Ga0081455_10001105 | Ga0081455_1000110518 | 323 |
| 415 | 3300006042 | Ga0075368_10003888 | Ga0075368_100038882 | 323 |
| 416 | 3300006177 | Ga0075362_10000497 | Ga0075362_100004979 | 323 |
| 417 | 3300006186 | Ga0075369_10050434 | Ga0075369_100504342 | 323 |
| 418 | 3300009101 | Ga0105247_10001097 | Ga0105247_1000109719 | 323 |
| 419 | 3300009177 | Ga0105248_10489999 | Ga0105248_104899992 | 323 |
| 420 | 3300009553 | Ga0105249_10001541 | Ga0105249_1000154118 | 323 |
| 421 | 3300013306 | Ga0163162_10076303 | Ga0163162_100763033 | 323 |
| 422 | 3300014326 | Ga0157380_10002769 | Ga0157380_100027691 | 323 |
| 423 | 3300017792 | Ga0163161_10141345 | Ga0163161_101413451 | 323 |
| 424 | 3300025909 | Ga0207705_10032368 | Ga0207705_100323683 | 323 |
| 425 | 3300025921 | Ga0207652_10000474 | Ga0207652_100004744 | 323 |
| 426 | 3300025923 | Ga0207681_10000188 | Ga0207681_1000018838 | 323 |
| 427 | 3300025931 | Ga0207644_10000008 | Ga0207644_10000008101 | 323 |
| 428 | 3300025936 | Ga0207670_10368470 | Ga0207670_103684702 | 323 |
| 429 | 3300025944 | Ga0207661_10188778 | Ga0207661_101887782 | 323 |
| 430 | 3300025944 | Ga0207661_10514272 | Ga0207661_105142721 | 323 |
| 431 | 3300025949 | Ga0207667_10004469 | Ga0207667_1000446916 | 323 |
| 432 | 3300025961 | Ga0207712_10000026 | Ga0207712_100000262 | 323 |
| 433 | 3300025972 | Ga0207668_10201593 | Ga0207668_102015931 | 323 |
| 434 | 3300025981 | Ga0207640_10027744 | Ga0207640_100277443 | 323 |
| 435 | 3300025986 | Ga0207658_10139406 | Ga0207658_101394061 | 323 |
| 436 | 3300026035 | Ga0207703_10114264 | Ga0207703_101142642 | 323 |
| 437 | 3300026041 | Ga0207639_10050897 | Ga0207639_100508973 | 323 |
| 438 | 3300026088 | Ga0207641_10001495 | Ga0207641_1000149517 | 323 |
| 439 | 3300026088 | Ga0207641_10046468 | Ga0207641_100464682 | 323 |
| 440 | 3300026095 | Ga0207676_10352486 | Ga0207676_103524861 | 323 |
| 441 | 3300026142 | Ga0207698_10224304 | Ga0207698_102243041 | 323 |
| 442 | 3300027866 | Ga0209813_10000230 | Ga0209813_100002307 | 323 |
| 443 | 3300027876 | Ga0209974_10011023 | Ga0209974_100110234 | 323 |
| 444 | 3300028379 | Ga0268266_10080988 | Ga0268266_100809881 | 323 |
| 445 | 3300028380 | Ga0268265_10000084 | Ga0268265_1000008468 | 323 |
| 446 | 3300028381 | Ga0268264_10026074 | Ga0268264_100260742 | 323 |
| 447 | 3300031456 | Ga0307513_10005129 | Ga0307513_1000512912 | 323 |
| 448 | 3300031731 | Ga0307405_10000196 | Ga0307405_100001964 | 323 |
| 449 | 3300031731 | Ga0307405_10307445 | Ga0307405_103074451 | 323 |
| 450 | 3300031911 | Ga0307412_10001536 | Ga0307412_100015364 | 323 |
| 451 | 3300032133 | Ga0316583_10002571 | Ga0316583_100025713 | 323 |
| 452 | 3300036647 | Ga0316582_0003260 | Ga0316582_0003260_5050_6036 | 323 |
| 453 | 3300036647 | Ga0316582_0188192 | Ga0316582_0188192_28_1014 | 323 |
| 454 | 3300036712 | Ga0316584_0036022 | Ga0316584_0036022_1682_2668 | 323 |
| 455 | 3300036712 | Ga0316584_0241479 | Ga0316584_0241479_113_1099 | 323 |
| 456 | 3300039450 | Ga0436363_1082316 | Ga0436363_1082316_690_1661 | 323 |
| 457 | 3300041486 | Ga0451807_0405409 | Ga0451807_0405409_417_1580 | 323 |
| 458 | 3300045051 | Ga0451576_0012145 | Ga0451576_0012145_4882_5868 | 323 |
| 459 | 3300046525 | Ga0495663_0006746 | Ga0495663_0006746_2121_3092 | 323 |
| 460 | 3300046530 | Ga0495654_0002327 | Ga0495654_0002327_7785_8756 | 323 |
| 461 | 3300046557 | Ga0495622_0045033 | Ga0495622_0045033_116_1102 | 323 |
| 462 | 3300046558 | Ga0495633_0126817 | Ga0495633_0126817_45_1031 | 323 |
| 463 | 3300046616 | Ga0495668_0003835 | Ga0495668_0003835_4962_5933 | 323 |
| 464 | 3300048905 | Ga0496102_0246218 | Ga0496102_0246218_130_1107 | 323 |
| 465 | 3300048908 | Ga0496105_0288538 | Ga0496105_0288538_30_1007 | 323 |
| 466 | 3300048909 | Ga0496106_0000171 | Ga0496106_0000171_15860_16837 | 323 |
| 467 | 3300048910 | Ga0496107_0000853 | Ga0496107_0000853_16857_17834 | 323 |
| 468 | 3300048912 | Ga0496109_0130040 | Ga0496109_0130040_256_1233 | 323 |
| 469 | 3300048912 | Ga0496109_0491262 | Ga0496109_0491262_155_1138 | 323 |
| 470 | 3300048916 | Ga0496113_0012751 | Ga0496113_0012751_1506_2483 | 323 |
| 471 | 3300048924 | Ga0496121_0019203 | Ga0496121_0019203_5288_6262 | 323 |
| 472 | 3300048924 | Ga0496121_0062513 | Ga0496121_0062513_134_1108 | 323 |
| 473 | 3300048925 | Ga0496122_0007023 | Ga0496122_0007023_2757_3731 | 323 |
| 474 | 3300048926 | Ga0496123_0012582 | Ga0496123_0012582_2261_3235 | 323 |
| 475 | 3300048928 | Ga0496125_0022597 | Ga0496125_0022597_1814_2788 | 323 |
| 476 | 3300049571 | Ga0501034_0202474 | Ga0501034_0202474_726_1724 | 323 |
| 477 | 3300049823 | Ga0501044_0094190 | Ga0501044_0094190_1462_2457 | 323 |
| 478 | 3300049823 | Ga0501044_0418545 | Ga0501044_0418545_66_1049 | 323 |
| 479 | 3300050489 | nmdc:mga03683_61_c1 | nmdc:mga03683_61_c1_12404_13381 | 323 |
| 480 | 3300050490 | nmdc:mga03n38_526_c1 | nmdc:mga03n38_526_c1_6274_7251 | 323 |
| 481 | 3300050494 | nmdc:mga06z11_221_c1 | nmdc:mga06z11_221_c1_16858_17835 | 323 |
| 482 | 3300050495 | nmdc:mga04h51_187_c1 | nmdc:mga04h51_187_c1_10816_11793 | 323 |
| 483 | 3300050496 | nmdc:mga07m45_9_c1 | nmdc:mga07m45_9_c1_3621_4598 | 323 |
| 484 | 3300050516 | nmdc:mga0sz30_1158_c1 | nmdc:mga0sz30_1158_c1_72_1049 | 323 |
| 485 | 3300053087 | Ga0500643_000005 | Ga0500643_000005_156852_157868 | 323 |
| 486 | 3300053087 | Ga0500643_001690 | Ga0500643_001690_11172_12158 | 323 |
| 487 | 3300053104 | Ga0500556_0000027 | Ga0500556_0000027_9480_10466 | 323 |
| 488 | 3300053118 | Ga0500594_0047825 | Ga0500594_0047825_54_1040 | 323 |
| 489 | 3300053121 | Ga0500607_000060 | Ga0500607_000060_59350_60327 | 323 |
| 490 | 3300053130 | Ga0500642_0000003 | Ga0500642_0000003_380363_381349 | 323 |
| 491 | 3300053139 | Ga0500568_0000679 | Ga0500568_0000679_16164_17159 | 323 |
| 492 | 3300053153 | Ga0500616_0000375 | Ga0500616_0000375_41603_42598 | 323 |
| 493 | 3300053158 | Ga0500627_0000624 | Ga0500627_0000624_4119_5090 | 323 |
| 494 | 3300053739 | Ga0500587_002704 | Ga0500587_002704_118_1113 | 323 |
| 495 | iso_pu_bacteria | 2512564014 | 2512642330 | 323 |
| 496 | iso_pu_bacteria | 2775507255 | 2778126722 | 323 |
| 497 | iso_pu_bacteria | 2808606401 | 2809063121 | 323 |
| 498 | iso_pu_bacteria | 2808606404 | 2809079085 | 323 |
| 499 | iso_pu_bacteria | 2808606405 | 2809083540 | 323 |
| 500 | 2162886007 | SwRhRL2b_contig_3124566 | SwRhRL2b_0228.00006840 | 324 |
| 501 | 3300002070 | JGI24750J21931_1013782 | JGI24750J21931_10137821 | 324 |
| 502 | 3300005289 | Ga0065704_10076327 | Ga0065704_100763273 | 324 |
| 503 | 3300005327 | Ga0070658_10021169 | Ga0070658_100211695 | 324 |
| 504 | 3300005331 | Ga0070670_100016761 | Ga0070670_1000167612 | 324 |
| 505 | 3300005331 | Ga0070670_100064201 | Ga0070670_1000642014 | 324 |
| 506 | 3300005335 | Ga0070666_10000177 | Ga0070666_1000017725 | 324 |
| 507 | 3300005335 | Ga0070666_10015560 | Ga0070666_100155602 | 324 |
| 508 | 3300005347 | Ga0070668_100000031 | Ga0070668_10000003136 | 324 |
| 509 | 3300005347 | Ga0070668_100000158 | Ga0070668_1000001584 | 324 |
| 510 | 3300005347 | Ga0070668_100018199 | Ga0070668_1000181993 | 324 |
| 511 | 3300005347 | Ga0070668_100166226 | Ga0070668_1001662262 | 324 |
| 512 | 3300005353 | Ga0070669_100000136 | Ga0070669_10000013652 | 324 |
| 513 | 3300005355 | Ga0070671_100000081 | Ga0070671_10000008152 | 324 |
| 514 | 3300005367 | Ga0070667_100000004 | Ga0070667_10000000436 | 324 |
| 515 | 3300005367 | Ga0070667_100000081 | Ga0070667_10000008115 | 324 |
| 516 | 3300005367 | Ga0070667_100009025 | Ga0070667_1000090253 | 324 |
| 517 | 3300005445 | Ga0070708_100170630 | Ga0070708_1001706302 | 324 |
| 518 | 3300005455 | Ga0070663_100238032 | Ga0070663_1002380322 | 324 |
| 519 | 3300005530 | Ga0070679_100175843 | Ga0070679_1001758431 | 324 |
| 520 | 3300005548 | Ga0070665_100000011 | Ga0070665_100000011145 | 324 |
| 521 | 3300005548 | Ga0070665_100012821 | Ga0070665_1000128218 | 324 |
| 522 | 3300005563 | Ga0068855_100000573 | Ga0068855_10000057322 | 324 |
| 523 | 3300005564 | Ga0070664_100302327 | Ga0070664_1003023272 | 324 |
| 524 | 3300005614 | Ga0068856_100308578 | Ga0068856_1003085782 | 324 |
| 525 | 3300005616 | Ga0068852_100359962 | Ga0068852_1003599622 | 324 |
| 526 | 3300005617 | Ga0068859_100000484 | Ga0068859_10000048435 | 324 |
| 527 | 3300005618 | Ga0068864_100006151 | Ga0068864_10000615111 | 324 |
| 528 | 3300005618 | Ga0068864_100028618 | Ga0068864_1000286182 | 324 |
| 529 | 3300005719 | Ga0068861_100007195 | Ga0068861_1000071954 | 324 |
| 530 | 3300005719 | Ga0068861_100008877 | Ga0068861_1000088773 | 324 |
| 531 | 3300005841 | Ga0068863_100000028 | Ga0068863_10000002813 | 324 |
| 532 | 3300005841 | Ga0068863_100000103 | Ga0068863_10000010314 | 324 |
| 533 | 3300005841 | Ga0068863_100000459 | Ga0068863_10000045932 | 324 |
| 534 | 3300005841 | Ga0068863_100028365 | Ga0068863_1000283653 | 324 |
| 535 | 3300005842 | Ga0068858_100025093 | Ga0068858_1000250932 | 324 |
| 536 | 3300005842 | Ga0068858_100125046 | Ga0068858_1001250462 | 324 |
| 537 | 3300005843 | Ga0068860_100000002 | Ga0068860_10000000221 | 324 |
| 538 | 3300005843 | Ga0068860_100000093 | Ga0068860_10000009316 | 324 |
| 539 | 3300005843 | Ga0068860_100002238 | Ga0068860_1000022388 | 324 |
| 540 | 3300005843 | Ga0068860_100007641 | Ga0068860_10000764112 | 324 |
| 541 | 3300005843 | Ga0068860_100046017 | Ga0068860_1000460173 | 324 |
| 542 | 3300005844 | Ga0068862_100000721 | Ga0068862_10000072121 | 324 |
| 543 | 3300005844 | Ga0068862_100000924 | Ga0068862_1000009246 | 324 |
| 544 | 3300005844 | Ga0068862_100250749 | Ga0068862_1002507491 | 324 |
| 545 | 3300006195 | Ga0075366_10003329 | Ga0075366_100033298 | 324 |
| 546 | 3300006237 | Ga0097621_100122775 | Ga0097621_1001227753 | 324 |
| 547 | 3300006931 | Ga0097620_100000484 | Ga0097620_1000004849 | 324 |
| 548 | 3300009093 | Ga0105240_10056443 | Ga0105240_100564432 | 324 |
| 549 | 3300009094 | Ga0111539_10175324 | Ga0111539_101753242 | 324 |
| 550 | 3300009101 | Ga0105247_10000201 | Ga0105247_1000020151 | 324 |
| 551 | 3300009148 | Ga0105243_10016334 | Ga0105243_100163345 | 324 |
| 552 | 3300009177 | Ga0105248_10008146 | Ga0105248_1000814610 | 324 |
| 553 | 3300009177 | Ga0105248_10049162 | Ga0105248_100491623 | 324 |
| 554 | 3300009551 | Ga0105238_10193088 | Ga0105238_101930882 | 324 |
| 555 | 3300009551 | Ga0105238_10259608 | Ga0105238_102596082 | 324 |
| 556 | 3300009553 | Ga0105249_10000797 | Ga0105249_100007974 | 324 |
| 557 | 3300013306 | Ga0163162_10005464 | Ga0163162_100054649 | 324 |
| 558 | 3300014968 | Ga0157379_10005857 | Ga0157379_100058577 | 324 |
| 559 | 3300017792 | Ga0163161_10038545 | Ga0163161_100385453 | 324 |
| 560 | 3300025893 | Ga0207682_10002753 | Ga0207682_100027536 | 324 |
| 561 | 3300025900 | Ga0207710_10001219 | Ga0207710_1000121911 | 324 |
| 562 | 3300025903 | Ga0207680_10009261 | Ga0207680_100092615 | 324 |
| 563 | 3300025903 | Ga0207680_10031024 | Ga0207680_100310242 | 324 |
| 564 | 3300025903 | Ga0207680_10173349 | Ga0207680_101733492 | 324 |
| 565 | 3300025909 | Ga0207705_10001756 | Ga0207705_100017564 | 324 |
| 566 | 3300025913 | Ga0207695_10005423 | Ga0207695_1000542310 | 324 |
| 567 | 3300025919 | Ga0207657_10017821 | Ga0207657_100178215 | 324 |
| 568 | 3300025923 | Ga0207681_10000046 | Ga0207681_1000004670 | 324 |
| 569 | 3300025923 | Ga0207681_10036798 | Ga0207681_100367982 | 324 |
| 570 | 3300025924 | Ga0207694_10242330 | Ga0207694_102423302 | 324 |
| 571 | 3300025925 | Ga0207650_10001094 | Ga0207650_100010942 | 324 |
| 572 | 3300025927 | Ga0207687_10033482 | Ga0207687_100334822 | 324 |
| 573 | 3300025931 | Ga0207644_10000038 | Ga0207644_1000003863 | 324 |
| 574 | 3300025931 | Ga0207644_10000170 | Ga0207644_1000017014 | 324 |
| 575 | 3300025931 | Ga0207644_10179621 | Ga0207644_101796212 | 324 |
| 576 | 3300025938 | Ga0207704_10288126 | Ga0207704_102881262 | 324 |
| 577 | 3300025940 | Ga0207691_10190241 | Ga0207691_101902412 | 324 |
| 578 | 3300025944 | Ga0207661_10114288 | Ga0207661_101142883 | 324 |
| 579 | 3300025949 | Ga0207667_10001495 | Ga0207667_1000149528 | 324 |
| 580 | 3300025961 | Ga0207712_10004100 | Ga0207712_100041002 | 324 |
| 581 | 3300025972 | Ga0207668_10000024 | Ga0207668_1000002435 | 324 |
| 582 | 3300025972 | Ga0207668_10000616 | Ga0207668_1000061615 | 324 |
| 583 | 3300025972 | Ga0207668_10000626 | Ga0207668_1000062618 | 324 |
| 584 | 3300025972 | Ga0207668_10011041 | Ga0207668_100110415 | 324 |
| 585 | 3300025986 | Ga0207658_10000002 | Ga0207658_10000002328 | 324 |
| 586 | 3300025986 | Ga0207658_10000062 | Ga0207658_10000062102 | 324 |
| 587 | 3300025986 | Ga0207658_10001112 | Ga0207658_1000111217 | 324 |
| 588 | 3300025986 | Ga0207658_10003195 | Ga0207658_100031953 | 324 |
| 589 | 3300026035 | Ga0207703_10002154 | Ga0207703_1000215415 | 324 |
| 590 | 3300026035 | Ga0207703_10145526 | Ga0207703_101455262 | 324 |
| 591 | 3300026067 | Ga0207678_10234946 | Ga0207678_102349461 | 324 |
| 592 | 3300026078 | Ga0207702_10480983 | Ga0207702_104809832 | 324 |
| 593 | 3300026088 | Ga0207641_10000014 | Ga0207641_10000014161 | 324 |
| 594 | 3300026088 | Ga0207641_10000113 | Ga0207641_1000011314 | 324 |
| 595 | 3300026088 | Ga0207641_10000179 | Ga0207641_1000017921 | 324 |
| 596 | 3300026088 | Ga0207641_10002154 | Ga0207641_100021543 | 324 |
| 597 | 3300026088 | Ga0207641_10004408 | Ga0207641_1000440811 | 324 |
| 598 | 3300026095 | Ga0207676_10001265 | Ga0207676_1000126513 | 324 |
| 599 | 3300026095 | Ga0207676_10006523 | Ga0207676_100065238 | 324 |
| 600 | 3300026095 | Ga0207676_10017180 | Ga0207676_100171805 | 324 |
| 601 | 3300026118 | Ga0207675_100000048 | Ga0207675_10000004862 | 324 |
| 602 | 3300026118 | Ga0207675_100016337 | Ga0207675_1000163373 | 324 |
| 603 | 3300027614 | Ga0209970_1009139 | Ga0209970_10091392 | 324 |
| 604 | 3300027876 | Ga0209974_10002593 | Ga0209974_100025935 | 324 |
| 605 | 3300028379 | Ga0268266_10000063 | Ga0268266_10000063142 | 324 |
| 606 | 3300028379 | Ga0268266_10000487 | Ga0268266_1000048731 | 324 |
| 607 | 3300028379 | Ga0268266_10002389 | Ga0268266_1000238920 | 324 |
| 608 | 3300028380 | Ga0268265_10000269 | Ga0268265_100002699 | 324 |
| 609 | 3300028380 | Ga0268265_10000358 | Ga0268265_1000035835 | 324 |
| 610 | 3300028380 | Ga0268265_10030321 | Ga0268265_100303212 | 324 |
| 611 | 3300028380 | Ga0268265_10230880 | Ga0268265_102308801 | 324 |
| 612 | 3300028381 | Ga0268264_10000001 | Ga0268264_10000001653 | 324 |
| 613 | 3300028381 | Ga0268264_10000067 | Ga0268264_10000067276 | 324 |
| 614 | 3300028381 | Ga0268264_10000406 | Ga0268264_1000040610 | 324 |
| 615 | 3300028381 | Ga0268264_10017300 | Ga0268264_100173005 | 324 |
| 616 | 3300028381 | Ga0268264_10033448 | Ga0268264_100334483 | 324 |
| 617 | 3300030744 | Ga0316181_1169913 | Ga0316181_11699131 | 324 |
| 618 | 3300030745 | Ga0316182_1417669 | Ga0316182_14176691 | 324 |
| 619 | 3300031548 | Ga0307408_100034516 | Ga0307408_1000345163 | 324 |
| 620 | 3300031548 | Ga0307408_100086745 | Ga0307408_1000867451 | 324 |
| 621 | 3300031731 | Ga0307405_10001629 | Ga0307405_1000162910 | 324 |
| 622 | 3300031731 | Ga0307405_10046590 | Ga0307405_100465902 | 324 |
| 623 | 3300031824 | Ga0307413_10005246 | Ga0307413_100052464 | 324 |
| 624 | 3300031852 | Ga0307410_10006608 | Ga0307410_100066085 | 324 |
| 625 | 3300031852 | Ga0307410_10060579 | Ga0307410_100605793 | 324 |
| 626 | 3300031901 | Ga0307406_10022429 | Ga0307406_100224293 | 324 |
| 627 | 3300031901 | Ga0307406_10079341 | Ga0307406_100793412 | 324 |
| 628 | 3300031903 | Ga0307407_10012754 | Ga0307407_100127543 | 324 |
| 629 | 3300031911 | Ga0307412_10009535 | Ga0307412_100095353 | 324 |
| 630 | 3300031911 | Ga0307412_10065913 | Ga0307412_100659133 | 324 |
| 631 | 3300031911 | Ga0307412_10134058 | Ga0307412_101340583 | 324 |
| 632 | 3300031911 | Ga0307412_10143895 | Ga0307412_101438952 | 324 |
| 633 | 3300031995 | Ga0307409_100032819 | Ga0307409_1000328194 | 324 |
| 634 | 3300031995 | Ga0307409_100040966 | Ga0307409_1000409663 | 324 |
| 635 | 3300031995 | Ga0307409_100071646 | Ga0307409_1000716462 | 324 |
| 636 | 3300031995 | Ga0307409_100204214 | Ga0307409_1002042142 | 324 |
| 637 | 3300032002 | Ga0307416_100054276 | Ga0307416_1000542763 | 324 |
| 638 | 3300032002 | Ga0307416_100075784 | Ga0307416_1000757842 | 324 |
| 639 | 3300032004 | Ga0307414_10091975 | Ga0307414_100919751 | 324 |
| 640 | 3300032005 | Ga0307411_10010805 | Ga0307411_100108055 | 324 |
| 641 | 3300032005 | Ga0307411_10039173 | Ga0307411_100391731 | 324 |
| 642 | 3300032005 | Ga0307411_10101592 | Ga0307411_101015924 | 324 |
| 643 | 3300032126 | Ga0307415_100024741 | Ga0307415_1000247412 | 324 |
| 644 | 3300032126 | Ga0307415_100042979 | Ga0307415_1000429792 | 324 |
| 645 | 3300032126 | Ga0307415_100207705 | Ga0307415_1002077052 | 324 |
| 646 | 3300032126 | Ga0307415_100275610 | Ga0307415_1002756102 | 324 |
| 647 | 3300033180 | Ga0307510_10135340 | Ga0307510_101353402 | 324 |
| 648 | 3300042006 | Ga0439432_031309 | Ga0439432_031309_589_1563 | 324 |
| 649 | 3300044712 | Ga0453684_0128487 | Ga0453684_0128487_1615_2601 | 324 |
| 650 | 3300046460 | Ga0495638_0000014 | Ga0495638_0000014_227051_228025 | 324 |
| 651 | 3300046471 | Ga0495650_0004373 | Ga0495650_0004373_3884_4924 | 324 |
| 652 | 3300046506 | Ga0495583_0000557 | Ga0495583_0000557_45008_45982 | 324 |
| 653 | 3300046513 | Ga0495616_0000013 | Ga0495616_0000013_198173_199147 | 324 |
| 654 | 3300046519 | Ga0495632_0003550 | Ga0495632_0003550_4194_5168 | 324 |
| 655 | 3300046524 | Ga0495648_0000021 | Ga0495648_0000021_200660_201634 | 324 |
| 656 | 3300046530 | Ga0495654_0048080 | Ga0495654_0048080_1027_2007 | 324 |
| 657 | 3300046558 | Ga0495633_0007320 | Ga0495633_0007320_781_1755 | 324 |
| 658 | 3300046616 | Ga0495668_0084335 | Ga0495668_0084335_164_1138 | 324 |
| 659 | 3300046660 | Ga0495625_0003783 | Ga0495625_0003783_11093_12082 | 324 |
| 660 | 3300046660 | Ga0495625_0085991 | Ga0495625_0085991_453_1433 | 324 |
| 661 | 3300046691 | Ga0495670_0141657 | Ga0495670_0141657_71_1051 | 324 |
| 662 | 3300046692 | Ga0495671_0000028 | Ga0495671_0000028_45131_46105 | 324 |
| 663 | 3300047469 | Ga0495673_0000058 | Ga0495673_0000058_188886_189860 | 324 |
| 664 | 3300048904 | Ga0496101_0275588 | Ga0496101_0275588_252_1226 | 324 |
| 665 | 3300048907 | Ga0496104_0020819 | Ga0496104_0020819_2251_3231 | 324 |
| 666 | 3300048908 | Ga0496105_0000224 | Ga0496105_0000224_22750_23730 | 324 |
| 667 | 3300048912 | Ga0496109_0173464 | Ga0496109_0173464_953_1927 | 324 |
| 668 | 3300048913 | Ga0496110_0190634 | Ga0496110_0190634_849_1823 | 324 |
| 669 | 3300048917 | Ga0496114_0077083 | Ga0496114_0077083_704_1678 | 324 |
| 670 | 3300048921 | Ga0496118_0030914 | Ga0496118_0030914_2988_3968 | 324 |
| 671 | 3300048924 | Ga0496121_0000274 | Ga0496121_0000274_9078_10058 | 324 |
| 672 | 3300049688 | Ga0501259_015279 | Ga0501259_015279_39_1013 | 324 |
| 673 | 3300049765 | Ga0501268_001367 | Ga0501268_001367_806_1780 | 324 |
| 674 | 3300049769 | Ga0501272_001814 | Ga0501272_001814_855_1829 | 324 |
| 675 | 3300050493 | nmdc:mga0k408_1890_c1 | nmdc:mga0k408_1890_c1_343_1320 | 324 |
| 676 | 3300050511 | nmdc:mga08y16_227938_c1 | nmdc:mga08y16_227938_c1_85_1059 | 324 |
| 677 | 3300053087 | Ga0500643_006839 | Ga0500643_006839_3122_4105 | 324 |
| 678 | 3300053087 | Ga0500643_006840 | Ga0500643_006840_594_1577 | 324 |
| 679 | 3300053087 | Ga0500643_007854 | Ga0500643_007854_2819_3799 | 324 |
| 680 | 3300053119 | Ga0500595_014569 | Ga0500595_014569_291_1271 | 324 |
| 681 | 3300053136 | Ga0500559_0003528 | Ga0500559_0003528_552_1532 | 324 |
| 682 | 3300053136 | Ga0500559_0062232 | Ga0500559_0062232_325_1314 | 324 |
| 683 | 3300053151 | Ga0500604_0005398 | Ga0500604_0005398_1249_2223 | 324 |
| 684 | 3300053156 | Ga0500622_0000256 | Ga0500622_0000256_1182_2162 | 324 |
| 685 | 3300053156 | Ga0500622_0040789 | Ga0500622_0040789_856_1845 | 324 |
| 686 | 3300053730 | Ga0500645_000205 | Ga0500645_000205_10106_11095 | 324 |
| 687 | 3300053730 | Ga0500645_028998 | Ga0500645_028998_269_1249 | 324 |
| 688 | 3300001904 | JGI24736J21556_1000004 | JGI24736J21556_100000452 | 325 |
| 689 | 3300001976 | JGI24752J21851_1002724 | JGI24752J21851_10027241 | 325 |
| 690 | 3300001979 | JGI24740J21852_10011202 | JGI24740J21852_100112022 | 325 |
| 691 | 3300001989 | JGI24739J22299_10014124 | JGI24739J22299_100141243 | 325 |
| 692 | 3300001990 | JGI24737J22298_10009329 | JGI24737J22298_100093294 | 325 |
| 693 | 3300002067 | JGI24735J21928_10003797 | JGI24735J21928_100037977 | 325 |
| 694 | 3300002070 | JGI24750J21931_1000167 | JGI24750J21931_10001677 | 325 |
| 695 | 3300002074 | JGI24748J21848_1000032 | JGI24748J21848_100003227 | 325 |
| 696 | 3300002075 | JGI24738J21930_10002788 | JGI24738J21930_100027882 | 325 |
| 697 | 3300002076 | JGI24749J21850_1000751 | JGI24749J21850_10007515 | 325 |
| 698 | 3300002239 | JGI24034J26672_10000022 | JGI24034J26672_1000002268 | 325 |
| 699 | 3300002244 | JGI24742J22300_10002170 | JGI24742J22300_100021702 | 325 |
| 700 | 3300002459 | JGI24751J29686_10009441 | JGI24751J29686_100094413 | 325 |
| 701 | 3300005330 | Ga0070690_100000056 | Ga0070690_10000005646 | 325 |
| 702 | 3300005331 | Ga0070670_100030233 | Ga0070670_1000302331 | 325 |
| 703 | 3300005335 | Ga0070666_10000002 | Ga0070666_1000000251 | 325 |
| 704 | 3300005340 | Ga0070689_100003288 | Ga0070689_10000328810 | 325 |
| 705 | 3300005353 | Ga0070669_100000170 | Ga0070669_10000017051 | 325 |
| 706 | 3300005355 | Ga0070671_100021128 | Ga0070671_1000211282 | 325 |
| 707 | 3300005365 | Ga0070688_100002242 | Ga0070688_1000022428 | 325 |
| 708 | 3300005367 | Ga0070667_100031993 | Ga0070667_1000319936 | 325 |
| 709 | 3300005457 | Ga0070662_100026714 | Ga0070662_1000267145 | 325 |
| 710 | 3300005539 | Ga0068853_100202371 | Ga0068853_1002023712 | 325 |
| 711 | 3300005544 | Ga0070686_100000003 | Ga0070686_100000003316 | 325 |
| 712 | 3300005548 | Ga0070665_100000036 | Ga0070665_100000036287 | 325 |
| 713 | 3300005564 | Ga0070664_100027493 | Ga0070664_1000274936 | 325 |
| 714 | 3300005617 | Ga0068859_100138192 | Ga0068859_1001381922 | 325 |
| 715 | 3300005719 | Ga0068861_100004430 | Ga0068861_1000044301 | 325 |
| 716 | 3300005841 | Ga0068863_100000095 | Ga0068863_10000009547 | 325 |
| 717 | 3300005842 | Ga0068858_100000953 | Ga0068858_10000095310 | 325 |
| 718 | 3300005843 | Ga0068860_100000001 | Ga0068860_10000000151 | 325 |
| 719 | 3300005844 | Ga0068862_100007519 | Ga0068862_1000075195 | 325 |
| 720 | 3300006931 | Ga0097620_100138184 | Ga0097620_1001381842 | 325 |
| 721 | 3300009093 | Ga0105240_10728524 | Ga0105240_107285241 | 325 |
| 722 | 3300009098 | Ga0105245_10183139 | Ga0105245_101831394 | 325 |
| 723 | 3300009174 | Ga0105241_10229759 | Ga0105241_102297592 | 325 |
| 724 | 3300009174 | Ga0105241_10252634 | Ga0105241_102526341 | 325 |
| 725 | 3300009545 | Ga0105237_10376154 | Ga0105237_103761542 | 325 |
| 726 | 3300009553 | Ga0105249_10000026 | Ga0105249_1000002650 | 325 |
| 727 | 3300013104 | Ga0157370_10025526 | Ga0157370_100255264 | 325 |
| 728 | 3300013105 | Ga0157369_10053991 | Ga0157369_100539913 | 325 |
| 729 | 3300014325 | Ga0163163_10133816 | Ga0163163_101338162 | 325 |
| 730 | 3300014326 | Ga0157380_10002745 | Ga0157380_100027458 | 325 |
| 731 | 3300017792 | Ga0163161_10000008 | Ga0163161_10000008257 | 325 |
| 732 | 3300025223 | Ga0207672_1000347 | Ga0207672_10003476 | 325 |
| 733 | 3300025321 | Ga0207656_10002248 | Ga0207656_100022486 | 325 |
| 734 | 3300025903 | Ga0207680_10000004 | Ga0207680_10000004809 | 325 |
| 735 | 3300025904 | Ga0207647_10000861 | Ga0207647_1000086112 | 325 |
| 736 | 3300025911 | Ga0207654_10016953 | Ga0207654_100169536 | 325 |
| 737 | 3300025913 | Ga0207695_10003647 | Ga0207695_1000364715 | 325 |
| 738 | 3300025914 | Ga0207671_10004057 | Ga0207671_1000405714 | 325 |
| 739 | 3300025923 | Ga0207681_10000588 | Ga0207681_1000058810 | 325 |
| 740 | 3300025924 | Ga0207694_10009277 | Ga0207694_100092776 | 325 |
| 741 | 3300025931 | Ga0207644_10001088 | Ga0207644_100010882 | 325 |
| 742 | 3300025936 | Ga0207670_10003876 | Ga0207670_100038765 | 325 |
| 743 | 3300025941 | Ga0207711_10023502 | Ga0207711_100235025 | 325 |
| 744 | 3300025949 | Ga0207667_10014622 | Ga0207667_100146224 | 325 |
| 745 | 3300025961 | Ga0207712_10000001 | Ga0207712_10000001683 | 325 |
| 746 | 3300025986 | Ga0207658_10000832 | Ga0207658_100008322 | 325 |
| 747 | 3300026035 | Ga0207703_10003684 | Ga0207703_100036842 | 325 |
| 748 | 3300026078 | Ga0207702_10004491 | Ga0207702_100044916 | 325 |
| 749 | 3300026088 | Ga0207641_10000148 | Ga0207641_1000014848 | 325 |
| 750 | 3300026095 | Ga0207676_10000479 | Ga0207676_1000047924 | 325 |
| 751 | 3300026116 | Ga0207674_10011027 | Ga0207674_100110278 | 325 |
| 752 | 3300026118 | Ga0207675_100004475 | Ga0207675_10000447511 | 325 |
| 753 | 3300026142 | Ga0207698_10203678 | Ga0207698_102036782 | 325 |
| 754 | 3300028379 | Ga0268266_10000042 | Ga0268266_1000004252 | 325 |
| 755 | 3300028380 | Ga0268265_10001122 | Ga0268265_1000112225 | 325 |
| 756 | 3300028381 | Ga0268264_10000006 | Ga0268264_10000006809 | 325 |
| 757 | 3300031548 | Ga0307408_100229082 | Ga0307408_1002290821 | 325 |
| 758 | 3300031824 | Ga0307413_10160139 | Ga0307413_101601392 | 325 |
| 759 | 3300031901 | Ga0307406_10064020 | Ga0307406_100640202 | 325 |
| 760 | 3300031903 | Ga0307407_10016909 | Ga0307407_100169092 | 325 |
| 761 | 3300031911 | Ga0307412_10177944 | Ga0307412_101779442 | 325 |
| 762 | 3300031995 | Ga0307409_100069187 | Ga0307409_1000691873 | 325 |
| 763 | 3300032002 | Ga0307416_100035478 | Ga0307416_1000354785 | 325 |
| 764 | 3300032002 | Ga0307416_100172467 | Ga0307416_1001724673 | 325 |
| 765 | 3300032004 | Ga0307414_10093543 | Ga0307414_100935433 | 325 |
| 766 | 3300032004 | Ga0307414_10096462 | Ga0307414_100964621 | 325 |
| 767 | 3300032004 | Ga0307414_10246010 | Ga0307414_102460102 | 325 |
| 768 | 3300032126 | Ga0307415_100172174 | Ga0307415_1001721743 | 325 |
| 769 | 3300032126 | Ga0307415_100275605 | Ga0307415_1002756052 | 325 |
| 770 | 3300048904 | Ga0496101_0275640 | Ga0496101_0275640_182_1159 | 325 |
| 771 | 3300048905 | Ga0496102_0016012 | Ga0496102_0016012_3128_4105 | 325 |
| 772 | 3300048906 | Ga0496103_0003222 | Ga0496103_0003222_5940_6917 | 325 |
| 773 | 3300048907 | Ga0496104_0023092 | Ga0496104_0023092_2557_3534 | 325 |
| 774 | 3300048908 | Ga0496105_0077963 | Ga0496105_0077963_1589_2566 | 325 |
| 775 | 3300048910 | Ga0496107_0080661 | Ga0496107_0080661_1025_2002 | 325 |
| 776 | 3300048920 | Ga0496117_0011577 | Ga0496117_0011577_3583_4560 | 325 |
| 777 | 3300048921 | Ga0496118_0006208 | Ga0496118_0006208_10480_11457 | 325 |
| 778 | 3300048922 | Ga0496119_0180092 | Ga0496119_0180092_107_1084 | 325 |
| 779 | 3300048927 | Ga0496124_0240404 | Ga0496124_0240404_350_1327 | 325 |
| 780 | 3300049765 | Ga0501268_002447 | Ga0501268_002447_239_1216 | 325 |
| 781 | 3300053087 | Ga0500643_000524 | Ga0500643_000524_21906_22883 | 325 |
| 782 | iso_pu_bacteria | 2880518877 | 2880520379 | 325 |
| 783 | 3300001989 | JGI24739J22299_10014975 | JGI24739J22299_100149752 | 326 |
| 784 | 3300005331 | Ga0070670_100001143 | Ga0070670_1000011438 | 326 |
| 785 | 3300005331 | Ga0070670_100095651 | Ga0070670_1000956512 | 326 |
| 786 | 3300005338 | Ga0068868_100000182 | Ga0068868_10000018212 | 326 |
| 787 | 3300005339 | Ga0070660_100000364 | Ga0070660_10000036424 | 326 |
| 788 | 3300005353 | Ga0070669_100120461 | Ga0070669_1001204613 | 326 |
| 789 | 3300005366 | Ga0070659_100000022 | Ga0070659_10000002225 | 326 |
| 790 | 3300005367 | Ga0070667_100001233 | Ga0070667_1000012338 | 326 |
| 791 | 3300005457 | Ga0070662_100008659 | Ga0070662_1000086596 | 326 |
| 792 | 3300005539 | Ga0068853_100002599 | Ga0068853_10000259911 | 326 |
| 793 | 3300005539 | Ga0068853_100042414 | Ga0068853_1000424144 | 326 |
| 794 | 3300005577 | Ga0068857_100065537 | Ga0068857_1000655373 | 326 |
| 795 | 3300005618 | Ga0068864_100000017 | Ga0068864_100000017303 | 326 |
| 796 | 3300005834 | Ga0068851_10010455 | Ga0068851_100104554 | 326 |
| 797 | 3300005841 | Ga0068863_100000018 | Ga0068863_100000018225 | 326 |
| 798 | 3300005844 | Ga0068862_100000010 | Ga0068862_1000000107 | 326 |
| 799 | 3300009011 | Ga0105251_10000568 | Ga0105251_100005681 | 326 |
| 800 | 3300009177 | Ga0105248_10000128 | Ga0105248_100001287 | 326 |
| 801 | 3300009553 | Ga0105249_10000173 | Ga0105249_1000017318 | 326 |
| 802 | 3300013306 | Ga0163162_10037199 | Ga0163162_100371992 | 326 |
| 803 | 3300025321 | Ga0207656_10139628 | Ga0207656_101396281 | 326 |
| 804 | 3300025735 | Ga0207713_1006583 | Ga0207713_10065831 | 326 |
| 805 | 3300025919 | Ga0207657_10001613 | Ga0207657_1000161312 | 326 |
| 806 | 3300025923 | Ga0207681_10125081 | Ga0207681_101250813 | 326 |
| 807 | 3300025925 | Ga0207650_10000199 | Ga0207650_1000019972 | 326 |
| 808 | 3300025926 | Ga0207659_10020886 | Ga0207659_100208866 | 326 |
| 809 | 3300025927 | Ga0207687_10277787 | Ga0207687_102777872 | 326 |
| 810 | 3300025932 | Ga0207690_10000003 | Ga0207690_10000003670 | 326 |
| 811 | 3300025933 | Ga0207706_10013575 | Ga0207706_100135754 | 326 |
| 812 | 3300025941 | Ga0207711_10000031 | Ga0207711_100000317 | 326 |
| 813 | 3300025961 | Ga0207712_10000541 | Ga0207712_1000054116 | 326 |
| 814 | 3300025986 | Ga0207658_10000627 | Ga0207658_1000062719 | 326 |
| 815 | 3300026041 | Ga0207639_10028114 | Ga0207639_100281144 | 326 |
| 816 | 3300026041 | Ga0207639_10057898 | Ga0207639_100578982 | 326 |
| 817 | 3300026088 | Ga0207641_10000002 | Ga0207641_10000002477 | 326 |
| 818 | 3300026095 | Ga0207676_10000005 | Ga0207676_10000005330 | 326 |
| 819 | 3300026116 | Ga0207674_10005854 | Ga0207674_1000585414 | 326 |
| 820 | 3300028380 | Ga0268265_10000003 | Ga0268265_10000003512 | 326 |
| 821 | 3300031548 | Ga0307408_100131621 | Ga0307408_1001316213 | 326 |
| 822 | 3300031901 | Ga0307406_10319479 | Ga0307406_103194791 | 326 |
| 823 | 3300031903 | Ga0307407_10065949 | Ga0307407_100659492 | 326 |
| 824 | 3300032004 | Ga0307414_10050459 | Ga0307414_100504593 | 326 |
| 825 | 3300032004 | Ga0307414_10099110 | Ga0307414_100991103 | 326 |
| 826 | 3300046692 | Ga0495671_0106235 | Ga0495671_0106235_381_1361 | 326 |
| 827 | 3300048905 | Ga0496102_0557708 | Ga0496102_0557708_12_992 | 326 |
| 828 | 3300048906 | Ga0496103_0140163 | Ga0496103_0140163_531_1511 | 326 |
| 829 | 3300048920 | Ga0496117_0024655 | Ga0496117_0024655_3687_4667 | 326 |
| 830 | 3300048921 | Ga0496118_0004371 | Ga0496118_0004371_12170_13150 | 326 |
| 831 | 3300049663 | Ga0501223_000007 | Ga0501223_000007_28846_29826 | 326 |
| 832 | 3300049676 | Ga0501246_000328 | Ga0501246_000328_623_1603 | 326 |
| 833 | 3300049705 | Ga0501225_0000096 | Ga0501225_0000096_4645_5625 | 326 |
| 834 | 3300053157 | Ga0500624_000072 | Ga0500624_000072_16030_17010 | 326 |
| 835 | 3300053177 | Ga0500636_0002804 | Ga0500636_0002804_8514_9494 | 326 |
| 836 | 2162886007 | SwRhRL2b_contig_1168444 | SwRhRL2b_0312.00003340 | 327 |
| 837 | 2162886007 | SwRhRL2b_contig_3755818 | SwRhRL2b_0665.00003240 | 327 |
| 838 | 3300001904 | JGI24736J21556_1000307 | JGI24736J21556_10003079 | 327 |
| 839 | 3300001915 | JGI24741J21665_1000198 | JGI24741J21665_100019810 | 327 |
| 840 | 3300001979 | JGI24740J21852_10000826 | JGI24740J21852_1000082610 | 327 |
| 841 | 3300001989 | JGI24739J22299_10007439 | JGI24739J22299_100074392 | 327 |
| 842 | 3300002067 | JGI24735J21928_10000294 | JGI24735J21928_100002948 | 327 |
| 843 | 3300002075 | JGI24738J21930_10001664 | JGI24738J21930_100016646 | 327 |
| 844 | 3300005289 | Ga0065704_10004352 | Ga0065704_100043525 | 327 |
| 845 | 3300005289 | Ga0065704_10098162 | Ga0065704_100981622 | 327 |
| 846 | 3300005327 | Ga0070658_10153388 | Ga0070658_101533881 | 327 |
| 847 | 3300005331 | Ga0070670_100012295 | Ga0070670_1000122954 | 327 |
| 848 | 3300005353 | Ga0070669_100031436 | Ga0070669_1000314363 | 327 |
| 849 | 3300005366 | Ga0070659_100002729 | Ga0070659_1000027297 | 327 |
| 850 | 3300005455 | Ga0070663_100001009 | Ga0070663_10000100916 | 327 |
| 851 | 3300005466 | Ga0070685_10031819 | Ga0070685_100318193 | 327 |
| 852 | 3300005564 | Ga0070664_100253726 | Ga0070664_1002537262 | 327 |
| 853 | 3300005577 | Ga0068857_100251598 | Ga0068857_1002515982 | 327 |
| 854 | 3300005614 | Ga0068856_100007034 | Ga0068856_1000070344 | 327 |
| 855 | 3300005616 | Ga0068852_100089119 | Ga0068852_1000891192 | 327 |
| 856 | 3300005842 | Ga0068858_100006139 | Ga0068858_1000061393 | 327 |
| 857 | 3300006042 | Ga0075368_10000448 | Ga0075368_1000044811 | 327 |
| 858 | 3300006178 | Ga0075367_10001865 | Ga0075367_100018654 | 327 |
| 859 | 3300006353 | Ga0075370_10014121 | Ga0075370_100141214 | 327 |
| 860 | 3300009174 | Ga0105241_10001357 | Ga0105241_1000135711 | 327 |
| 861 | 3300009545 | Ga0105237_10017796 | Ga0105237_100177964 | 327 |
| 862 | 3300009978 | Ga0105148_100001 | Ga0105148_1000015 | 327 |
| 863 | 3300009982 | Ga0105147_100489 | Ga0105147_1004893 | 327 |
| 864 | 3300013100 | Ga0157373_10175173 | Ga0157373_101751732 | 327 |
| 865 | 3300013105 | Ga0157369_10272486 | Ga0157369_102724862 | 327 |
| 866 | 3300014325 | Ga0163163_10486080 | Ga0163163_104860801 | 327 |
| 867 | 3300014326 | Ga0157380_10012455 | Ga0157380_100124556 | 327 |
| 868 | 3300017792 | Ga0163161_10023698 | Ga0163161_100236986 | 327 |
| 869 | 3300025229 | Ga0209147_103087 | Ga0209147_1030873 | 327 |
| 870 | 3300025321 | Ga0207656_10035337 | Ga0207656_100353372 | 327 |
| 871 | 3300025909 | Ga0207705_10298353 | Ga0207705_102983531 | 327 |
| 872 | 3300025913 | Ga0207695_10030897 | Ga0207695_100308974 | 327 |
| 873 | 3300025919 | Ga0207657_10265965 | Ga0207657_102659651 | 327 |
| 874 | 3300025924 | Ga0207694_10118050 | Ga0207694_101180501 | 327 |
| 875 | 3300025925 | Ga0207650_10015388 | Ga0207650_100153883 | 327 |
| 876 | 3300025933 | Ga0207706_10010105 | Ga0207706_100101053 | 327 |
| 877 | 3300025949 | Ga0207667_10096985 | Ga0207667_100969852 | 327 |
| 878 | 3300026041 | Ga0207639_10000815 | Ga0207639_1000081510 | 327 |
| 879 | 3300026067 | Ga0207678_10000080 | Ga0207678_1000008021 | 327 |
| 880 | 3300026078 | Ga0207702_10003704 | Ga0207702_1000370410 | 327 |
| 881 | 3300026116 | Ga0207674_10011489 | Ga0207674_100114892 | 327 |
| 882 | 3300026116 | Ga0207674_10020838 | Ga0207674_100208385 | 327 |
| 883 | 3300026142 | Ga0207698_10012634 | Ga0207698_100126343 | 327 |
| 884 | 3300027866 | Ga0209813_10000578 | Ga0209813_100005785 | 327 |
| 885 | 3300031548 | Ga0307408_100005149 | Ga0307408_1000051498 | 327 |
| 886 | 3300031852 | Ga0307410_10051247 | Ga0307410_100512473 | 327 |
| 887 | 3300031852 | Ga0307410_10077483 | Ga0307410_100774832 | 327 |
| 888 | 3300031901 | Ga0307406_10170478 | Ga0307406_101704782 | 327 |
| 889 | 3300031911 | Ga0307412_10070727 | Ga0307412_100707273 | 327 |
| 890 | 3300032002 | Ga0307416_100245203 | Ga0307416_1002452031 | 327 |
| 891 | 3300032004 | Ga0307414_10206985 | Ga0307414_102069852 | 327 |
| 892 | 3300032126 | Ga0307415_100069300 | Ga0307415_1000693002 | 327 |
| 893 | 3300046453 | Ga0495627_000036 | Ga0495627_000036_9619_10605 | 327 |
| 894 | 3300046491 | Ga0495584_0028431 | Ga0495584_0028431_1126_2109 | 327 |
| 895 | 3300046519 | Ga0495632_0000047 | Ga0495632_0000047_93556_94539 | 327 |
| 896 | 3300046520 | Ga0495637_0000367 | Ga0495637_0000367_18571_19554 | 327 |
| 897 | 3300046522 | Ga0495643_0000031 | Ga0495643_0000031_82759_83742 | 327 |
| 898 | 3300046524 | Ga0495648_0005850 | Ga0495648_0005850_3040_4026 | 327 |
| 899 | 3300046524 | Ga0495648_0031987 | Ga0495648_0031987_1386_2369 | 327 |
| 900 | 3300046525 | Ga0495663_0000017 | Ga0495663_0000017_93562_94545 | 327 |
| 901 | 3300046525 | Ga0495663_0072641 | Ga0495663_0072641_81_1067 | 327 |
| 902 | 3300046525 | Ga0495663_0073598 | Ga0495663_0073598_44_1030 | 327 |
| 903 | 3300046558 | Ga0495633_0000952 | Ga0495633_0000952_2987_3970 | 327 |
| 904 | 3300046558 | Ga0495633_0001585 | Ga0495633_0001585_6061_7044 | 327 |
| 905 | 3300046692 | Ga0495671_0000021 | Ga0495671_0000021_174079_175062 | 327 |
| 906 | 3300047470 | Ga0495681_0000827 | Ga0495681_0000827_5239_6222 | 327 |
| 907 | 3300047472 | Ga0495686_0009156 | Ga0495686_0009156_3099_4082 | 327 |
| 908 | 3300048906 | Ga0496103_0272522 | Ga0496103_0272522_63_1052 | 327 |
| 909 | 3300048911 | Ga0496108_0012266 | Ga0496108_0012266_2908_3891 | 327 |
| 910 | 3300048911 | Ga0496108_0021371 | Ga0496108_0021371_1493_2476 | 327 |
| 911 | 3300048912 | Ga0496109_0049878 | Ga0496109_0049878_2184_3167 | 327 |
| 912 | 3300048913 | Ga0496110_0062754 | Ga0496110_0062754_53_1036 | 327 |
| 913 | 3300048914 | Ga0496111_0078716 | Ga0496111_0078716_802_1785 | 327 |
| 914 | 3300048916 | Ga0496113_0104465 | Ga0496113_0104465_727_1710 | 327 |
| 915 | 3300048919 | Ga0496116_0022179 | Ga0496116_0022179_2297_3286 | 327 |
| 916 | 3300048920 | Ga0496117_0028816 | Ga0496117_0028816_1407_2396 | 327 |
| 917 | 3300048922 | Ga0496119_0080101 | Ga0496119_0080101_483_1472 | 327 |
| 918 | 3300048924 | Ga0496121_0000065 | Ga0496121_0000065_151310_152293 | 327 |
| 919 | 3300048925 | Ga0496122_0030586 | Ga0496122_0030586_456_1439 | 327 |
| 920 | 3300048925 | Ga0496122_0043137 | Ga0496122_0043137_689_1672 | 327 |
| 921 | 3300048928 | Ga0496125_0012413 | Ga0496125_0012413_4397_5380 | 327 |
| 922 | 3300048928 | Ga0496125_0101878 | Ga0496125_0101878_762_1745 | 327 |
| 923 | 3300048928 | Ga0496125_0109641 | Ga0496125_0109641_100_1086 | 327 |
| 924 | 3300048928 | Ga0496125_0127540 | Ga0496125_0127540_476_1459 | 327 |
| 925 | 3300048929 | Ga0496126_0003496 | Ga0496126_0003496_18167_19150 | 327 |
| 926 | 3300049658 | Ga0501211_000395 | Ga0501211_000395_2677_3660 | 327 |
| 927 | 3300049669 | Ga0501235_013626 | Ga0501235_013626_283_1266 | 327 |
| 928 | 3300049705 | Ga0501225_0000960 | Ga0501225_0000960_4444_5427 | 327 |
| 929 | 3300049705 | Ga0501225_0006195 | Ga0501225_0006195_1352_2335 | 327 |
| 930 | 3300050494 | nmdc:mga06z11_73_c1 | nmdc:mga06z11_73_c1_37541_38524 | 327 |
| 931 | 3300050495 | nmdc:mga04h51_603_c1 | nmdc:mga04h51_603_c1_4070_5053 | 327 |
| 932 | 3300050496 | nmdc:mga07m45_14098_c1 | nmdc:mga07m45_14098_c1_2859_3842 | 327 |
| 933 | 3300053157 | Ga0500624_000073 | Ga0500624_000073_22988_23974 | 327 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2r8t-assembly1.cif.gz_A | crystal structure of the fructose 1,6-bisphosphatase glpx from e.coli in the complex with fructose 1,6-bisphosphate | 0.9506 | 9 | 322 |
| 8g5w-assembly1.cif.gz_A | structure of the class ii fructose-1,6-bisphophatase from francisella tularensis complexed with native metal cofactor mn++ | 0.9434 | 9 | 326 |
| 7txb-assembly2.cif.gz_A | structure of the class ii fructose-1,6-bisphophatase from mycobacterium tuberculosis complexed with substrate f1,6bp | 0.9415 | 16 | 322 |
| 3bih-assembly1.cif.gz_A | crystal structure of fructose-1,6-bisphosphatase from e.coli glpx | 0.9376 | 10 | 322 |
| 8g5x-assembly1.cif.gz_D | structure of the class ii fructose-1,6-bisphophatase from francisella tularensis complexed with native metal cofactor mn++ and substrate fructose-1,6-bisphosphate | 0.9357 | 9 | 326 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2r8tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9515 | 119 | 273 | 3.40.190.90 |
| 3rplA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9454 | 119 | 273 | 3.40.190.90 |
| af_P9WN21_138_292_3.40.190.90 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9411 | 119 | 273 | 3.40.190.90 |
| 1ni9A01 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 | 0.9358 | 9 | 324 | 3.30.540.10 |
| af_P9WN21_138_292_3.40.190.90 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9295 | 119 | 273 | 3.40.190.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T0KHP7-F1-model_v4 | Fructose-1,6-bisphosphatase | 0.9937 | 1 | 327 |
GO:0005829
GO:0006071 GO:0006094 GO:0030388 GO:0042132 GO:0046872 |
| AF-A0A2N8EKR2-F1-model_v4 | deleted | 0.9937 | 12 | 88 |
|
| AF-A0A4Q5QLR6-F1-model_v4 | fructose-bisphosphatase (EC 3.1.3.11) | 0.9914 | 167 | 323 |
GO:0005829
GO:0006071 GO:0006094 GO:0030388 GO:0042132 |
| AF-A0A520ETV3-F1-model_v4 | deleted | 0.9911 | 175 | 323 |
|
| AF-T0KHP7-F1-model_v4 | Fructose-1,6-bisphosphatase | 0.9906 | 1 | 327 |
GO:0005829
GO:0006071 GO:0006094 GO:0030388 GO:0042132 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar