F486084

General Info

Members Datasets Scaffolds Average Seq Length
933 397 903 325

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100064201|Ga0070670_1000642014
Length 346
Sequence MLDKAIPTAYRNGDNKNERIFDMAQAGSALDRVLVLEMVRVTEAAAIAASKLIGRGDEKAADAAAVEAMRLAFNDLYMDGTVVIGEGERDEAPMLYIGEKVGNAIGTGPRIDIALDPLEGTTITAKAGPNALAVLAISEEGGLLNAPDVYMEKLAIGPGYPEGIIDLKKSVKDNVEAVAAHKGVAPSDIIVCVLDRPRHEKLIGELRAIGCGIMLIPDGDVAGVIATTDPETTIDMYMGSGGAPEGVLACAALRCVGGQFKGRLLFRNEDEKQRAYKWGITDLDKVYDLKELAIGDCIFAATGVTDGSLLDGVKRLPGGKLTTESVVMRASTGTVRWVKGEHKTAV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
4 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
5 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
6 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
7 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
8 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
9 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
10 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
11 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
12 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
13 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
14 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
15 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
16 2842694124 Methylopila sp. R-72369 Isolate Unclassified
17 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
18 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
19 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
20 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
21 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
22 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
23 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
24 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
25 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
26 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
27 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
28 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
29 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
30 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
31 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
32 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
33 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
34 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
35 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
36 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
37 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
38 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
39 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
40 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
41 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
42 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
43 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
44 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
45 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
46 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
47 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
48 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
49 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
50 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
51 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
52 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
53 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
54 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
55 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
56 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
57 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
58 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
59 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
60 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
61 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
64 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
65 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
66 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
72 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
73 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
74 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
75 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
76 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
77 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
78 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
79 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
80 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
81 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
82 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
83 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
84 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
87 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
88 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
89 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
106 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
107 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
108 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
109 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
110 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
111 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
118 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
119 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
122 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
123 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
135 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
136 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
144 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
148 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
149 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
150 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
151 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
155 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
162 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
220 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
225 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
226 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
227 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
228 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
229 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
230 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
231 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
232 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
233 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
234 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
235 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
236 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
237 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
238 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
239 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
240 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
241 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
242 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
243 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
246 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
247 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
248 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
251 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
252 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
253 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
254 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
255 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
256 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
257 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
258 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
259 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
260 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
261 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
262 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
263 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
264 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
265 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
266 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
267 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
268 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
269 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
270 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
271 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
274 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
275 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
276 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
277 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
278 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
279 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
280 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
281 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
282 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
283 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
284 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
285 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
286 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
287 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
288 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
289 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
290 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
291 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
292 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
293 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
294 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
295 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
296 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
297 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
298 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
299 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
300 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
301 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
304 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
305 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
306 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
307 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
308 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
309 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
310 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
311 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
312 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
313 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
326 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
327 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
328 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
329 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
330 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
331 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
332 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
333 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
334 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
335 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
336 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
337 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
338 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
339 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
342 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
343 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
344 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
345 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
346 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
347 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
348 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
349 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
350 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
351 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
352 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
353 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
354 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
356 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
357 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
358 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
359 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
360 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
361 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
362 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
363 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
364 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
365 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
366 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
367 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
368 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
369 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
370 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
371 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
372 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
373 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
374 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
375 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
376 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
377 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
378 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
379 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
380 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
381 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
382 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
383 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
384 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
385 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
386 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
387 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
388 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
389 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
390 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
391 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
392 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
393 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
394 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
395 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
396 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
397 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.68
Metatranscriptomes 0.11
Isolates 3.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.5
Nodule 0.11
Rhizoplane 4.93
Rhizosphere 76.31
Stem 0
Stem Tuber 0.11
Unclassified 8.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1168444 2162886007 Bacteria 3598
2 SwRhRL2b_contig_3124566 2162886007 Bacteria 2009
3 SwRhRL2b_contig_3755818 2162886007 Bacteria 1834
4 JGI24736J21556_1000004 3300001904 Bacteria 55308
5 JGI24736J21556_1000307 3300001904 Bacteria 9005
6 JGI24741J21665_1000198 3300001915 Bacteria 17758
7 JGI24741J21665_1001068 3300001915 Bacteria 8189
8 JGI24752J21851_1002724 3300001976 Bacteria 2348
9 JGI24740J21852_10000826 3300001979 Bacteria 13630
10 JGI24740J21852_10002539 3300001979 Bacteria 8232
11 JGI24740J21852_10011202 3300001979 Bacteria 3422
12 JGI24739J22299_10007439 3300001989 Bacteria 4110
13 JGI24739J22299_10014124 3300001989 Bacteria 2907
14 JGI24739J22299_10014975 3300001989 Bacteria 2820
15 JGI24737J22298_10009329 3300001990 Bacteria 3267
16 JGI24737J22298_10011369 3300001990 Bacteria 2918
17 JGI24735J21928_10000294 3300002067 Bacteria 17391
18 JGI24735J21928_10003797 3300002067 Bacteria 5117
19 JGI24750J21931_1000167 3300002070 Bacteria 10935
20 JGI24750J21931_1013782 3300002070 Bacteria 1083
21 JGI24748J21848_1000032 3300002074 Bacteria 79791
22 JGI24738J21930_10001664 3300002075 Bacteria 6089
23 JGI24738J21930_10002788 3300002075 Bacteria 4488
24 JGI24749J21850_1000751 3300002076 Bacteria 4684
25 JGI24034J26672_10000022 3300002239 Bacteria 116342
26 JGI24742J22300_10002170 3300002244 Bacteria 3126
27 JGI24751J29686_10000481 3300002459 Bacteria 11844
28 JGI24751J29686_10009441 3300002459 Bacteria 2005
29 JGI24751J29686_10022625 3300002459 Bacteria 1304
30 JGI25153J46596_10000119 3300003215 Bacteria 89604
31 JGI25153J46596_10044147 3300003215 Bacteria 1343
32 Ga0055525_1000070 3300003759 Bacteria 183047
33 Ga0055542_1000102 3300003762 Bacteria 115614
34 Ga0055529_1000520 3300003763 Bacteria 33667
35 Ga0055524_1000155 3300003775 Bacteria 79672
36 Ga0055530_10000202 3300003791 Bacteria 53648
37 Ga0055530_10015115 3300003791 Bacteria 2540
38 Ga0055531_10000090 3300003794 Bacteria 100342
39 Ga0055531_10001103 3300003794 Bacteria 21032
40 Ga0065165_1008857 3300005262 Bacteria 4620
41 Ga0065704_10004352 3300005289 Bacteria 6496
42 Ga0065704_10076327 3300005289 Bacteria 5135
43 Ga0065704_10098162 3300005289 Bacteria 2363
44 Ga0065707_10082164 3300005295 Bacteria 20479
45 Ga0070658_10003391 3300005327 Bacteria 13120
46 Ga0070658_10016648 3300005327 Bacteria 5884
47 Ga0070658_10021169 3300005327 Bacteria 5209
48 Ga0070658_10112831 3300005327 Bacteria 2253
49 Ga0070658_10153388 3300005327 Bacteria 1929
50 Ga0070658_10283690 3300005327 Bacteria 1410
51 Ga0070676_10027030 3300005328 Bacteria 3252
52 Ga0070683_100026014 3300005329 Bacteria 5263
53 Ga0070690_100000056 3300005330 Bacteria 54517
54 Ga0070670_100001143 3300005331 Bacteria 21059
55 Ga0070670_100012295 3300005331 Bacteria 7324
56 Ga0070670_100016761 3300005331 Bacteria 6288
57 Ga0070670_100030233 3300005331 Bacteria 4664
58 Ga0070670_100064201 3300005331 Bacteria 3151
59 Ga0070670_100095651 3300005331 Bacteria 2555
60 Ga0070670_100440177 3300005331 Bacteria 1154
61 Ga0070666_10000002 3300005335 Bacteria 478684
62 Ga0070666_10000177 3300005335 Bacteria 43707
63 Ga0070666_10005062 3300005335 Bacteria 8066
64 Ga0070666_10015560 3300005335 Bacteria 4854
65 Ga0070680_100209111 3300005336 Bacteria 1646
66 Ga0068868_100000182 3300005338 Bacteria 42019
67 Ga0070660_100000364 3300005339 Bacteria 30100
68 Ga0070660_100007526 3300005339 Bacteria 7591
69 Ga0070689_100003288 3300005340 Bacteria 10735
70 Ga0070689_100074859 3300005340 Bacteria 2650
71 Ga0070668_100000031 3300005347 Bacteria 87761
72 Ga0070668_100000158 3300005347 Bacteria 43238
73 Ga0070668_100003381 3300005347 Bacteria 11768
74 Ga0070668_100018199 3300005347 Bacteria 5272
75 Ga0070668_100166226 3300005347 Bacteria 1793
76 Ga0070668_100201825 3300005347 Bacteria 1632
77 Ga0070668_100273853 3300005347 Bacteria 1408
78 Ga0070669_100000052 3300005353 Bacteria 114467
79 Ga0070669_100000136 3300005353 Bacteria 66350
80 Ga0070669_100000170 3300005353 Bacteria 57161
81 Ga0070669_100031436 3300005353 Bacteria 3835
82 Ga0070669_100120461 3300005353 Bacteria 2001
83 Ga0070669_100218277 3300005353 Bacteria 1507
84 Ga0070669_100361247 3300005353 Bacteria 1181
85 Ga0070671_100000005 3300005355 Bacteria 256547
86 Ga0070671_100000081 3300005355 Bacteria 60882
87 Ga0070671_100017013 3300005355 Bacteria 5881
88 Ga0070671_100021128 3300005355 Bacteria 5315
89 Ga0070671_100021681 3300005355 Bacteria 5247
90 Ga0070671_100059830 3300005355 Bacteria 3171
91 Ga0070674_100001545 3300005356 Bacteria 12316
92 Ga0070674_100003399 3300005356 Bacteria 8923
93 Ga0070688_100002242 3300005365 Bacteria 9749
94 Ga0070659_100000022 3300005366 Bacteria 154091
95 Ga0070659_100002729 3300005366 Bacteria 12564
96 Ga0070659_100219976 3300005366 Bacteria 1567
97 Ga0070667_100000004 3300005367 Bacteria 444091
98 Ga0070667_100000081 3300005367 Bacteria 118819
99 Ga0070667_100001233 3300005367 Bacteria 23231
100 Ga0070667_100009025 3300005367 Bacteria 8252
101 Ga0070667_100031993 3300005367 Bacteria 4386
102 Ga0070709_10039814 3300005434 Bacteria 2886
103 Ga0070714_100038777 3300005435 Bacteria 4007
104 Ga0070713_100085122 3300005436 Bacteria 2707
105 Ga0070713_100498344 3300005436 Bacteria 1149
106 Ga0070710_10042976 3300005437 Bacteria 2501
107 Ga0070711_100370614 3300005439 Bacteria 1155
108 Ga0070708_100019929 3300005445 Bacteria 5645
109 Ga0070708_100170630 3300005445 Bacteria 2031
110 Ga0070708_100523055 3300005445 Bacteria 1119
111 Ga0070663_100001009 3300005455 Bacteria 15347
112 Ga0070663_100005371 3300005455 Bacteria 7609
113 Ga0070663_100040887 3300005455 Bacteria 3248
114 Ga0070663_100182250 3300005455 Bacteria 1630
115 Ga0070663_100238032 3300005455 Bacteria 1436
116 Ga0070678_100000139 3300005456 Bacteria 29667
117 Ga0070662_100008659 3300005457 Bacteria 6638
118 Ga0070662_100010089 3300005457 Bacteria 6187
119 Ga0070662_100026714 3300005457 Bacteria 4000
120 Ga0070681_10030096 3300005458 Bacteria 5447
121 Ga0070681_10175057 3300005458 Bacteria 2067
122 Ga0070681_10260837 3300005458 Bacteria 1645
123 Ga0070685_10031819 3300005466 Bacteria 2950
124 Ga0070706_100000006 3300005467 Bacteria 262251
125 Ga0070698_100004136 3300005471 Bacteria 15959
126 Ga0070698_100163773 3300005471 Bacteria 2167
127 Ga0070699_100238274 3300005518 Bacteria 1623
128 Ga0070679_100002476 3300005530 Bacteria 16722
129 Ga0070679_100054902 3300005530 Bacteria 3967
130 Ga0070679_100083331 3300005530 Bacteria 3186
131 Ga0070679_100175843 3300005530 Bacteria 2113
132 Ga0070697_100008183 3300005536 Bacteria 8163
133 Ga0070697_100071394 3300005536 Bacteria 2847
134 Ga0068853_100002599 3300005539 Bacteria 13574
135 Ga0068853_100025281 3300005539 Bacteria 4983
136 Ga0068853_100042414 3300005539 Bacteria 3890
137 Ga0068853_100202371 3300005539 Bacteria 1807
138 Ga0070672_100357351 3300005543 Bacteria 1246
139 Ga0070686_100000003 3300005544 Bacteria 308397
140 Ga0070665_100000011 3300005548 Bacteria 525539
141 Ga0070665_100000036 3300005548 Bacteria 314603
142 Ga0070665_100012821 3300005548 Bacteria 8441
143 Ga0070665_100103386 3300005548 Bacteria 2852
144 Ga0068855_100000573 3300005563 Bacteria 45131
145 Ga0068855_100022640 3300005563 Bacteria 7529
146 Ga0068855_100052109 3300005563 Bacteria 4818
147 Ga0068855_100067455 3300005563 Bacteria 4167
148 Ga0070664_100027493 3300005564 Bacteria 4727
149 Ga0070664_100253726 3300005564 Bacteria 1582
150 Ga0070664_100302327 3300005564 Bacteria 1446
151 Ga0068857_100065537 3300005577 Bacteria 3230
152 Ga0068857_100251598 3300005577 Bacteria 1620
153 Ga0068854_100100486 3300005578 Bacteria 2168
154 Ga0068856_100007034 3300005614 Bacteria 10991
155 Ga0068856_100308578 3300005614 Bacteria 1600
156 Ga0068852_100089119 3300005616 Bacteria 2756
157 Ga0068852_100212345 3300005616 Bacteria 1836
158 Ga0068852_100272948 3300005616 Bacteria 1628
159 Ga0068852_100359962 3300005616 Bacteria 1423
160 Ga0068859_100000484 3300005617 Bacteria 39271
161 Ga0068859_100006473 3300005617 Bacteria 11885
162 Ga0068859_100138192 3300005617 Bacteria 2510
163 Ga0068864_100000017 3300005618 Bacteria 285607
164 Ga0068864_100000114 3300005618 Bacteria 79636
165 Ga0068864_100006151 3300005618 Bacteria 9843
166 Ga0068864_100020255 3300005618 Bacteria 5564
167 Ga0068864_100028618 3300005618 Bacteria 4712
168 Ga0068864_100184524 3300005618 Bacteria 1909
169 Ga0068864_100368589 3300005618 Bacteria 1359
170 Ga0068861_100000391 3300005719 Bacteria 25251
171 Ga0068861_100004430 3300005719 Bacteria 9420
172 Ga0068861_100007195 3300005719 Bacteria 7624
173 Ga0068861_100008877 3300005719 Bacteria 6928
174 Ga0068851_10010455 3300005834 Bacteria 4335
175 Ga0068851_10034883 3300005834 Bacteria 2513
176 Ga0068863_100000018 3300005841 Bacteria 206948
177 Ga0068863_100000028 3300005841 Bacteria 181662
178 Ga0068863_100000095 3300005841 Bacteria 96080
179 Ga0068863_100000103 3300005841 Bacteria 91380
180 Ga0068863_100000459 3300005841 Bacteria 41571
181 Ga0068863_100007873 3300005841 Bacteria 10421
182 Ga0068863_100028365 3300005841 Bacteria 5345
183 Ga0068863_100155059 3300005841 Bacteria 2193
184 Ga0068858_100000332 3300005842 Bacteria 50007
185 Ga0068858_100000953 3300005842 Bacteria 29927
186 Ga0068858_100006139 3300005842 Bacteria 11719
187 Ga0068858_100025093 3300005842 Bacteria 5547
188 Ga0068858_100125046 3300005842 Bacteria 2407
189 Ga0068858_100282254 3300005842 Bacteria 1581
190 Ga0068860_100000001 3300005843 Bacteria 703043
191 Ga0068860_100000002 3300005843 Bacteria 627849
192 Ga0068860_100000093 3300005843 Bacteria 150034
193 Ga0068860_100002238 3300005843 Bacteria 20365
194 Ga0068860_100007641 3300005843 Bacteria 10816
195 Ga0068860_100022488 3300005843 Bacteria 6097
196 Ga0068860_100022991 3300005843 Bacteria 6029
197 Ga0068860_100046017 3300005843 Bacteria 4161
198 Ga0068860_100056603 3300005843 Bacteria 3727
199 Ga0068862_100000010 3300005844 Bacteria 285607
200 Ga0068862_100000099 3300005844 Bacteria 103870
201 Ga0068862_100000721 3300005844 Bacteria 33533
202 Ga0068862_100000924 3300005844 Bacteria 28406
203 Ga0068862_100001440 3300005844 Bacteria 21979
204 Ga0068862_100007519 3300005844 Bacteria 9027
205 Ga0068862_100127906 3300005844 Bacteria 2244
206 Ga0068862_100168856 3300005844 Bacteria 1957
207 Ga0068862_100250749 3300005844 Bacteria 1613
208 Ga0068862_100542078 3300005844 Bacteria 1110
209 Ga0081455_10001105 3300005937 Bacteria 33920
210 Ga0081538_10003537 3300005981 Bacteria 14695
211 Ga0081540_1008827 3300005983 Bacteria 6998
212 Ga0070717_10004405 3300006028 Bacteria 10165
213 Ga0070717_10259400 3300006028 Bacteria 1537
214 Ga0075368_10000448 3300006042 Bacteria 12173
215 Ga0075368_10003888 3300006042 Bacteria 5028
216 Ga0070712_100031989 3300006175 Bacteria 3549
217 Ga0075362_10000497 3300006177 Bacteria 11481
218 Ga0075367_10001865 3300006178 Bacteria 9310
219 Ga0075367_10032537 3300006178 Bacteria 3002
220 Ga0075369_10021161 3300006186 Bacteria 2670
221 Ga0075369_10050434 3300006186 Bacteria 1800
222 Ga0075366_10003329 3300006195 Bacteria 8458
223 Ga0097621_100060411 3300006237 Bacteria 3107
224 Ga0097621_100122775 3300006237 Bacteria 2205
225 Ga0075370_10014121 3300006353 Bacteria 4254
226 Ga0075430_100020444 3300006846 Bacteria 5631
227 Ga0075431_100066774 3300006847 Bacteria 3714
228 Ga0068865_100061812 3300006881 Bacteria 2627
229 Ga0068865_100277114 3300006881 Bacteria 1334
230 Ga0097620_100000484 3300006931 Bacteria 39271
231 Ga0097620_100006473 3300006931 Bacteria 11885
232 Ga0097620_100138184 3300006931 Bacteria 2510
233 Ga0099794_10000021 3300007265 Bacteria 66385
234 Ga0099795_10048486 3300007788 Bacteria 1538
235 Ga0105251_10000568 3300009011 Bacteria 34626
236 Ga0105240_10056443 3300009093 Bacteria 4914
237 Ga0105240_10100638 3300009093 Bacteria 3516
238 Ga0105240_10728524 3300009093 Bacteria 1080
239 Ga0111539_10175324 3300009094 Bacteria 2505
240 Ga0105245_10183139 3300009098 Bacteria 2002
241 Ga0105247_10000201 3300009101 Bacteria 58586
242 Ga0105247_10001097 3300009101 Bacteria 20134
243 Ga0105243_10000367 3300009148 Bacteria 48386
244 Ga0105243_10016334 3300009148 Bacteria 5616
245 Ga0105241_10001357 3300009174 Bacteria 18634
246 Ga0105241_10007520 3300009174 Bacteria 8014
247 Ga0105241_10229759 3300009174 Bacteria 1563
248 Ga0105241_10252634 3300009174 Bacteria 1495
249 Ga0105248_10000128 3300009177 Bacteria 87735
250 Ga0105248_10001723 3300009177 Bacteria 24308
251 Ga0105248_10006900 3300009177 Bacteria 12444
252 Ga0105248_10008146 3300009177 Bacteria 11508
253 Ga0105248_10049162 3300009177 Bacteria 4730
254 Ga0105248_10081893 3300009177 Bacteria 3629
255 Ga0105248_10283150 3300009177 Bacteria 1866
256 Ga0105248_10489999 3300009177 Bacteria 1386
257 Ga0105237_10017796 3300009545 Bacteria 7368
258 Ga0105237_10376154 3300009545 Bacteria 1425
259 Ga0105238_10193088 3300009551 Bacteria 2012
260 Ga0105238_10259608 3300009551 Bacteria 1717
261 Ga0105249_10000026 3300009553 Bacteria 232053
262 Ga0105249_10000173 3300009553 Bacteria 75519
263 Ga0105249_10000797 3300009553 Bacteria 28324
264 Ga0105249_10001541 3300009553 Bacteria 20225
265 Ga0105148_100001 3300009978 Bacteria 58900
266 Ga0105147_100489 3300009982 Bacteria 3239
267 Ga0157373_10007763 3300013100 Bacteria 7975
268 Ga0157373_10129087 3300013100 Bacteria 1777
269 Ga0157373_10175173 3300013100 Bacteria 1510
270 Ga0157371_10000793 3300013102 Bacteria 36288
271 Ga0157371_10002588 3300013102 Bacteria 17163
272 Ga0157371_10037986 3300013102 Bacteria 3445
273 Ga0157370_10007620 3300013104 Bacteria 11758
274 Ga0157370_10025526 3300013104 Bacteria 5850
275 Ga0157370_10068145 3300013104 Bacteria 3363
276 Ga0157369_10053991 3300013105 Bacteria 4339
277 Ga0157369_10272486 3300013105 Bacteria 1763
278 Ga0157378_10017918 3300013297 Bacteria 6216
279 Ga0163162_10005464 3300013306 Bacteria 12280
280 Ga0163162_10022371 3300013306 Bacteria 6230
281 Ga0163162_10037199 3300013306 Bacteria 4855
282 Ga0163162_10076303 3300013306 Bacteria 3413
283 Ga0163162_10835823 3300013306 Bacteria 1037
284 Ga0157372_10229429 3300013307 Bacteria 2152
285 Ga0163163_10133816 3300014325 Bacteria 2519
286 Ga0163163_10486080 3300014325 Bacteria 1296
287 Ga0157380_10002745 3300014326 Bacteria 11947
288 Ga0157380_10002769 3300014326 Bacteria 11907
289 Ga0157380_10012455 3300014326 Bacteria 6171
290 Ga0157379_10005857 3300014968 Bacteria 10572
291 Ga0157379_10195244 3300014968 Bacteria 1829
292 Ga0163161_10000008 3300017792 Bacteria 294642
293 Ga0163161_10000848 3300017792 Bacteria 23837
294 Ga0163161_10023698 3300017792 Bacteria 4332
295 Ga0163161_10038545 3300017792 Bacteria 3428
296 Ga0163161_10141345 3300017792 Bacteria 1823
297 Ga0213873_10000021 3300021358 Bacteria 113830
298 Ga0213876_10000050 3300021384 Bacteria 144836
299 Ga0213876_10068527 3300021384 Bacteria 1874
300 Ga0213875_10000970 3300021388 Bacteria 20525
301 Ga0228598_1008452 3300024227 Bacteria 2078
302 Ga0207672_1000347 3300025223 Bacteria 6111
303 Ga0209147_103087 3300025229 Bacteria 3482
304 Ga0209563_100053 3300025230 Bacteria 332370
305 Ga0207425_1014330 3300025245 Bacteria 1802
306 Ga0209677_108087 3300025253 Bacteria 2102
307 Ga0209148_1000159 3300025254 Bacteria 139560
308 Ga0209565_1000011 3300025263 Bacteria 637062
309 Ga0209455_1000045 3300025272 Bacteria 383329
310 Ga0209673_1003151 3300025273 Bacteria 10073
311 Ga0209564_1022143 3300025295 Bacteria 2255
312 Ga0209758_1000328 3300025297 Bacteria 89656
313 Ga0209758_1006749 3300025297 Bacteria 8074
314 Ga0209050_1000051 3300025298 Bacteria 353153
315 Ga0209050_1019568 3300025298 Bacteria 2564
316 Ga0209256_1000016 3300025299 Bacteria 599092
317 Ga0209257_1000028 3300025304 Bacteria 699493
318 Ga0209257_1002691 3300025304 Bacteria 16999
319 Ga0207656_10001389 3300025321 Bacteria 7995
320 Ga0207656_10002248 3300025321 Bacteria 6472
321 Ga0207656_10035337 3300025321 Bacteria 2092
322 Ga0207656_10036837 3300025321 Bacteria 2055
323 Ga0207656_10139628 3300025321 Bacteria 1141
324 Ga0207713_1006583 3300025735 Bacteria 7052
325 Ga0207682_10002753 3300025893 Bacteria 7791
326 Ga0207710_10001219 3300025900 Bacteria 13064
327 Ga0207680_10000004 3300025903 Bacteria 827324
328 Ga0207680_10009261 3300025903 Bacteria 4876
329 Ga0207680_10031024 3300025903 Bacteria 3024
330 Ga0207680_10173349 3300025903 Bacteria 1454
331 Ga0207647_10000861 3300025904 Bacteria 23527
332 Ga0207647_10019099 3300025904 Bacteria 4615
333 Ga0207647_10184934 3300025904 Bacteria 1209
334 Ga0207645_10033635 3300025907 Bacteria 3294
335 Ga0207705_10000294 3300025909 Bacteria 46555
336 Ga0207705_10001756 3300025909 Bacteria 17138
337 Ga0207705_10002561 3300025909 Bacteria 13978
338 Ga0207705_10032368 3300025909 Bacteria 3736
339 Ga0207705_10058767 3300025909 Bacteria 2774
340 Ga0207705_10157923 3300025909 Bacteria 1702
341 Ga0207705_10298353 3300025909 Bacteria 1236
342 Ga0207684_10000004 3300025910 Bacteria 755956
343 Ga0207684_10148588 3300025910 Bacteria 2016
344 Ga0207654_10000436 3300025911 Bacteria 23923
345 Ga0207654_10016953 3300025911 Bacteria 3802
346 Ga0207707_10030145 3300025912 Bacteria 4744
347 Ga0207707_10400614 3300025912 Bacteria 1178
348 Ga0207695_10003647 3300025913 Bacteria 21506
349 Ga0207695_10005423 3300025913 Bacteria 16927
350 Ga0207695_10030897 3300025913 Bacteria 5890
351 Ga0207695_10031869 3300025913 Bacteria 5776
352 Ga0207695_10179699 3300025913 Bacteria 2037
353 Ga0207671_10004057 3300025914 Bacteria 14199
354 Ga0207671_10007219 3300025914 Bacteria 9677
355 Ga0207693_10055554 3300025915 Bacteria 3106
356 Ga0207660_10086756 3300025917 Bacteria 2311
357 Ga0207657_10001613 3300025919 Bacteria 24264
358 Ga0207657_10007485 3300025919 Bacteria 11190
359 Ga0207657_10009830 3300025919 Bacteria 9583
360 Ga0207657_10017821 3300025919 Bacteria 6799
361 Ga0207657_10138370 3300025919 Bacteria 1991
362 Ga0207657_10265965 3300025919 Bacteria 1364
363 Ga0207657_10295321 3300025919 Bacteria 1284
364 Ga0207649_10006484 3300025920 Bacteria 6354
365 Ga0207652_10000474 3300025921 Bacteria 41182
366 Ga0207652_10429992 3300025921 Bacteria 1190
367 Ga0207646_10012705 3300025922 Bacteria 8082
368 Ga0207646_10322525 3300025922 Bacteria 1396
369 Ga0207681_10000046 3300025923 Bacteria 127902
370 Ga0207681_10000188 3300025923 Bacteria 50361
371 Ga0207681_10000588 3300025923 Bacteria 24733
372 Ga0207681_10036798 3300025923 Bacteria 3231
373 Ga0207681_10125081 3300025923 Bacteria 1892
374 Ga0207694_10009277 3300025924 Bacteria 7423
375 Ga0207694_10118050 3300025924 Bacteria 2116
376 Ga0207694_10242330 3300025924 Bacteria 1474
377 Ga0207650_10000199 3300025925 Bacteria 69216
378 Ga0207650_10001094 3300025925 Bacteria 20023
379 Ga0207650_10015388 3300025925 Bacteria 5326
380 Ga0207659_10020886 3300025926 Bacteria 4337
381 Ga0207687_10033482 3300025927 Bacteria 3486
382 Ga0207687_10277787 3300025927 Bacteria 1341
383 Ga0207700_10371694 3300025928 Bacteria 1248
384 Ga0207644_10000008 3300025931 Bacteria 354219
385 Ga0207644_10000038 3300025931 Bacteria 121482
386 Ga0207644_10000170 3300025931 Bacteria 46372
387 Ga0207644_10001088 3300025931 Bacteria 17430
388 Ga0207644_10010610 3300025931 Bacteria 6074
389 Ga0207644_10026293 3300025931 Bacteria 4009
390 Ga0207644_10179621 3300025931 Bacteria 1658
391 Ga0207690_10000003 3300025932 Bacteria 783011
392 Ga0207690_10004751 3300025932 Bacteria 8019
393 Ga0207706_10001335 3300025933 Bacteria 24697
394 Ga0207706_10010105 3300025933 Bacteria 8642
395 Ga0207706_10013575 3300025933 Bacteria 7400
396 Ga0207709_10000047 3300025935 Bacteria 238649
397 Ga0207709_10131151 3300025935 Bacteria 1708
398 Ga0207670_10003876 3300025936 Bacteria 7975
399 Ga0207670_10368470 3300025936 Bacteria 1141
400 Ga0207669_10000361 3300025937 Bacteria 20623
401 Ga0207669_10013539 3300025937 Bacteria 4054
402 Ga0207704_10288126 3300025938 Bacteria 1252
403 Ga0207691_10190241 3300025940 Bacteria 1790
404 Ga0207691_10232379 3300025940 Bacteria 1596
405 Ga0207691_10376527 3300025940 Bacteria 1212
406 Ga0207711_10000031 3300025941 Bacteria 203323
407 Ga0207711_10000222 3300025941 Bacteria 60984
408 Ga0207711_10023502 3300025941 Bacteria 5159
409 Ga0207711_10026962 3300025941 Bacteria 4823
410 Ga0207661_10114288 3300025944 Bacteria 2289
411 Ga0207661_10188778 3300025944 Bacteria 1805
412 Ga0207661_10199323 3300025944 Bacteria 1759
413 Ga0207661_10514272 3300025944 Bacteria 1095
414 Ga0207679_10072613 3300025945 Bacteria 2600
415 Ga0207667_10000001 3300025949 Bacteria 1178522
416 Ga0207667_10001495 3300025949 Bacteria 29331
417 Ga0207667_10004469 3300025949 Bacteria 17115
418 Ga0207667_10014622 3300025949 Bacteria 8937
419 Ga0207667_10064711 3300025949 Bacteria 3816
420 Ga0207667_10096985 3300025949 Bacteria 3043
421 Ga0207651_10135531 3300025960 Bacteria 1893
422 Ga0207712_10000001 3300025961 Bacteria 750309
423 Ga0207712_10000026 3300025961 Bacteria 271237
424 Ga0207712_10000541 3300025961 Bacteria 30768
425 Ga0207712_10004100 3300025961 Bacteria 9195
426 Ga0207668_10000024 3300025972 Bacteria 131871
427 Ga0207668_10000616 3300025972 Bacteria 22155
428 Ga0207668_10000626 3300025972 Bacteria 21905
429 Ga0207668_10011041 3300025972 Bacteria 5477
430 Ga0207668_10201593 3300025972 Bacteria 1585
431 Ga0207640_10001051 3300025981 Bacteria 15254
432 Ga0207640_10027744 3300025981 Bacteria 3453
433 Ga0207658_10000002 3300025986 Bacteria 1364188
434 Ga0207658_10000062 3300025986 Bacteria 118845
435 Ga0207658_10000627 3300025986 Bacteria 31226
436 Ga0207658_10000832 3300025986 Bacteria 25782
437 Ga0207658_10001112 3300025986 Bacteria 21725
438 Ga0207658_10003195 3300025986 Bacteria 11669
439 Ga0207658_10139406 3300025986 Bacteria 1960
440 Ga0207703_10002154 3300026035 Bacteria 17303
441 Ga0207703_10003684 3300026035 Bacteria 12768
442 Ga0207703_10004842 3300026035 Bacteria 10953
443 Ga0207703_10114264 3300026035 Bacteria 2308
444 Ga0207703_10145526 3300026035 Bacteria 2061
445 Ga0207639_10000815 3300026041 Bacteria 21193
446 Ga0207639_10004049 3300026041 Bacteria 9885
447 Ga0207639_10028114 3300026041 Bacteria 4103
448 Ga0207639_10050897 3300026041 Bacteria 3148
449 Ga0207639_10057898 3300026041 Bacteria 2978
450 Ga0207639_10242712 3300026041 Bacteria 1567
451 Ga0207678_10000080 3300026067 Bacteria 78553
452 Ga0207678_10009812 3300026067 Bacteria 8419
453 Ga0207678_10010539 3300026067 Bacteria 8118
454 Ga0207678_10234946 3300026067 Bacteria 1570
455 Ga0207702_10003704 3300026078 Bacteria 13830
456 Ga0207702_10004491 3300026078 Bacteria 12384
457 Ga0207702_10004975 3300026078 Bacteria 11677
458 Ga0207702_10480983 3300026078 Bacteria 1208
459 Ga0207641_10000002 3300026088 Bacteria 981004
460 Ga0207641_10000014 3300026088 Bacteria 336170
461 Ga0207641_10000113 3300026088 Bacteria 119188
462 Ga0207641_10000148 3300026088 Bacteria 99601
463 Ga0207641_10000179 3300026088 Bacteria 88061
464 Ga0207641_10001495 3300026088 Bacteria 22870
465 Ga0207641_10002154 3300026088 Bacteria 18554
466 Ga0207641_10004408 3300026088 Bacteria 12197
467 Ga0207641_10046468 3300026088 Bacteria 3660
468 Ga0207676_10000005 3300026095 Bacteria 698744
469 Ga0207676_10000479 3300026095 Bacteria 33652
470 Ga0207676_10001056 3300026095 Bacteria 20977
471 Ga0207676_10001265 3300026095 Bacteria 18803
472 Ga0207676_10006523 3300026095 Bacteria 8250
473 Ga0207676_10017180 3300026095 Bacteria 5242
474 Ga0207676_10031475 3300026095 Bacteria 3991
475 Ga0207676_10221341 3300026095 Bacteria 1686
476 Ga0207676_10352486 3300026095 Bacteria 1361
477 Ga0207674_10005854 3300026116 Bacteria 14578
478 Ga0207674_10011027 3300026116 Bacteria 10165
479 Ga0207674_10011489 3300026116 Bacteria 9946
480 Ga0207674_10020838 3300026116 Bacteria 7076
481 Ga0207675_100000048 3300026118 Bacteria 84512
482 Ga0207675_100000584 3300026118 Bacteria 35641
483 Ga0207675_100004475 3300026118 Bacteria 13506
484 Ga0207675_100016337 3300026118 Bacteria 6928
485 Ga0207683_10001314 3300026121 Bacteria 22455
486 Ga0207698_10002750 3300026142 Bacteria 10489
487 Ga0207698_10012373 3300026142 Bacteria 5580
488 Ga0207698_10012634 3300026142 Bacteria 5533
489 Ga0207698_10069993 3300026142 Bacteria 2778
490 Ga0207698_10203678 3300026142 Bacteria 1774
491 Ga0207698_10224304 3300026142 Bacteria 1701
492 Ga0209970_1009139 3300027614 Bacteria 1621
493 Ga0209588_1000027 3300027671 Bacteria 80998
494 Ga0209813_10000230 3300027866 Bacteria 17157
495 Ga0209813_10000578 3300027866 Bacteria 8550
496 Ga0209974_10002593 3300027876 Bacteria 6567
497 Ga0209974_10011023 3300027876 Bacteria 3043
498 Ga0209974_10014065 3300027876 Bacteria 2666
499 Ga0268266_10000042 3300028379 Bacteria 316826
500 Ga0268266_10000063 3300028379 Bacteria 253339
501 Ga0268266_10000487 3300028379 Bacteria 56915
502 Ga0268266_10002389 3300028379 Bacteria 20264
503 Ga0268266_10080988 3300028379 Bacteria 2830
504 Ga0268265_10000003 3300028380 Bacteria 949201
505 Ga0268265_10000084 3300028380 Bacteria 119522
506 Ga0268265_10000269 3300028380 Bacteria 58934
507 Ga0268265_10000358 3300028380 Bacteria 49394
508 Ga0268265_10001122 3300028380 Bacteria 23704
509 Ga0268265_10007014 3300028380 Bacteria 7619
510 Ga0268265_10030321 3300028380 Bacteria 3893
511 Ga0268265_10032828 3300028380 Bacteria 3767
512 Ga0268265_10230880 3300028380 Bacteria 1626
513 Ga0268264_10000001 3300028381 Bacteria 1221000
514 Ga0268264_10000006 3300028381 Bacteria 827324
515 Ga0268264_10000067 3300028381 Bacteria 284445
516 Ga0268264_10000406 3300028381 Bacteria 61180
517 Ga0268264_10017300 3300028381 Bacteria 5907
518 Ga0268264_10026074 3300028381 Bacteria 4773
519 Ga0268264_10033448 3300028381 Bacteria 4224
520 Ga0268264_10035077 3300028381 Bacteria 4130
521 Ga0268264_10135058 3300028381 Bacteria 2192
522 Ga0307517_10010279 3300028786 Bacteria 13119
523 Ga0307517_10073454 3300028786 Bacteria 3031
524 Ga0316181_1169913 3300030744 Bacteria 1836
525 Ga0316182_1417669 3300030745 Bacteria 1096
526 Ga0265327_10001060 3300031251 Bacteria 38391
527 Ga0307513_10005129 3300031456 Bacteria 17343
528 Ga0307513_10013356 3300031456 Bacteria 10085
529 Ga0307408_100005149 3300031548 Bacteria 8766
530 Ga0307408_100034516 3300031548 Bacteria 3543
531 Ga0307408_100086745 3300031548 Bacteria 2353
532 Ga0307408_100131621 3300031548 Bacteria 1952
533 Ga0307408_100229082 3300031548 Bacteria 1520
534 Ga0307408_100446226 3300031548 Bacteria 1121
535 Ga0307405_10000196 3300031731 Bacteria 22239
536 Ga0307405_10001629 3300031731 Bacteria 9548
537 Ga0307405_10041649 3300031731 Bacteria 2790
538 Ga0307405_10046590 3300031731 Bacteria 2665
539 Ga0307405_10307445 3300031731 Bacteria 1205
540 Ga0307413_10005246 3300031824 Bacteria 5755
541 Ga0307413_10160139 3300031824 Bacteria 1580
542 Ga0307410_10006608 3300031852 Bacteria 6270
543 Ga0307410_10051247 3300031852 Bacteria 2780
544 Ga0307410_10060579 3300031852 Bacteria 2587
545 Ga0307410_10077483 3300031852 Bacteria 2324
546 Ga0307410_10102499 3300031852 Bacteria 2054
547 Ga0307406_10022429 3300031901 Bacteria 3745
548 Ga0307406_10036829 3300031901 Bacteria 3017
549 Ga0307406_10064020 3300031901 Bacteria 2384
550 Ga0307406_10079341 3300031901 Bacteria 2177
551 Ga0307406_10170478 3300031901 Bacteria 1574
552 Ga0307406_10319479 3300031901 Bacteria 1200
553 Ga0307407_10011741 3300031903 Bacteria 4184
554 Ga0307407_10012754 3300031903 Bacteria 4053
555 Ga0307407_10016909 3300031903 Bacteria 3644
556 Ga0307407_10065949 3300031903 Bacteria 2134
557 Ga0307412_10000206 3300031911 Bacteria 40298
558 Ga0307412_10000348 3300031911 Bacteria 28830
559 Ga0307412_10001536 3300031911 Bacteria 12772
560 Ga0307412_10009535 3300031911 Bacteria 5573
561 Ga0307412_10023398 3300031911 Bacteria 3801
562 Ga0307412_10065913 3300031911 Bacteria 2453
563 Ga0307412_10070727 3300031911 Bacteria 2379
564 Ga0307412_10134058 3300031911 Bacteria 1804
565 Ga0307412_10143895 3300031911 Bacteria 1750
566 Ga0307412_10177944 3300031911 Bacteria 1597
567 Ga0307409_100013972 3300031995 Bacteria 5197
568 Ga0307409_100032819 3300031995 Bacteria 3770
569 Ga0307409_100040966 3300031995 Bacteria 3455
570 Ga0307409_100069187 3300031995 Bacteria 2795
571 Ga0307409_100071646 3300031995 Bacteria 2756
572 Ga0307409_100204214 3300031995 Bacteria 1770
573 Ga0307416_100035478 3300032002 Bacteria 3809
574 Ga0307416_100054276 3300032002 Bacteria 3220
575 Ga0307416_100075784 3300032002 Bacteria 2816
576 Ga0307416_100098595 3300032002 Bacteria 2535
577 Ga0307416_100172467 3300032002 Bacteria 2016
578 Ga0307416_100245203 3300032002 Bacteria 1739
579 Ga0307416_100323317 3300032002 Bacteria 1546
580 Ga0307414_10000105 3300032004 Bacteria 59546
581 Ga0307414_10050459 3300032004 Bacteria 2882
582 Ga0307414_10091975 3300032004 Bacteria 2256
583 Ga0307414_10093543 3300032004 Bacteria 2241
584 Ga0307414_10096462 3300032004 Bacteria 2212
585 Ga0307414_10099110 3300032004 Bacteria 2188
586 Ga0307414_10206985 3300032004 Bacteria 1600
587 Ga0307414_10246010 3300032004 Bacteria 1483
588 Ga0307411_10010805 3300032005 Bacteria 4888
589 Ga0307411_10039173 3300032005 Bacteria 2996
590 Ga0307411_10091073 3300032005 Bacteria 2129
591 Ga0307411_10101592 3300032005 Bacteria 2035
592 Ga0307415_100024741 3300032126 Bacteria 3756
593 Ga0307415_100042979 3300032126 Bacteria 3011
594 Ga0307415_100069300 3300032126 Bacteria 2473
595 Ga0307415_100172174 3300032126 Bacteria 1689
596 Ga0307415_100207705 3300032126 Bacteria 1559
597 Ga0307415_100275605 3300032126 Bacteria 1380
598 Ga0307415_100275610 3300032126 Bacteria 1380
599 Ga0316583_10002571 3300032133 Bacteria 6326
600 Ga0307510_10135340 3300033180 Bacteria 2124
601 Ga0373954_0062041 3300035118 Bacteria 1765
602 Ga0373955_0179617 3300035172 Bacteria 1255
603 Ga0373933_0086048 3300035724 Bacteria 1934
604 Ga0373937_0009491 3300036401 Bacteria 8459
605 Ga0373937_0062941 3300036401 Bacteria 3411
606 Ga0316582_0003260 3300036647 Bacteria 7916
607 Ga0316582_0188192 3300036647 Bacteria 1406
608 Ga0316584_0036022 3300036712 Bacteria 3672
609 Ga0316584_0241479 3300036712 Bacteria 1322
610 Ga0395900_0125025 3300037418 Bacteria 2637
611 Ga0395905_0001203 3300037471 Bacteria 32348
612 Ga0436364_0307891 3300037853 Bacteria 26050
613 Ga0436364_1238312 3300037853 Bacteria 3565
614 Ga0436364_1423369 3300037853 Bacteria 2772
615 Ga0395901_0479935 3300038443 Bacteria 1268
616 Ga0400483_136500 3300039062 Bacteria 13362
617 Ga0400483_150385 3300039062 Bacteria 3970
618 Ga0436365_0049397 3300039437 Bacteria 1786
619 Ga0436365_0480912 3300039437 Bacteria 48758
620 Ga0436365_0667467 3300039437 Bacteria 944
621 Ga0436365_0830679 3300039437 Bacteria 2733
622 Ga0436360_1007169 3300039438 Bacteria 2318
623 Ga0436360_1294149 3300039438 Bacteria 1266
624 Ga0436361_0206906 3300039447 Bacteria 1181
625 Ga0436361_0428535 3300039447 Bacteria 2594
626 Ga0436363_0226637 3300039450 Bacteria 1052
627 Ga0436363_0465256 3300039450 Bacteria 1734
628 Ga0436363_0553133 3300039450 Bacteria 2624
629 Ga0436363_1082316 3300039450 Bacteria 1812
630 Ga0436362_0553111 3300039453 Bacteria 45057
631 Ga0436362_0771929 3300039453 Bacteria 1191
632 Ga0436362_0892678 3300039453 Bacteria 1346
633 Ga0439436_0017110 3300041404 Bacteria 2170
634 Ga0439447_033430 3300041407 Bacteria 1282
635 Ga0439461_0000135 3300041410 Bacteria 9827
636 Ga0451807_0405409 3300041486 Bacteria 1813
637 Ga0439431_0009775 3300041997 Bacteria 2170
638 Ga0439432_000988 3300042006 Bacteria 10744
639 Ga0439432_031309 3300042006 Bacteria 1721
640 Ga0439457_018890 3300042014 Bacteria 1531
641 Ga0439462_0001472 3300042015 Bacteria 5251
642 Ga0439434_0010099 3300042435 Bacteria 2781
643 Ga0466963_0009226 3300044694 Bacteria 5939
644 Ga0453684_0128487 3300044712 Bacteria 3045
645 Ga0466968_0042551 3300044735 Bacteria 1921
646 Ga0466957_0174750 3300044842 Bacteria 1400
647 Ga0451576_0012145 3300045051 Bacteria 9710
648 Ga0466967_0142639 3300045976 Bacteria 2232
649 Ga0495627_000036 3300046453 Bacteria 205589
650 Ga0495638_0000014 3300046460 Bacteria 417060
651 Ga0495638_0023112 3300046460 Bacteria 4072
652 Ga0495650_0000644 3300046471 Bacteria 46276
653 Ga0495650_0004373 3300046471 Bacteria 9726
654 Ga0495662_0065167 3300046476 Bacteria 1761
655 Ga0495584_0028431 3300046491 Bacteria 2833
656 Ga0495585_0032475 3300046492 Bacteria 2957
657 Ga0495585_0118799 3300046492 Bacteria 1400
658 Ga0495583_0000557 3300046506 Bacteria 52013
659 Ga0495583_0004151 3300046506 Bacteria 10587
660 Ga0495606_0044411 3300046507 Bacteria 2955
661 Ga0495616_0000013 3300046513 Bacteria 202334
662 Ga0495631_0011352 3300046518 Bacteria 4383
663 Ga0495632_0000047 3300046519 Bacteria 138951
664 Ga0495632_0003550 3300046519 Bacteria 11029
665 Ga0495637_0000367 3300046520 Bacteria 34078
666 Ga0495643_0000031 3300046522 Bacteria 257820
667 Ga0495643_0001349 3300046522 Bacteria 23106
668 Ga0495643_0001424 3300046522 Bacteria 22149
669 Ga0495643_0021191 3300046522 Bacteria 3733
670 Ga0495648_0000021 3300046524 Bacteria 246945
671 Ga0495648_0000122 3300046524 Bacteria 93823
672 Ga0495648_0005850 3300046524 Bacteria 10123
673 Ga0495648_0031987 3300046524 Bacteria 3459
674 Ga0495663_0000017 3300046525 Bacteria 138955
675 Ga0495663_0003969 3300046525 Bacteria 4209
676 Ga0495663_0006746 3300046525 Bacteria 3165
677 Ga0495663_0072641 3300046525 Bacteria 1097
678 Ga0495663_0073598 3300046525 Bacteria 1091
679 Ga0495642_0006607 3300046528 Bacteria 4452
680 Ga0495654_0002327 3300046530 Bacteria 12278
681 Ga0495654_0048080 3300046530 Bacteria 2095
682 Ga0495654_0054284 3300046530 Bacteria 1944
683 Ga0495586_0118873 3300046535 Bacteria 1475
684 Ga0495598_0000694 3300046537 Bacteria 6402
685 Ga0495622_0045033 3300046557 Bacteria 2050
686 Ga0495633_0000952 3300046558 Bacteria 24068
687 Ga0495633_0001585 3300046558 Bacteria 17325
688 Ga0495633_0001728 3300046558 Bacteria 16325
689 Ga0495633_0007320 3300046558 Bacteria 6365
690 Ga0495633_0077274 3300046558 Bacteria 1550
691 Ga0495633_0126817 3300046558 Bacteria 1181
692 Ga0495667_0043052 3300046559 Bacteria 2993
693 Ga0495668_0000377 3300046616 Bacteria 59127
694 Ga0495668_0003835 3300046616 Bacteria 11002
695 Ga0495668_0084335 3300046616 Bacteria 1742
696 Ga0495625_0001416 3300046660 Bacteria 29318
697 Ga0495625_0003783 3300046660 Bacteria 14689
698 Ga0495625_0008470 3300046660 Bacteria 8776
699 Ga0495625_0049042 3300046660 Bacteria 3036
700 Ga0495625_0085991 3300046660 Bacteria 2182
701 Ga0495625_0110874 3300046660 Bacteria 1875
702 Ga0495635_0054879 3300046663 Bacteria 2744
703 Ga0495661_0096820 3300046665 Bacteria 1668
704 Ga0495599_0038391 3300046678 Bacteria 3009
705 Ga0495669_0000773 3300046684 Bacteria 13683
706 Ga0495670_0000029 3300046691 Bacteria 87662
707 Ga0495670_0141657 3300046691 Bacteria 1257
708 Ga0495671_0000021 3300046692 Bacteria 257820
709 Ga0495671_0000028 3300046692 Bacteria 234938
710 Ga0495671_0106235 3300046692 Bacteria 1371
711 Ga0495649_0063274 3300046694 Bacteria 1988
712 Ga0495600_0056689 3300046809 Bacteria 2560
713 Ga0495600_0065668 3300046809 Bacteria 2372
714 Ga0495660_0043737 3300046810 Bacteria 2468
715 Ga0495680_0127214 3300047322 Bacteria 1875
716 Ga0495683_0107496 3300047323 Bacteria 1335
717 Ga0495687_000392 3300047443 Bacteria 54348
718 Ga0495687_005666 3300047443 Bacteria 7886
719 Ga0495677_0000853 3300047445 Bacteria 12332
720 Ga0495673_0000058 3300047469 Bacteria 235044
721 Ga0495681_0000827 3300047470 Bacteria 23860
722 Ga0495686_0000023 3300047472 Bacteria 400457
723 Ga0495686_0004215 3300047472 Bacteria 11938
724 Ga0495686_0009156 3300047472 Bacteria 7169
725 Ga0496101_0011708 3300048904 Bacteria 5829
726 Ga0496101_0076347 3300048904 Bacteria 2468
727 Ga0496101_0275588 3300048904 Bacteria 1314
728 Ga0496101_0275640 3300048904 Bacteria 1314
729 Ga0496102_0001821 3300048905 Bacteria 18398
730 Ga0496102_0016012 3300048905 Bacteria 6545
731 Ga0496102_0246218 3300048905 Bacteria 1685
732 Ga0496102_0557708 3300048905 Bacteria 1068
733 Ga0496103_0000165 3300048906 Bacteria 69702
734 Ga0496103_0003222 3300048906 Bacteria 10011
735 Ga0496103_0140163 3300048906 Bacteria 1546
736 Ga0496103_0272522 3300048906 Bacteria 1089
737 Ga0496104_0020496 3300048907 Bacteria 6061
738 Ga0496104_0020819 3300048907 Bacteria 6014
739 Ga0496104_0023092 3300048907 Bacteria 5717
740 Ga0496105_0000224 3300048908 Bacteria 38048
741 Ga0496105_0000467 3300048908 Bacteria 26582
742 Ga0496105_0077963 3300048908 Bacteria 2736
743 Ga0496105_0288538 3300048908 Bacteria 1321
744 Ga0496106_0000171 3300048909 Bacteria 47281
745 Ga0496106_0083416 3300048909 Bacteria 2458
746 Ga0496106_0373509 3300048909 Bacteria 1146
747 Ga0496106_0460443 3300048909 Bacteria 1022
748 Ga0496107_0000853 3300048910 Bacteria 17891
749 Ga0496107_0080661 3300048910 Bacteria 2373
750 Ga0496107_0094410 3300048910 Bacteria 2188
751 Ga0496108_0012266 3300048911 Bacteria 6971
752 Ga0496108_0021371 3300048911 Bacteria 5318
753 Ga0496109_0049878 3300048912 Bacteria 3812
754 Ga0496109_0116341 3300048912 Bacteria 2488
755 Ga0496109_0130040 3300048912 Bacteria 2349
756 Ga0496109_0173464 3300048912 Bacteria 2024
757 Ga0496109_0491262 3300048912 Bacteria 1159
758 Ga0496110_0062754 3300048913 Bacteria 3282
759 Ga0496110_0190634 3300048913 Bacteria 1862
760 Ga0496111_0003672 3300048914 Bacteria 9532
761 Ga0496111_0078716 3300048914 Bacteria 2404
762 Ga0496111_0087349 3300048914 Bacteria 2282
763 Ga0496113_0012751 3300048916 Bacteria 5661
764 Ga0496113_0104465 3300048916 Bacteria 2198
765 Ga0496114_0077083 3300048917 Bacteria 2810
766 Ga0496114_0088277 3300048917 Bacteria 2630
767 Ga0496115_0000202 3300048918 Bacteria 55680
768 Ga0496115_0063213 3300048918 Bacteria 2986
769 Ga0496116_0004804 3300048919 Bacteria 12755
770 Ga0496116_0022179 3300048919 Bacteria 4766
771 Ga0496116_0172895 3300048919 Bacteria 1168
772 Ga0496117_0000616 3300048920 Bacteria 57666
773 Ga0496117_0011577 3300048920 Bacteria 7889
774 Ga0496117_0024655 3300048920 Bacteria 4749
775 Ga0496117_0028816 3300048920 Bacteria 4292
776 Ga0496118_0000425 3300048921 Bacteria 70035
777 Ga0496118_0004371 3300048921 Bacteria 16808
778 Ga0496118_0006208 3300048921 Bacteria 13229
779 Ga0496118_0013410 3300048921 Bacteria 7756
780 Ga0496118_0030914 3300048921 Bacteria 4455
781 Ga0496119_0007265 3300048922 Bacteria 10021
782 Ga0496119_0080101 3300048922 Bacteria 1884
783 Ga0496119_0180092 3300048922 Bacteria 1109
784 Ga0496120_0068303 3300048923 Bacteria 1961
785 Ga0496121_0000065 3300048924 Bacteria 269310
786 Ga0496121_0000274 3300048924 Bacteria 107140
787 Ga0496121_0000737 3300048924 Bacteria 60298
788 Ga0496121_0000796 3300048924 Bacteria 57621
789 Ga0496121_0019203 3300048924 Bacteria 6847
790 Ga0496121_0062513 3300048924 Bacteria 3049
791 Ga0496122_0007023 3300048925 Bacteria 12659
792 Ga0496122_0030586 3300048925 Bacteria 4507
793 Ga0496122_0043137 3300048925 Bacteria 3538
794 Ga0496122_0085759 3300048925 Bacteria 2171
795 Ga0496123_0012582 3300048926 Bacteria 7197
796 Ga0496123_0015310 3300048926 Bacteria 6299
797 Ga0496124_0000116 3300048927 Bacteria 164788
798 Ga0496124_0000468 3300048927 Bacteria 69747
799 Ga0496124_0020523 3300048927 Bacteria 6102
800 Ga0496124_0112588 3300048927 Bacteria 2188
801 Ga0496124_0240404 3300048927 Bacteria 1347
802 Ga0496125_0000704 3300048928 Bacteria 55382
803 Ga0496125_0012413 3300048928 Bacteria 8460
804 Ga0496125_0022597 3300048928 Bacteria 5834
805 Ga0496125_0101878 3300048928 Bacteria 2111
806 Ga0496125_0109641 3300048928 Bacteria 2003
807 Ga0496125_0127540 3300048928 Bacteria 1799
808 Ga0496126_0000563 3300048929 Bacteria 71182
809 Ga0496126_0003496 3300048929 Bacteria 19818
810 Ga0496126_0079422 3300048929 Bacteria 2904
811 Ga0496126_0093737 3300048929 Bacteria 2636
812 Ga0501314_000892 3300049530 Bacteria 2006
813 Ga0501034_0017114 3300049571 Bacteria 7437
814 Ga0501034_0147720 3300049571 Bacteria 2327
815 Ga0501034_0202474 3300049571 Bacteria 1943
816 Ga0501069_0120875 3300049585 Bacteria 1496
817 Ga0501070_0081129 3300049586 Bacteria 2683
818 Ga0501070_0116310 3300049586 Bacteria 2209
819 Ga0501073_0222245 3300049589 Bacteria 1305
820 Ga0501211_000395 3300049658 Bacteria 4147
821 Ga0501223_000007 3300049663 Bacteria 132601
822 Ga0501223_000043 3300049663 Bacteria 44137
823 Ga0501224_000019 3300049664 Bacteria 78204
824 Ga0501233_000300 3300049668 Bacteria 7630
825 Ga0501235_013626 3300049669 Bacteria 1790
826 Ga0501246_000328 3300049676 Bacteria 3291
827 Ga0501259_015279 3300049688 Bacteria 1310
828 Ga0501225_0000065 3300049705 Bacteria 34445
829 Ga0501225_0000096 3300049705 Bacteria 28223
830 Ga0501225_0000960 3300049705 Bacteria 9024
831 Ga0501225_0006195 3300049705 Bacteria 3494
832 Ga0501268_001367 3300049765 Bacteria 3029
833 Ga0501268_002447 3300049765 Bacteria 2448
834 Ga0501272_001814 3300049769 Bacteria 2078
835 Ga0501044_0094190 3300049823 Bacteria 3020
836 Ga0501044_0418545 3300049823 Bacteria 1250
837 Ga0501226_000080 3300049853 Bacteria 29131
838 nmdc:mga03683_2650_c1 3300050489 Bacteria 5602
839 nmdc:mga03683_61_c1 3300050489 Bacteria 41527
840 nmdc:mga03n38_526_c1 3300050490 Bacteria 9692
841 nmdc:mga0k408_1890_c1 3300050493 Bacteria 11220
842 nmdc:mga06z11_13318_c1 3300050494 Bacteria 3607
843 nmdc:mga06z11_221_c1 3300050494 Bacteria 22754
844 nmdc:mga06z11_73_c1 3300050494 Bacteria 42058
845 nmdc:mga04h51_187_c1 3300050495 Bacteria 17156
846 nmdc:mga04h51_603_c1 3300050495 Bacteria 8565
847 nmdc:mga07m45_14098_c1 3300050496 Bacteria 4252
848 nmdc:mga07m45_9_c1 3300050496 Bacteria 171776
849 nmdc:mga08y16_227938_c1 3300050511 Bacteria 1927
850 nmdc:mga08x19_36419_c1 3300050514 Bacteria 3116
851 nmdc:mga0sz30_1158_c1 3300050516 Bacteria 9448
852 Ga0495601_0187381 3300053077 Bacteria 1352
853 Ga0500610_0001915 3300053079 Bacteria 7400
854 Ga0495595_0131986 3300053084 Bacteria 1221
855 Ga0495619_0006898 3300053085 Bacteria 7182
856 Ga0495619_0363168 3300053085 Bacteria 1001
857 Ga0500643_000005 3300053087 Bacteria 539775
858 Ga0500643_000524 3300053087 Bacteria 26993
859 Ga0500643_001690 3300053087 Bacteria 12274
860 Ga0500643_006775 3300053087 Bacteria 4727
861 Ga0500643_006839 3300053087 Bacteria 4698
862 Ga0500643_006840 3300053087 Bacteria 4698
863 Ga0500643_007854 3300053087 Bacteria 4251
864 Ga0500646_0036775 3300053090 Bacteria 1365
865 Ga0500651_0002015 3300053093 Bacteria 10544
866 Ga0500566_0003816 3300053094 Bacteria 8982
867 Ga0500556_0000027 3300053104 Bacteria 165855
868 Ga0500594_0047825 3300053118 Bacteria 1194
869 Ga0500595_014569 3300053119 Bacteria 2980
870 Ga0500607_000060 3300053121 Bacteria 77770
871 Ga0500608_000381 3300053122 Bacteria 17140
872 Ga0500642_0000003 3300053130 Bacteria 544899
873 Ga0500642_0003426 3300053130 Bacteria 4796
874 Ga0500642_0015101 3300053130 Bacteria 2892
875 Ga0500658_0002039 3300053134 Bacteria 7881
876 Ga0500559_0003528 3300053136 Bacteria 7662
877 Ga0500559_0036418 3300053136 Bacteria 2128
878 Ga0500559_0062232 3300053136 Bacteria 1666
879 Ga0500564_000226 3300053138 Bacteria 15670
880 Ga0500568_0000679 3300053139 Bacteria 24563
881 Ga0500604_0005398 3300053151 Bacteria 3375
882 Ga0500604_0052636 3300053151 Bacteria 1260
883 Ga0500616_0000375 3300053153 Bacteria 62773
884 Ga0500616_0005540 3300053153 Bacteria 8550
885 Ga0500622_0000256 3300053156 Bacteria 54136
886 Ga0500622_0040789 3300053156 Bacteria 2417
887 Ga0500622_0069681 3300053156 Bacteria 1780
888 Ga0500622_0075211 3300053156 Bacteria 1700
889 Ga0500622_0110064 3300053156 Bacteria 1346
890 Ga0500624_000072 3300053157 Bacteria 57950
891 Ga0500624_000073 3300053157 Bacteria 57630
892 Ga0500627_0000624 3300053158 Bacteria 9436
893 Ga0500636_0002804 3300053177 Bacteria 9727
894 Ga0500567_000272 3300053723 Bacteria 16060
895 Ga0500625_000004 3300053729 Bacteria 245905
896 Ga0500645_000034 3300053730 Bacteria 116363
897 Ga0500645_000205 3300053730 Bacteria 45699
898 Ga0500645_010112 3300053730 Bacteria 3138
899 Ga0500645_028998 3300053730 Bacteria 1672
900 Ga0500609_000579 3300053731 Bacteria 5542
901 Ga0500552_001146 3300053733 Bacteria 2513
902 Ga0500596_002547 3300053735 Bacteria 3583
903 Ga0500587_002704 3300053739 Bacteria 2512

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0479935 Ga0395901_0479935_410_1255 274
2 3300048909 Ga0496106_0373509 Ga0496106_0373509_281_1126 274
3 3300039437 Ga0436365_0667467 Ga0436365_0667467_23_877 275
4 3300048929 Ga0496126_0093737 Ga0496126_0093737_12_845 277
5 3300001990 JGI24737J22298_10011369 JGI24737J22298_100113691 281
6 3300046660 Ga0495625_0049042 Ga0495625_0049042_2168_3019 281
7 3300048923 Ga0496120_0068303 Ga0496120_0068303_12_875 287
8 3300049589 Ga0501073_0222245 Ga0501073_0222245_405_1289 287
9 3300005844 Ga0068862_100001440 Ga0068862_10000144021 290
10 3300028380 Ga0268265_10007014 Ga0268265_100070146 290
11 3300053130 Ga0500642_0003426 Ga0500642_0003426_1275_2246 290
12 3300053151 Ga0500604_0052636 Ga0500604_0052636_191_1162 290
13 3300053731 Ga0500609_000579 Ga0500609_000579_4303_5274 290
14 3300013306 Ga0163162_10835823 Ga0163162_108358232 291
15 3300035172 Ga0373955_0179617 Ga0373955_0179617_17_919 291
16 3300039447 Ga0436361_0206906 Ga0436361_0206906_21_923 291
17 3300053156 Ga0500622_0110064 Ga0500622_0110064_17_919 291
18 3300039450 Ga0436363_0226637 Ga0436363_0226637_137_1042 292
19 3300048909 Ga0496106_0460443 Ga0496106_0460443_11_901 296
20 3300048919 Ga0496116_0172895 Ga0496116_0172895_14_904 296
21 3300049586 Ga0501070_0116310 Ga0501070_0116310_729_1700 296
22 3300044694 Ga0466963_0009226 Ga0466963_0009226_605_1588 301
23 3300044842 Ga0466957_0174750 Ga0466957_0174750_85_1068 301
24 3300045976 Ga0466967_0142639 Ga0466967_0142639_413_1396 301
25 3300006178 Ga0075367_10032537 Ga0075367_100325372 302
26 3300006186 Ga0075369_10021161 Ga0075369_100211612 302
27 3300050494 nmdc:mga06z11_13318_c1 nmdc:mga06z11_13318_c1_1180_2163 302
28 3300053733 Ga0500552_001146 Ga0500552_001146_124_1119 303
29 3300026142 Ga0207698_10069993 Ga0207698_100699933 304
30 3300048924 Ga0496121_0000737 Ga0496121_0000737_29228_30199 304
31 3300053085 Ga0495619_0363168 Ga0495619_0363168_33_947 304
32 3300013306 Ga0163162_10022371 Ga0163162_100223713 306
33 3300050489 nmdc:mga03683_2650_c1 nmdc:mga03683_2650_c1_2541_3524 306
34 3300005536 Ga0070697_100071394 Ga0070697_1000713943 308
35 3300014968 Ga0157379_10195244 Ga0157379_101952442 308
36 3300025910 Ga0207684_10148588 Ga0207684_101485882 308
37 3300031995 Ga0307409_100013972 Ga0307409_1000139724 308
38 3300032005 Ga0307411_10091073 Ga0307411_100910732 308
39 3300046530 Ga0495654_0054284 Ga0495654_0054284_32_961 309
40 3300053122 Ga0500608_000381 Ga0500608_000381_9480_10409 309
41 3300053136 Ga0500559_0036418 Ga0500559_0036418_757_1686 309
42 3300053138 Ga0500564_000226 Ga0500564_000226_1971_2900 309
43 3300053723 Ga0500567_000272 Ga0500567_000272_13417_14346 309
44 3300053729 Ga0500625_000004 Ga0500625_000004_6754_7683 309
45 iso_pu_bacteria 2842333319 2842334638 309
46 3300005467 Ga0070706_100000006 Ga0070706_100000006156 312
47 3300005471 Ga0070698_100163773 Ga0070698_1001637733 312
48 3300005518 Ga0070699_100238274 Ga0070699_1002382742 312
49 3300005536 Ga0070697_100008183 Ga0070697_1000081836 312
50 3300005844 Ga0068862_100542078 Ga0068862_1005420782 312
51 3300006846 Ga0075430_100020444 Ga0075430_1000204446 312
52 3300006847 Ga0075431_100066774 Ga0075431_1000667743 312
53 3300007265 Ga0099794_10000021 Ga0099794_1000002133 312
54 3300025910 Ga0207684_10000004 Ga0207684_10000004480 312
55 3300025922 Ga0207646_10012705 Ga0207646_100127053 312
56 3300027671 Ga0209588_1000027 Ga0209588_10000279 312
57 3300028381 Ga0268264_10035077 Ga0268264_100350776 312
58 iso_pu_bacteria 2919709256 2919709374 312
59 3300026041 Ga0207639_10242712 Ga0207639_102427122 313
60 3300041407 Ga0439447_033430 Ga0439447_033430_286_1254 313
61 3300048925 Ga0496122_0085759 Ga0496122_0085759_1137_2102 313
62 3300035118 Ga0373954_0062041 Ga0373954_0062041_69_1040 314
63 3300036401 Ga0373937_0062941 Ga0373937_0062941_532_1503 314
64 3300037853 Ga0436364_0307891 Ga0436364_0307891_9181_10152 314
65 3300037853 Ga0436364_1238312 Ga0436364_1238312_1682_2653 314
66 3300039437 Ga0436365_0049397 Ga0436365_0049397_14_985 314
67 3300039438 Ga0436360_1007169 Ga0436360_1007169_100_1071 314
68 3300039438 Ga0436360_1294149 Ga0436360_1294149_171_1142 314
69 3300039447 Ga0436361_0428535 Ga0436361_0428535_820_1791 314
70 3300039453 Ga0436362_0771929 Ga0436362_0771929_110_1081 314
71 3300046476 Ga0495662_0065167 Ga0495662_0065167_55_1026 314
72 3300046559 Ga0495667_0043052 Ga0495667_0043052_1202_2173 314
73 3300046663 Ga0495635_0054879 Ga0495635_0054879_1173_2144 314
74 3300046678 Ga0495599_0038391 Ga0495599_0038391_244_1215 314
75 3300046809 Ga0495600_0056689 Ga0495600_0056689_419_1390 314
76 3300053077 Ga0495601_0187381 Ga0495601_0187381_274_1245 314
77 3300053084 Ga0495595_0131986 Ga0495595_0131986_166_1137 314
78 3300053085 Ga0495619_0006898 Ga0495619_0006898_1596_2567 314
79 3300053093 Ga0500651_0002015 Ga0500651_0002015_9099_10070 314
80 3300047472 Ga0495686_0000023 Ga0495686_0000023_265572_266540 315
81 3300005436 Ga0070713_100498344 Ga0070713_1004983441 316
82 3300005458 Ga0070681_10030096 Ga0070681_100300963 316
83 3300005530 Ga0070679_100002476 Ga0070679_1000024763 316
84 3300009093 Ga0105240_10100638 Ga0105240_101006382 316
85 3300013104 Ga0157370_10007620 Ga0157370_100076203 316
86 3300025912 Ga0207707_10030145 Ga0207707_100301452 316
87 3300025913 Ga0207695_10179699 Ga0207695_101796992 316
88 3300025928 Ga0207700_10371694 Ga0207700_103716941 316
89 3300035724 Ga0373933_0086048 Ga0373933_0086048_99_1073 316
90 3300036401 Ga0373937_0009491 Ga0373937_0009491_1394_2368 316
91 3300049585 Ga0501069_0120875 Ga0501069_0120875_165_1136 316
92 iso_pu_bacteria 2830075706 2830078250 316
93 3300053153 Ga0500616_0005540 Ga0500616_0005540_520_1473 317
94 iso_pu_bacteria 8057101203 8057103190 317
95 3300005355 Ga0070671_100021681 Ga0070671_1000216814 318
96 3300009177 Ga0105248_10006900 Ga0105248_100069009 318
97 3300021384 Ga0213876_10068527 Ga0213876_100685272 318
98 3300025931 Ga0207644_10010610 Ga0207644_100106105 318
99 3300025941 Ga0207711_10026962 Ga0207711_100269627 318
100 3300037471 Ga0395905_0001203 Ga0395905_0001203_6061_7050 318
101 3300046460 Ga0495638_0023112 Ga0495638_0023112_19_975 318
102 3300048904 Ga0496101_0011708 Ga0496101_0011708_3550_4539 318
103 3300048909 Ga0496106_0083416 Ga0496106_0083416_196_1185 318
104 3300048910 Ga0496107_0094410 Ga0496107_0094410_1178_2167 318
105 3300048918 Ga0496115_0063213 Ga0496115_0063213_1904_2893 318
106 iso_pu_bacteria 2599185359 2600228442 318
107 iso_pu_bacteria 2643221622 2644125251 318
108 iso_pu_bacteria 2818991466 2819715236 318
109 iso_pu_bacteria 2879163058 2879163077 318
110 iso_pu_bacteria 2897803580 2897807576 318
111 iso_pu_bacteria 2928526807 2928528024 318
112 iso_pu_bacteria 2928968154 2928971472 318
113 iso_pu_bacteria 8054002106 8054006359 318
114 3300005445 Ga0070708_100019929 Ga0070708_1000199294 319
115 3300005445 Ga0070708_100523055 Ga0070708_1005230551 319
116 3300025919 Ga0207657_10295321 Ga0207657_102953211 319
117 3300031251 Ga0265327_10001060 Ga0265327_100010603 319
118 3300039450 Ga0436363_0465256 Ga0436363_0465256_644_1651 319
119 3300050514 nmdc:mga08x19_36419_c1 nmdc:mga08x19_36419_c1_937_1923 319
120 3300053090 Ga0500646_0036775 Ga0500646_0036775_189_1175 319
121 3300053156 Ga0500622_0069681 Ga0500622_0069681_466_1452 319
122 iso_pu_bacteria 2842694124 2842697234 319
123 iso_pu_bacteria 2896253425 2896255961 319
124 iso_pu_bacteria 2919138771 2919143214 319
125 iso_pu_bacteria 2946787523 2946791000 319
126 3300005331 Ga0070670_100440177 Ga0070670_1004401771 320
127 3300005353 Ga0070669_100361247 Ga0070669_1003612472 320
128 3300005355 Ga0070671_100017013 Ga0070671_1000170135 320
129 3300005434 Ga0070709_10039814 Ga0070709_100398142 320
130 3300005435 Ga0070714_100038777 Ga0070714_1000387772 320
131 3300005436 Ga0070713_100085122 Ga0070713_1000851222 320
132 3300005437 Ga0070710_10042976 Ga0070710_100429761 320
133 3300005439 Ga0070711_100370614 Ga0070711_1003706141 320
134 3300005458 Ga0070681_10260837 Ga0070681_102608372 320
135 3300005471 Ga0070698_100004136 Ga0070698_1000041366 320
136 3300005616 Ga0068852_100212345 Ga0068852_1002123453 320
137 3300005618 Ga0068864_100020255 Ga0068864_1000202557 320
138 3300005834 Ga0068851_10034883 Ga0068851_100348832 320
139 3300005843 Ga0068860_100056603 Ga0068860_1000566032 320
140 3300005844 Ga0068862_100127906 Ga0068862_1001279062 320
141 3300005981 Ga0081538_10003537 Ga0081538_1000353711 320
142 3300005983 Ga0081540_1008827 Ga0081540_10088271 320
143 3300006028 Ga0070717_10004405 Ga0070717_100044051 320
144 3300006028 Ga0070717_10259400 Ga0070717_102594002 320
145 3300006175 Ga0070712_100031989 Ga0070712_1000319893 320
146 3300007788 Ga0099795_10048486 Ga0099795_100484862 320
147 3300009177 Ga0105248_10081893 Ga0105248_100818932 320
148 3300017792 Ga0163161_10000848 Ga0163161_1000084817 320
149 3300021388 Ga0213875_10000970 Ga0213875_1000097013 320
150 3300024227 Ga0228598_1008452 Ga0228598_10084521 320
151 3300025321 Ga0207656_10036837 Ga0207656_100368372 320
152 3300025909 Ga0207705_10157923 Ga0207705_101579231 320
153 3300025915 Ga0207693_10055554 Ga0207693_100555542 320
154 3300025922 Ga0207646_10322525 Ga0207646_103225252 320
155 3300025940 Ga0207691_10376527 Ga0207691_103765271 320
156 3300025960 Ga0207651_10135531 Ga0207651_101355311 320
157 3300026095 Ga0207676_10031475 Ga0207676_100314752 320
158 3300028380 Ga0268265_10032828 Ga0268265_100328283 320
159 3300031852 Ga0307410_10102499 Ga0307410_101024993 320
160 3300037418 Ga0395900_0125025 Ga0395900_0125025_1097_2092 320
161 3300037853 Ga0436364_1423369 Ga0436364_1423369_862_1851 320
162 3300039450 Ga0436363_0553133 Ga0436363_0553133_1586_2575 320
163 3300039453 Ga0436362_0892678 Ga0436362_0892678_94_1083 320
164 3300044735 Ga0466968_0042551 Ga0466968_0042551_421_1452 320
165 3300046535 Ga0495586_0118873 Ga0495586_0118873_402_1445 320
166 3300046537 Ga0495598_0000694 Ga0495598_0000694_5137_6117 320
167 3300047322 Ga0495680_0127214 Ga0495680_0127214_26_1015 320
168 3300047472 Ga0495686_0004215 Ga0495686_0004215_8883_9845 320
169 3300048904 Ga0496101_0076347 Ga0496101_0076347_901_1896 320
170 3300048912 Ga0496109_0116341 Ga0496109_0116341_474_1469 320
171 3300048914 Ga0496111_0087349 Ga0496111_0087349_773_1768 320
172 iso_pu_bacteria 2510917021 2511130612 320
173 iso_pu_bacteria 2848297114 2848298168 320
174 iso_pu_bacteria 2882806704 2882809447 320
175 iso_pu_bacteria 2896184354 2896186033 320
176 3300013102 Ga0157371_10037986 Ga0157371_100379862 321
177 3300031903 Ga0307407_10011741 Ga0307407_100117411 321
178 3300032002 Ga0307416_100323317 Ga0307416_1003233172 321
179 3300039062 Ga0400483_136500 Ga0400483_136500_10637_11632 321
180 3300039062 Ga0400483_150385 Ga0400483_150385_2009_3004 321
181 3300039437 Ga0436365_0830679 Ga0436365_0830679_1018_2016 321
182 3300049571 Ga0501034_0147720 Ga0501034_0147720_1292_2275 321
183 3300049586 Ga0501070_0081129 Ga0501070_0081129_1411_2394 321
184 iso_pu_bacteria 2524023250 2524611971 321
185 iso_pu_bacteria 2739367664 2739650762 321
186 iso_pu_bacteria 2739367865 2740029235 321
187 iso_pu_bacteria 2885427238 2885427315 321
188 3300001915 JGI24741J21665_1001068 JGI24741J21665_100106810 322
189 3300001979 JGI24740J21852_10002539 JGI24740J21852_100025395 322
190 3300002459 JGI24751J29686_10022625 JGI24751J29686_100226252 322
191 3300003215 JGI25153J46596_10000119 JGI25153J46596_1000011933 322
192 3300003215 JGI25153J46596_10044147 JGI25153J46596_100441472 322
193 3300003759 Ga0055525_1000070 Ga0055525_100007033 322
194 3300003762 Ga0055542_1000102 Ga0055542_10001027 322
195 3300003763 Ga0055529_1000520 Ga0055529_100052028 322
196 3300003775 Ga0055524_1000155 Ga0055524_100015553 322
197 3300003791 Ga0055530_10000202 Ga0055530_1000020245 322
198 3300003791 Ga0055530_10015115 Ga0055530_100151152 322
199 3300003794 Ga0055531_10000090 Ga0055531_1000009056 322
200 3300003794 Ga0055531_10001103 Ga0055531_100011033 322
201 3300005262 Ga0065165_1008857 Ga0065165_10088572 322
202 3300005327 Ga0070658_10003391 Ga0070658_1000339111 322
203 3300005327 Ga0070658_10016648 Ga0070658_100166485 322
204 3300005328 Ga0070676_10027030 Ga0070676_100270304 322
205 3300005336 Ga0070680_100209111 Ga0070680_1002091112 322
206 3300005339 Ga0070660_100007526 Ga0070660_1000075264 322
207 3300005347 Ga0070668_100003381 Ga0070668_1000033818 322
208 3300005347 Ga0070668_100273853 Ga0070668_1002738532 322
209 3300005353 Ga0070669_100218277 Ga0070669_1002182772 322
210 3300005355 Ga0070671_100059830 Ga0070671_1000598302 322
211 3300005356 Ga0070674_100001545 Ga0070674_1000015456 322
212 3300005356 Ga0070674_100003399 Ga0070674_1000033993 322
213 3300005455 Ga0070663_100005371 Ga0070663_1000053714 322
214 3300005455 Ga0070663_100040887 Ga0070663_1000408873 322
215 3300005455 Ga0070663_100182250 Ga0070663_1001822501 322
216 3300005456 Ga0070678_100000139 Ga0070678_10000013910 322
217 3300005457 Ga0070662_100010089 Ga0070662_1000100895 322
218 3300005458 Ga0070681_10175057 Ga0070681_101750572 322
219 3300005530 Ga0070679_100083331 Ga0070679_1000833312 322
220 3300005543 Ga0070672_100357351 Ga0070672_1003573511 322
221 3300005548 Ga0070665_100103386 Ga0070665_1001033861 322
222 3300005563 Ga0068855_100022640 Ga0068855_1000226405 322
223 3300005563 Ga0068855_100067455 Ga0068855_1000674553 322
224 3300005617 Ga0068859_100006473 Ga0068859_1000064738 322
225 3300005618 Ga0068864_100000114 Ga0068864_10000011468 322
226 3300005618 Ga0068864_100184524 Ga0068864_1001845242 322
227 3300005719 Ga0068861_100000391 Ga0068861_10000039117 322
228 3300005842 Ga0068858_100000332 Ga0068858_10000033232 322
229 3300005843 Ga0068860_100022991 Ga0068860_1000229912 322
230 3300005844 Ga0068862_100168856 Ga0068862_1001688562 322
231 3300006237 Ga0097621_100060411 Ga0097621_1000604113 322
232 3300006881 Ga0068865_100061812 Ga0068865_1000618123 322
233 3300006881 Ga0068865_100277114 Ga0068865_1002771141 322
234 3300006931 Ga0097620_100006473 Ga0097620_1000064738 322
235 3300009148 Ga0105243_10000367 Ga0105243_1000036727 322
236 3300009174 Ga0105241_10007520 Ga0105241_100075206 322
237 3300009177 Ga0105248_10001723 Ga0105248_100017238 322
238 3300009177 Ga0105248_10283150 Ga0105248_102831501 322
239 3300013100 Ga0157373_10007763 Ga0157373_100077634 322
240 3300013100 Ga0157373_10129087 Ga0157373_101290872 322
241 3300013102 Ga0157371_10000793 Ga0157371_100007933 322
242 3300013102 Ga0157371_10002588 Ga0157371_100025882 322
243 3300013104 Ga0157370_10068145 Ga0157370_100681454 322
244 3300013297 Ga0157378_10017918 Ga0157378_100179182 322
245 3300013307 Ga0157372_10229429 Ga0157372_102294293 322
246 3300021358 Ga0213873_10000021 Ga0213873_10000021112 322
247 3300021384 Ga0213876_10000050 Ga0213876_1000005011 322
248 3300025230 Ga0209563_100053 Ga0209563_100053164 322
249 3300025245 Ga0207425_1014330 Ga0207425_10143302 322
250 3300025253 Ga0209677_108087 Ga0209677_1080873 322
251 3300025254 Ga0209148_1000159 Ga0209148_100015927 322
252 3300025263 Ga0209565_1000011 Ga0209565_1000011101 322
253 3300025272 Ga0209455_1000045 Ga0209455_1000045116 322
254 3300025273 Ga0209673_1003151 Ga0209673_100315112 322
255 3300025295 Ga0209564_1022143 Ga0209564_10221432 322
256 3300025297 Ga0209758_1000328 Ga0209758_100032857 322
257 3300025297 Ga0209758_1006749 Ga0209758_10067491 322
258 3300025298 Ga0209050_1000051 Ga0209050_1000051182 322
259 3300025298 Ga0209050_1019568 Ga0209050_10195682 322
260 3300025299 Ga0209256_1000016 Ga0209256_1000016498 322
261 3300025304 Ga0209257_1000028 Ga0209257_1000028186 322
262 3300025304 Ga0209257_1002691 Ga0209257_10026916 322
263 3300025321 Ga0207656_10001389 Ga0207656_100013895 322
264 3300025904 Ga0207647_10019099 Ga0207647_100190993 322
265 3300025904 Ga0207647_10184934 Ga0207647_101849342 322
266 3300025907 Ga0207645_10033635 Ga0207645_100336352 322
267 3300025909 Ga0207705_10000294 Ga0207705_100002949 322
268 3300025909 Ga0207705_10002561 Ga0207705_100025617 322
269 3300025909 Ga0207705_10058767 Ga0207705_100587672 322
270 3300025911 Ga0207654_10000436 Ga0207654_1000043614 322
271 3300025912 Ga0207707_10400614 Ga0207707_104006142 322
272 3300025913 Ga0207695_10031869 Ga0207695_100318696 322
273 3300025914 Ga0207671_10007219 Ga0207671_100072196 322
274 3300025917 Ga0207660_10086756 Ga0207660_100867562 322
275 3300025919 Ga0207657_10007485 Ga0207657_1000748513 322
276 3300025919 Ga0207657_10009830 Ga0207657_100098304 322
277 3300025919 Ga0207657_10138370 Ga0207657_101383702 322
278 3300025920 Ga0207649_10006484 Ga0207649_100064845 322
279 3300025921 Ga0207652_10429992 Ga0207652_104299921 322
280 3300025931 Ga0207644_10026293 Ga0207644_100262932 322
281 3300025932 Ga0207690_10004751 Ga0207690_100047513 322
282 3300025933 Ga0207706_10001335 Ga0207706_1000133523 322
283 3300025935 Ga0207709_10000047 Ga0207709_1000004785 322
284 3300025935 Ga0207709_10131151 Ga0207709_101311511 322
285 3300025937 Ga0207669_10000361 Ga0207669_1000036111 322
286 3300025937 Ga0207669_10013539 Ga0207669_100135392 322
287 3300025940 Ga0207691_10232379 Ga0207691_102323792 322
288 3300025941 Ga0207711_10000222 Ga0207711_1000022253 322
289 3300025944 Ga0207661_10199323 Ga0207661_101993231 322
290 3300025945 Ga0207679_10072613 Ga0207679_100726132 322
291 3300025949 Ga0207667_10000001 Ga0207667_1000000134 322
292 3300025949 Ga0207667_10064711 Ga0207667_100647114 322
293 3300025981 Ga0207640_10001051 Ga0207640_100010512 322
294 3300026035 Ga0207703_10004842 Ga0207703_100048427 322
295 3300026041 Ga0207639_10004049 Ga0207639_100040495 322
296 3300026067 Ga0207678_10009812 Ga0207678_100098125 322
297 3300026067 Ga0207678_10010539 Ga0207678_100105396 322
298 3300026078 Ga0207702_10004975 Ga0207702_100049755 322
299 3300026095 Ga0207676_10001056 Ga0207676_100010566 322
300 3300026095 Ga0207676_10221341 Ga0207676_102213411 322
301 3300026118 Ga0207675_100000584 Ga0207675_1000005848 322
302 3300026121 Ga0207683_10001314 Ga0207683_1000131411 322
303 3300026142 Ga0207698_10002750 Ga0207698_100027506 322
304 3300026142 Ga0207698_10012373 Ga0207698_100123733 322
305 3300027876 Ga0209974_10014065 Ga0209974_100140653 322
306 3300028381 Ga0268264_10135058 Ga0268264_101350582 322
307 3300028786 Ga0307517_10010279 Ga0307517_100102794 322
308 3300028786 Ga0307517_10073454 Ga0307517_100734541 322
309 3300031456 Ga0307513_10013356 Ga0307513_100133568 322
310 3300031548 Ga0307408_100446226 Ga0307408_1004462261 322
311 3300031731 Ga0307405_10041649 Ga0307405_100416493 322
312 3300031901 Ga0307406_10036829 Ga0307406_100368292 322
313 3300031911 Ga0307412_10000206 Ga0307412_1000020630 322
314 3300031911 Ga0307412_10000348 Ga0307412_1000034821 322
315 3300031911 Ga0307412_10023398 Ga0307412_100233982 322
316 3300032002 Ga0307416_100098595 Ga0307416_1000985952 322
317 3300032004 Ga0307414_10000105 Ga0307414_1000010533 322
318 3300039437 Ga0436365_0480912 Ga0436365_0480912_38492_39475 322
319 3300039453 Ga0436362_0553111 Ga0436362_0553111_9284_10267 322
320 3300041404 Ga0439436_0017110 Ga0439436_0017110_656_1624 322
321 3300041410 Ga0439461_0000135 Ga0439461_0000135_7958_8926 322
322 3300041997 Ga0439431_0009775 Ga0439431_0009775_1164_2132 322
323 3300042006 Ga0439432_000988 Ga0439432_000988_8317_9285 322
324 3300042014 Ga0439457_018890 Ga0439457_018890_155_1123 322
325 3300042015 Ga0439462_0001472 Ga0439462_0001472_4213_5181 322
326 3300042435 Ga0439434_0010099 Ga0439434_0010099_928_1896 322
327 3300046471 Ga0495650_0000644 Ga0495650_0000644_36378_37346 322
328 3300046492 Ga0495585_0032475 Ga0495585_0032475_222_1190 322
329 3300046492 Ga0495585_0118799 Ga0495585_0118799_345_1313 322
330 3300046506 Ga0495583_0004151 Ga0495583_0004151_1353_2321 322
331 3300046507 Ga0495606_0044411 Ga0495606_0044411_132_1100 322
332 3300046518 Ga0495631_0011352 Ga0495631_0011352_938_1906 322
333 3300046522 Ga0495643_0001349 Ga0495643_0001349_7932_8900 322
334 3300046522 Ga0495643_0001424 Ga0495643_0001424_3137_4105 322
335 3300046522 Ga0495643_0021191 Ga0495643_0021191_2433_3401 322
336 3300046524 Ga0495648_0000122 Ga0495648_0000122_57555_58523 322
337 3300046525 Ga0495663_0003969 Ga0495663_0003969_3082_4050 322
338 3300046528 Ga0495642_0006607 Ga0495642_0006607_1501_2469 322
339 3300046558 Ga0495633_0001728 Ga0495633_0001728_10921_11889 322
340 3300046558 Ga0495633_0077274 Ga0495633_0077274_271_1239 322
341 3300046616 Ga0495668_0000377 Ga0495668_0000377_37609_38577 322
342 3300046660 Ga0495625_0001416 Ga0495625_0001416_18006_18974 322
343 3300046660 Ga0495625_0008470 Ga0495625_0008470_7747_8715 322
344 3300046660 Ga0495625_0110874 Ga0495625_0110874_861_1829 322
345 3300046665 Ga0495661_0096820 Ga0495661_0096820_31_999 322
346 3300046684 Ga0495669_0000773 Ga0495669_0000773_12632_13600 322
347 3300046691 Ga0495670_0000029 Ga0495670_0000029_10639_11610 322
348 3300046694 Ga0495649_0063274 Ga0495649_0063274_659_1627 322
349 3300046809 Ga0495600_0065668 Ga0495600_0065668_829_1797 322
350 3300046810 Ga0495660_0043737 Ga0495660_0043737_1271_2239 322
351 3300047323 Ga0495683_0107496 Ga0495683_0107496_35_1003 322
352 3300047443 Ga0495687_000392 Ga0495687_000392_28680_29648 322
353 3300047443 Ga0495687_005666 Ga0495687_005666_6880_7848 322
354 3300047445 Ga0495677_0000853 Ga0495677_0000853_5823_6791 322
355 3300048905 Ga0496102_0001821 Ga0496102_0001821_11862_12830 322
356 3300048906 Ga0496103_0000165 Ga0496103_0000165_35600_36568 322
357 3300048907 Ga0496104_0020496 Ga0496104_0020496_5063_6031 322
358 3300048908 Ga0496105_0000467 Ga0496105_0000467_6999_7967 322
359 3300048914 Ga0496111_0003672 Ga0496111_0003672_452_1420 322
360 3300048917 Ga0496114_0088277 Ga0496114_0088277_350_1318 322
361 3300048918 Ga0496115_0000202 Ga0496115_0000202_31534_32502 322
362 3300048919 Ga0496116_0004804 Ga0496116_0004804_3254_4222 322
363 3300048920 Ga0496117_0000616 Ga0496117_0000616_33019_33987 322
364 3300048921 Ga0496118_0000425 Ga0496118_0000425_35588_36556 322
365 3300048921 Ga0496118_0013410 Ga0496118_0013410_3038_4006 322
366 3300048922 Ga0496119_0007265 Ga0496119_0007265_2069_3037 322
367 3300048924 Ga0496121_0000796 Ga0496121_0000796_33099_34067 322
368 3300048926 Ga0496123_0015310 Ga0496123_0015310_1707_2675 322
369 3300048927 Ga0496124_0000116 Ga0496124_0000116_154675_155643 322
370 3300048927 Ga0496124_0000468 Ga0496124_0000468_35612_36580 322
371 3300048927 Ga0496124_0020523 Ga0496124_0020523_2001_2969 322
372 3300048927 Ga0496124_0112588 Ga0496124_0112588_846_1814 322
373 3300048928 Ga0496125_0000704 Ga0496125_0000704_23593_24561 322
374 3300048929 Ga0496126_0000563 Ga0496126_0000563_32997_33965 322
375 3300048929 Ga0496126_0079422 Ga0496126_0079422_24_998 322
376 3300049530 Ga0501314_000892 Ga0501314_000892_539_1507 322
377 3300049571 Ga0501034_0017114 Ga0501034_0017114_4886_5854 322
378 3300049663 Ga0501223_000043 Ga0501223_000043_7688_8656 322
379 3300049664 Ga0501224_000019 Ga0501224_000019_69093_70061 322
380 3300049668 Ga0501233_000300 Ga0501233_000300_5108_6076 322
381 3300049705 Ga0501225_0000065 Ga0501225_0000065_7578_8546 322
382 3300049853 Ga0501226_000080 Ga0501226_000080_20592_21560 322
383 3300053079 Ga0500610_0001915 Ga0500610_0001915_3402_4370 322
384 3300053087 Ga0500643_006775 Ga0500643_006775_3168_4136 322
385 3300053094 Ga0500566_0003816 Ga0500566_0003816_6782_7750 322
386 3300053130 Ga0500642_0015101 Ga0500642_0015101_1837_2805 322
387 3300053134 Ga0500658_0002039 Ga0500658_0002039_1500_2468 322
388 3300053156 Ga0500622_0075211 Ga0500622_0075211_218_1189 322
389 3300053730 Ga0500645_000034 Ga0500645_000034_32713_33681 322
390 3300053730 Ga0500645_010112 Ga0500645_010112_725_1693 322
391 3300053735 Ga0500596_002547 Ga0500596_002547_1499_2467 322
392 3300002459 JGI24751J29686_10000481 JGI24751J29686_100004815 323
393 3300005295 Ga0065707_10082164 Ga0065707_100821647 323
394 3300005327 Ga0070658_10112831 Ga0070658_101128313 323
395 3300005327 Ga0070658_10283690 Ga0070658_102836902 323
396 3300005329 Ga0070683_100026014 Ga0070683_1000260143 323
397 3300005335 Ga0070666_10005062 Ga0070666_100050627 323
398 3300005340 Ga0070689_100074859 Ga0070689_1000748592 323
399 3300005347 Ga0070668_100201825 Ga0070668_1002018252 323
400 3300005353 Ga0070669_100000052 Ga0070669_10000005218 323
401 3300005355 Ga0070671_100000005 Ga0070671_100000005223 323
402 3300005366 Ga0070659_100219976 Ga0070659_1002199762 323
403 3300005530 Ga0070679_100054902 Ga0070679_1000549024 323
404 3300005539 Ga0068853_100025281 Ga0068853_1000252815 323
405 3300005563 Ga0068855_100052109 Ga0068855_1000521092 323
406 3300005578 Ga0068854_100100486 Ga0068854_1001004862 323
407 3300005616 Ga0068852_100272948 Ga0068852_1002729482 323
408 3300005618 Ga0068864_100368589 Ga0068864_1003685891 323
409 3300005841 Ga0068863_100007873 Ga0068863_1000078737 323
410 3300005841 Ga0068863_100155059 Ga0068863_1001550592 323
411 3300005842 Ga0068858_100282254 Ga0068858_1002822542 323
412 3300005843 Ga0068860_100022488 Ga0068860_1000224883 323
413 3300005844 Ga0068862_100000099 Ga0068862_10000009969 323
414 3300005937 Ga0081455_10001105 Ga0081455_1000110518 323
415 3300006042 Ga0075368_10003888 Ga0075368_100038882 323
416 3300006177 Ga0075362_10000497 Ga0075362_100004979 323
417 3300006186 Ga0075369_10050434 Ga0075369_100504342 323
418 3300009101 Ga0105247_10001097 Ga0105247_1000109719 323
419 3300009177 Ga0105248_10489999 Ga0105248_104899992 323
420 3300009553 Ga0105249_10001541 Ga0105249_1000154118 323
421 3300013306 Ga0163162_10076303 Ga0163162_100763033 323
422 3300014326 Ga0157380_10002769 Ga0157380_100027691 323
423 3300017792 Ga0163161_10141345 Ga0163161_101413451 323
424 3300025909 Ga0207705_10032368 Ga0207705_100323683 323
425 3300025921 Ga0207652_10000474 Ga0207652_100004744 323
426 3300025923 Ga0207681_10000188 Ga0207681_1000018838 323
427 3300025931 Ga0207644_10000008 Ga0207644_10000008101 323
428 3300025936 Ga0207670_10368470 Ga0207670_103684702 323
429 3300025944 Ga0207661_10188778 Ga0207661_101887782 323
430 3300025944 Ga0207661_10514272 Ga0207661_105142721 323
431 3300025949 Ga0207667_10004469 Ga0207667_1000446916 323
432 3300025961 Ga0207712_10000026 Ga0207712_100000262 323
433 3300025972 Ga0207668_10201593 Ga0207668_102015931 323
434 3300025981 Ga0207640_10027744 Ga0207640_100277443 323
435 3300025986 Ga0207658_10139406 Ga0207658_101394061 323
436 3300026035 Ga0207703_10114264 Ga0207703_101142642 323
437 3300026041 Ga0207639_10050897 Ga0207639_100508973 323
438 3300026088 Ga0207641_10001495 Ga0207641_1000149517 323
439 3300026088 Ga0207641_10046468 Ga0207641_100464682 323
440 3300026095 Ga0207676_10352486 Ga0207676_103524861 323
441 3300026142 Ga0207698_10224304 Ga0207698_102243041 323
442 3300027866 Ga0209813_10000230 Ga0209813_100002307 323
443 3300027876 Ga0209974_10011023 Ga0209974_100110234 323
444 3300028379 Ga0268266_10080988 Ga0268266_100809881 323
445 3300028380 Ga0268265_10000084 Ga0268265_1000008468 323
446 3300028381 Ga0268264_10026074 Ga0268264_100260742 323
447 3300031456 Ga0307513_10005129 Ga0307513_1000512912 323
448 3300031731 Ga0307405_10000196 Ga0307405_100001964 323
449 3300031731 Ga0307405_10307445 Ga0307405_103074451 323
450 3300031911 Ga0307412_10001536 Ga0307412_100015364 323
451 3300032133 Ga0316583_10002571 Ga0316583_100025713 323
452 3300036647 Ga0316582_0003260 Ga0316582_0003260_5050_6036 323
453 3300036647 Ga0316582_0188192 Ga0316582_0188192_28_1014 323
454 3300036712 Ga0316584_0036022 Ga0316584_0036022_1682_2668 323
455 3300036712 Ga0316584_0241479 Ga0316584_0241479_113_1099 323
456 3300039450 Ga0436363_1082316 Ga0436363_1082316_690_1661 323
457 3300041486 Ga0451807_0405409 Ga0451807_0405409_417_1580 323
458 3300045051 Ga0451576_0012145 Ga0451576_0012145_4882_5868 323
459 3300046525 Ga0495663_0006746 Ga0495663_0006746_2121_3092 323
460 3300046530 Ga0495654_0002327 Ga0495654_0002327_7785_8756 323
461 3300046557 Ga0495622_0045033 Ga0495622_0045033_116_1102 323
462 3300046558 Ga0495633_0126817 Ga0495633_0126817_45_1031 323
463 3300046616 Ga0495668_0003835 Ga0495668_0003835_4962_5933 323
464 3300048905 Ga0496102_0246218 Ga0496102_0246218_130_1107 323
465 3300048908 Ga0496105_0288538 Ga0496105_0288538_30_1007 323
466 3300048909 Ga0496106_0000171 Ga0496106_0000171_15860_16837 323
467 3300048910 Ga0496107_0000853 Ga0496107_0000853_16857_17834 323
468 3300048912 Ga0496109_0130040 Ga0496109_0130040_256_1233 323
469 3300048912 Ga0496109_0491262 Ga0496109_0491262_155_1138 323
470 3300048916 Ga0496113_0012751 Ga0496113_0012751_1506_2483 323
471 3300048924 Ga0496121_0019203 Ga0496121_0019203_5288_6262 323
472 3300048924 Ga0496121_0062513 Ga0496121_0062513_134_1108 323
473 3300048925 Ga0496122_0007023 Ga0496122_0007023_2757_3731 323
474 3300048926 Ga0496123_0012582 Ga0496123_0012582_2261_3235 323
475 3300048928 Ga0496125_0022597 Ga0496125_0022597_1814_2788 323
476 3300049571 Ga0501034_0202474 Ga0501034_0202474_726_1724 323
477 3300049823 Ga0501044_0094190 Ga0501044_0094190_1462_2457 323
478 3300049823 Ga0501044_0418545 Ga0501044_0418545_66_1049 323
479 3300050489 nmdc:mga03683_61_c1 nmdc:mga03683_61_c1_12404_13381 323
480 3300050490 nmdc:mga03n38_526_c1 nmdc:mga03n38_526_c1_6274_7251 323
481 3300050494 nmdc:mga06z11_221_c1 nmdc:mga06z11_221_c1_16858_17835 323
482 3300050495 nmdc:mga04h51_187_c1 nmdc:mga04h51_187_c1_10816_11793 323
483 3300050496 nmdc:mga07m45_9_c1 nmdc:mga07m45_9_c1_3621_4598 323
484 3300050516 nmdc:mga0sz30_1158_c1 nmdc:mga0sz30_1158_c1_72_1049 323
485 3300053087 Ga0500643_000005 Ga0500643_000005_156852_157868 323
486 3300053087 Ga0500643_001690 Ga0500643_001690_11172_12158 323
487 3300053104 Ga0500556_0000027 Ga0500556_0000027_9480_10466 323
488 3300053118 Ga0500594_0047825 Ga0500594_0047825_54_1040 323
489 3300053121 Ga0500607_000060 Ga0500607_000060_59350_60327 323
490 3300053130 Ga0500642_0000003 Ga0500642_0000003_380363_381349 323
491 3300053139 Ga0500568_0000679 Ga0500568_0000679_16164_17159 323
492 3300053153 Ga0500616_0000375 Ga0500616_0000375_41603_42598 323
493 3300053158 Ga0500627_0000624 Ga0500627_0000624_4119_5090 323
494 3300053739 Ga0500587_002704 Ga0500587_002704_118_1113 323
495 iso_pu_bacteria 2512564014 2512642330 323
496 iso_pu_bacteria 2775507255 2778126722 323
497 iso_pu_bacteria 2808606401 2809063121 323
498 iso_pu_bacteria 2808606404 2809079085 323
499 iso_pu_bacteria 2808606405 2809083540 323
500 2162886007 SwRhRL2b_contig_3124566 SwRhRL2b_0228.00006840 324
501 3300002070 JGI24750J21931_1013782 JGI24750J21931_10137821 324
502 3300005289 Ga0065704_10076327 Ga0065704_100763273 324
503 3300005327 Ga0070658_10021169 Ga0070658_100211695 324
504 3300005331 Ga0070670_100016761 Ga0070670_1000167612 324
505 3300005331 Ga0070670_100064201 Ga0070670_1000642014 324
506 3300005335 Ga0070666_10000177 Ga0070666_1000017725 324
507 3300005335 Ga0070666_10015560 Ga0070666_100155602 324
508 3300005347 Ga0070668_100000031 Ga0070668_10000003136 324
509 3300005347 Ga0070668_100000158 Ga0070668_1000001584 324
510 3300005347 Ga0070668_100018199 Ga0070668_1000181993 324
511 3300005347 Ga0070668_100166226 Ga0070668_1001662262 324
512 3300005353 Ga0070669_100000136 Ga0070669_10000013652 324
513 3300005355 Ga0070671_100000081 Ga0070671_10000008152 324
514 3300005367 Ga0070667_100000004 Ga0070667_10000000436 324
515 3300005367 Ga0070667_100000081 Ga0070667_10000008115 324
516 3300005367 Ga0070667_100009025 Ga0070667_1000090253 324
517 3300005445 Ga0070708_100170630 Ga0070708_1001706302 324
518 3300005455 Ga0070663_100238032 Ga0070663_1002380322 324
519 3300005530 Ga0070679_100175843 Ga0070679_1001758431 324
520 3300005548 Ga0070665_100000011 Ga0070665_100000011145 324
521 3300005548 Ga0070665_100012821 Ga0070665_1000128218 324
522 3300005563 Ga0068855_100000573 Ga0068855_10000057322 324
523 3300005564 Ga0070664_100302327 Ga0070664_1003023272 324
524 3300005614 Ga0068856_100308578 Ga0068856_1003085782 324
525 3300005616 Ga0068852_100359962 Ga0068852_1003599622 324
526 3300005617 Ga0068859_100000484 Ga0068859_10000048435 324
527 3300005618 Ga0068864_100006151 Ga0068864_10000615111 324
528 3300005618 Ga0068864_100028618 Ga0068864_1000286182 324
529 3300005719 Ga0068861_100007195 Ga0068861_1000071954 324
530 3300005719 Ga0068861_100008877 Ga0068861_1000088773 324
531 3300005841 Ga0068863_100000028 Ga0068863_10000002813 324
532 3300005841 Ga0068863_100000103 Ga0068863_10000010314 324
533 3300005841 Ga0068863_100000459 Ga0068863_10000045932 324
534 3300005841 Ga0068863_100028365 Ga0068863_1000283653 324
535 3300005842 Ga0068858_100025093 Ga0068858_1000250932 324
536 3300005842 Ga0068858_100125046 Ga0068858_1001250462 324
537 3300005843 Ga0068860_100000002 Ga0068860_10000000221 324
538 3300005843 Ga0068860_100000093 Ga0068860_10000009316 324
539 3300005843 Ga0068860_100002238 Ga0068860_1000022388 324
540 3300005843 Ga0068860_100007641 Ga0068860_10000764112 324
541 3300005843 Ga0068860_100046017 Ga0068860_1000460173 324
542 3300005844 Ga0068862_100000721 Ga0068862_10000072121 324
543 3300005844 Ga0068862_100000924 Ga0068862_1000009246 324
544 3300005844 Ga0068862_100250749 Ga0068862_1002507491 324
545 3300006195 Ga0075366_10003329 Ga0075366_100033298 324
546 3300006237 Ga0097621_100122775 Ga0097621_1001227753 324
547 3300006931 Ga0097620_100000484 Ga0097620_1000004849 324
548 3300009093 Ga0105240_10056443 Ga0105240_100564432 324
549 3300009094 Ga0111539_10175324 Ga0111539_101753242 324
550 3300009101 Ga0105247_10000201 Ga0105247_1000020151 324
551 3300009148 Ga0105243_10016334 Ga0105243_100163345 324
552 3300009177 Ga0105248_10008146 Ga0105248_1000814610 324
553 3300009177 Ga0105248_10049162 Ga0105248_100491623 324
554 3300009551 Ga0105238_10193088 Ga0105238_101930882 324
555 3300009551 Ga0105238_10259608 Ga0105238_102596082 324
556 3300009553 Ga0105249_10000797 Ga0105249_100007974 324
557 3300013306 Ga0163162_10005464 Ga0163162_100054649 324
558 3300014968 Ga0157379_10005857 Ga0157379_100058577 324
559 3300017792 Ga0163161_10038545 Ga0163161_100385453 324
560 3300025893 Ga0207682_10002753 Ga0207682_100027536 324
561 3300025900 Ga0207710_10001219 Ga0207710_1000121911 324
562 3300025903 Ga0207680_10009261 Ga0207680_100092615 324
563 3300025903 Ga0207680_10031024 Ga0207680_100310242 324
564 3300025903 Ga0207680_10173349 Ga0207680_101733492 324
565 3300025909 Ga0207705_10001756 Ga0207705_100017564 324
566 3300025913 Ga0207695_10005423 Ga0207695_1000542310 324
567 3300025919 Ga0207657_10017821 Ga0207657_100178215 324
568 3300025923 Ga0207681_10000046 Ga0207681_1000004670 324
569 3300025923 Ga0207681_10036798 Ga0207681_100367982 324
570 3300025924 Ga0207694_10242330 Ga0207694_102423302 324
571 3300025925 Ga0207650_10001094 Ga0207650_100010942 324
572 3300025927 Ga0207687_10033482 Ga0207687_100334822 324
573 3300025931 Ga0207644_10000038 Ga0207644_1000003863 324
574 3300025931 Ga0207644_10000170 Ga0207644_1000017014 324
575 3300025931 Ga0207644_10179621 Ga0207644_101796212 324
576 3300025938 Ga0207704_10288126 Ga0207704_102881262 324
577 3300025940 Ga0207691_10190241 Ga0207691_101902412 324
578 3300025944 Ga0207661_10114288 Ga0207661_101142883 324
579 3300025949 Ga0207667_10001495 Ga0207667_1000149528 324
580 3300025961 Ga0207712_10004100 Ga0207712_100041002 324
581 3300025972 Ga0207668_10000024 Ga0207668_1000002435 324
582 3300025972 Ga0207668_10000616 Ga0207668_1000061615 324
583 3300025972 Ga0207668_10000626 Ga0207668_1000062618 324
584 3300025972 Ga0207668_10011041 Ga0207668_100110415 324
585 3300025986 Ga0207658_10000002 Ga0207658_10000002328 324
586 3300025986 Ga0207658_10000062 Ga0207658_10000062102 324
587 3300025986 Ga0207658_10001112 Ga0207658_1000111217 324
588 3300025986 Ga0207658_10003195 Ga0207658_100031953 324
589 3300026035 Ga0207703_10002154 Ga0207703_1000215415 324
590 3300026035 Ga0207703_10145526 Ga0207703_101455262 324
591 3300026067 Ga0207678_10234946 Ga0207678_102349461 324
592 3300026078 Ga0207702_10480983 Ga0207702_104809832 324
593 3300026088 Ga0207641_10000014 Ga0207641_10000014161 324
594 3300026088 Ga0207641_10000113 Ga0207641_1000011314 324
595 3300026088 Ga0207641_10000179 Ga0207641_1000017921 324
596 3300026088 Ga0207641_10002154 Ga0207641_100021543 324
597 3300026088 Ga0207641_10004408 Ga0207641_1000440811 324
598 3300026095 Ga0207676_10001265 Ga0207676_1000126513 324
599 3300026095 Ga0207676_10006523 Ga0207676_100065238 324
600 3300026095 Ga0207676_10017180 Ga0207676_100171805 324
601 3300026118 Ga0207675_100000048 Ga0207675_10000004862 324
602 3300026118 Ga0207675_100016337 Ga0207675_1000163373 324
603 3300027614 Ga0209970_1009139 Ga0209970_10091392 324
604 3300027876 Ga0209974_10002593 Ga0209974_100025935 324
605 3300028379 Ga0268266_10000063 Ga0268266_10000063142 324
606 3300028379 Ga0268266_10000487 Ga0268266_1000048731 324
607 3300028379 Ga0268266_10002389 Ga0268266_1000238920 324
608 3300028380 Ga0268265_10000269 Ga0268265_100002699 324
609 3300028380 Ga0268265_10000358 Ga0268265_1000035835 324
610 3300028380 Ga0268265_10030321 Ga0268265_100303212 324
611 3300028380 Ga0268265_10230880 Ga0268265_102308801 324
612 3300028381 Ga0268264_10000001 Ga0268264_10000001653 324
613 3300028381 Ga0268264_10000067 Ga0268264_10000067276 324
614 3300028381 Ga0268264_10000406 Ga0268264_1000040610 324
615 3300028381 Ga0268264_10017300 Ga0268264_100173005 324
616 3300028381 Ga0268264_10033448 Ga0268264_100334483 324
617 3300030744 Ga0316181_1169913 Ga0316181_11699131 324
618 3300030745 Ga0316182_1417669 Ga0316182_14176691 324
619 3300031548 Ga0307408_100034516 Ga0307408_1000345163 324
620 3300031548 Ga0307408_100086745 Ga0307408_1000867451 324
621 3300031731 Ga0307405_10001629 Ga0307405_1000162910 324
622 3300031731 Ga0307405_10046590 Ga0307405_100465902 324
623 3300031824 Ga0307413_10005246 Ga0307413_100052464 324
624 3300031852 Ga0307410_10006608 Ga0307410_100066085 324
625 3300031852 Ga0307410_10060579 Ga0307410_100605793 324
626 3300031901 Ga0307406_10022429 Ga0307406_100224293 324
627 3300031901 Ga0307406_10079341 Ga0307406_100793412 324
628 3300031903 Ga0307407_10012754 Ga0307407_100127543 324
629 3300031911 Ga0307412_10009535 Ga0307412_100095353 324
630 3300031911 Ga0307412_10065913 Ga0307412_100659133 324
631 3300031911 Ga0307412_10134058 Ga0307412_101340583 324
632 3300031911 Ga0307412_10143895 Ga0307412_101438952 324
633 3300031995 Ga0307409_100032819 Ga0307409_1000328194 324
634 3300031995 Ga0307409_100040966 Ga0307409_1000409663 324
635 3300031995 Ga0307409_100071646 Ga0307409_1000716462 324
636 3300031995 Ga0307409_100204214 Ga0307409_1002042142 324
637 3300032002 Ga0307416_100054276 Ga0307416_1000542763 324
638 3300032002 Ga0307416_100075784 Ga0307416_1000757842 324
639 3300032004 Ga0307414_10091975 Ga0307414_100919751 324
640 3300032005 Ga0307411_10010805 Ga0307411_100108055 324
641 3300032005 Ga0307411_10039173 Ga0307411_100391731 324
642 3300032005 Ga0307411_10101592 Ga0307411_101015924 324
643 3300032126 Ga0307415_100024741 Ga0307415_1000247412 324
644 3300032126 Ga0307415_100042979 Ga0307415_1000429792 324
645 3300032126 Ga0307415_100207705 Ga0307415_1002077052 324
646 3300032126 Ga0307415_100275610 Ga0307415_1002756102 324
647 3300033180 Ga0307510_10135340 Ga0307510_101353402 324
648 3300042006 Ga0439432_031309 Ga0439432_031309_589_1563 324
649 3300044712 Ga0453684_0128487 Ga0453684_0128487_1615_2601 324
650 3300046460 Ga0495638_0000014 Ga0495638_0000014_227051_228025 324
651 3300046471 Ga0495650_0004373 Ga0495650_0004373_3884_4924 324
652 3300046506 Ga0495583_0000557 Ga0495583_0000557_45008_45982 324
653 3300046513 Ga0495616_0000013 Ga0495616_0000013_198173_199147 324
654 3300046519 Ga0495632_0003550 Ga0495632_0003550_4194_5168 324
655 3300046524 Ga0495648_0000021 Ga0495648_0000021_200660_201634 324
656 3300046530 Ga0495654_0048080 Ga0495654_0048080_1027_2007 324
657 3300046558 Ga0495633_0007320 Ga0495633_0007320_781_1755 324
658 3300046616 Ga0495668_0084335 Ga0495668_0084335_164_1138 324
659 3300046660 Ga0495625_0003783 Ga0495625_0003783_11093_12082 324
660 3300046660 Ga0495625_0085991 Ga0495625_0085991_453_1433 324
661 3300046691 Ga0495670_0141657 Ga0495670_0141657_71_1051 324
662 3300046692 Ga0495671_0000028 Ga0495671_0000028_45131_46105 324
663 3300047469 Ga0495673_0000058 Ga0495673_0000058_188886_189860 324
664 3300048904 Ga0496101_0275588 Ga0496101_0275588_252_1226 324
665 3300048907 Ga0496104_0020819 Ga0496104_0020819_2251_3231 324
666 3300048908 Ga0496105_0000224 Ga0496105_0000224_22750_23730 324
667 3300048912 Ga0496109_0173464 Ga0496109_0173464_953_1927 324
668 3300048913 Ga0496110_0190634 Ga0496110_0190634_849_1823 324
669 3300048917 Ga0496114_0077083 Ga0496114_0077083_704_1678 324
670 3300048921 Ga0496118_0030914 Ga0496118_0030914_2988_3968 324
671 3300048924 Ga0496121_0000274 Ga0496121_0000274_9078_10058 324
672 3300049688 Ga0501259_015279 Ga0501259_015279_39_1013 324
673 3300049765 Ga0501268_001367 Ga0501268_001367_806_1780 324
674 3300049769 Ga0501272_001814 Ga0501272_001814_855_1829 324
675 3300050493 nmdc:mga0k408_1890_c1 nmdc:mga0k408_1890_c1_343_1320 324
676 3300050511 nmdc:mga08y16_227938_c1 nmdc:mga08y16_227938_c1_85_1059 324
677 3300053087 Ga0500643_006839 Ga0500643_006839_3122_4105 324
678 3300053087 Ga0500643_006840 Ga0500643_006840_594_1577 324
679 3300053087 Ga0500643_007854 Ga0500643_007854_2819_3799 324
680 3300053119 Ga0500595_014569 Ga0500595_014569_291_1271 324
681 3300053136 Ga0500559_0003528 Ga0500559_0003528_552_1532 324
682 3300053136 Ga0500559_0062232 Ga0500559_0062232_325_1314 324
683 3300053151 Ga0500604_0005398 Ga0500604_0005398_1249_2223 324
684 3300053156 Ga0500622_0000256 Ga0500622_0000256_1182_2162 324
685 3300053156 Ga0500622_0040789 Ga0500622_0040789_856_1845 324
686 3300053730 Ga0500645_000205 Ga0500645_000205_10106_11095 324
687 3300053730 Ga0500645_028998 Ga0500645_028998_269_1249 324
688 3300001904 JGI24736J21556_1000004 JGI24736J21556_100000452 325
689 3300001976 JGI24752J21851_1002724 JGI24752J21851_10027241 325
690 3300001979 JGI24740J21852_10011202 JGI24740J21852_100112022 325
691 3300001989 JGI24739J22299_10014124 JGI24739J22299_100141243 325
692 3300001990 JGI24737J22298_10009329 JGI24737J22298_100093294 325
693 3300002067 JGI24735J21928_10003797 JGI24735J21928_100037977 325
694 3300002070 JGI24750J21931_1000167 JGI24750J21931_10001677 325
695 3300002074 JGI24748J21848_1000032 JGI24748J21848_100003227 325
696 3300002075 JGI24738J21930_10002788 JGI24738J21930_100027882 325
697 3300002076 JGI24749J21850_1000751 JGI24749J21850_10007515 325
698 3300002239 JGI24034J26672_10000022 JGI24034J26672_1000002268 325
699 3300002244 JGI24742J22300_10002170 JGI24742J22300_100021702 325
700 3300002459 JGI24751J29686_10009441 JGI24751J29686_100094413 325
701 3300005330 Ga0070690_100000056 Ga0070690_10000005646 325
702 3300005331 Ga0070670_100030233 Ga0070670_1000302331 325
703 3300005335 Ga0070666_10000002 Ga0070666_1000000251 325
704 3300005340 Ga0070689_100003288 Ga0070689_10000328810 325
705 3300005353 Ga0070669_100000170 Ga0070669_10000017051 325
706 3300005355 Ga0070671_100021128 Ga0070671_1000211282 325
707 3300005365 Ga0070688_100002242 Ga0070688_1000022428 325
708 3300005367 Ga0070667_100031993 Ga0070667_1000319936 325
709 3300005457 Ga0070662_100026714 Ga0070662_1000267145 325
710 3300005539 Ga0068853_100202371 Ga0068853_1002023712 325
711 3300005544 Ga0070686_100000003 Ga0070686_100000003316 325
712 3300005548 Ga0070665_100000036 Ga0070665_100000036287 325
713 3300005564 Ga0070664_100027493 Ga0070664_1000274936 325
714 3300005617 Ga0068859_100138192 Ga0068859_1001381922 325
715 3300005719 Ga0068861_100004430 Ga0068861_1000044301 325
716 3300005841 Ga0068863_100000095 Ga0068863_10000009547 325
717 3300005842 Ga0068858_100000953 Ga0068858_10000095310 325
718 3300005843 Ga0068860_100000001 Ga0068860_10000000151 325
719 3300005844 Ga0068862_100007519 Ga0068862_1000075195 325
720 3300006931 Ga0097620_100138184 Ga0097620_1001381842 325
721 3300009093 Ga0105240_10728524 Ga0105240_107285241 325
722 3300009098 Ga0105245_10183139 Ga0105245_101831394 325
723 3300009174 Ga0105241_10229759 Ga0105241_102297592 325
724 3300009174 Ga0105241_10252634 Ga0105241_102526341 325
725 3300009545 Ga0105237_10376154 Ga0105237_103761542 325
726 3300009553 Ga0105249_10000026 Ga0105249_1000002650 325
727 3300013104 Ga0157370_10025526 Ga0157370_100255264 325
728 3300013105 Ga0157369_10053991 Ga0157369_100539913 325
729 3300014325 Ga0163163_10133816 Ga0163163_101338162 325
730 3300014326 Ga0157380_10002745 Ga0157380_100027458 325
731 3300017792 Ga0163161_10000008 Ga0163161_10000008257 325
732 3300025223 Ga0207672_1000347 Ga0207672_10003476 325
733 3300025321 Ga0207656_10002248 Ga0207656_100022486 325
734 3300025903 Ga0207680_10000004 Ga0207680_10000004809 325
735 3300025904 Ga0207647_10000861 Ga0207647_1000086112 325
736 3300025911 Ga0207654_10016953 Ga0207654_100169536 325
737 3300025913 Ga0207695_10003647 Ga0207695_1000364715 325
738 3300025914 Ga0207671_10004057 Ga0207671_1000405714 325
739 3300025923 Ga0207681_10000588 Ga0207681_1000058810 325
740 3300025924 Ga0207694_10009277 Ga0207694_100092776 325
741 3300025931 Ga0207644_10001088 Ga0207644_100010882 325
742 3300025936 Ga0207670_10003876 Ga0207670_100038765 325
743 3300025941 Ga0207711_10023502 Ga0207711_100235025 325
744 3300025949 Ga0207667_10014622 Ga0207667_100146224 325
745 3300025961 Ga0207712_10000001 Ga0207712_10000001683 325
746 3300025986 Ga0207658_10000832 Ga0207658_100008322 325
747 3300026035 Ga0207703_10003684 Ga0207703_100036842 325
748 3300026078 Ga0207702_10004491 Ga0207702_100044916 325
749 3300026088 Ga0207641_10000148 Ga0207641_1000014848 325
750 3300026095 Ga0207676_10000479 Ga0207676_1000047924 325
751 3300026116 Ga0207674_10011027 Ga0207674_100110278 325
752 3300026118 Ga0207675_100004475 Ga0207675_10000447511 325
753 3300026142 Ga0207698_10203678 Ga0207698_102036782 325
754 3300028379 Ga0268266_10000042 Ga0268266_1000004252 325
755 3300028380 Ga0268265_10001122 Ga0268265_1000112225 325
756 3300028381 Ga0268264_10000006 Ga0268264_10000006809 325
757 3300031548 Ga0307408_100229082 Ga0307408_1002290821 325
758 3300031824 Ga0307413_10160139 Ga0307413_101601392 325
759 3300031901 Ga0307406_10064020 Ga0307406_100640202 325
760 3300031903 Ga0307407_10016909 Ga0307407_100169092 325
761 3300031911 Ga0307412_10177944 Ga0307412_101779442 325
762 3300031995 Ga0307409_100069187 Ga0307409_1000691873 325
763 3300032002 Ga0307416_100035478 Ga0307416_1000354785 325
764 3300032002 Ga0307416_100172467 Ga0307416_1001724673 325
765 3300032004 Ga0307414_10093543 Ga0307414_100935433 325
766 3300032004 Ga0307414_10096462 Ga0307414_100964621 325
767 3300032004 Ga0307414_10246010 Ga0307414_102460102 325
768 3300032126 Ga0307415_100172174 Ga0307415_1001721743 325
769 3300032126 Ga0307415_100275605 Ga0307415_1002756052 325
770 3300048904 Ga0496101_0275640 Ga0496101_0275640_182_1159 325
771 3300048905 Ga0496102_0016012 Ga0496102_0016012_3128_4105 325
772 3300048906 Ga0496103_0003222 Ga0496103_0003222_5940_6917 325
773 3300048907 Ga0496104_0023092 Ga0496104_0023092_2557_3534 325
774 3300048908 Ga0496105_0077963 Ga0496105_0077963_1589_2566 325
775 3300048910 Ga0496107_0080661 Ga0496107_0080661_1025_2002 325
776 3300048920 Ga0496117_0011577 Ga0496117_0011577_3583_4560 325
777 3300048921 Ga0496118_0006208 Ga0496118_0006208_10480_11457 325
778 3300048922 Ga0496119_0180092 Ga0496119_0180092_107_1084 325
779 3300048927 Ga0496124_0240404 Ga0496124_0240404_350_1327 325
780 3300049765 Ga0501268_002447 Ga0501268_002447_239_1216 325
781 3300053087 Ga0500643_000524 Ga0500643_000524_21906_22883 325
782 iso_pu_bacteria 2880518877 2880520379 325
783 3300001989 JGI24739J22299_10014975 JGI24739J22299_100149752 326
784 3300005331 Ga0070670_100001143 Ga0070670_1000011438 326
785 3300005331 Ga0070670_100095651 Ga0070670_1000956512 326
786 3300005338 Ga0068868_100000182 Ga0068868_10000018212 326
787 3300005339 Ga0070660_100000364 Ga0070660_10000036424 326
788 3300005353 Ga0070669_100120461 Ga0070669_1001204613 326
789 3300005366 Ga0070659_100000022 Ga0070659_10000002225 326
790 3300005367 Ga0070667_100001233 Ga0070667_1000012338 326
791 3300005457 Ga0070662_100008659 Ga0070662_1000086596 326
792 3300005539 Ga0068853_100002599 Ga0068853_10000259911 326
793 3300005539 Ga0068853_100042414 Ga0068853_1000424144 326
794 3300005577 Ga0068857_100065537 Ga0068857_1000655373 326
795 3300005618 Ga0068864_100000017 Ga0068864_100000017303 326
796 3300005834 Ga0068851_10010455 Ga0068851_100104554 326
797 3300005841 Ga0068863_100000018 Ga0068863_100000018225 326
798 3300005844 Ga0068862_100000010 Ga0068862_1000000107 326
799 3300009011 Ga0105251_10000568 Ga0105251_100005681 326
800 3300009177 Ga0105248_10000128 Ga0105248_100001287 326
801 3300009553 Ga0105249_10000173 Ga0105249_1000017318 326
802 3300013306 Ga0163162_10037199 Ga0163162_100371992 326
803 3300025321 Ga0207656_10139628 Ga0207656_101396281 326
804 3300025735 Ga0207713_1006583 Ga0207713_10065831 326
805 3300025919 Ga0207657_10001613 Ga0207657_1000161312 326
806 3300025923 Ga0207681_10125081 Ga0207681_101250813 326
807 3300025925 Ga0207650_10000199 Ga0207650_1000019972 326
808 3300025926 Ga0207659_10020886 Ga0207659_100208866 326
809 3300025927 Ga0207687_10277787 Ga0207687_102777872 326
810 3300025932 Ga0207690_10000003 Ga0207690_10000003670 326
811 3300025933 Ga0207706_10013575 Ga0207706_100135754 326
812 3300025941 Ga0207711_10000031 Ga0207711_100000317 326
813 3300025961 Ga0207712_10000541 Ga0207712_1000054116 326
814 3300025986 Ga0207658_10000627 Ga0207658_1000062719 326
815 3300026041 Ga0207639_10028114 Ga0207639_100281144 326
816 3300026041 Ga0207639_10057898 Ga0207639_100578982 326
817 3300026088 Ga0207641_10000002 Ga0207641_10000002477 326
818 3300026095 Ga0207676_10000005 Ga0207676_10000005330 326
819 3300026116 Ga0207674_10005854 Ga0207674_1000585414 326
820 3300028380 Ga0268265_10000003 Ga0268265_10000003512 326
821 3300031548 Ga0307408_100131621 Ga0307408_1001316213 326
822 3300031901 Ga0307406_10319479 Ga0307406_103194791 326
823 3300031903 Ga0307407_10065949 Ga0307407_100659492 326
824 3300032004 Ga0307414_10050459 Ga0307414_100504593 326
825 3300032004 Ga0307414_10099110 Ga0307414_100991103 326
826 3300046692 Ga0495671_0106235 Ga0495671_0106235_381_1361 326
827 3300048905 Ga0496102_0557708 Ga0496102_0557708_12_992 326
828 3300048906 Ga0496103_0140163 Ga0496103_0140163_531_1511 326
829 3300048920 Ga0496117_0024655 Ga0496117_0024655_3687_4667 326
830 3300048921 Ga0496118_0004371 Ga0496118_0004371_12170_13150 326
831 3300049663 Ga0501223_000007 Ga0501223_000007_28846_29826 326
832 3300049676 Ga0501246_000328 Ga0501246_000328_623_1603 326
833 3300049705 Ga0501225_0000096 Ga0501225_0000096_4645_5625 326
834 3300053157 Ga0500624_000072 Ga0500624_000072_16030_17010 326
835 3300053177 Ga0500636_0002804 Ga0500636_0002804_8514_9494 326
836 2162886007 SwRhRL2b_contig_1168444 SwRhRL2b_0312.00003340 327
837 2162886007 SwRhRL2b_contig_3755818 SwRhRL2b_0665.00003240 327
838 3300001904 JGI24736J21556_1000307 JGI24736J21556_10003079 327
839 3300001915 JGI24741J21665_1000198 JGI24741J21665_100019810 327
840 3300001979 JGI24740J21852_10000826 JGI24740J21852_1000082610 327
841 3300001989 JGI24739J22299_10007439 JGI24739J22299_100074392 327
842 3300002067 JGI24735J21928_10000294 JGI24735J21928_100002948 327
843 3300002075 JGI24738J21930_10001664 JGI24738J21930_100016646 327
844 3300005289 Ga0065704_10004352 Ga0065704_100043525 327
845 3300005289 Ga0065704_10098162 Ga0065704_100981622 327
846 3300005327 Ga0070658_10153388 Ga0070658_101533881 327
847 3300005331 Ga0070670_100012295 Ga0070670_1000122954 327
848 3300005353 Ga0070669_100031436 Ga0070669_1000314363 327
849 3300005366 Ga0070659_100002729 Ga0070659_1000027297 327
850 3300005455 Ga0070663_100001009 Ga0070663_10000100916 327
851 3300005466 Ga0070685_10031819 Ga0070685_100318193 327
852 3300005564 Ga0070664_100253726 Ga0070664_1002537262 327
853 3300005577 Ga0068857_100251598 Ga0068857_1002515982 327
854 3300005614 Ga0068856_100007034 Ga0068856_1000070344 327
855 3300005616 Ga0068852_100089119 Ga0068852_1000891192 327
856 3300005842 Ga0068858_100006139 Ga0068858_1000061393 327
857 3300006042 Ga0075368_10000448 Ga0075368_1000044811 327
858 3300006178 Ga0075367_10001865 Ga0075367_100018654 327
859 3300006353 Ga0075370_10014121 Ga0075370_100141214 327
860 3300009174 Ga0105241_10001357 Ga0105241_1000135711 327
861 3300009545 Ga0105237_10017796 Ga0105237_100177964 327
862 3300009978 Ga0105148_100001 Ga0105148_1000015 327
863 3300009982 Ga0105147_100489 Ga0105147_1004893 327
864 3300013100 Ga0157373_10175173 Ga0157373_101751732 327
865 3300013105 Ga0157369_10272486 Ga0157369_102724862 327
866 3300014325 Ga0163163_10486080 Ga0163163_104860801 327
867 3300014326 Ga0157380_10012455 Ga0157380_100124556 327
868 3300017792 Ga0163161_10023698 Ga0163161_100236986 327
869 3300025229 Ga0209147_103087 Ga0209147_1030873 327
870 3300025321 Ga0207656_10035337 Ga0207656_100353372 327
871 3300025909 Ga0207705_10298353 Ga0207705_102983531 327
872 3300025913 Ga0207695_10030897 Ga0207695_100308974 327
873 3300025919 Ga0207657_10265965 Ga0207657_102659651 327
874 3300025924 Ga0207694_10118050 Ga0207694_101180501 327
875 3300025925 Ga0207650_10015388 Ga0207650_100153883 327
876 3300025933 Ga0207706_10010105 Ga0207706_100101053 327
877 3300025949 Ga0207667_10096985 Ga0207667_100969852 327
878 3300026041 Ga0207639_10000815 Ga0207639_1000081510 327
879 3300026067 Ga0207678_10000080 Ga0207678_1000008021 327
880 3300026078 Ga0207702_10003704 Ga0207702_1000370410 327
881 3300026116 Ga0207674_10011489 Ga0207674_100114892 327
882 3300026116 Ga0207674_10020838 Ga0207674_100208385 327
883 3300026142 Ga0207698_10012634 Ga0207698_100126343 327
884 3300027866 Ga0209813_10000578 Ga0209813_100005785 327
885 3300031548 Ga0307408_100005149 Ga0307408_1000051498 327
886 3300031852 Ga0307410_10051247 Ga0307410_100512473 327
887 3300031852 Ga0307410_10077483 Ga0307410_100774832 327
888 3300031901 Ga0307406_10170478 Ga0307406_101704782 327
889 3300031911 Ga0307412_10070727 Ga0307412_100707273 327
890 3300032002 Ga0307416_100245203 Ga0307416_1002452031 327
891 3300032004 Ga0307414_10206985 Ga0307414_102069852 327
892 3300032126 Ga0307415_100069300 Ga0307415_1000693002 327
893 3300046453 Ga0495627_000036 Ga0495627_000036_9619_10605 327
894 3300046491 Ga0495584_0028431 Ga0495584_0028431_1126_2109 327
895 3300046519 Ga0495632_0000047 Ga0495632_0000047_93556_94539 327
896 3300046520 Ga0495637_0000367 Ga0495637_0000367_18571_19554 327
897 3300046522 Ga0495643_0000031 Ga0495643_0000031_82759_83742 327
898 3300046524 Ga0495648_0005850 Ga0495648_0005850_3040_4026 327
899 3300046524 Ga0495648_0031987 Ga0495648_0031987_1386_2369 327
900 3300046525 Ga0495663_0000017 Ga0495663_0000017_93562_94545 327
901 3300046525 Ga0495663_0072641 Ga0495663_0072641_81_1067 327
902 3300046525 Ga0495663_0073598 Ga0495663_0073598_44_1030 327
903 3300046558 Ga0495633_0000952 Ga0495633_0000952_2987_3970 327
904 3300046558 Ga0495633_0001585 Ga0495633_0001585_6061_7044 327
905 3300046692 Ga0495671_0000021 Ga0495671_0000021_174079_175062 327
906 3300047470 Ga0495681_0000827 Ga0495681_0000827_5239_6222 327
907 3300047472 Ga0495686_0009156 Ga0495686_0009156_3099_4082 327
908 3300048906 Ga0496103_0272522 Ga0496103_0272522_63_1052 327
909 3300048911 Ga0496108_0012266 Ga0496108_0012266_2908_3891 327
910 3300048911 Ga0496108_0021371 Ga0496108_0021371_1493_2476 327
911 3300048912 Ga0496109_0049878 Ga0496109_0049878_2184_3167 327
912 3300048913 Ga0496110_0062754 Ga0496110_0062754_53_1036 327
913 3300048914 Ga0496111_0078716 Ga0496111_0078716_802_1785 327
914 3300048916 Ga0496113_0104465 Ga0496113_0104465_727_1710 327
915 3300048919 Ga0496116_0022179 Ga0496116_0022179_2297_3286 327
916 3300048920 Ga0496117_0028816 Ga0496117_0028816_1407_2396 327
917 3300048922 Ga0496119_0080101 Ga0496119_0080101_483_1472 327
918 3300048924 Ga0496121_0000065 Ga0496121_0000065_151310_152293 327
919 3300048925 Ga0496122_0030586 Ga0496122_0030586_456_1439 327
920 3300048925 Ga0496122_0043137 Ga0496122_0043137_689_1672 327
921 3300048928 Ga0496125_0012413 Ga0496125_0012413_4397_5380 327
922 3300048928 Ga0496125_0101878 Ga0496125_0101878_762_1745 327
923 3300048928 Ga0496125_0109641 Ga0496125_0109641_100_1086 327
924 3300048928 Ga0496125_0127540 Ga0496125_0127540_476_1459 327
925 3300048929 Ga0496126_0003496 Ga0496126_0003496_18167_19150 327
926 3300049658 Ga0501211_000395 Ga0501211_000395_2677_3660 327
927 3300049669 Ga0501235_013626 Ga0501235_013626_283_1266 327
928 3300049705 Ga0501225_0000960 Ga0501225_0000960_4444_5427 327
929 3300049705 Ga0501225_0006195 Ga0501225_0006195_1352_2335 327
930 3300050494 nmdc:mga06z11_73_c1 nmdc:mga06z11_73_c1_37541_38524 327
931 3300050495 nmdc:mga04h51_603_c1 nmdc:mga04h51_603_c1_4070_5053 327
932 3300050496 nmdc:mga07m45_14098_c1 nmdc:mga07m45_14098_c1_2859_3842 327
933 3300053157 Ga0500624_000073 Ga0500624_000073_22988_23974 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03320

FBPase_glpX

Bacterial fructose-1,6-bisphosphatase, glpX-encoded

32

342

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r8t-assembly1.cif.gz_A crystal structure of the fructose 1,6-bisphosphatase glpx from e.coli in the complex with fructose 1,6-bisphosphate 0.9506 9 322
8g5w-assembly1.cif.gz_A structure of the class ii fructose-1,6-bisphophatase from francisella tularensis complexed with native metal cofactor mn++ 0.9434 9 326
7txb-assembly2.cif.gz_A structure of the class ii fructose-1,6-bisphophatase from mycobacterium tuberculosis complexed with substrate f1,6bp 0.9415 16 322
3bih-assembly1.cif.gz_A crystal structure of fructose-1,6-bisphosphatase from e.coli glpx 0.9376 10 322
8g5x-assembly1.cif.gz_D structure of the class ii fructose-1,6-bisphophatase from francisella tularensis complexed with native metal cofactor mn++ and substrate fructose-1,6-bisphosphate 0.9357 9 326
ID Description Score Start End Superfamily
2r8tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9515 119 273 3.40.190.90
3rplA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9454 119 273 3.40.190.90
af_P9WN21_138_292_3.40.190.90 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9411 119 273 3.40.190.90
1ni9A01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9358 9 324 3.30.540.10
af_P9WN21_138_292_3.40.190.90 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9295 119 273 3.40.190.90
ID Description Score Start End GO Terms
AF-T0KHP7-F1-model_v4 Fructose-1,6-bisphosphatase 0.9937 1 327 GO:0005829
GO:0006071
GO:0006094
GO:0030388
GO:0042132
GO:0046872
AF-A0A2N8EKR2-F1-model_v4 deleted 0.9937 12 88
AF-A0A4Q5QLR6-F1-model_v4 fructose-bisphosphatase (EC 3.1.3.11) 0.9914 167 323 GO:0005829
GO:0006071
GO:0006094
GO:0030388
GO:0042132
AF-A0A520ETV3-F1-model_v4 deleted 0.9911 175 323
AF-T0KHP7-F1-model_v4 Fructose-1,6-bisphosphatase 0.9906 1 327 GO:0005829
GO:0006071
GO:0006094
GO:0030388
GO:0042132
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.91 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map