F484184

General Info

Members Datasets Scaffolds Average Seq Length
871 505 761 391

Family's Representative Sequence

Representative Sequence 3300025292|Ga0209676_1001194|Ga0209676_100119421
Length 446
Sequence MFKTRQHFTISLAKLRLFLLSKIVKIFVKIDISASSICMQCSFLNGEKGRMFMTNEVVIVSAVRTAIGSFQGTLKDVPATKLGSIVIKEALVRAGVAGEKVGEVIMGNVLSAGLGQNPARQAAIAAGLPHEVSALTINKVCGSGLKAVHLATQAILAGDADIVVAGGFENMSQAPYVLKNAREGFRMGDQKVVDTMIHDGLWCAFNDYHMGVTAENLCDVYEISREEQDAFAARSQQRAEAAITAGKFNDEIIAVEIPQRKGDPIVFDKDEFPRQGVTAESLSKLRPAFKKDGSVTAANASGINDGAAAVVVMSKEKAEELGIRPMALITANASAGVDPAIMGTGPVTAVKKALAKADVTLDNIDLIEANEAFAAQSIAVDRELGFNHDKLNVNGGAIALGHPIGASGARILVTLLHEMEKRDAKTGLATLCIGGGQGVATVVKRP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
4 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
5 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
6 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
7 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
8 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
9 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
10 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
11 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
12 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
13 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
14 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
15 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
16 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
17 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
18 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
19 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
20 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
21 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
22 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
23 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
24 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
25 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
26 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
27 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
28 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
29 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
30 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
31 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
32 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
33 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
34 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
35 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
36 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
37 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
38 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
39 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
40 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
41 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
42 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
43 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
44 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
45 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
46 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
47 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
48 2636415599 Klebsiella variicola DX120E Isolate Unclassified
49 2643221732 Bacillus sp. Root239 Isolate Unclassified
50 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
51 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
52 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
53 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
54 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
55 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
56 2738543017 Bacillus sp. OV186 Isolate Unclassified
57 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
58 2751185917 Enterobacter sp. HK169 Isolate Unclassified
59 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
60 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
61 2775507074 Klebsiella sp. D5A Isolate Unclassified
62 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
63 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
64 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
65 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
66 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
67 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
68 2821118458 Enterobacter asburiae 609 Isolate Unclassified
69 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
70 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
71 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
72 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
73 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
74 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
75 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
76 2857586860 Bacillus sp. R-71935 Isolate Unclassified
77 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
78 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
79 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
80 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
81 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
82 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
83 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
84 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
85 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
86 2919720352 Priestia megaterium 4340 Isolate Unclassified
87 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
88 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
89 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
90 2929004312 Priestia megaterium 1104 Isolate Unclassified
91 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
92 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
93 2937539931 Pantoea sp. LS15 Isolate Unclassified
94 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
95 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
96 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
97 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
98 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
99 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
100 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
101 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
102 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
103 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
104 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
105 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
106 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
107 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
108 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
109 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
110 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
111 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
112 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
113 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
114 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
115 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
116 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
117 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
118 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
119 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
120 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
121 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
122 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
123 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
124 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
125 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
126 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
127 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
128 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
129 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
130 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
131 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
132 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
133 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
134 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
135 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
136 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
137 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
138 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
139 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
140 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
141 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
142 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
143 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
144 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
145 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
146 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
147 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
148 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
149 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
150 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
151 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
152 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
153 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
154 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
155 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
156 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
157 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
158 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
159 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
160 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
161 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
162 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
163 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
164 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
165 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
166 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
167 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
168 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
169 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
170 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
171 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
172 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
173 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
174 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
175 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
176 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
177 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
178 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
179 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
180 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
181 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
182 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
183 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
184 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
185 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
186 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
187 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
188 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
189 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
190 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
191 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
192 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
193 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
194 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
195 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
196 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
197 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
198 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
199 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
200 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
201 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
202 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
203 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
204 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
205 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
206 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
207 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
208 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
209 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
210 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
211 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
212 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
213 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
214 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
215 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
216 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
217 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
218 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
219 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
220 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
221 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
223 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
228 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
230 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
274 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
276 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
277 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
281 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
282 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
283 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
284 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
285 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
286 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
287 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
288 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
289 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
290 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
291 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
292 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
293 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
294 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
295 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
296 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
297 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
298 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
299 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
300 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
301 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
302 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
303 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
304 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
305 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
308 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
309 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
310 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
311 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
312 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
313 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
314 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
315 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
316 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
317 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
318 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
319 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
320 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
321 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
322 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
323 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
324 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
325 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
326 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
327 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
328 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
329 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
330 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
331 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
332 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
333 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
334 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
335 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
336 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
337 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
338 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
339 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
340 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
341 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
342 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
343 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
344 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
345 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
346 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
347 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
348 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
349 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
350 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
351 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
352 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
353 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
354 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
355 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
356 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
357 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
358 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
359 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
360 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
361 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
362 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
363 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
364 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
365 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
366 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
367 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
368 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
369 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
370 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
371 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
372 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
373 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
374 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
375 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
376 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
377 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
378 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
379 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
380 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
381 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
382 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
383 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
384 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
385 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
386 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
387 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
388 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
389 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
390 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
391 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
392 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
393 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
394 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
395 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
396 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
397 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
398 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
399 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
400 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
401 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
402 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
403 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
404 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
405 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
406 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
407 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
408 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
409 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
410 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
411 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
412 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
413 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
414 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
415 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
416 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
417 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
418 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
419 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
420 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
421 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
422 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
423 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
424 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
425 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
426 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
427 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
428 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
429 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
430 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
431 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
433 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
449 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
450 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
454 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
455 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
456 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
457 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
458 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
459 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
460 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
461 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
462 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
463 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
464 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
465 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
466 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
469 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
470 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
471 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
472 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
473 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
474 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
475 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
476 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
477 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
478 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
479 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
480 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
481 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
482 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
483 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
484 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
485 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
486 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
487 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
488 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
489 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
490 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
491 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
492 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
493 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
494 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
495 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
496 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
497 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
498 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
499 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
500 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
501 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
502 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
503 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
504 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
505 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.19
Metatranscriptomes 2.18
Isolates 12.63

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 6.77
Nodule 0.69
Rhizoplane 10.1
Rhizosphere 67.74
Stem 0
Stem Tuber 0
Unclassified 14.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2703074 2162886007 Bacteria 7875
2 JGI24736J21556_1001340 3300001904 Bacteria 4498
3 JGI24740J21852_10006911 3300001979 Bacteria 4660
4 JGI24735J21928_10001258 3300002067 Bacteria 8994
5 Ga0006778J45830_1026826 3300003162 Bacteria 1257
6 JGI25151J46595_10000302 3300003187 Bacteria 54102
7 JGI25151J46595_10002958 3300003187 Bacteria 9705
8 JGI25151J46595_10007108 3300003187 Bacteria 5523
9 JGI25151J46595_10039571 3300003187 Bacteria 1739
10 rootH2_10023994 3300003320 Bacteria 23941
11 rootH2_10083643 3300003320 Bacteria 8038
12 Ga0007416J51690_1021970 3300003577 Bacteria 1317
13 Ga0007429J51699_1018838 3300003579 Bacteria 1263
14 Ga0055532_1000060 3300003758 Bacteria 150321
15 Ga0055532_1001176 3300003758 Bacteria 7896
16 Ga0055542_1000589 3300003762 Bacteria 31380
17 Ga0055529_1004088 3300003763 Bacteria 2272
18 Ga0055536_1000461 3300003781 Bacteria 28659
19 Ga0055536_1000666 3300003781 Bacteria 23120
20 Ga0055530_10000424 3300003791 Bacteria 37602
21 Ga0055540_1000122 3300003792 Bacteria 81293
22 Ga0055531_10000146 3300003794 Bacteria 81289
23 Ga0058692_1000622 3300003856 Bacteria 14677
24 Ga0058692_1000674 3300003856 Bacteria 14060
25 Ga0058692_1007359 3300003856 Bacteria 2929
26 Ga0065714_10084763 3300005288 Bacteria 2182
27 Ga0065704_10070699 3300005289 Bacteria 17430
28 Ga0065704_10083393 3300005289 Bacteria 3473
29 Ga0065707_10105464 3300005295 Bacteria 2630
30 Ga0070658_10006314 3300005327 Bacteria 9600
31 Ga0070676_10055192 3300005328 Bacteria 2344
32 Ga0070676_10061532 3300005328 Bacteria 2232
33 Ga0070690_100049678 3300005330 Bacteria 2675
34 Ga0070670_100045743 3300005331 Bacteria 3763
35 Ga0070670_100057539 3300005331 Bacteria 3337
36 Ga0070666_10004186 3300005335 Bacteria 8755
37 Ga0070680_100009507 3300005336 Bacteria 7467
38 Ga0070682_100059039 3300005337 Bacteria 2421
39 Ga0070689_100015633 3300005340 Bacteria 5539
40 Ga0070689_100065480 3300005340 Bacteria 2830
41 Ga0070692_10129027 3300005345 Bacteria 1419
42 Ga0070668_100000707 3300005347 Bacteria 22821
43 Ga0070668_100004391 3300005347 Bacteria 10460
44 Ga0070673_100067712 3300005364 Bacteria 2856
45 Ga0070688_100022333 3300005365 Bacteria 3706
46 Ga0070667_100003824 3300005367 Bacteria 12796
47 Ga0070709_10065471 3300005434 Bacteria 2327
48 Ga0070714_100074276 3300005435 Bacteria 2947
49 Ga0070713_100037681 3300005436 Bacteria 3910
50 Ga0070713_100051297 3300005436 Bacteria 3411
51 Ga0070713_100063212 3300005436 Bacteria 3102
52 Ga0070710_10021576 3300005437 Bacteria 3358
53 Ga0070705_100049180 3300005440 Bacteria 2447
54 Ga0070700_100006997 3300005441 Bacteria 6056
55 Ga0070694_100001005 3300005444 Bacteria 16031
56 Ga0070694_100058197 3300005444 Bacteria 2629
57 Ga0070708_100026124 3300005445 Bacteria 4995
58 Ga0070663_100020685 3300005455 Bacteria 4360
59 Ga0070663_100163365 3300005455 Bacteria 1716
60 Ga0070681_10004050 3300005458 Bacteria 13835
61 Ga0070681_10078648 3300005458 Bacteria 3254
62 Ga0070681_10145752 3300005458 Bacteria 2297
63 Ga0068867_100027781 3300005459 Bacteria 4070
64 Ga0070685_10093879 3300005466 Bacteria 1821
65 Ga0070706_100004372 3300005467 Bacteria 13649
66 Ga0070706_100153608 3300005467 Bacteria 2149
67 Ga0070707_100064773 3300005468 Bacteria 3510
68 Ga0070699_100000540 3300005518 Bacteria 35757
69 Ga0070699_100184242 3300005518 Bacteria 1853
70 Ga0070679_100025738 3300005530 Bacteria 5774
71 Ga0070679_100073177 3300005530 Bacteria 3419
72 Ga0070684_100100836 3300005535 Bacteria 2579
73 Ga0070697_100127625 3300005536 Bacteria 2131
74 Ga0068853_100000230 3300005539 Bacteria 39593
75 Ga0068853_100360062 3300005539 Bacteria 1355
76 Ga0070695_100000710 3300005545 Bacteria 17788
77 Ga0070695_100010886 3300005545 Bacteria 5434
78 Ga0070696_100000156 3300005546 Bacteria 38002
79 Ga0070665_100000406 3300005548 Bacteria 63162
80 Ga0070665_100006587 3300005548 Bacteria 11805
81 Ga0070665_100011615 3300005548 Bacteria 8903
82 Ga0068855_100000034 3300005563 Bacteria 166436
83 Ga0068855_100161923 3300005563 Bacteria 2539
84 Ga0068857_100006498 3300005577 Bacteria 10028
85 Ga0068854_100106278 3300005578 Bacteria 2111
86 Ga0068854_100185818 3300005578 Bacteria 1626
87 Ga0068856_100031657 3300005614 Bacteria 5176
88 Ga0068852_100018197 3300005616 Bacteria 5532
89 Ga0068859_100199657 3300005617 Bacteria 2084
90 Ga0068864_100164996 3300005618 Bacteria 2016
91 Ga0068861_100031979 3300005719 Bacteria 3871
92 Ga0068858_100037806 3300005842 Bacteria 4476
93 Ga0068860_100000351 3300005843 Bacteria 61888
94 Ga0068860_100007718 3300005843 Bacteria 10756
95 Ga0068860_100078572 3300005843 Bacteria 3138
96 Ga0068862_100024035 3300005844 Bacteria 5109
97 Ga0068862_100045374 3300005844 Bacteria 3750
98 Ga0068862_100050025 3300005844 Bacteria 3571
99 Ga0068862_100063471 3300005844 Bacteria 3178
100 Ga0081455_10000028 3300005937 Bacteria 155778
101 Ga0081455_10001108 3300005937 Bacteria 33842
102 Ga0081455_10045047 3300005937 Bacteria 3842
103 Ga0081455_10100945 3300005937 Bacteria 2317
104 Ga0081538_10007910 3300005981 Bacteria 9109
105 Ga0081538_10018206 3300005981 Bacteria 5289
106 Ga0081538_10020695 3300005981 Bacteria 4831
107 Ga0081538_10024985 3300005981 Bacteria 4235
108 Ga0081540_1000060 3300005983 Bacteria 119707
109 Ga0081540_1043059 3300005983 Bacteria 2321
110 Ga0081539_10000977 3300005985 Bacteria 53347
111 Ga0081539_10005453 3300005985 Bacteria 12976
112 Ga0081539_10010261 3300005985 Bacteria 7651
113 Ga0081539_10015990 3300005985 Bacteria 5403
114 Ga0070717_10024871 3300006028 Bacteria 4757
115 Ga0070717_10057481 3300006028 Bacteria 3215
116 Ga0070717_10080726 3300006028 Bacteria 2729
117 Ga0075365_10009401 3300006038 Bacteria 5617
118 Ga0075365_10036665 3300006038 Bacteria 3178
119 Ga0075363_100038942 3300006048 Bacteria 2501
120 Ga0075364_10043851 3300006051 Bacteria 2908
121 Ga0070715_10015199 3300006163 Bacteria 2866
122 Ga0070716_100027329 3300006173 Bacteria 3064
123 Ga0070716_100216075 3300006173 Bacteria 1285
124 Ga0070712_100014972 3300006175 Bacteria 4986
125 Ga0070712_100068020 3300006175 Bacteria 2536
126 Ga0075366_10017931 3300006195 Bacteria 4084
127 Ga0075370_10011338 3300006353 Bacteria 4681
128 Ga0075370_10014893 3300006353 Bacteria 4154
129 Ga0075428_100002387 3300006844 Bacteria 20393
130 Ga0075428_100002525 3300006844 Bacteria 19895
131 Ga0075428_100057384 3300006844 Bacteria 4262
132 Ga0075430_100060823 3300006846 Bacteria 3174
133 Ga0075430_100089607 3300006846 Bacteria 2573
134 Ga0075431_100005137 3300006847 Bacteria 12878
135 Ga0075431_100087766 3300006847 Bacteria 3210
136 Ga0075433_10011214 3300006852 Bacteria 7213
137 Ga0075433_10122881 3300006852 Bacteria 2306
138 Ga0075434_100067556 3300006871 Bacteria 3560
139 Ga0075434_100091899 3300006871 Bacteria 3036
140 Ga0075434_100192022 3300006871 Bacteria 2063
141 Ga0075436_100002374 3300006914 Bacteria 13001
142 Ga0075436_100043110 3300006914 Bacteria 3110
143 Ga0097620_100199661 3300006931 Bacteria 2084
144 Ga0079104_1001990 3300006946 Bacteria 11958
145 Ga0075435_100029369 3300007076 Bacteria 4314
146 Ga0075435_100079607 3300007076 Bacteria 2689
147 Ga0099794_10008524 3300007265 Bacteria 4264
148 Ga0105251_10000064 3300009011 Bacteria 100095
149 Ga0105251_10001689 3300009011 Bacteria 18557
150 Ga0105251_10008061 3300009011 Bacteria 6386
151 Ga0105251_10034656 3300009011 Bacteria 2496
152 Ga0105250_10000053 3300009092 Bacteria 114563
153 Ga0105250_10001882 3300009092 Bacteria 10908
154 Ga0105250_10005639 3300009092 Bacteria 5591
155 Ga0105250_10043755 3300009092 Bacteria 1795
156 Ga0105240_10022032 3300009093 Bacteria 8460
157 Ga0111539_10018998 3300009094 Bacteria 8497
158 Ga0111539_10034619 3300009094 Bacteria 6120
159 Ga0105245_10005334 3300009098 Bacteria 11294
160 Ga0114129_10023661 3300009147 Bacteria 8707
161 Ga0114129_10032683 3300009147 Bacteria 7352
162 Ga0114129_10040156 3300009147 Bacteria 6597
163 Ga0114129_10098515 3300009147 Bacteria 4046
164 Ga0105241_10016604 3300009174 Bacteria 5402
165 Ga0105248_10000001 3300009177 Bacteria 1881304
166 Ga0105248_10024110 3300009177 Bacteria 6762
167 Ga0105248_10069958 3300009177 Bacteria 3941
168 Ga0105249_10299309 3300009553 Bacteria 1613
169 Ga0105148_100251 3300009978 Bacteria 7349
170 Ga0099796_10000988 3300010159 Bacteria 5342
171 Ga0099796_10004076 3300010159 Bacteria 3486
172 Ga0105246_10004282 3300011119 Bacteria 8680
173 Ga0157345_1000058 3300012498 Bacteria 23631
174 Ga0157370_10004253 3300013104 Bacteria 16534
175 Ga0157370_10110370 3300013104 Bacteria 2571
176 Ga0157369_10002217 3300013105 Bacteria 23382
177 Ga0157369_10002227 3300013105 Bacteria 23348
178 Ga0157369_10007939 3300013105 Bacteria 12204
179 Ga0157369_10298786 3300013105 Bacteria 1675
180 Ga0157369_10406137 3300013105 Bacteria 1413
181 Ga0157374_10098952 3300013296 Bacteria 2793
182 Ga0163162_10201294 3300013306 Bacteria 2120
183 Ga0157372_10337573 3300013307 Bacteria 1755
184 Ga0157375_10254859 3300013308 Bacteria 1916
185 Ga0163163_10245913 3300014325 Bacteria 1839
186 Ga0182008_10101987 3300014497 Bacteria 1419
187 Ga0183366_1001 3300015679 Bacteria 2743932
188 Ga0183370_1001 3300015680 Bacteria 2743932
189 Ga0183369_1001 3300015685 Bacteria 2743932
190 Ga0183368_1001 3300015687 Bacteria 2743932
191 Ga0163161_10006599 3300017792 Bacteria 8034
192 Ga0206356_10667046 3300020070 Bacteria 1781
193 Ga0213872_10000860 3300021361 Bacteria 21983
194 Ga0213872_10022550 3300021361 Bacteria 2900
195 Ga0213876_10000084 3300021384 Bacteria 107178
196 Ga0213876_10000103 3300021384 Bacteria 94164
197 Ga0247553_100221 3300023672 Bacteria 1911
198 Ga0228598_1000875 3300024227 Bacteria 6508
199 Ga0209784_100118 3300025224 Bacteria 83084
200 Ga0209147_100080 3300025229 Bacteria 196308
201 Ga0209147_100101 3300025229 Bacteria 161976
202 Ga0209148_1000384 3300025254 Bacteria 53115
203 Ga0209455_1000152 3300025272 Bacteria 125942
204 Ga0209675_1005781 3300025291 Bacteria 5095
205 Ga0209676_1000020 3300025292 Bacteria 617256
206 Ga0209676_1000102 3300025292 Bacteria 227372
207 Ga0209676_1000427 3300025292 Bacteria 73627
208 Ga0209676_1001194 3300025292 Bacteria 27901
209 Ga0209025_1000262 3300025294 Bacteria 123617
210 Ga0209025_1002935 3300025294 Bacteria 16963
211 Ga0209025_1004102 3300025294 Bacteria 12975
212 Ga0209025_1005174 3300025294 Bacteria 10787
213 Ga0209025_1008076 3300025294 Bacteria 7661
214 Ga0209050_1000105 3300025298 Bacteria 227285
215 Ga0209051_1000066 3300025303 Bacteria 227369
216 Ga0209257_1000124 3300025304 Bacteria 218195
217 Ga0207696_1000088 3300025711 Bacteria 190313
218 Ga0207696_1000116 3300025711 Bacteria 148125
219 Ga0207696_1002383 3300025711 Bacteria 9275
220 Ga0207696_1005207 3300025711 Bacteria 5440
221 Ga0207655_1007416 3300025728 Bacteria 7114
222 Ga0207655_1026537 3300025728 Bacteria 2781
223 Ga0207713_1000002 3300025735 Bacteria 1061749
224 Ga0207713_1000370 3300025735 Bacteria 48903
225 Ga0207713_1000883 3300025735 Bacteria 27325
226 Ga0207713_1002682 3300025735 Bacteria 12729
227 Ga0207713_1002965 3300025735 Bacteria 11859
228 Ga0207713_1025470 3300025735 Bacteria 2731
229 Ga0207713_1032114 3300025735 Bacteria 2310
230 Ga0207713_1037039 3300025735 Bacteria 2085
231 Ga0207653_10000724 3300025885 Bacteria 11298
232 Ga0207692_10022673 3300025898 Bacteria 2893
233 Ga0207692_10095516 3300025898 Bacteria 1621
234 Ga0207688_10006050 3300025901 Bacteria 6583
235 Ga0207680_10000192 3300025903 Bacteria 29474
236 Ga0207685_10004693 3300025905 Bacteria 3511
237 Ga0207699_10158718 3300025906 Bacteria 1503
238 Ga0207645_10046281 3300025907 Bacteria 2779
239 Ga0207684_10006877 3300025910 Bacteria 10292
240 Ga0207684_10033976 3300025910 Bacteria 4336
241 Ga0207707_10013817 3300025912 Bacteria 7041
242 Ga0207707_10019402 3300025912 Bacteria 5935
243 Ga0207695_10141179 3300025913 Bacteria 2357
244 Ga0207693_10002296 3300025915 Bacteria 16616
245 Ga0207693_10024341 3300025915 Bacteria 4805
246 Ga0207693_10049456 3300025915 Bacteria 3301
247 Ga0207693_10064671 3300025915 Bacteria 2865
248 Ga0207663_10019794 3300025916 Bacteria 3799
249 Ga0207660_10003986 3300025917 Bacteria 9626
250 Ga0207660_10184586 3300025917 Bacteria 1622
251 Ga0207646_10026623 3300025922 Bacteria 5275
252 Ga0207650_10002443 3300025925 Bacteria 12941
253 Ga0207650_10099874 3300025925 Bacteria 2232
254 Ga0207659_10112886 3300025926 Bacteria 2069
255 Ga0207687_10066936 3300025927 Bacteria 2554
256 Ga0207700_10007976 3300025928 Bacteria 6520
257 Ga0207700_10075251 3300025928 Bacteria 2616
258 Ga0207700_10301932 3300025928 Bacteria 1383
259 Ga0207664_10079190 3300025929 Bacteria 2667
260 Ga0207670_10009459 3300025936 Bacteria 5562
261 Ga0207670_10016209 3300025936 Bacteria 4471
262 Ga0207670_10170450 3300025936 Bacteria 1632
263 Ga0207665_10000117 3300025939 Bacteria 52204
264 Ga0207665_10272203 3300025939 Bacteria 1258
265 Ga0207691_10133928 3300025940 Bacteria 2187
266 Ga0207711_10000001 3300025941 Bacteria 1325674
267 Ga0207711_10013853 3300025941 Bacteria 6697
268 Ga0207667_10108121 3300025949 Bacteria 2869
269 Ga0207651_10014448 3300025960 Bacteria 4560
270 Ga0207712_10014325 3300025961 Bacteria 5099
271 Ga0207668_10000002 3300025972 Bacteria 209163
272 Ga0207668_10025508 3300025972 Bacteria 3826
273 Ga0207668_10033453 3300025972 Bacteria 3406
274 Ga0207640_10073191 3300025981 Bacteria 2315
275 Ga0207640_10096434 3300025981 Bacteria 2062
276 Ga0207703_10003659 3300026035 Bacteria 12816
277 Ga0207639_10000338 3300026041 Bacteria 32510
278 Ga0207639_10017877 3300026041 Bacteria 5029
279 Ga0207678_10029207 3300026067 Bacteria 4811
280 Ga0207708_10013835 3300026075 Bacteria 6030
281 Ga0207641_10165713 3300026088 Bacteria 2012
282 Ga0207648_10040324 3300026089 Bacteria 4104
283 Ga0207648_10160414 3300026089 Bacteria 1986
284 Ga0207674_10004781 3300026116 Bacteria 16234
285 Ga0207674_10013979 3300026116 Bacteria 8875
286 Ga0207675_100267322 3300026118 Bacteria 1659
287 Ga0207698_10142237 3300026142 Bacteria 2069
288 Ga0209281_1000820 3300027111 Bacteria 28065
289 Ga0209371_1000001 3300027312 Bacteria 2771503
290 Ga0209371_1000020 3300027312 Bacteria 556282
291 Ga0209371_1001119 3300027312 Bacteria 19769
292 Ga0209371_1002623 3300027312 Bacteria 9844
293 Ga0209371_1006607 3300027312 Bacteria 4256
294 Ga0209813_10012558 3300027866 Bacteria 2242
295 Ga0209974_10026553 3300027876 Bacteria 1917
296 Ga0268266_10000435 3300028379 Bacteria 62710
297 Ga0268266_10000811 3300028379 Bacteria 41188
298 Ga0268265_10006024 3300028380 Bacteria 8250
299 Ga0268264_10000749 3300028381 Bacteria 36626
300 Ga0268264_10035403 3300028381 Bacteria 4111
301 Ga0268264_10049442 3300028381 Bacteria 3498
302 Ga0307517_10008180 3300028786 Bacteria 15041
303 Ga0268256_1000001 3300030500 Bacteria 2771065
304 Ga0268256_1000057 3300030500 Bacteria 229991
305 Ga0268256_1000951 3300030500 Bacteria 19769
306 Ga0268256_1002322 3300030500 Bacteria 9844
307 Ga0268256_1006662 3300030500 Bacteria 4256
308 Ga0316178_1118621 3300030735 Bacteria 29653
309 Ga0265330_10055322 3300031235 Bacteria 1733
310 Ga0265332_10001502 3300031238 Bacteria 12971
311 Ga0265320_10000039 3300031240 Bacteria 134478
312 Ga0265320_10000550 3300031240 Bacteria 28890
313 Ga0265325_10048989 3300031241 Bacteria 2182
314 Ga0265325_10058138 3300031241 Bacteria 1970
315 Ga0265340_10040691 3300031247 Bacteria 2288
316 Ga0265339_10011897 3300031249 Bacteria 5336
317 Ga0265339_10036463 3300031249 Bacteria 2752
318 Ga0307513_10000077 3300031456 Bacteria 134167
319 Ga0307408_100006252 3300031548 Bacteria 7906
320 Ga0307408_100029279 3300031548 Bacteria 3813
321 Ga0307408_100058061 3300031548 Bacteria 2812
322 Ga0316575_10017975 3300031665 Bacteria 2692
323 Ga0265314_10013436 3300031711 Bacteria 6613
324 Ga0265314_10014914 3300031711 Bacteria 6190
325 Ga0265314_10019715 3300031711 Bacteria 5217
326 Ga0265314_10097843 3300031711 Bacteria 1894
327 Ga0265342_10008983 3300031712 Bacteria 7097
328 Ga0265342_10092051 3300031712 Bacteria 1737
329 Ga0316576_10034845 3300031727 Bacteria 3590
330 Ga0316576_10042757 3300031727 Bacteria 3266
331 Ga0316576_10155394 3300031727 Bacteria 1724
332 Ga0316578_10000916 3300031728 Bacteria 11148
333 Ga0316578_10014050 3300031728 Bacteria 4264
334 Ga0316578_10092765 3300031728 Bacteria 1805
335 Ga0307405_10082306 3300031731 Bacteria 2106
336 Ga0307410_10023315 3300031852 Bacteria 3845
337 Ga0307410_10110887 3300031852 Bacteria 1985
338 Ga0307410_10154752 3300031852 Bacteria 1711
339 Ga0307412_10085309 3300031911 Bacteria 2194
340 Ga0307412_10117093 3300031911 Bacteria 1912
341 Ga0307409_100042898 3300031995 Bacteria 3392
342 Ga0307409_100219446 3300031995 Bacteria 1715
343 Ga0307416_100053199 3300032002 Bacteria 3247
344 Ga0307416_100087297 3300032002 Bacteria 2662
345 Ga0307416_100194892 3300032002 Bacteria 1915
346 Ga0307414_10156780 3300032004 Bacteria 1803
347 Ga0316053_101354 3300032120 Bacteria 1289
348 Ga0316585_10015583 3300032137 Bacteria 2283
349 Ga0316580_10011049 3300032139 Bacteria 2736
350 Ga0316580_10013050 3300032139 Bacteria 2532
351 Ga0316588_1010906 3300033528 Bacteria 1927
352 Ga0316596_1007729 3300033541 Bacteria 2547
353 Ga0373926_0013371 3300035083 Bacteria 2783
354 Ga0373926_0059021 3300035083 Bacteria 1396
355 Ga0373940_0006440 3300035088 Bacteria 2604
356 Ga0373944_0002385 3300035089 Bacteria 4783
357 Ga0373949_0010649 3300035090 Bacteria 2017
358 Ga0373923_0009386 3300035111 Bacteria 3530
359 Ga0373932_0011803 3300035112 Bacteria 2141
360 Ga0373939_0019131 3300035114 Bacteria 1844
361 Ga0373941_0009585 3300035115 Bacteria 2443
362 Ga0373956_0012242 3300035119 Bacteria 3552
363 Ga0373956_0052707 3300035119 Bacteria 1830
364 Ga0373943_0007037 3300035170 Bacteria 5046
365 Ga0373955_0026576 3300035172 Bacteria 2983
366 Ga0373961_0004207 3300035241 Bacteria 3493
367 Ga0316574_0006329 3300035398 Bacteria 6390
368 Ga0316574_0007076 3300035398 Bacteria 6122
369 Ga0316574_0012119 3300035398 Bacteria 4924
370 Ga0373924_0051158 3300035410 Bacteria 1712
371 Ga0373931_0002980 3300035691 Bacteria 7564
372 Ga0373931_0009777 3300035691 Bacteria 4592
373 Ga0373935_0001583 3300035692 Bacteria 12687
374 Ga0373935_0003507 3300035692 Bacteria 9123
375 Ga0373935_0052567 3300035692 Bacteria 2590
376 Ga0373927_0000243 3300035695 Bacteria 42834
377 Ga0373927_0050482 3300035695 Bacteria 2690
378 Ga0373933_0008345 3300035724 Bacteria 5656
379 Ga0373933_0039115 3300035724 Bacteria 2789
380 Ga0373933_0075339 3300035724 Bacteria 2060
381 Ga0373947_0006288 3300035725 Bacteria 6904
382 Ga0373937_0014589 3300036401 Bacteria 6940
383 Ga0373937_0041928 3300036401 Bacteria 4176
384 Ga0373937_0057447 3300036401 Bacteria 3574
385 Ga0316582_0039051 3300036647 Bacteria 2954
386 Ga0316582_0100345 3300036647 Bacteria 1916
387 Ga0316584_0020718 3300036712 Bacteria 4771
388 Ga0316584_0044039 3300036712 Bacteria 3328
389 Ga0373925_0102445 3300037068 Bacteria 2202
390 Ga0395898_0041459 3300037466 Bacteria 4547
391 Ga0436364_0777042 3300037853 Bacteria 1376
392 Ga0436364_0943381 3300037853 Bacteria 2572
393 Ga0436364_0992727 3300037853 Bacteria 1286
394 Ga0395901_0085923 3300038443 Bacteria 3289
395 Ga0237819_00896 3300038705 Bacteria 9258
396 Ga0400483_011703 3300039062 Bacteria 5250
397 Ga0400483_144988 3300039062 Bacteria 3461
398 Ga0400483_150944 3300039062 Bacteria 17535
399 Ga0400489_33857 3300039093 Bacteria 3056
400 Ga0436365_0203066 3300039437 Bacteria 111457
401 Ga0436365_0924222 3300039437 Bacteria 2939
402 Ga0436365_1805879 3300039437 Bacteria 2909
403 Ga0436365_1861022 3300039437 Bacteria 74232
404 Ga0436360_0886478 3300039438 Bacteria 2494
405 Ga0436361_0453677 3300039447 Bacteria 28726
406 Ga0436361_0984484 3300039447 Bacteria 2052
407 Ga0436361_1001866 3300039447 Bacteria 37490
408 Ga0436363_0439161 3300039450 Bacteria 2158
409 Ga0436363_0452161 3300039450 Bacteria 1463
410 Ga0436363_1190291 3300039450 Bacteria 1539
411 Ga0436362_0660459 3300039453 Bacteria 1558
412 Ga0439436_0001265 3300041404 Bacteria 7214
413 Ga0439438_005534 3300041405 Bacteria 4626
414 Ga0439438_006885 3300041405 Bacteria 3957
415 Ga0439447_007714 3300041407 Bacteria 3389
416 Ga0451853_1896193 3300041512 Bacteria 2018
417 Ga0439432_013194 3300042006 Bacteria 2812
418 Ga0439432_014713 3300042006 Bacteria 2646
419 Ga0439450_000469 3300042008 Bacteria 5250
420 Ga0439452_000142 3300042010 Bacteria 54077
421 Ga0439452_000221 3300042010 Bacteria 40244
422 Ga0439452_001405 3300042010 Bacteria 9905
423 Ga0439455_0035371 3300042012 Bacteria 1260
424 Ga0450902_015737 3300042137 Bacteria 1229
425 Ga0450904_001512 3300042139 Bacteria 3203
426 Ga0439434_0008880 3300042435 Bacteria 2953
427 Ga0450916_001727 3300042530 Bacteria 2218
428 Ga0453683_0005602 3300044673 Bacteria 8730
429 Ga0453684_0003922 3300044712 Bacteria 32678
430 Ga0453684_0011998 3300044712 Bacteria 14410
431 Ga0453684_0048239 3300044712 Bacteria 5635
432 Ga0453684_0244145 3300044712 Bacteria 2066
433 Ga0453684_0278560 3300044712 Bacteria 1908
434 Ga0466960_0136396 3300044901 Bacteria 1300
435 Ga0466959_0035190 3300045049 Bacteria 3706
436 Ga0451576_0000016 3300045051 Bacteria 565050
437 Ga0451576_0000051 3300045051 Bacteria 313453
438 Ga0451576_0000696 3300045051 Bacteria 68242
439 Ga0451576_0013071 3300045051 Bacteria 9297
440 Ga0495591_003608 3300046458 Bacteria 7885
441 Ga0495629_0029522 3300046459 Bacteria 3887
442 Ga0495638_0007527 3300046460 Bacteria 7793
443 Ga0495641_0042091 3300046461 Bacteria 2119
444 Ga0495651_0019514 3300046462 Bacteria 5256
445 Ga0495651_0130188 3300046462 Bacteria 1838
446 Ga0495653_0027546 3300046463 Bacteria 4547
447 Ga0495650_0000005 3300046471 Bacteria 766553
448 Ga0495580_0046745 3300046472 Bacteria 3070
449 Ga0495662_0025639 3300046476 Bacteria 2847
450 Ga0495662_0053389 3300046476 Bacteria 1951
451 Ga0495664_0069604 3300046477 Bacteria 2100
452 Ga0495584_0020115 3300046491 Bacteria 3391
453 Ga0495584_0052579 3300046491 Bacteria 2050
454 Ga0495585_0002318 3300046492 Bacteria 13716
455 Ga0495607_0000668 3300046501 Bacteria 33232
456 Ga0495583_0000447 3300046506 Bacteria 61780
457 Ga0495583_0010816 3300046506 Bacteria 5283
458 Ga0495606_0044385 3300046507 Bacteria 2956
459 Ga0495608_0061405 3300046511 Bacteria 2471
460 Ga0495610_0004539 3300046512 Bacteria 10212
461 Ga0495618_0095864 3300046514 Eukaryota 1897
462 Ga0495618_0131624 3300046514 Bacteria 1600
463 Ga0495628_0045518 3300046516 Bacteria 3488
464 Ga0495652_0077715 3300046529 Bacteria 2750
465 Ga0495652_0094290 3300046529 Bacteria 2441
466 Ga0495654_0003014 3300046530 Bacteria 10501
467 Ga0495640_0005373 3300046533 Bacteria 10190
468 Ga0495640_0061829 3300046533 Bacteria 2542
469 Ga0495587_0018878 3300046536 Bacteria 4274
470 Ga0495587_0069761 3300046536 Bacteria 2046
471 Ga0495645_0001277 3300046543 Bacteria 17149
472 Ga0495633_0024969 3300046558 Bacteria 2948
473 Ga0495667_0128996 3300046559 Bacteria 1631
474 Ga0495634_0066926 3300046642 Bacteria 2377
475 Ga0495635_0020720 3300046663 Bacteria 4580
476 Ga0495599_0033264 3300046678 Bacteria 3239
477 Ga0495646_0031506 3300046680 Bacteria 3304
478 Ga0495647_0091441 3300046681 Bacteria 1248
479 Ga0495658_0075819 3300046683 Bacteria 1963
480 Ga0495613_0001199 3300046689 Bacteria 19784
481 Ga0495613_0187394 3300046689 Bacteria 1463
482 Ga0495671_0074401 3300046692 Bacteria 1666
483 Ga0495649_0000777 3300046694 Bacteria 25668
484 Ga0495649_0001900 3300046694 Bacteria 15256
485 Ga0495649_0005219 3300046694 Bacteria 8313
486 Ga0495600_0068905 3300046809 Bacteria 2312
487 Ga0495604_0024793 3300047317 Bacteria 4785
488 Ga0495604_0094935 3300047317 Bacteria 2204
489 Ga0495604_0203218 3300047317 Bacteria 1373
490 Ga0495674_0002065 3300047319 Bacteria 19693
491 Ga0495674_0018921 3300047319 Bacteria 6405
492 Ga0495674_0109410 3300047319 Bacteria 2344
493 Ga0495676_0124179 3300047321 Bacteria 1873
494 Ga0495680_0074380 3300047322 Bacteria 2580
495 Ga0495683_0022584 3300047323 Bacteria 3235
496 Ga0495675_0059761 3300047444 Bacteria 2416
497 Ga0495679_012913 3300047446 Bacteria 3158
498 Ga0495684_0014934 3300047471 Bacteria 5981
499 Ga0495684_0067146 3300047471 Bacteria 2727
500 Ga0495684_0091239 3300047471 Bacteria 2308
501 Ga0495593_0013645 3300047673 Bacteria 4629
502 Ga0495593_0015025 3300047673 Bacteria 4397
503 Ga0495593_0021887 3300047673 Bacteria 3567
504 Ga0495602_0024310 3300048088 Bacteria 5879
505 Ga0495602_0177774 3300048088 Bacteria 1645
506 Ga0496100_0245144 3300048903 Bacteria 1323
507 Ga0496101_0057632 3300048904 Bacteria 2810
508 Ga0496102_0024135 3300048905 Bacteria 5404
509 Ga0496102_0238494 3300048905 Bacteria 1715
510 Ga0496102_0243049 3300048905 Bacteria 1697
511 Ga0496103_0011761 3300048906 Bacteria 5192
512 Ga0496104_0000449 3300048907 Bacteria 35646
513 Ga0496104_0002199 3300048907 Bacteria 16874
514 Ga0496104_0009135 3300048907 Bacteria 8813
515 Ga0496104_0013664 3300048907 Bacteria 7320
516 Ga0496104_0085492 3300048907 Bacteria 3011
517 Ga0496104_0184392 3300048907 Bacteria 1997
518 Ga0496105_0002469 3300048908 Bacteria 13385
519 Ga0496105_0006002 3300048908 Bacteria 9278
520 Ga0496105_0009008 3300048908 Bacteria 7787
521 Ga0496105_0068782 3300048908 Bacteria 2926
522 Ga0496105_0091271 3300048908 Bacteria 2515
523 Ga0496106_0001760 3300048909 Bacteria 16160
524 Ga0496106_0022779 3300048909 Bacteria 4653
525 Ga0496106_0022817 3300048909 Bacteria 4649
526 Ga0496107_0033613 3300048910 Bacteria 3670
527 Ga0496107_0326795 3300048910 Bacteria 1141
528 Ga0496108_0002321 3300048911 Bacteria 15223
529 Ga0496108_0010630 3300048911 Bacteria 7466
530 Ga0496108_0087161 3300048911 Bacteria 2651
531 Ga0496109_0033184 3300048912 Bacteria 4643
532 Ga0496110_0004012 3300048913 Bacteria 11346
533 Ga0496110_0006378 3300048913 Bacteria 9328
534 Ga0496110_0014478 3300048913 Bacteria 6552
535 Ga0496110_0130943 3300048913 Bacteria 2265
536 Ga0496110_0167942 3300048913 Bacteria 1990
537 Ga0496110_0256996 3300048913 Bacteria 1590
538 Ga0496111_0005262 3300048914 Bacteria 8258
539 Ga0496111_0046266 3300048914 Bacteria 3133
540 Ga0496111_0066041 3300048914 Bacteria 2626
541 Ga0496111_0110256 3300048914 Bacteria 2027
542 Ga0496112_0007190 3300048915 Bacteria 9862
543 Ga0496112_0028322 3300048915 Bacteria 5406
544 Ga0496112_0062681 3300048915 Bacteria 3668
545 Ga0496113_0184103 3300048916 Bacteria 1656
546 Ga0496113_0195128 3300048916 Bacteria 1608
547 Ga0496114_0031868 3300048917 Bacteria 4337
548 Ga0496115_0029287 3300048918 Bacteria 4323
549 Ga0496115_0032343 3300048918 Bacteria 4127
550 Ga0496116_0002683 3300048919 Bacteria 18391
551 Ga0496116_0013421 3300048919 Bacteria 6606
552 Ga0496116_0017493 3300048919 Bacteria 5560
553 Ga0496116_0023278 3300048919 Bacteria 4616
554 Ga0496116_0037362 3300048919 Bacteria 3387
555 Ga0496116_0064856 3300048919 Bacteria 2345
556 Ga0496117_0001622 3300048920 Bacteria 31785
557 Ga0496117_0008046 3300048920 Bacteria 10108
558 Ga0496117_0008546 3300048920 Bacteria 9710
559 Ga0496117_0049826 3300048920 Bacteria 2974
560 Ga0496117_0062267 3300048920 Bacteria 2557
561 Ga0496117_0065527 3300048920 Bacteria 2469
562 Ga0496117_0066130 3300048920 Bacteria 2453
563 Ga0496118_0000015 3300048921 Bacteria 551359
564 Ga0496118_0005930 3300048921 Bacteria 13661
565 Ga0496119_0000841 3300048922 Bacteria 40637
566 Ga0496119_0001419 3300048922 Bacteria 29009
567 Ga0496119_0003785 3300048922 Bacteria 15466
568 Ga0496119_0010725 3300048922 Bacteria 7680
569 Ga0496120_0001068 3300048923 Bacteria 36230
570 Ga0496120_0003719 3300048923 Bacteria 13569
571 Ga0496120_0006370 3300048923 Bacteria 9077
572 Ga0496120_0018028 3300048923 Bacteria 4561
573 Ga0496120_0018282 3300048923 Bacteria 4523
574 Ga0496120_0018283 3300048923 Bacteria 4523
575 Ga0496121_0004213 3300048924 Bacteria 19602
576 Ga0496121_0004271 3300048924 Bacteria 19402
577 Ga0496121_0006970 3300048924 Bacteria 13755
578 Ga0496121_0008075 3300048924 Bacteria 12536
579 Ga0496121_0034501 3300048924 Bacteria 4553
580 Ga0496121_0174712 3300048924 Bacteria 1556
581 Ga0496122_0000202 3300048925 Bacteria 132984
582 Ga0496122_0000259 3300048925 Bacteria 119366
583 Ga0496122_0001139 3300048925 Bacteria 45609
584 Ga0496122_0008382 3300048925 Bacteria 11170
585 Ga0496122_0012999 3300048925 Bacteria 8207
586 Ga0496122_0014310 3300048925 Bacteria 7680
587 Ga0496122_0024755 3300048925 Bacteria 5242
588 Ga0496122_0030357 3300048925 Bacteria 4529
589 Ga0496122_0033844 3300048925 Bacteria 4194
590 Ga0496122_0039679 3300048925 Bacteria 3751
591 Ga0496122_0175949 3300048925 Bacteria 1282
592 Ga0496123_0000144 3300048926 Bacteria 144603
593 Ga0496123_0000209 3300048926 Bacteria 119480
594 Ga0496123_0001178 3300048926 Bacteria 38532
595 Ga0496123_0006680 3300048926 Bacteria 11118
596 Ga0496123_0008091 3300048926 Bacteria 9725
597 Ga0496123_0008482 3300048926 Bacteria 9434
598 Ga0496123_0015055 3300048926 Bacteria 6369
599 Ga0496123_0077027 3300048926 Bacteria 2050
600 Ga0496123_0100344 3300048926 Bacteria 1686
601 Ga0496123_0130560 3300048926 Bacteria 1392
602 Ga0496124_0005265 3300048927 Bacteria 14637
603 Ga0496124_0014963 3300048927 Bacteria 7468
604 Ga0496124_0030441 3300048927 Bacteria 4790
605 Ga0496124_0045115 3300048927 Bacteria 3779
606 Ga0496124_0065945 3300048927 Bacteria 3017
607 Ga0496124_0138639 3300048927 Bacteria 1922
608 Ga0496124_0158960 3300048927 Bacteria 1764
609 Ga0496124_0175192 3300048927 Bacteria 1656
610 Ga0496125_0000009 3300048928 Bacteria 677678
611 Ga0496125_0004716 3300048928 Bacteria 15541
612 Ga0496125_0004820 3300048928 Bacteria 15335
613 Ga0496125_0005489 3300048928 Bacteria 14066
614 Ga0496125_0061793 3300048928 Bacteria 3001
615 Ga0496125_0081889 3300048928 Bacteria 2463
616 Ga0496126_0000779 3300048929 Bacteria 57561
617 Ga0496126_0003414 3300048929 Bacteria 20080
618 Ga0496126_0039952 3300048929 Bacteria 4350
619 Ga0496126_0045247 3300048929 Bacteria 4046
620 Ga0496126_0070293 3300048929 Bacteria 3119
621 Ga0496126_0078009 3300048929 Bacteria 2935
622 Ga0501305_000167 3300049161 Bacteria 4473
623 Ga0501305_007969 3300049161 Bacteria 1359
624 Ga0495678_004515 3300049459 Bacteria 8024
625 Ga0501312_000134 3300049528 Bacteria 4637
626 Ga0501314_003831 3300049530 Bacteria 1226
627 Ga0501315_005212 3300049531 Bacteria 1399
628 Ga0501316_004946 3300049532 Bacteria 1361
629 Ga0501317_002748 3300049533 Bacteria 1692
630 Ga0501317_005478 3300049533 Bacteria 1361
631 Ga0501323_000290 3300049539 Bacteria 3467
632 Ga0501323_007455 3300049539 Bacteria 1249
633 Ga0501335_004207 3300049551 Bacteria 1250
634 Ga0501031_0004673 3300049568 Bacteria 8892
635 Ga0501032_0000006 3300049569 Bacteria 261727
636 Ga0501032_0000045 3300049569 Bacteria 110632
637 Ga0501032_0004902 3300049569 Bacteria 10016
638 Ga0501033_0000053 3300049570 Bacteria 109042
639 Ga0501033_0036195 3300049570 Bacteria 3700
640 Ga0501033_0278252 3300049570 Bacteria 1182
641 Ga0501034_0000001 3300049571 Bacteria 2184493
642 Ga0501034_0000030 3300049571 Bacteria 248180
643 Ga0501034_0049632 3300049571 Bacteria 4234
644 Ga0501034_0080709 3300049571 Bacteria 3256
645 Ga0501034_0116188 3300049571 Bacteria 2664
646 Ga0501034_0120067 3300049571 Bacteria 2615
647 Ga0501034_0158550 3300049571 Bacteria 2235
648 Ga0501036_0000003 3300049572 Bacteria 261545
649 Ga0501037_0000003 3300049573 Bacteria 261548
650 Ga0501037_0003548 3300049573 Bacteria 11318
651 Ga0501038_0000004 3300049574 Bacteria 261289
652 Ga0501038_0001565 3300049574 Bacteria 21184
653 Ga0501038_0059157 3300049574 Bacteria 3283
654 Ga0501038_0128540 3300049574 Bacteria 2083
655 Ga0501038_0363520 3300049574 Bacteria 1125
656 Ga0501039_0000008 3300049575 Bacteria 274778
657 Ga0501039_0000041 3300049575 Bacteria 113488
658 Ga0501039_0004448 3300049575 Bacteria 10579
659 Ga0501040_0000210 3300049576 Bacteria 34012
660 Ga0501042_0004169 3300049578 Bacteria 9187
661 Ga0501042_0147115 3300049578 Bacteria 1698
662 Ga0501043_0000431 3300049579 Bacteria 37716
663 Ga0501046_0003231 3300049580 Bacteria 14971
664 Ga0501047_0002242 3300049581 Bacteria 18498
665 Ga0501047_0172586 3300049581 Bacteria 2031
666 Ga0501048_0004383 3300049582 Bacteria 10748
667 Ga0501067_0002609 3300049583 Bacteria 9976
668 Ga0501067_0036201 3300049583 Bacteria 2741
669 Ga0501070_0022527 3300049586 Bacteria 5277
670 Ga0501070_0102913 3300049586 Bacteria 2362
671 Ga0501070_0187233 3300049586 Bacteria 1702
672 Ga0501071_0027148 3300049587 Bacteria 4025
673 Ga0501073_0050441 3300049589 Bacteria 2916
674 Ga0501074_0005445 3300049590 Bacteria 9155
675 Ga0501074_0136259 3300049590 Bacteria 1756
676 Ga0501077_0101486 3300049593 Bacteria 1823
677 Ga0501077_0134376 3300049593 Bacteria 1569
678 Ga0501077_0195196 3300049593 Bacteria 1286
679 Ga0501223_000043 3300049663 Bacteria 44137
680 Ga0501224_000019 3300049664 Bacteria 78204
681 Ga0501233_000077 3300049668 Bacteria 13013
682 Ga0501225_0000065 3300049705 Bacteria 34445
683 Ga0501079_0094950 3300049741 Bacteria 2311
684 Ga0501083_0008771 3300049744 Bacteria 7135
685 Ga0501035_0000031 3300049822 Bacteria 175591
686 Ga0501044_0000008 3300049823 Bacteria 274778
687 Ga0501044_0000509 3300049823 Bacteria 47320
688 Ga0501044_0023168 3300049823 Bacteria 6608
689 Ga0501044_0068659 3300049823 Bacteria 3610
690 Ga0501044_0121115 3300049823 Bacteria 2617
691 Ga0501044_0139541 3300049823 Bacteria 2413
692 Ga0501226_000080 3300049853 Bacteria 29131
693 nmdc:mga03683_8756_c1 3300050489 Bacteria 3570
694 nmdc:mga00v17_15936_c1 3300050491 Bacteria 4229
695 nmdc:mga00v17_18634_c1 3300050491 Bacteria 3947
696 nmdc:mga00v17_49332_c1 3300050491 Bacteria 2553
697 nmdc:mga0yw44_3196_c1 3300050492 Bacteria 7210
698 nmdc:mga0yw44_56678_c1 3300050492 Bacteria 2389
699 nmdc:mga0yw44_6604_c1 3300050492 Bacteria 5622
700 nmdc:mga0k408_11707_c1 3300050493 Bacteria 4783
701 nmdc:mga0k408_42615_c1 3300050493 Bacteria 2614
702 nmdc:mga07m45_17202_c1 3300050496 Bacteria 3154
703 nmdc:mga05p37_10714_c1 3300050507 Bacteria 10882
704 nmdc:mga05p37_350142_c1 3300050507 Bacteria 1739
705 nmdc:mga05p37_87537_c1 3300050507 Bacteria 3839
706 nmdc:mga0qj67_43499_c1 3300050509 Bacteria 3537
707 nmdc:mga0qj67_83049_c1 3300050509 Bacteria 2568
708 nmdc:mga06r32_57677_c1 3300050510 Bacteria 3730
709 nmdc:mga06r32_8428_c1 3300050510 Bacteria 9289
710 nmdc:mga06r32_84974_c1 3300050510 Bacteria 3085
711 nmdc:mga08y16_167369_c1 3300050511 Bacteria 2283
712 nmdc:mga08y16_45093_c1 3300050511 Bacteria 4619
713 nmdc:mga08y16_67799_c1 3300050511 Bacteria 3722
714 nmdc:mga08y16_87369_c1 3300050511 Bacteria 3249
715 nmdc:mga0n895_183322_c1 3300050512 Bacteria 2125
716 nmdc:mga0n895_214691_c1 3300050512 Bacteria 1954
717 nmdc:mga0n895_2737_c1 3300050512 Bacteria 13916
718 nmdc:mga0n895_33904_c1 3300050512 Bacteria 4910
719 nmdc:mga0n895_58450_c1 3300050512 Bacteria 3802
720 nmdc:mga0n895_87600_c1 3300050512 Bacteria 3111
721 nmdc:mga0rr50_29874_c1 3300050513 Bacteria 3850
722 nmdc:mga0rr50_81888_c1 3300050513 Bacteria 2492
723 nmdc:mga08x19_60609_c1 3300050514 Bacteria 2451
724 nmdc:mga08x19_6_c2 3300050514 Bacteria 52011
725 nmdc:mga08x19_99118_c1 3300050514 Bacteria 1931
726 nmdc:mga0a205_105164_c1 3300050515 Bacteria 2721
727 nmdc:mga0a205_125132_c1 3300050515 Bacteria 2470
728 nmdc:mga0a205_190609_c1 3300050515 Bacteria 1942
729 nmdc:mga0a205_26885_c1 3300050515 Bacteria 3025
730 nmdc:mga0a205_3402_c1 3300050515 Bacteria 14185
731 Ga0495601_0001526 3300053077 Bacteria 12769
732 Ga0495601_0001594 3300053077 Bacteria 12527
733 Ga0495601_0179478 3300053077 Bacteria 1384
734 Ga0495612_0001337 3300053078 Bacteria 10155
735 Ga0495612_0037001 3300053078 Bacteria 1981
736 Ga0495595_0005548 3300053084 Bacteria 5106
737 Ga0495595_0026650 3300053084 Bacteria 2570
738 Ga0495595_0078953 3300053084 Bacteria 1565
739 Ga0495619_0004091 3300053085 Bacteria 9333
740 Ga0495619_0005185 3300053085 Bacteria 8260
741 Ga0495619_0210745 3300053085 Bacteria 1345
742 Ga0500643_001292 3300053087 Bacteria 14753
743 Ga0500651_0036112 3300053093 Bacteria 3114
744 Ga0500641_0004747 3300053096 Bacteria 4808
745 Ga0500556_0002197 3300053104 Bacteria 6547
746 Ga0500658_0023651 3300053134 Bacteria 2348
747 Ga0500559_0000042 3300053136 Bacteria 101570
748 Ga0500568_0000127 3300053139 Bacteria 68647
749 Ga0500588_0002612 3300053146 Bacteria 3696
750 Ga0500616_0013338 3300053153 Bacteria 4776
751 Ga0500619_003726 3300053154 Bacteria 3169
752 Ga0501084_0000234 3300054114 Bacteria 41758
753 Ga0501084_0069303 3300054114 Bacteria 2953
754 Ga0501084_0087990 3300054114 Bacteria 2608
755 Ga0590074_006728 3300059423 Bacteria 1909
756 Ga0590075_004026 3300059424 Bacteria 3477
757 Ga0590075_016712 3300059424 Bacteria 1806
758 Ga0501082_0017108 3300060353 Bacteria 6247
759 Ga0501082_0017151 3300060353 Bacteria 6238
760 Ga0501082_0030808 3300060353 Bacteria 4624
761 Ga0530510_0196755 3300061734 Bacteria 1497

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042137 Ga0450902_015737 Ga0450902_015737_28_1029 329
2 3300037853 Ga0436364_0992727 Ga0436364_0992727_10_1029 338
3 3300049589 Ga0501073_0050441 Ga0501073_0050441_1860_2876 338
4 3300049574 Ga0501038_0363520 Ga0501038_0363520_90_1115 340
5 3300049571 Ga0501034_0049632 Ga0501034_0049632_1011_2216 344
6 3300005983 Ga0081540_1000060 Ga0081540_100006098 353
7 3300005444 Ga0070694_100058197 Ga0070694_1000581972 359
8 3300005719 Ga0068861_100031979 Ga0068861_1000319791 359
9 3300009094 Ga0111539_10034619 Ga0111539_100346193 359
10 3300042012 Ga0439455_0035371 Ga0439455_0035371_14_1105 359
11 3300048903 Ga0496100_0245144 Ga0496100_0245144_57_1238 359
12 3300048910 Ga0496107_0326795 Ga0496107_0326795_49_1131 359
13 3300048917 Ga0496114_0031868 Ga0496114_0031868_1391_2572 359
14 3300050515 nmdc:mga0a205_3402_c1 nmdc:mga0a205_3402_c1_9300_10487 359
15 3300039062 Ga0400483_011703 Ga0400483_011703_4065_5150 360
16 3300047673 Ga0495593_0013645 Ga0495593_0013645_3530_4615 360
17 3300048924 Ga0496121_0174712 Ga0496121_0174712_424_1506 360
18 3300048925 Ga0496122_0175949 Ga0496122_0175949_140_1222 360
19 3300050515 nmdc:mga0a205_190609_c1 nmdc:mga0a205_190609_c1_537_1724 360
20 3300046694 Ga0495649_0000777 Ga0495649_0000777_15_1103 361
21 3300046694 Ga0495649_0001900 Ga0495649_0001900_15_1103 361
22 3300039062 Ga0400483_144988 Ga0400483_144988_1838_2929 362
23 3300048927 Ga0496124_0065945 Ga0496124_0065945_886_2094 362
24 3300039453 Ga0436362_0660459 Ga0436362_0660459_119_1210 363
25 3300046514 Ga0495618_0095864 Ga0495618_0095864_61_1191 363
26 3300031240 Ga0265320_10000550 Ga0265320_100005506 365
27 3300031711 Ga0265314_10013436 Ga0265314_100134364 365
28 3300053139 Ga0500568_0000127 Ga0500568_0000127_13931_15109 365
29 3300005983 Ga0081540_1043059 Ga0081540_10430592 367
30 3300035088 Ga0373940_0006440 Ga0373940_0006440_161_1348 367
31 3300046491 Ga0495584_0052579 Ga0495584_0052579_410_1600 367
32 3300046681 Ga0495647_0091441 Ga0495647_0091441_125_1228 367
33 3300049569 Ga0501032_0000006 Ga0501032_0000006_43669_45003 367
34 3300049570 Ga0501033_0000053 Ga0501033_0000053_56720_58054 367
35 3300049570 Ga0501033_0278252 Ga0501033_0278252_17_1120 367
36 3300049571 Ga0501034_0000030 Ga0501034_0000030_190127_191461 367
37 3300049572 Ga0501036_0000003 Ga0501036_0000003_216725_218059 367
38 3300049573 Ga0501037_0000003 Ga0501037_0000003_216725_218059 367
39 3300049574 Ga0501038_0000004 Ga0501038_0000004_216725_218059 367
40 3300049575 Ga0501039_0000008 Ga0501039_0000008_216725_218059 367
41 3300049579 Ga0501043_0000431 Ga0501043_0000431_1639_2973 367
42 3300049581 Ga0501047_0002242 Ga0501047_0002242_15614_16948 367
43 3300049822 Ga0501035_0000031 Ga0501035_0000031_117538_118872 367
44 3300049823 Ga0501044_0000008 Ga0501044_0000008_216725_218059 367
45 3300050511 nmdc:mga08y16_167369_c1 nmdc:mga08y16_167369_c1_97_1287 367
46 iso_pu_bacteria 2512047018 2512328703 367
47 3300009147 Ga0114129_10098515 Ga0114129_100985155 368
48 3300047317 Ga0495604_0094935 Ga0495604_0094935_1060_2169 368
49 3300050507 nmdc:mga05p37_350142_c1 nmdc:mga05p37_350142_c1_204_1391 368
50 3300005937 Ga0081455_10000028 Ga0081455_10000028105 371
51 3300035090 Ga0373949_0010649 Ga0373949_0010649_594_1781 371
52 3300035115 Ga0373941_0009585 Ga0373941_0009585_539_1726 371
53 3300035398 Ga0316574_0007076 Ga0316574_0007076_3432_4610 371
54 3300035691 Ga0373931_0002980 Ga0373931_0002980_654_1841 371
55 3300048914 Ga0496111_0046266 Ga0496111_0046266_322_1443 372
56 3300001979 JGI24740J21852_10006911 JGI24740J21852_100069113 373
57 3300005548 Ga0070665_100011615 Ga0070665_1000116158 373
58 3300005614 Ga0068856_100031657 Ga0068856_1000316573 373
59 3300005616 Ga0068852_100018197 Ga0068852_1000181976 373
60 3300006051 Ga0075364_10043851 Ga0075364_100438513 373
61 3300006353 Ga0075370_10014893 Ga0075370_100148933 373
62 3300031852 Ga0307410_10110887 Ga0307410_101108872 373
63 3300031995 Ga0307409_100042898 Ga0307409_1000428982 373
64 3300049571 Ga0501034_0158550 Ga0501034_0158550_907_2091 373
65 3300050491 nmdc:mga00v17_15936_c1 nmdc:mga00v17_15936_c1_1001_2224 373
66 3300050492 nmdc:mga0yw44_6604_c1 nmdc:mga0yw44_6604_c1_1157_2380 373
67 3300050496 nmdc:mga07m45_17202_c1 nmdc:mga07m45_17202_c1_1159_2382 373
68 3300005331 Ga0070670_100045743 Ga0070670_1000457434 374
69 3300005347 Ga0070668_100004391 Ga0070668_1000043917 374
70 3300005618 Ga0068864_100164996 Ga0068864_1001649962 374
71 3300005843 Ga0068860_100007718 Ga0068860_1000077183 374
72 3300005844 Ga0068862_100050025 Ga0068862_1000500252 374
73 3300025925 Ga0207650_10099874 Ga0207650_100998742 374
74 3300025972 Ga0207668_10025508 Ga0207668_100255084 374
75 3300026088 Ga0207641_10165713 Ga0207641_101657132 374
76 3300026118 Ga0207675_100267322 Ga0207675_1002673221 374
77 3300028381 Ga0268264_10049442 Ga0268264_100494422 374
78 3300039450 Ga0436363_0439161 Ga0436363_0439161_254_1426 374
79 3300005455 Ga0070663_100163365 Ga0070663_1001633652 375
80 3300006852 Ga0075433_10011214 Ga0075433_100112143 375
81 3300006871 Ga0075434_100067556 Ga0075434_1000675563 375
82 3300045051 Ga0451576_0000696 Ga0451576_0000696_51246_52427 375
83 3300050511 nmdc:mga08y16_45093_c1 nmdc:mga08y16_45093_c1_288_1475 375
84 3300050512 nmdc:mga0n895_2737_c1 nmdc:mga0n895_2737_c1_8090_9277 375
85 3300005539 Ga0068853_100000230 Ga0068853_1000002305 376
86 3300026041 Ga0207639_10000338 Ga0207639_100003383 376
87 3300026089 Ga0207648_10160414 Ga0207648_101604142 376
88 3300048907 Ga0496104_0009135 Ga0496104_0009135_696_1883 376
89 3300048918 Ga0496115_0032343 Ga0496115_0032343_2788_3975 376
90 iso_pu_bacteria 2687453257 2688065515 376
91 3300005985 Ga0081539_10005453 Ga0081539_1000545310 377
92 3300006038 Ga0075365_10036665 Ga0075365_100366652 377
93 3300035083 Ga0373926_0059021 Ga0373926_0059021_247_1380 377
94 3300045051 Ga0451576_0000051 Ga0451576_0000051_137740_138918 377
95 3300005577 Ga0068857_100006498 Ga0068857_1000064984 379
96 3300025926 Ga0207659_10112886 Ga0207659_101128861 379
97 3300026116 Ga0207674_10004781 Ga0207674_100047815 379
98 3300046506 Ga0495583_0010816 Ga0495583_0010816_4129_5271 379
99 3300005335 Ga0070666_10004186 Ga0070666_100041861 380
100 3300005563 Ga0068855_100161923 Ga0068855_1001619231 380
101 3300025903 Ga0207680_10000192 Ga0207680_1000019216 380
102 3300025949 Ga0207667_10108121 Ga0207667_101081214 380
103 3300048929 Ga0496126_0070293 Ga0496126_0070293_1917_3095 380
104 3300039437 Ga0436365_0924222 Ga0436365_0924222_139_1317 381
105 3300039447 Ga0436361_0984484 Ga0436361_0984484_36_1220 381
106 3300048927 Ga0496124_0158960 Ga0496124_0158960_364_1740 381
107 3300049593 Ga0501077_0134376 Ga0501077_0134376_351_1538 381
108 3300053104 Ga0500556_0002197 Ga0500556_0002197_454_1608 381
109 3300054114 Ga0501084_0087990 Ga0501084_0087990_811_1998 381
110 3300003762 Ga0055542_1000589 Ga0055542_100058912 382
111 3300003763 Ga0055529_1004088 Ga0055529_10040882 382
112 3300003781 Ga0055536_1000461 Ga0055536_10004611 382
113 3300003781 Ga0055536_1000666 Ga0055536_10006661 382
114 3300003791 Ga0055530_10000424 Ga0055530_1000042429 382
115 3300003792 Ga0055540_1000122 Ga0055540_100012252 382
116 3300003794 Ga0055531_10000146 Ga0055531_1000014629 382
117 3300005288 Ga0065714_10084763 Ga0065714_100847632 382
118 3300005440 Ga0070705_100049180 Ga0070705_1000491803 382
119 3300005545 Ga0070695_100010886 Ga0070695_1000108866 382
120 3300006914 Ga0075436_100002374 Ga0075436_10000237415 382
121 3300009011 Ga0105251_10034656 Ga0105251_100346562 382
122 3300009092 Ga0105250_10005639 Ga0105250_100056396 382
123 3300009092 Ga0105250_10043755 Ga0105250_100437552 382
124 3300012498 Ga0157345_1000058 Ga0157345_10000581 382
125 3300013105 Ga0157369_10002217 Ga0157369_1000221719 382
126 3300013105 Ga0157369_10002227 Ga0157369_1000222720 382
127 3300013105 Ga0157369_10298786 Ga0157369_102987862 382
128 3300013105 Ga0157369_10406137 Ga0157369_104061371 382
129 3300017792 Ga0163161_10006599 Ga0163161_100065998 382
130 3300025254 Ga0209148_1000384 Ga0209148_100038423 382
131 3300025272 Ga0209455_1000152 Ga0209455_1000152104 382
132 3300025291 Ga0209675_1005781 Ga0209675_10057815 382
133 3300025292 Ga0209676_1000020 Ga0209676_1000020503 382
134 3300025292 Ga0209676_1000102 Ga0209676_1000102162 382
135 3300025298 Ga0209050_1000105 Ga0209050_1000105162 382
136 3300025303 Ga0209051_1000066 Ga0209051_1000066162 382
137 3300025304 Ga0209257_1000124 Ga0209257_100012428 382
138 3300025711 Ga0207696_1002383 Ga0207696_10023836 382
139 3300025711 Ga0207696_1005207 Ga0207696_10052072 382
140 3300025728 Ga0207655_1007416 Ga0207655_10074163 382
141 3300025735 Ga0207713_1000883 Ga0207713_100088324 382
142 3300030735 Ga0316178_1118621 Ga0316178_111862114 382
143 3300031548 Ga0307408_100006252 Ga0307408_1000062528 382
144 3300031548 Ga0307408_100029279 Ga0307408_1000292793 382
145 3300031911 Ga0307412_10117093 Ga0307412_101170931 382
146 3300032004 Ga0307414_10156780 Ga0307414_101567801 382
147 3300038705 Ga0237819_00896 Ga0237819_00896_3684_4865 382
148 3300041404 Ga0439436_0001265 Ga0439436_0001265_1828_3006 382
149 3300041405 Ga0439438_005534 Ga0439438_005534_707_1888 382
150 3300041405 Ga0439438_006885 Ga0439438_006885_2740_3921 382
151 3300041407 Ga0439447_007714 Ga0439447_007714_1581_2759 382
152 3300042006 Ga0439432_013194 Ga0439432_013194_570_1748 382
153 3300042006 Ga0439432_014713 Ga0439432_014713_1420_2601 382
154 3300042010 Ga0439452_000221 Ga0439452_000221_38994_40175 382
155 3300042435 Ga0439434_0008880 Ga0439434_0008880_815_1993 382
156 3300046458 Ga0495591_003608 Ga0495591_003608_6687_7868 382
157 3300046460 Ga0495638_0007527 Ga0495638_0007527_42_1223 382
158 3300046492 Ga0495585_0002318 Ga0495585_0002318_12481_13662 382
159 3300046501 Ga0495607_0000668 Ga0495607_0000668_32023_33204 382
160 3300046507 Ga0495606_0044385 Ga0495606_0044385_1725_2906 382
161 3300046512 Ga0495610_0004539 Ga0495610_0004539_8959_10140 382
162 3300046530 Ga0495654_0003014 Ga0495654_0003014_9284_10465 382
163 3300046692 Ga0495671_0074401 Ga0495671_0074401_51_1232 382
164 3300046694 Ga0495649_0005219 Ga0495649_0005219_66_1247 382
165 3300048925 Ga0496122_0000259 Ga0496122_0000259_84469_85662 382
166 3300048926 Ga0496123_0000209 Ga0496123_0000209_84498_85691 382
167 3300049459 Ga0495678_004515 Ga0495678_004515_33_1214 382
168 3300050513 nmdc:mga0rr50_29874_c1 nmdc:mga0rr50_29874_c1_2267_3445 382
169 3300050514 nmdc:mga08x19_6_c2 nmdc:mga08x19_6_c2_45196_46374 382
170 3300048923 Ga0496120_0018028 Ga0496120_0018028_1645_2868 383
171 3300048925 Ga0496122_0012999 Ga0496122_0012999_1322_2527 383
172 3300006847 Ga0075431_100087766 Ga0075431_1000877663 384
173 3300049741 Ga0501079_0094950 Ga0501079_0094950_453_1640 384
174 3300050510 nmdc:mga06r32_84974_c1 nmdc:mga06r32_84974_c1_485_1672 384
175 3300060353 Ga0501082_0017108 Ga0501082_0017108_3315_4502 384
176 3300006914 Ga0075436_100043110 Ga0075436_1000431102 385
177 3300007076 Ga0075435_100079607 Ga0075435_1000796072 385
178 3300050512 nmdc:mga0n895_214691_c1 nmdc:mga0n895_214691_c1_566_1741 385
179 3300050514 nmdc:mga08x19_60609_c1 nmdc:mga08x19_60609_c1_776_1951 385
180 3300050515 nmdc:mga0a205_125132_c1 nmdc:mga0a205_125132_c1_1134_2309 385
181 iso_pu_bacteria 2509276019 2509380352 385
182 iso_pu_bacteria 2522572158 2523102757 386
183 iso_pu_bacteria 2671180139 2671693840 386
184 iso_pu_bacteria 2834578030 2834579536 386
185 iso_pu_bacteria 2919138771 2919139565 386
186 3300031727 Ga0316576_10042757 Ga0316576_100427573 387
187 iso_pu_bacteria 2600254943 2600401724 387
188 iso_pu_bacteria 2615840698 2616550830 387
189 iso_pu_bacteria 2841957949 2841964569 387
190 3300005467 Ga0070706_100004372 Ga0070706_1000043726 388
191 3300005468 Ga0070707_100064773 Ga0070707_1000647732 388
192 3300005536 Ga0070697_100127625 Ga0070697_1001276252 388
193 3300025910 Ga0207684_10006877 Ga0207684_100068777 388
194 3300025922 Ga0207646_10026623 Ga0207646_100266234 388
195 3300049586 Ga0501070_0187233 Ga0501070_0187233_449_1663 388
196 iso_pu_bacteria 2609459761 2609914142 388
197 iso_pu_bacteria 2945874760 2945876230 388
198 iso_pu_bacteria 3007855910 3007856383 388
199 iso_pu_bacteria 8057304971 8057305068 388
200 3300005985 Ga0081539_10010261 Ga0081539_100102617 389
201 3300005985 Ga0081539_10015990 Ga0081539_100159904 389
202 3300021361 Ga0213872_10000860 Ga0213872_100008605 389
203 3300031235 Ga0265330_10055322 Ga0265330_100553222 389
204 3300031241 Ga0265325_10058138 Ga0265325_100581382 389
205 3300031249 Ga0265339_10011897 Ga0265339_100118975 389
206 3300031249 Ga0265339_10036463 Ga0265339_100364633 389
207 3300031665 Ga0316575_10017975 Ga0316575_100179752 389
208 3300031711 Ga0265314_10014914 Ga0265314_100149146 389
209 3300031712 Ga0265342_10092051 Ga0265342_100920512 389
210 3300031728 Ga0316578_10000916 Ga0316578_100009166 389
211 3300032002 Ga0307416_100194892 Ga0307416_1001948923 389
212 3300032137 Ga0316585_10015583 Ga0316585_100155832 389
213 3300032139 Ga0316580_10013050 Ga0316580_100130502 389
214 3300035398 Ga0316574_0012119 Ga0316574_0012119_2250_3428 389
215 3300038443 Ga0395901_0085923 Ga0395901_0085923_137_1309 389
216 3300039438 Ga0436360_0886478 Ga0436360_0886478_307_1485 389
217 3300039447 Ga0436361_0453677 Ga0436361_0453677_25395_26564 389
218 3300039447 Ga0436361_1001866 Ga0436361_1001866_20553_21722 389
219 3300045049 Ga0466959_0035190 Ga0466959_0035190_1875_3044 389
220 3300046689 Ga0495613_0001199 Ga0495613_0001199_3905_5074 389
221 3300053136 Ga0500559_0000042 Ga0500559_0000042_85674_86846 389
222 iso_pu_bacteria 2554235234 2555258593 389
223 iso_pu_bacteria 2593339131 2595091378 389
224 iso_pu_bacteria 2599185169 2599408997 389
225 iso_pu_bacteria 2600255254 2601522485 389
226 iso_pu_bacteria 2600255255 2601527512 389
227 iso_pu_bacteria 2600255280 2601614342 389
228 iso_pu_bacteria 2600255281 2601619063 389
229 iso_pu_bacteria 2600255287 2601642325 389
230 iso_pu_bacteria 2600255288 2601647179 389
231 iso_pu_bacteria 2600255289 2601652489 389
232 iso_pu_bacteria 2600255290 2601657816 389
233 iso_pu_bacteria 2600255291 2601662148 389
234 iso_pu_bacteria 2600255298 2601695106 389
235 iso_pu_bacteria 2600255299 2601699778 389
236 iso_pu_bacteria 2600255300 2601706335 389
237 iso_pu_bacteria 2600255301 2601710641 389
238 iso_pu_bacteria 2600255302 2601715655 389
239 iso_pu_bacteria 2600255303 2601720129 389
240 iso_pu_bacteria 2600255304 2601726060 389
241 iso_pu_bacteria 2600255305 2601730601 389
242 iso_pu_bacteria 2600255306 2601735618 389
243 iso_pu_bacteria 2600255307 2601740887 389
244 iso_pu_bacteria 2600255309 2601750817 389
245 iso_pu_bacteria 2600255392 2602018071 389
246 iso_pu_bacteria 2602042047 2603642730 389
247 iso_pu_bacteria 2602042052 2603659511 389
248 iso_pu_bacteria 2602042053 2603664787 389
249 iso_pu_bacteria 2602042067 2603703331 389
250 iso_pu_bacteria 2602042103 2603837993 389
251 iso_pu_bacteria 2602042104 2603843071 389
252 iso_pu_bacteria 2602042105 2603848144 389
253 iso_pu_bacteria 2602042106 2603853215 389
254 iso_pu_bacteria 2602042109 2603867150 389
255 iso_pu_bacteria 2602042110 2603871270 389
256 iso_pu_bacteria 2602042111 2603876192 389
257 iso_pu_bacteria 2603880178 2606048463 389
258 iso_pu_bacteria 2603880184 2606069214 389
259 iso_pu_bacteria 2603880202 2606145030 389
260 iso_pu_bacteria 2603880211 2606175864 389
261 iso_pu_bacteria 2609459761 2609912190 389
262 iso_pu_bacteria 2636415599 2637224901 389
263 iso_pu_bacteria 2667528172 2671103257 389
264 iso_pu_bacteria 2675903046 2676406137 389
265 iso_pu_bacteria 2681812866 2681997605 389
266 iso_pu_bacteria 2681812869 2682006883 389
267 iso_pu_bacteria 2738543017 2739269064 389
268 iso_pu_bacteria 2751185917 2753855684 389
269 iso_pu_bacteria 2765235842 2765588668 389
270 iso_pu_bacteria 2775506706 2775538672 389
271 iso_pu_bacteria 2775507074 2777022071 389
272 iso_pu_bacteria 2775507177 2777761910 389
273 iso_pu_bacteria 2775507192 2777839577 389
274 iso_pu_bacteria 2788500588 2791212505 389
275 iso_pu_bacteria 2818991451 2819626102 389
276 iso_pu_bacteria 2821118458 2821119487 389
277 iso_pu_bacteria 2823373977 2823374455 389
278 iso_pu_bacteria 2844425489 2844427226 389
279 iso_pu_bacteria 2852673933 2852675098 389
280 iso_pu_bacteria 2857586860 2857588011 389
281 iso_pu_bacteria 2904513164 2904514224 389
282 iso_pu_bacteria 2904606771 2904606772 389
283 iso_pu_bacteria 2919108558 2919110462 389
284 iso_pu_bacteria 2923634449 2923634548 389
285 iso_pu_bacteria 2927833300 2927834395 389
286 iso_pu_bacteria 2928510474 2928511811 389
287 iso_pu_bacteria 2936340661 2936345166 389
288 iso_pu_bacteria 2937539931 2937540260 389
289 iso_pu_bacteria 2939573065 2939573629 389
290 iso_pu_bacteria 2939593269 2939593417 389
291 iso_pu_bacteria 2945874760 2945877976 389
292 iso_pu_bacteria 2969079654 2969081884 389
293 iso_pu_bacteria 2971820967 2971821821 389
294 iso_pu_bacteria 2984559226 2984564313 389
295 iso_pu_bacteria 2984595703 2984597045 389
296 iso_pu_bacteria 3000376612 3000376911 389
297 iso_pu_bacteria 8018405270 8018408444 389
298 iso_pu_bacteria 8054844752 8054845071 389
299 iso_pu_bacteria 8055531788 8055533182 389
300 3300001904 JGI24736J21556_1001340 JGI24736J21556_10013403 390
301 3300002067 JGI24735J21928_10001258 JGI24735J21928_100012582 390
302 3300003162 Ga0006778J45830_1026826 Ga0006778J45830_10268261 390
303 3300003320 rootH2_10023994 rootH2_1002399416 390
304 3300003577 Ga0007416J51690_1021970 Ga0007416J51690_10219701 390
305 3300003579 Ga0007429J51699_1018838 Ga0007429J51699_10188381 390
306 3300005289 Ga0065704_10083393 Ga0065704_100833932 390
307 3300005295 Ga0065707_10105464 Ga0065707_101054642 390
308 3300005327 Ga0070658_10006314 Ga0070658_100063147 390
309 3300005328 Ga0070676_10055192 Ga0070676_100551921 390
310 3300005328 Ga0070676_10061532 Ga0070676_100615322 390
311 3300005330 Ga0070690_100049678 Ga0070690_1000496781 390
312 3300005331 Ga0070670_100057539 Ga0070670_1000575394 390
313 3300005336 Ga0070680_100009507 Ga0070680_1000095075 390
314 3300005340 Ga0070689_100015633 Ga0070689_1000156336 390
315 3300005340 Ga0070689_100065480 Ga0070689_1000654804 390
316 3300005345 Ga0070692_10129027 Ga0070692_101290271 390
317 3300005347 Ga0070668_100000707 Ga0070668_10000070720 390
318 3300005364 Ga0070673_100067712 Ga0070673_1000677121 390
319 3300005365 Ga0070688_100022333 Ga0070688_1000223333 390
320 3300005367 Ga0070667_100003824 Ga0070667_1000038246 390
321 3300005434 Ga0070709_10065471 Ga0070709_100654712 390
322 3300005435 Ga0070714_100074276 Ga0070714_1000742762 390
323 3300005436 Ga0070713_100037681 Ga0070713_1000376815 390
324 3300005436 Ga0070713_100051297 Ga0070713_1000512972 390
325 3300005436 Ga0070713_100063212 Ga0070713_1000632122 390
326 3300005437 Ga0070710_10021576 Ga0070710_100215763 390
327 3300005441 Ga0070700_100006997 Ga0070700_1000069974 390
328 3300005444 Ga0070694_100001005 Ga0070694_1000010057 390
329 3300005445 Ga0070708_100026124 Ga0070708_1000261245 390
330 3300005455 Ga0070663_100020685 Ga0070663_1000206854 390
331 3300005458 Ga0070681_10004050 Ga0070681_1000405012 390
332 3300005458 Ga0070681_10078648 Ga0070681_100786482 390
333 3300005458 Ga0070681_10145752 Ga0070681_101457522 390
334 3300005459 Ga0068867_100027781 Ga0068867_1000277813 390
335 3300005466 Ga0070685_10093879 Ga0070685_100938792 390
336 3300005467 Ga0070706_100153608 Ga0070706_1001536082 390
337 3300005518 Ga0070699_100000540 Ga0070699_10000054032 390
338 3300005518 Ga0070699_100184242 Ga0070699_1001842422 390
339 3300005530 Ga0070679_100025738 Ga0070679_1000257382 390
340 3300005530 Ga0070679_100073177 Ga0070679_1000731773 390
341 3300005535 Ga0070684_100100836 Ga0070684_1001008364 390
342 3300005539 Ga0068853_100360062 Ga0068853_1003600621 390
343 3300005545 Ga0070695_100000710 Ga0070695_1000007104 390
344 3300005546 Ga0070696_100000156 Ga0070696_10000015640 390
345 3300005548 Ga0070665_100006587 Ga0070665_1000065875 390
346 3300005563 Ga0068855_100000034 Ga0068855_10000003438 390
347 3300005578 Ga0068854_100106278 Ga0068854_1001062782 390
348 3300005578 Ga0068854_100185818 Ga0068854_1001858182 390
349 3300005617 Ga0068859_100199657 Ga0068859_1001996571 390
350 3300005842 Ga0068858_100037806 Ga0068858_1000378062 390
351 3300005843 Ga0068860_100000351 Ga0068860_10000035120 390
352 3300005843 Ga0068860_100078572 Ga0068860_1000785723 390
353 3300005844 Ga0068862_100024035 Ga0068862_1000240356 390
354 3300005844 Ga0068862_100045374 Ga0068862_1000453741 390
355 3300005844 Ga0068862_100063471 Ga0068862_1000634712 390
356 3300005937 Ga0081455_10001108 Ga0081455_1000110812 390
357 3300005937 Ga0081455_10045047 Ga0081455_100450474 390
358 3300005937 Ga0081455_10100945 Ga0081455_101009452 390
359 3300005981 Ga0081538_10007910 Ga0081538_100079106 390
360 3300005981 Ga0081538_10018206 Ga0081538_100182065 390
361 3300005981 Ga0081538_10020695 Ga0081538_100206954 390
362 3300005985 Ga0081539_10000977 Ga0081539_1000097712 390
363 3300006028 Ga0070717_10024871 Ga0070717_100248714 390
364 3300006028 Ga0070717_10057481 Ga0070717_100574813 390
365 3300006028 Ga0070717_10080726 Ga0070717_100807262 390
366 3300006038 Ga0075365_10009401 Ga0075365_100094016 390
367 3300006048 Ga0075363_100038942 Ga0075363_1000389422 390
368 3300006163 Ga0070715_10015199 Ga0070715_100151994 390
369 3300006173 Ga0070716_100027329 Ga0070716_1000273292 390
370 3300006173 Ga0070716_100216075 Ga0070716_1002160751 390
371 3300006175 Ga0070712_100014972 Ga0070712_1000149722 390
372 3300006175 Ga0070712_100068020 Ga0070712_1000680202 390
373 3300006195 Ga0075366_10017931 Ga0075366_100179312 390
374 3300006353 Ga0075370_10011338 Ga0075370_100113385 390
375 3300006844 Ga0075428_100002387 Ga0075428_10000238710 390
376 3300006844 Ga0075428_100057384 Ga0075428_1000573842 390
377 3300006846 Ga0075430_100060823 Ga0075430_1000608231 390
378 3300006846 Ga0075430_100089607 Ga0075430_1000896074 390
379 3300006847 Ga0075431_100005137 Ga0075431_1000051379 390
380 3300006871 Ga0075434_100091899 Ga0075434_1000918992 390
381 3300006871 Ga0075434_100192022 Ga0075434_1001920222 390
382 3300006931 Ga0097620_100199661 Ga0097620_1001996611 390
383 3300007076 Ga0075435_100029369 Ga0075435_1000293692 390
384 3300007265 Ga0099794_10008524 Ga0099794_100085242 390
385 3300009011 Ga0105251_10001689 Ga0105251_100016893 390
386 3300009093 Ga0105240_10022032 Ga0105240_100220325 390
387 3300009094 Ga0111539_10018998 Ga0111539_100189983 390
388 3300009098 Ga0105245_10005334 Ga0105245_100053349 390
389 3300009147 Ga0114129_10023661 Ga0114129_100236617 390
390 3300009147 Ga0114129_10032683 Ga0114129_100326835 390
391 3300009147 Ga0114129_10040156 Ga0114129_100401563 390
392 3300009174 Ga0105241_10016604 Ga0105241_100166042 390
393 3300009177 Ga0105248_10000001 Ga0105248_10000001573 390
394 3300009177 Ga0105248_10024110 Ga0105248_100241107 390
395 3300009177 Ga0105248_10069958 Ga0105248_100699583 390
396 3300009553 Ga0105249_10299309 Ga0105249_102993091 390
397 3300009978 Ga0105148_100251 Ga0105148_1002518 390
398 3300010159 Ga0099796_10000988 Ga0099796_100009885 390
399 3300010159 Ga0099796_10004076 Ga0099796_100040764 390
400 3300011119 Ga0105246_10004282 Ga0105246_100042823 390
401 3300013104 Ga0157370_10110370 Ga0157370_101103702 390
402 3300013296 Ga0157374_10098952 Ga0157374_100989522 390
403 3300013306 Ga0163162_10201294 Ga0163162_102012942 390
404 3300013307 Ga0157372_10337573 Ga0157372_103375732 390
405 3300013308 Ga0157375_10254859 Ga0157375_102548592 390
406 3300014325 Ga0163163_10245913 Ga0163163_102459131 390
407 3300014497 Ga0182008_10101987 Ga0182008_101019871 390
408 3300020070 Ga0206356_10667046 Ga0206356_106670462 390
409 3300021361 Ga0213872_10022550 Ga0213872_100225502 390
410 3300023672 Ga0247553_100221 Ga0247553_1002211 390
411 3300024227 Ga0228598_1000875 Ga0228598_10008757 390
412 3300025735 Ga0207713_1000370 Ga0207713_100037016 390
413 3300025885 Ga0207653_10000724 Ga0207653_100007241 390
414 3300025898 Ga0207692_10022673 Ga0207692_100226732 390
415 3300025898 Ga0207692_10095516 Ga0207692_100955161 390
416 3300025901 Ga0207688_10006050 Ga0207688_100060502 390
417 3300025905 Ga0207685_10004693 Ga0207685_100046932 390
418 3300025906 Ga0207699_10158718 Ga0207699_101587182 390
419 3300025907 Ga0207645_10046281 Ga0207645_100462814 390
420 3300025910 Ga0207684_10033976 Ga0207684_100339762 390
421 3300025912 Ga0207707_10013817 Ga0207707_100138177 390
422 3300025912 Ga0207707_10019402 Ga0207707_100194025 390
423 3300025913 Ga0207695_10141179 Ga0207695_101411792 390
424 3300025915 Ga0207693_10002296 Ga0207693_100022962 390
425 3300025915 Ga0207693_10024341 Ga0207693_100243412 390
426 3300025915 Ga0207693_10049456 Ga0207693_100494562 390
427 3300025915 Ga0207693_10064671 Ga0207693_100646712 390
428 3300025916 Ga0207663_10019794 Ga0207663_100197943 390
429 3300025917 Ga0207660_10003986 Ga0207660_100039862 390
430 3300025917 Ga0207660_10184586 Ga0207660_101845862 390
431 3300025925 Ga0207650_10002443 Ga0207650_100024438 390
432 3300025927 Ga0207687_10066936 Ga0207687_100669362 390
433 3300025928 Ga0207700_10007976 Ga0207700_100079765 390
434 3300025928 Ga0207700_10075251 Ga0207700_100752512 390
435 3300025928 Ga0207700_10301932 Ga0207700_103019321 390
436 3300025929 Ga0207664_10079190 Ga0207664_100791902 390
437 3300025936 Ga0207670_10009459 Ga0207670_100094592 390
438 3300025936 Ga0207670_10016209 Ga0207670_100162092 390
439 3300025936 Ga0207670_10170450 Ga0207670_101704501 390
440 3300025939 Ga0207665_10000117 Ga0207665_1000011747 390
441 3300025939 Ga0207665_10272203 Ga0207665_102722031 390
442 3300025940 Ga0207691_10133928 Ga0207691_101339282 390
443 3300025941 Ga0207711_10000001 Ga0207711_100000011297 390
444 3300025941 Ga0207711_10013853 Ga0207711_100138537 390
445 3300025960 Ga0207651_10014448 Ga0207651_100144482 390
446 3300025961 Ga0207712_10014325 Ga0207712_100143254 390
447 3300025972 Ga0207668_10000002 Ga0207668_10000002107 390
448 3300025972 Ga0207668_10033453 Ga0207668_100334532 390
449 3300025981 Ga0207640_10073191 Ga0207640_100731912 390
450 3300025981 Ga0207640_10096434 Ga0207640_100964342 390
451 3300026035 Ga0207703_10003659 Ga0207703_100036592 390
452 3300026041 Ga0207639_10017877 Ga0207639_100178775 390
453 3300026067 Ga0207678_10029207 Ga0207678_100292073 390
454 3300026075 Ga0207708_10013835 Ga0207708_100138352 390
455 3300026089 Ga0207648_10040324 Ga0207648_100403243 390
456 3300026116 Ga0207674_10013979 Ga0207674_100139796 390
457 3300026142 Ga0207698_10142237 Ga0207698_101422372 390
458 3300027312 Ga0209371_1006607 Ga0209371_10066073 390
459 3300027866 Ga0209813_10012558 Ga0209813_100125583 390
460 3300027876 Ga0209974_10026553 Ga0209974_100265532 390
461 3300028379 Ga0268266_10000811 Ga0268266_1000081137 390
462 3300028380 Ga0268265_10006024 Ga0268265_100060246 390
463 3300028381 Ga0268264_10000749 Ga0268264_1000074917 390
464 3300028381 Ga0268264_10035403 Ga0268264_100354033 390
465 3300028786 Ga0307517_10008180 Ga0307517_1000818014 390
466 3300030500 Ga0268256_1006662 Ga0268256_10066623 390
467 3300031240 Ga0265320_10000039 Ga0265320_1000003968 390
468 3300031241 Ga0265325_10048989 Ga0265325_100489892 390
469 3300031247 Ga0265340_10040691 Ga0265340_100406912 390
470 3300031456 Ga0307513_10000077 Ga0307513_1000007789 390
471 3300031711 Ga0265314_10019715 Ga0265314_100197153 390
472 3300031731 Ga0307405_10082306 Ga0307405_100823062 390
473 3300031852 Ga0307410_10023315 Ga0307410_100233152 390
474 3300031852 Ga0307410_10154752 Ga0307410_101547522 390
475 3300031911 Ga0307412_10085309 Ga0307412_100853092 390
476 3300031995 Ga0307409_100219446 Ga0307409_1002194462 390
477 3300032002 Ga0307416_100053199 Ga0307416_1000531992 390
478 3300032120 Ga0316053_101354 Ga0316053_1013541 390
479 3300035083 Ga0373926_0013371 Ga0373926_0013371_423_1601 390
480 3300035089 Ga0373944_0002385 Ga0373944_0002385_1076_2251 390
481 3300035111 Ga0373923_0009386 Ga0373923_0009386_1567_2814 390
482 3300035112 Ga0373932_0011803 Ga0373932_0011803_77_1330 390
483 3300035114 Ga0373939_0019131 Ga0373939_0019131_114_1289 390
484 3300035119 Ga0373956_0012242 Ga0373956_0012242_461_1708 390
485 3300035119 Ga0373956_0052707 Ga0373956_0052707_99_1286 390
486 3300035170 Ga0373943_0007037 Ga0373943_0007037_936_2111 390
487 3300035172 Ga0373955_0026576 Ga0373955_0026576_1146_2393 390
488 3300035241 Ga0373961_0004207 Ga0373961_0004207_1091_2266 390
489 3300035410 Ga0373924_0051158 Ga0373924_0051158_453_1628 390
490 3300035691 Ga0373931_0009777 Ga0373931_0009777_2850_4025 390
491 3300035692 Ga0373935_0001583 Ga0373935_0001583_1422_2597 390
492 3300035692 Ga0373935_0003507 Ga0373935_0003507_7269_8447 390
493 3300035692 Ga0373935_0052567 Ga0373935_0052567_614_1861 390
494 3300035695 Ga0373927_0000243 Ga0373927_0000243_10669_11844 390
495 3300035695 Ga0373927_0050482 Ga0373927_0050482_1213_2388 390
496 3300035724 Ga0373933_0008345 Ga0373933_0008345_1949_3136 390
497 3300035724 Ga0373933_0039115 Ga0373933_0039115_1177_2352 390
498 3300035724 Ga0373933_0075339 Ga0373933_0075339_589_1836 390
499 3300035725 Ga0373947_0006288 Ga0373947_0006288_4818_5993 390
500 3300036401 Ga0373937_0014589 Ga0373937_0014589_297_1472 390
501 3300036401 Ga0373937_0041928 Ga0373937_0041928_2622_3869 390
502 3300036401 Ga0373937_0057447 Ga0373937_0057447_1051_2238 390
503 3300036647 Ga0316582_0039051 Ga0316582_0039051_933_2129 390
504 3300037068 Ga0373925_0102445 Ga0373925_0102445_152_1327 390
505 3300037466 Ga0395898_0041459 Ga0395898_0041459_2178_3353 390
506 3300037853 Ga0436364_0777042 Ga0436364_0777042_61_1236 390
507 3300037853 Ga0436364_0943381 Ga0436364_0943381_794_1981 390
508 3300039437 Ga0436365_1805879 Ga0436365_1805879_1298_2473 390
509 3300039450 Ga0436363_0452161 Ga0436363_0452161_53_1225 390
510 3300039450 Ga0436363_1190291 Ga0436363_1190291_115_1359 390
511 3300042008 Ga0439450_000469 Ga0439450_000469_1587_2792 390
512 3300042139 Ga0450904_001512 Ga0450904_001512_819_2024 390
513 3300042530 Ga0450916_001727 Ga0450916_001727_598_1803 390
514 3300044712 Ga0453684_0011998 Ga0453684_0011998_9700_10872 390
515 3300044712 Ga0453684_0244145 Ga0453684_0244145_503_1789 390
516 3300044901 Ga0466960_0136396 Ga0466960_0136396_76_1281 390
517 3300046459 Ga0495629_0029522 Ga0495629_0029522_2359_3534 390
518 3300046461 Ga0495641_0042091 Ga0495641_0042091_107_1285 390
519 3300046462 Ga0495651_0019514 Ga0495651_0019514_299_1474 390
520 3300046462 Ga0495651_0130188 Ga0495651_0130188_294_1469 390
521 3300046463 Ga0495653_0027546 Ga0495653_0027546_3268_4443 390
522 3300046472 Ga0495580_0046745 Ga0495580_0046745_139_1317 390
523 3300046476 Ga0495662_0025639 Ga0495662_0025639_161_1336 390
524 3300046476 Ga0495662_0053389 Ga0495662_0053389_367_1545 390
525 3300046477 Ga0495664_0069604 Ga0495664_0069604_397_1575 390
526 3300046491 Ga0495584_0020115 Ga0495584_0020115_901_2076 390
527 3300046506 Ga0495583_0000447 Ga0495583_0000447_55186_56358 390
528 3300046511 Ga0495608_0061405 Ga0495608_0061405_1213_2388 390
529 3300046514 Ga0495618_0131624 Ga0495618_0131624_304_1482 390
530 3300046516 Ga0495628_0045518 Ga0495628_0045518_250_1425 390
531 3300046529 Ga0495652_0077715 Ga0495652_0077715_453_1628 390
532 3300046529 Ga0495652_0094290 Ga0495652_0094290_11_1186 390
533 3300046533 Ga0495640_0005373 Ga0495640_0005373_8134_9309 390
534 3300046533 Ga0495640_0061829 Ga0495640_0061829_69_1247 390
535 3300046536 Ga0495587_0018878 Ga0495587_0018878_1682_2857 390
536 3300046536 Ga0495587_0069761 Ga0495587_0069761_348_1574 390
537 3300046543 Ga0495645_0001277 Ga0495645_0001277_14941_16116 390
538 3300046559 Ga0495667_0128996 Ga0495667_0128996_250_1428 390
539 3300046642 Ga0495634_0066926 Ga0495634_0066926_663_1841 390
540 3300046663 Ga0495635_0020720 Ga0495635_0020720_88_1266 390
541 3300046678 Ga0495599_0033264 Ga0495599_0033264_2027_3202 390
542 3300046680 Ga0495646_0031506 Ga0495646_0031506_465_1640 390
543 3300046683 Ga0495658_0075819 Ga0495658_0075819_72_1247 390
544 3300046689 Ga0495613_0187394 Ga0495613_0187394_104_1279 390
545 3300046809 Ga0495600_0068905 Ga0495600_0068905_1085_2260 390
546 3300047317 Ga0495604_0024793 Ga0495604_0024793_2309_3484 390
547 3300047317 Ga0495604_0203218 Ga0495604_0203218_43_1218 390
548 3300047319 Ga0495674_0002065 Ga0495674_0002065_13754_14929 390
549 3300047319 Ga0495674_0018921 Ga0495674_0018921_3257_4435 390
550 3300047319 Ga0495674_0109410 Ga0495674_0109410_344_1519 390
551 3300047321 Ga0495676_0124179 Ga0495676_0124179_686_1861 390
552 3300047322 Ga0495680_0074380 Ga0495680_0074380_214_1389 390
553 3300047444 Ga0495675_0059761 Ga0495675_0059761_1023_2198 390
554 3300047471 Ga0495684_0014934 Ga0495684_0014934_1511_2686 390
555 3300047471 Ga0495684_0067146 Ga0495684_0067146_182_1357 390
556 3300047471 Ga0495684_0091239 Ga0495684_0091239_896_2071 390
557 3300047673 Ga0495593_0015025 Ga0495593_0015025_1430_2605 390
558 3300047673 Ga0495593_0021887 Ga0495593_0021887_2173_3351 390
559 3300048088 Ga0495602_0024310 Ga0495602_0024310_4055_5230 390
560 3300048088 Ga0495602_0177774 Ga0495602_0177774_79_1269 390
561 3300048904 Ga0496101_0057632 Ga0496101_0057632_167_1342 390
562 3300048905 Ga0496102_0024135 Ga0496102_0024135_4087_5274 390
563 3300048905 Ga0496102_0238494 Ga0496102_0238494_192_1367 390
564 3300048905 Ga0496102_0243049 Ga0496102_0243049_242_1417 390
565 3300048906 Ga0496103_0011761 Ga0496103_0011761_2526_3713 390
566 3300048907 Ga0496104_0002199 Ga0496104_0002199_7817_9004 390
567 3300048907 Ga0496104_0013664 Ga0496104_0013664_1627_2805 390
568 3300048907 Ga0496104_0085492 Ga0496104_0085492_893_2080 390
569 3300048908 Ga0496105_0002469 Ga0496105_0002469_8355_9542 390
570 3300048908 Ga0496105_0006002 Ga0496105_0006002_7070_8248 390
571 3300048908 Ga0496105_0091271 Ga0496105_0091271_167_1342 390
572 3300048909 Ga0496106_0001760 Ga0496106_0001760_4114_5301 390
573 3300048909 Ga0496106_0022779 Ga0496106_0022779_3248_4423 390
574 3300048909 Ga0496106_0022817 Ga0496106_0022817_955_2241 390
575 3300048910 Ga0496107_0033613 Ga0496107_0033613_675_1853 390
576 3300048911 Ga0496108_0002321 Ga0496108_0002321_10475_11662 390
577 3300048911 Ga0496108_0010630 Ga0496108_0010630_5727_7043 390
578 3300048911 Ga0496108_0087161 Ga0496108_0087161_436_1611 390
579 3300048912 Ga0496109_0033184 Ga0496109_0033184_511_1698 390
580 3300048913 Ga0496110_0004012 Ga0496110_0004012_2988_4175 390
581 3300048913 Ga0496110_0006378 Ga0496110_0006378_7583_8827 390
582 3300048913 Ga0496110_0014478 Ga0496110_0014478_3439_4614 390
583 3300048913 Ga0496110_0167942 Ga0496110_0167942_615_1820 390
584 3300048913 Ga0496110_0256996 Ga0496110_0256996_28_1203 390
585 3300048914 Ga0496111_0005262 Ga0496111_0005262_5660_6847 390
586 3300048914 Ga0496111_0066041 Ga0496111_0066041_1271_2446 390
587 3300048914 Ga0496111_0110256 Ga0496111_0110256_566_1852 390
588 3300048915 Ga0496112_0007190 Ga0496112_0007190_5775_6950 390
589 3300048915 Ga0496112_0028322 Ga0496112_0028322_2137_3312 390
590 3300048915 Ga0496112_0062681 Ga0496112_0062681_502_1677 390
591 3300048916 Ga0496113_0184103 Ga0496113_0184103_292_1467 390
592 3300048918 Ga0496115_0029287 Ga0496115_0029287_2255_3430 390
593 3300049530 Ga0501314_003831 Ga0501314_003831_19_1191 390
594 3300049568 Ga0501031_0004673 Ga0501031_0004673_106_1281 390
595 3300049569 Ga0501032_0000045 Ga0501032_0000045_25310_26530 390
596 3300049569 Ga0501032_0004902 Ga0501032_0004902_838_2013 390
597 3300049570 Ga0501033_0036195 Ga0501033_0036195_1468_2664 390
598 3300049571 Ga0501034_0000001 Ga0501034_0000001_1851183_1852403 390
599 3300049571 Ga0501034_0080709 Ga0501034_0080709_1227_2402 390
600 3300049571 Ga0501034_0116188 Ga0501034_0116188_682_1857 390
601 3300049571 Ga0501034_0120067 Ga0501034_0120067_1422_2594 390
602 3300049573 Ga0501037_0003548 Ga0501037_0003548_8792_9967 390
603 3300049574 Ga0501038_0001565 Ga0501038_0001565_7872_9047 390
604 3300049574 Ga0501038_0059157 Ga0501038_0059157_1338_2513 390
605 3300049574 Ga0501038_0128540 Ga0501038_0128540_835_2025 390
606 3300049575 Ga0501039_0000041 Ga0501039_0000041_70326_71546 390
607 3300049575 Ga0501039_0004448 Ga0501039_0004448_8294_9469 390
608 3300049580 Ga0501046_0003231 Ga0501046_0003231_4826_6001 390
609 3300049581 Ga0501047_0172586 Ga0501047_0172586_216_1391 390
610 3300049582 Ga0501048_0004383 Ga0501048_0004383_8109_9284 390
611 3300049583 Ga0501067_0002609 Ga0501067_0002609_5173_6348 390
612 3300049583 Ga0501067_0036201 Ga0501067_0036201_1320_2498 390
613 3300049586 Ga0501070_0022527 Ga0501070_0022527_3958_5133 390
614 3300049586 Ga0501070_0102913 Ga0501070_0102913_1005_2180 390
615 3300049587 Ga0501071_0027148 Ga0501071_0027148_2271_3446 390
616 3300049590 Ga0501074_0005445 Ga0501074_0005445_397_1572 390
617 3300049590 Ga0501074_0136259 Ga0501074_0136259_174_1349 390
618 3300049593 Ga0501077_0101486 Ga0501077_0101486_335_1510 390
619 3300049593 Ga0501077_0195196 Ga0501077_0195196_47_1222 390
620 3300049663 Ga0501223_000043 Ga0501223_000043_20868_22040 390
621 3300049664 Ga0501224_000019 Ga0501224_000019_55709_56881 390
622 3300049668 Ga0501233_000077 Ga0501233_000077_6224_7396 390
623 3300049705 Ga0501225_0000065 Ga0501225_0000065_20758_21930 390
624 3300049744 Ga0501083_0008771 Ga0501083_0008771_4076_5251 390
625 3300049823 Ga0501044_0000509 Ga0501044_0000509_12830_14005 390
626 3300049823 Ga0501044_0023168 Ga0501044_0023168_3730_4905 390
627 3300049823 Ga0501044_0068659 Ga0501044_0068659_1422_2612 390
628 3300049823 Ga0501044_0121115 Ga0501044_0121115_1080_2255 390
629 3300049823 Ga0501044_0139541 Ga0501044_0139541_243_1514 390
630 3300049853 Ga0501226_000080 Ga0501226_000080_7208_8380 390
631 3300050489 nmdc:mga03683_8756_c1 nmdc:mga03683_8756_c1_1733_2908 390
632 3300050491 nmdc:mga00v17_18634_c1 nmdc:mga00v17_18634_c1_1067_2242 390
633 3300050491 nmdc:mga00v17_49332_c1 nmdc:mga00v17_49332_c1_572_1756 390
634 3300050492 nmdc:mga0yw44_3196_c1 nmdc:mga0yw44_3196_c1_2629_3804 390
635 3300050492 nmdc:mga0yw44_56678_c1 nmdc:mga0yw44_56678_c1_1029_2204 390
636 3300050493 nmdc:mga0k408_11707_c1 nmdc:mga0k408_11707_c1_1306_2481 390
637 3300050493 nmdc:mga0k408_42615_c1 nmdc:mga0k408_42615_c1_538_1713 390
638 3300050507 nmdc:mga05p37_10714_c1 nmdc:mga05p37_10714_c1_2814_3989 390
639 3300050507 nmdc:mga05p37_87537_c1 nmdc:mga05p37_87537_c1_1217_2419 390
640 3300050509 nmdc:mga0qj67_43499_c1 nmdc:mga0qj67_43499_c1_252_1439 390
641 3300050509 nmdc:mga0qj67_83049_c1 nmdc:mga0qj67_83049_c1_83_1258 390
642 3300050510 nmdc:mga06r32_57677_c1 nmdc:mga06r32_57677_c1_2352_3527 390
643 3300050510 nmdc:mga06r32_8428_c1 nmdc:mga06r32_8428_c1_6482_7669 390
644 3300050511 nmdc:mga08y16_67799_c1 nmdc:mga08y16_67799_c1_1474_2661 390
645 3300050511 nmdc:mga08y16_87369_c1 nmdc:mga08y16_87369_c1_1230_2429 390
646 3300050512 nmdc:mga0n895_183322_c1 nmdc:mga0n895_183322_c1_546_1721 390
647 3300050512 nmdc:mga0n895_33904_c1 nmdc:mga0n895_33904_c1_322_1545 390
648 3300050512 nmdc:mga0n895_58450_c1 nmdc:mga0n895_58450_c1_610_1896 390
649 3300050512 nmdc:mga0n895_87600_c1 nmdc:mga0n895_87600_c1_1729_2973 390
650 3300050513 nmdc:mga0rr50_81888_c1 nmdc:mga0rr50_81888_c1_578_1864 390
651 3300050514 nmdc:mga08x19_99118_c1 nmdc:mga08x19_99118_c1_461_1711 390
652 3300053077 Ga0495601_0001526 Ga0495601_0001526_6727_7902 390
653 3300053077 Ga0495601_0001594 Ga0495601_0001594_6267_7445 390
654 3300053077 Ga0495601_0179478 Ga0495601_0179478_162_1337 390
655 3300053078 Ga0495612_0001337 Ga0495612_0001337_189_1364 390
656 3300053078 Ga0495612_0037001 Ga0495612_0037001_169_1344 390
657 3300053084 Ga0495595_0005548 Ga0495595_0005548_394_1572 390
658 3300053084 Ga0495595_0026650 Ga0495595_0026650_716_1891 390
659 3300053084 Ga0495595_0078953 Ga0495595_0078953_370_1545 390
660 3300053085 Ga0495619_0004091 Ga0495619_0004091_7602_8780 390
661 3300053085 Ga0495619_0005185 Ga0495619_0005185_4360_5535 390
662 3300053085 Ga0495619_0210745 Ga0495619_0210745_158_1333 390
663 3300053087 Ga0500643_001292 Ga0500643_001292_12403_13578 390
664 3300053093 Ga0500651_0036112 Ga0500651_0036112_1113_2285 390
665 3300053096 Ga0500641_0004747 Ga0500641_0004747_2545_3720 390
666 3300053134 Ga0500658_0023651 Ga0500658_0023651_1124_2302 390
667 3300053146 Ga0500588_0002612 Ga0500588_0002612_774_1949 390
668 3300053153 Ga0500616_0013338 Ga0500616_0013338_637_1818 390
669 3300053154 Ga0500619_003726 Ga0500619_003726_1274_2449 390
670 3300054114 Ga0501084_0000234 Ga0501084_0000234_1765_2937 390
671 3300054114 Ga0501084_0069303 Ga0501084_0069303_834_2009 390
672 3300059424 Ga0590075_016712 Ga0590075_016712_258_1463 390
673 3300060353 Ga0501082_0017151 Ga0501082_0017151_4717_5892 390
674 3300060353 Ga0501082_0030808 Ga0501082_0030808_3031_4206 390
675 3300061734 Ga0530510_0196755 Ga0530510_0196755_13_1188 390
676 iso_pu_bacteria 2510917027 2511180339 390
677 iso_pu_bacteria 2643221732 2644724222 390
678 iso_pu_bacteria 2818991465 2819709379 390
679 iso_pu_bacteria 2857460504 2857460768 390
680 iso_pu_bacteria 2857465823 2857471243 390
681 iso_pu_bacteria 2857591370 2857595433 390
682 iso_pu_bacteria 2881644220 2881644282 390
683 iso_pu_bacteria 2915597211 2915597836 390
684 iso_pu_bacteria 2915606848 2915610581 390
685 iso_pu_bacteria 2919138771 2919140319 390
686 iso_pu_bacteria 2919414237 2919414354 390
687 iso_pu_bacteria 2919720352 2919723097 390
688 iso_pu_bacteria 2929004312 2929006248 390
689 iso_pu_bacteria 2929183550 2929189345 390
690 iso_pu_bacteria 2960319331 2960319997 390
691 iso_pu_bacteria 8022948649 8022949707 390
692 3300005337 Ga0070682_100059039 Ga0070682_1000590392 391
693 3300005981 Ga0081538_10024985 Ga0081538_100249852 391
694 3300006844 Ga0075428_100002525 Ga0075428_1000025253 391
695 3300006852 Ga0075433_10122881 Ga0075433_101228812 391
696 3300031548 Ga0307408_100058061 Ga0307408_1000580613 391
697 3300032002 Ga0307416_100087297 Ga0307416_1000872974 391
698 3300039093 Ga0400489_33857 Ga0400489_33857_856_2061 391
699 3300042010 Ga0439452_001405 Ga0439452_001405_6880_8058 391
700 3300050515 nmdc:mga0a205_105164_c1 nmdc:mga0a205_105164_c1_693_1871 391
701 3300050515 nmdc:mga0a205_26885_c1 nmdc:mga0a205_26885_c1_508_1686 391
702 3300059423 Ga0590074_006728 Ga0590074_006728_320_1534 391
703 3300059424 Ga0590075_004026 Ga0590075_004026_1082_2296 391
704 iso_pu_bacteria 2744054657 2745166031 391
705 iso_pu_bacteria 2816332336 2817620822 391
706 3300003187 JGI25151J46595_10000302 JGI25151J46595_100003023 392
707 3300003187 JGI25151J46595_10002958 JGI25151J46595_100029587 392
708 3300003187 JGI25151J46595_10007108 JGI25151J46595_100071085 392
709 3300003187 JGI25151J46595_10039571 JGI25151J46595_100395712 392
710 3300003758 Ga0055532_1000060 Ga0055532_10000609 392
711 3300003758 Ga0055532_1001176 Ga0055532_10011766 392
712 3300003856 Ga0058692_1000622 Ga0058692_10006225 392
713 3300013105 Ga0157369_10007939 Ga0157369_100079391 392
714 3300021384 Ga0213876_10000103 Ga0213876_1000010326 392
715 3300025224 Ga0209784_100118 Ga0209784_1001183 392
716 3300025229 Ga0209147_100080 Ga0209147_100080142 392
717 3300025229 Ga0209147_100101 Ga0209147_100101147 392
718 3300025292 Ga0209676_1000427 Ga0209676_100042745 392
719 3300025292 Ga0209676_1001194 Ga0209676_100119421 392
720 3300025294 Ga0209025_1000262 Ga0209025_1000262147 392
721 3300025294 Ga0209025_1002935 Ga0209025_100293516 392
722 3300025294 Ga0209025_1004102 Ga0209025_10041024 392
723 3300025294 Ga0209025_1005174 Ga0209025_10051747 392
724 3300025294 Ga0209025_1008076 Ga0209025_10080768 392
725 3300025728 Ga0207655_1026537 Ga0207655_10265372 392
726 3300027312 Ga0209371_1000020 Ga0209371_1000020371 392
727 3300030500 Ga0268256_1000057 Ga0268256_1000057207 392
728 3300031238 Ga0265332_10001502 Ga0265332_1000150211 392
729 3300031711 Ga0265314_10097843 Ga0265314_100978432 392
730 3300031712 Ga0265342_10008983 Ga0265342_100089832 392
731 3300031727 Ga0316576_10034845 Ga0316576_100348452 392
732 3300031727 Ga0316576_10155394 Ga0316576_101553942 392
733 3300031728 Ga0316578_10014050 Ga0316578_100140505 392
734 3300031728 Ga0316578_10092765 Ga0316578_100927652 392
735 3300032139 Ga0316580_10011049 Ga0316580_100110494 392
736 3300033528 Ga0316588_1010906 Ga0316588_10109062 392
737 3300033541 Ga0316596_1007729 Ga0316596_10077295 392
738 3300035398 Ga0316574_0006329 Ga0316574_0006329_4135_5316 392
739 3300036647 Ga0316582_0100345 Ga0316582_0100345_597_1787 392
740 3300036712 Ga0316584_0020718 Ga0316584_0020718_1799_3010 392
741 3300036712 Ga0316584_0044039 Ga0316584_0044039_173_1384 392
742 3300039062 Ga0400483_150944 Ga0400483_150944_6393_7586 392
743 3300039437 Ga0436365_1861022 Ga0436365_1861022_41409_42590 392
744 3300044673 Ga0453683_0005602 Ga0453683_0005602_6821_8002 392
745 3300044712 Ga0453684_0003922 Ga0453684_0003922_13422_14603 392
746 3300044712 Ga0453684_0048239 Ga0453684_0048239_355_1533 392
747 3300044712 Ga0453684_0278560 Ga0453684_0278560_325_1506 392
748 3300045051 Ga0451576_0000016 Ga0451576_0000016_480461_481639 392
749 3300045051 Ga0451576_0013071 Ga0451576_0013071_899_2080 392
750 3300046558 Ga0495633_0024969 Ga0495633_0024969_291_1478 392
751 3300047323 Ga0495683_0022584 Ga0495683_0022584_655_1842 392
752 3300048913 Ga0496110_0130943 Ga0496110_0130943_928_2133 392
753 3300048916 Ga0496113_0195128 Ga0496113_0195128_139_1374 392
754 3300048925 Ga0496122_0001139 Ga0496122_0001139_38893_40074 392
755 3300048926 Ga0496123_0001178 Ga0496123_0001178_31814_32995 392
756 3300049161 Ga0501305_000167 Ga0501305_000167_456_1643 392
757 3300049161 Ga0501305_007969 Ga0501305_007969_27_1217 392
758 3300049528 Ga0501312_000134 Ga0501312_000134_2816_4003 392
759 3300049531 Ga0501315_005212 Ga0501315_005212_27_1217 392
760 3300049532 Ga0501316_004946 Ga0501316_004946_28_1218 392
761 3300049533 Ga0501317_002748 Ga0501317_002748_53_1240 392
762 3300049533 Ga0501317_005478 Ga0501317_005478_28_1218 392
763 3300049539 Ga0501323_000290 Ga0501323_000290_605_1792 392
764 3300049539 Ga0501323_007455 Ga0501323_007455_31_1221 392
765 3300049551 Ga0501335_004207 Ga0501335_004207_26_1216 392
766 3300049576 Ga0501040_0000210 Ga0501040_0000210_13848_15092 392
767 3300049578 Ga0501042_0004169 Ga0501042_0004169_1686_2864 392
768 3300049578 Ga0501042_0147115 Ga0501042_0147115_36_1280 392
769 2162886007 SwRhRL2b_contig_2703074 SwRhRL2b_0829.00000490 393
770 3300003320 rootH2_10083643 rootH2_100836432 393
771 3300003856 Ga0058692_1000674 Ga0058692_10006747 393
772 3300003856 Ga0058692_1007359 Ga0058692_10073592 393
773 3300005289 Ga0065704_10070699 Ga0065704_1007069910 393
774 3300005548 Ga0070665_100000406 Ga0070665_10000040647 393
775 3300006946 Ga0079104_1001990 Ga0079104_10019905 393
776 3300009011 Ga0105251_10000064 Ga0105251_1000006427 393
777 3300009011 Ga0105251_10008061 Ga0105251_100080615 393
778 3300009092 Ga0105250_10000053 Ga0105250_1000005329 393
779 3300009092 Ga0105250_10001882 Ga0105250_1000188211 393
780 3300013104 Ga0157370_10004253 Ga0157370_1000425313 393
781 3300015679 Ga0183366_1001 Ga0183366_10011051 393
782 3300015680 Ga0183370_1001 Ga0183370_10011051 393
783 3300015685 Ga0183369_1001 Ga0183369_10011051 393
784 3300015687 Ga0183368_1001 Ga0183368_10011051 393
785 3300021384 Ga0213876_10000084 Ga0213876_1000008466 393
786 3300025711 Ga0207696_1000088 Ga0207696_100008835 393
787 3300025711 Ga0207696_1000116 Ga0207696_1000116114 393
788 3300025735 Ga0207713_1000002 Ga0207713_1000002928 393
789 3300025735 Ga0207713_1002682 Ga0207713_10026822 393
790 3300025735 Ga0207713_1002965 Ga0207713_10029656 393
791 3300025735 Ga0207713_1025470 Ga0207713_10254702 393
792 3300025735 Ga0207713_1032114 Ga0207713_10321142 393
793 3300025735 Ga0207713_1037039 Ga0207713_10370393 393
794 3300027111 Ga0209281_1000820 Ga0209281_100082016 393
795 3300027312 Ga0209371_1000001 Ga0209371_1000001975 393
796 3300027312 Ga0209371_1001119 Ga0209371_100111910 393
797 3300027312 Ga0209371_1002623 Ga0209371_10026235 393
798 3300028379 Ga0268266_10000435 Ga0268266_100004359 393
799 3300030500 Ga0268256_1000001 Ga0268256_10000011665 393
800 3300030500 Ga0268256_1000951 Ga0268256_100095112 393
801 3300030500 Ga0268256_1002322 Ga0268256_10023225 393
802 3300039437 Ga0436365_0203066 Ga0436365_0203066_84194_85390 393
803 3300041512 Ga0451853_1896193 Ga0451853_1896193_498_1679 393
804 3300042010 Ga0439452_000142 Ga0439452_000142_44768_45949 393
805 3300046471 Ga0495650_0000005 Ga0495650_0000005_753438_754619 393
806 3300047446 Ga0495679_012913 Ga0495679_012913_813_2009 393
807 3300048907 Ga0496104_0000449 Ga0496104_0000449_5473_6654 393
808 3300048907 Ga0496104_0184392 Ga0496104_0184392_634_1830 393
809 3300048908 Ga0496105_0009008 Ga0496105_0009008_5460_6656 393
810 3300048908 Ga0496105_0068782 Ga0496105_0068782_245_1426 393
811 3300048919 Ga0496116_0002683 Ga0496116_0002683_12864_14051 393
812 3300048919 Ga0496116_0013421 Ga0496116_0013421_1449_2630 393
813 3300048919 Ga0496116_0017493 Ga0496116_0017493_2890_4071 393
814 3300048919 Ga0496116_0023278 Ga0496116_0023278_1859_3040 393
815 3300048919 Ga0496116_0037362 Ga0496116_0037362_758_1939 393
816 3300048919 Ga0496116_0064856 Ga0496116_0064856_920_2101 393
817 3300048920 Ga0496117_0001622 Ga0496117_0001622_21964_23145 393
818 3300048920 Ga0496117_0008046 Ga0496117_0008046_2602_3798 393
819 3300048920 Ga0496117_0008546 Ga0496117_0008546_4833_6014 393
820 3300048920 Ga0496117_0049826 Ga0496117_0049826_1067_2248 393
821 3300048920 Ga0496117_0062267 Ga0496117_0062267_178_1359 393
822 3300048920 Ga0496117_0065527 Ga0496117_0065527_1239_2420 393
823 3300048920 Ga0496117_0066130 Ga0496117_0066130_131_1312 393
824 3300048921 Ga0496118_0000015 Ga0496118_0000015_542050_543231 393
825 3300048921 Ga0496118_0005930 Ga0496118_0005930_1182_2378 393
826 3300048922 Ga0496119_0000841 Ga0496119_0000841_31323_32510 393
827 3300048922 Ga0496119_0001419 Ga0496119_0001419_8712_9908 393
828 3300048922 Ga0496119_0003785 Ga0496119_0003785_9435_10616 393
829 3300048922 Ga0496119_0010725 Ga0496119_0010725_1041_2222 393
830 3300048923 Ga0496120_0001068 Ga0496120_0001068_19164_20360 393
831 3300048923 Ga0496120_0003719 Ga0496120_0003719_10455_11636 393
832 3300048923 Ga0496120_0006370 Ga0496120_0006370_3327_4514 393
833 3300048923 Ga0496120_0018282 Ga0496120_0018282_3001_4182 393
834 3300048923 Ga0496120_0018283 Ga0496120_0018283_342_1523 393
835 3300048924 Ga0496121_0004213 Ga0496121_0004213_10723_11904 393
836 3300048924 Ga0496121_0004271 Ga0496121_0004271_10523_11704 393
837 3300048924 Ga0496121_0006970 Ga0496121_0006970_4543_5724 393
838 3300048924 Ga0496121_0008075 Ga0496121_0008075_10941_12122 393
839 3300048924 Ga0496121_0034501 Ga0496121_0034501_2962_4143 393
840 3300048925 Ga0496122_0000202 Ga0496122_0000202_71892_73088 393
841 3300048925 Ga0496122_0008382 Ga0496122_0008382_6014_7201 393
842 3300048925 Ga0496122_0014310 Ga0496122_0014310_5458_6639 393
843 3300048925 Ga0496122_0024755 Ga0496122_0024755_3798_4979 393
844 3300048925 Ga0496122_0030357 Ga0496122_0030357_193_1374 393
845 3300048925 Ga0496122_0033844 Ga0496122_0033844_2680_3861 393
846 3300048925 Ga0496122_0039679 Ga0496122_0039679_411_1592 393
847 3300048926 Ga0496123_0000144 Ga0496123_0000144_71172_72368 393
848 3300048926 Ga0496123_0006680 Ga0496123_0006680_9674_10855 393
849 3300048926 Ga0496123_0008091 Ga0496123_0008091_3813_4994 393
850 3300048926 Ga0496123_0008482 Ga0496123_0008482_2905_4086 393
851 3300048926 Ga0496123_0015055 Ga0496123_0015055_2236_3417 393
852 3300048926 Ga0496123_0077027 Ga0496123_0077027_736_1977 393
853 3300048926 Ga0496123_0100344 Ga0496123_0100344_366_1547 393
854 3300048926 Ga0496123_0130560 Ga0496123_0130560_178_1359 393
855 3300048927 Ga0496124_0005265 Ga0496124_0005265_2890_4071 393
856 3300048927 Ga0496124_0014963 Ga0496124_0014963_2890_4071 393
857 3300048927 Ga0496124_0030441 Ga0496124_0030441_1505_2686 393
858 3300048927 Ga0496124_0045115 Ga0496124_0045115_2491_3672 393
859 3300048927 Ga0496124_0138639 Ga0496124_0138639_478_1659 393
860 3300048927 Ga0496124_0175192 Ga0496124_0175192_51_1232 393
861 3300048928 Ga0496125_0000009 Ga0496125_0000009_366854_368059 393
862 3300048928 Ga0496125_0004716 Ga0496125_0004716_3799_4980 393
863 3300048928 Ga0496125_0004820 Ga0496125_0004820_3799_4980 393
864 3300048928 Ga0496125_0005489 Ga0496125_0005489_10952_12133 393
865 3300048928 Ga0496125_0061793 Ga0496125_0061793_734_1915 393
866 3300048928 Ga0496125_0081889 Ga0496125_0081889_1077_2258 393
867 3300048929 Ga0496126_0000779 Ga0496126_0000779_1156_2337 393
868 3300048929 Ga0496126_0003414 Ga0496126_0003414_7979_9160 393
869 3300048929 Ga0496126_0039952 Ga0496126_0039952_1506_2687 393
870 3300048929 Ga0496126_0045247 Ga0496126_0045247_2481_3662 393
871 3300048929 Ga0496126_0078009 Ga0496126_0078009_1642_2823 393

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00108

Thiolase_N

Thiolase, N-terminal domain

57

316

0.99

PF02803

Thiolase_C

Thiolase, C-terminal domain

323

445

0.98

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

122

187

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1m3k-assembly1.cif.gz_A biosynthetic thiolase, inactive c89a mutant 0.9929 2 392
1dlu-assembly1.cif.gz_A unliganded biosynthetic thiolase from zoogloea ramigera 0.9923 4 392
7lcl-assembly1.cif.gz_D zoogloea ramigera biosynthetic thiolase q183y mutant 0.9921 3 392
2wkt-assembly1.cif.gz_C biosynthetic thiolase from z. ramigera. complex of the n316a mutant with coenzyme a. 0.992 4 392
1m4s-assembly1.cif.gz_A biosynthetic thiolase, cys89 acetylated, unliganded form 0.9917 1 392
ID Description Score Start End Superfamily
af_A0A096MJY8_281_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 1.001 278 388 3.40.47.10
af_O53871_287_399_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9911 278 388 3.40.47.10
af_P76461_265_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9908 266 393 3.40.47.10
af_Q8CAY6_6_396_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9903 2 393 3.40.47.10
af_Q8CAY6_6_396_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9877 2 393 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A7X6WFA2-F1-model_v4 Acetyl-CoA C-acyltransferase (EC 2.3.1.9) 1.001 284 393 GO:0003985
GO:0006635
GO:0010124
AF-M5BJ77-F1-model_v4 Acetyl-CoA C-acetyltransferase (EC 2.3.1.9) 0.9971 2 122 GO:0003985
GO:0005739
GO:0006635
AF-A0A3D6CKC3-F1-model_v4 Acetyl-CoA C-acetyltransferase (EC 2.3.1.9) 0.9965 1 107 GO:0003985
GO:0006635
AF-X1NTI0-F1-model_v4 Electron transfer flavoprotein alpha/beta-subunit N-terminal domain-containing protein 0.996 275 393 GO:0016747
AF-A0A098ME79-F1-model_v4 Thiolase C-terminal domain-containing protein 0.9956 277 393 GO:0003988
GO:0006635
GO:0010124

Feature Viewer

pLDDT pTM Quality
97.09 0.95 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map