F484184
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 871 | 505 | 761 | 391 |
Family's Representative Sequence
| Representative Sequence | 3300025292|Ga0209676_1001194|Ga0209676_100119421 |
| Length | 446 |
| Sequence | MFKTRQHFTISLAKLRLFLLSKIVKIFVKIDISASSICMQCSFLNGEKGRMFMTNEVVIVSAVRTAIGSFQGTLKDVPATKLGSIVIKEALVRAGVAGEKVGEVIMGNVLSAGLGQNPARQAAIAAGLPHEVSALTINKVCGSGLKAVHLATQAILAGDADIVVAGGFENMSQAPYVLKNAREGFRMGDQKVVDTMIHDGLWCAFNDYHMGVTAENLCDVYEISREEQDAFAARSQQRAEAAITAGKFNDEIIAVEIPQRKGDPIVFDKDEFPRQGVTAESLSKLRPAFKKDGSVTAANASGINDGAAAVVVMSKEKAEELGIRPMALITANASAGVDPAIMGTGPVTAVKKALAKADVTLDNIDLIEANEAFAAQSIAVDRELGFNHDKLNVNGGAIALGHPIGASGARILVTLLHEMEKRDAKTGLATLCIGGGQGVATVVKRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2510917027 | Brevibacillus sp. CF112 | Isolate | Rhizosphere |
| 4 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 5 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 6 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 7 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 8 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 9 | 2600254943 | Staphylococcus pasteuri NFIX07 | Isolate | Rhizoplane |
| 10 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 11 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 12 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 13 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 14 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 15 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 16 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 17 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 18 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 19 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 20 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 21 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 22 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 23 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 24 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 25 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 26 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 27 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 28 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 29 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 30 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 31 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 32 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 33 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 34 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 35 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 36 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 37 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 38 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 39 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 40 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 41 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 42 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 43 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 44 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 45 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 46 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 47 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 48 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 49 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 50 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 51 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 52 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 53 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 54 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 55 | 2687453257 | Planctomyces sp. SH-PL62 | Isolate | Unclassified |
| 56 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 57 | 2744054657 | Brevibacillus sp. SKDU10 | Isolate | Unclassified |
| 58 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 59 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 60 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 61 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 62 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 63 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 64 | 2788500588 | Lysinibacillus sp. YS11 | Isolate | Unclassified |
| 65 | 2816332336 | Brevibacillus laterosporus ZQ2 | Isolate | Unclassified |
| 66 | 2818991451 | Lysinibacillus fusiformis 3193 | Isolate | Unclassified |
| 67 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 68 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 69 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 70 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 71 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 72 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 73 | 2852673933 | Sporosarcina sp. JAI121 | Isolate | Rhizosphere |
| 74 | 2857460504 | Brevibacillus sp. R-74223 | Isolate | Unclassified |
| 75 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 76 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 77 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 78 | 2881644220 | Siminovitchia terrae LMG 29736 | Isolate | Rhizosphere |
| 79 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 80 | 2904606771 | Lysinibacillus macroides 1284 | Isolate | Rhizosphere |
| 81 | 2915597211 | Brevibacillus brevis Ag35 | Isolate | Nodule |
| 82 | 2915606848 | Brevibacillus sp. HD1.4A | Isolate | Rhizosphere |
| 83 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 84 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 85 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 86 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 87 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 88 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 89 | 2928510474 | Sporosarcina psychrophila 1288 | Isolate | Rhizosphere |
| 90 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 91 | 2929183550 | Brevibacillus sp. R-71971 Hybrid assembly | Isolate | Unclassified |
| 92 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 93 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 94 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 95 | 2939593269 | Lysinibacillus parviboronicapiens 736 | Isolate | Rhizosphere |
| 96 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 97 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 98 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 99 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 100 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 101 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 102 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 103 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 104 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 105 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 106 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 107 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 108 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 109 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 110 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 111 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 112 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 113 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 114 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 115 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 116 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 117 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 118 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 119 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 120 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 121 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 122 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 123 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 126 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 129 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 130 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 131 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 132 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 135 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 137 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 139 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 140 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 142 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 143 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 146 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 147 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 148 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 149 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 150 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 152 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 153 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 154 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 155 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 156 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 159 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 160 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 161 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 162 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 163 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 164 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 165 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 166 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 167 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 168 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 169 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 170 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 171 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 172 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 173 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 175 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 176 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 177 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 178 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 179 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 180 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 181 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 182 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 183 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 184 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 185 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 186 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 187 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 188 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 190 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 191 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 192 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 202 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 203 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 204 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 205 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 213 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 214 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 215 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 216 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 217 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 219 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 220 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 221 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 223 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 228 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 274 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 281 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 282 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 283 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 284 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 285 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 286 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 287 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 288 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 289 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 290 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 291 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 292 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 293 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 294 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 295 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 296 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 297 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 298 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 299 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 300 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 301 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 302 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 303 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 304 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 305 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 308 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 309 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 310 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 311 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 312 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 313 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 314 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 315 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 316 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 317 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 318 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 319 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 320 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 321 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 322 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 323 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 324 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 325 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 326 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 327 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 328 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 329 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 330 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 331 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 332 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 333 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 334 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 335 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 336 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 337 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 338 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 339 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 340 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 341 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 342 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 343 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 344 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 345 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 346 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 347 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 348 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 349 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 350 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 351 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 352 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 353 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 354 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 355 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 356 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 357 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 358 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 406 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 407 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 408 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 409 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 410 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 411 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 412 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 415 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 416 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 417 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 418 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 419 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 420 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 421 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 422 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 423 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 424 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 425 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 426 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 427 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 428 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 429 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 430 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 431 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 461 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 462 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 463 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 464 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 469 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 470 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 471 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 472 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 473 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 474 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 487 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 488 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 489 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 490 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 491 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 492 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 493 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 494 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 495 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 496 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 497 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 498 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 499 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 501 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 502 | 8022948649 | Bacillus endophyticus FH5 | Isolate | Rhizosphere |
| 503 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 504 | 8055531788 | Lysinibacillus pakistanensis LY1 | Isolate | Rhizosphere |
| 505 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.19 |
| Metatranscriptomes | 2.18 |
| Isolates | 12.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.23 |
| Bulb | 0 |
| Endosphere | 6.77 |
| Nodule | 0.69 |
| Rhizoplane | 10.1 |
| Rhizosphere | 67.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2703074 | 2162886007 | Bacteria | 7875 |
| 2 | JGI24736J21556_1001340 | 3300001904 | Bacteria | 4498 |
| 3 | JGI24740J21852_10006911 | 3300001979 | Bacteria | 4660 |
| 4 | JGI24735J21928_10001258 | 3300002067 | Bacteria | 8994 |
| 5 | Ga0006778J45830_1026826 | 3300003162 | Bacteria | 1257 |
| 6 | JGI25151J46595_10000302 | 3300003187 | Bacteria | 54102 |
| 7 | JGI25151J46595_10002958 | 3300003187 | Bacteria | 9705 |
| 8 | JGI25151J46595_10007108 | 3300003187 | Bacteria | 5523 |
| 9 | JGI25151J46595_10039571 | 3300003187 | Bacteria | 1739 |
| 10 | rootH2_10023994 | 3300003320 | Bacteria | 23941 |
| 11 | rootH2_10083643 | 3300003320 | Bacteria | 8038 |
| 12 | Ga0007416J51690_1021970 | 3300003577 | Bacteria | 1317 |
| 13 | Ga0007429J51699_1018838 | 3300003579 | Bacteria | 1263 |
| 14 | Ga0055532_1000060 | 3300003758 | Bacteria | 150321 |
| 15 | Ga0055532_1001176 | 3300003758 | Bacteria | 7896 |
| 16 | Ga0055542_1000589 | 3300003762 | Bacteria | 31380 |
| 17 | Ga0055529_1004088 | 3300003763 | Bacteria | 2272 |
| 18 | Ga0055536_1000461 | 3300003781 | Bacteria | 28659 |
| 19 | Ga0055536_1000666 | 3300003781 | Bacteria | 23120 |
| 20 | Ga0055530_10000424 | 3300003791 | Bacteria | 37602 |
| 21 | Ga0055540_1000122 | 3300003792 | Bacteria | 81293 |
| 22 | Ga0055531_10000146 | 3300003794 | Bacteria | 81289 |
| 23 | Ga0058692_1000622 | 3300003856 | Bacteria | 14677 |
| 24 | Ga0058692_1000674 | 3300003856 | Bacteria | 14060 |
| 25 | Ga0058692_1007359 | 3300003856 | Bacteria | 2929 |
| 26 | Ga0065714_10084763 | 3300005288 | Bacteria | 2182 |
| 27 | Ga0065704_10070699 | 3300005289 | Bacteria | 17430 |
| 28 | Ga0065704_10083393 | 3300005289 | Bacteria | 3473 |
| 29 | Ga0065707_10105464 | 3300005295 | Bacteria | 2630 |
| 30 | Ga0070658_10006314 | 3300005327 | Bacteria | 9600 |
| 31 | Ga0070676_10055192 | 3300005328 | Bacteria | 2344 |
| 32 | Ga0070676_10061532 | 3300005328 | Bacteria | 2232 |
| 33 | Ga0070690_100049678 | 3300005330 | Bacteria | 2675 |
| 34 | Ga0070670_100045743 | 3300005331 | Bacteria | 3763 |
| 35 | Ga0070670_100057539 | 3300005331 | Bacteria | 3337 |
| 36 | Ga0070666_10004186 | 3300005335 | Bacteria | 8755 |
| 37 | Ga0070680_100009507 | 3300005336 | Bacteria | 7467 |
| 38 | Ga0070682_100059039 | 3300005337 | Bacteria | 2421 |
| 39 | Ga0070689_100015633 | 3300005340 | Bacteria | 5539 |
| 40 | Ga0070689_100065480 | 3300005340 | Bacteria | 2830 |
| 41 | Ga0070692_10129027 | 3300005345 | Bacteria | 1419 |
| 42 | Ga0070668_100000707 | 3300005347 | Bacteria | 22821 |
| 43 | Ga0070668_100004391 | 3300005347 | Bacteria | 10460 |
| 44 | Ga0070673_100067712 | 3300005364 | Bacteria | 2856 |
| 45 | Ga0070688_100022333 | 3300005365 | Bacteria | 3706 |
| 46 | Ga0070667_100003824 | 3300005367 | Bacteria | 12796 |
| 47 | Ga0070709_10065471 | 3300005434 | Bacteria | 2327 |
| 48 | Ga0070714_100074276 | 3300005435 | Bacteria | 2947 |
| 49 | Ga0070713_100037681 | 3300005436 | Bacteria | 3910 |
| 50 | Ga0070713_100051297 | 3300005436 | Bacteria | 3411 |
| 51 | Ga0070713_100063212 | 3300005436 | Bacteria | 3102 |
| 52 | Ga0070710_10021576 | 3300005437 | Bacteria | 3358 |
| 53 | Ga0070705_100049180 | 3300005440 | Bacteria | 2447 |
| 54 | Ga0070700_100006997 | 3300005441 | Bacteria | 6056 |
| 55 | Ga0070694_100001005 | 3300005444 | Bacteria | 16031 |
| 56 | Ga0070694_100058197 | 3300005444 | Bacteria | 2629 |
| 57 | Ga0070708_100026124 | 3300005445 | Bacteria | 4995 |
| 58 | Ga0070663_100020685 | 3300005455 | Bacteria | 4360 |
| 59 | Ga0070663_100163365 | 3300005455 | Bacteria | 1716 |
| 60 | Ga0070681_10004050 | 3300005458 | Bacteria | 13835 |
| 61 | Ga0070681_10078648 | 3300005458 | Bacteria | 3254 |
| 62 | Ga0070681_10145752 | 3300005458 | Bacteria | 2297 |
| 63 | Ga0068867_100027781 | 3300005459 | Bacteria | 4070 |
| 64 | Ga0070685_10093879 | 3300005466 | Bacteria | 1821 |
| 65 | Ga0070706_100004372 | 3300005467 | Bacteria | 13649 |
| 66 | Ga0070706_100153608 | 3300005467 | Bacteria | 2149 |
| 67 | Ga0070707_100064773 | 3300005468 | Bacteria | 3510 |
| 68 | Ga0070699_100000540 | 3300005518 | Bacteria | 35757 |
| 69 | Ga0070699_100184242 | 3300005518 | Bacteria | 1853 |
| 70 | Ga0070679_100025738 | 3300005530 | Bacteria | 5774 |
| 71 | Ga0070679_100073177 | 3300005530 | Bacteria | 3419 |
| 72 | Ga0070684_100100836 | 3300005535 | Bacteria | 2579 |
| 73 | Ga0070697_100127625 | 3300005536 | Bacteria | 2131 |
| 74 | Ga0068853_100000230 | 3300005539 | Bacteria | 39593 |
| 75 | Ga0068853_100360062 | 3300005539 | Bacteria | 1355 |
| 76 | Ga0070695_100000710 | 3300005545 | Bacteria | 17788 |
| 77 | Ga0070695_100010886 | 3300005545 | Bacteria | 5434 |
| 78 | Ga0070696_100000156 | 3300005546 | Bacteria | 38002 |
| 79 | Ga0070665_100000406 | 3300005548 | Bacteria | 63162 |
| 80 | Ga0070665_100006587 | 3300005548 | Bacteria | 11805 |
| 81 | Ga0070665_100011615 | 3300005548 | Bacteria | 8903 |
| 82 | Ga0068855_100000034 | 3300005563 | Bacteria | 166436 |
| 83 | Ga0068855_100161923 | 3300005563 | Bacteria | 2539 |
| 84 | Ga0068857_100006498 | 3300005577 | Bacteria | 10028 |
| 85 | Ga0068854_100106278 | 3300005578 | Bacteria | 2111 |
| 86 | Ga0068854_100185818 | 3300005578 | Bacteria | 1626 |
| 87 | Ga0068856_100031657 | 3300005614 | Bacteria | 5176 |
| 88 | Ga0068852_100018197 | 3300005616 | Bacteria | 5532 |
| 89 | Ga0068859_100199657 | 3300005617 | Bacteria | 2084 |
| 90 | Ga0068864_100164996 | 3300005618 | Bacteria | 2016 |
| 91 | Ga0068861_100031979 | 3300005719 | Bacteria | 3871 |
| 92 | Ga0068858_100037806 | 3300005842 | Bacteria | 4476 |
| 93 | Ga0068860_100000351 | 3300005843 | Bacteria | 61888 |
| 94 | Ga0068860_100007718 | 3300005843 | Bacteria | 10756 |
| 95 | Ga0068860_100078572 | 3300005843 | Bacteria | 3138 |
| 96 | Ga0068862_100024035 | 3300005844 | Bacteria | 5109 |
| 97 | Ga0068862_100045374 | 3300005844 | Bacteria | 3750 |
| 98 | Ga0068862_100050025 | 3300005844 | Bacteria | 3571 |
| 99 | Ga0068862_100063471 | 3300005844 | Bacteria | 3178 |
| 100 | Ga0081455_10000028 | 3300005937 | Bacteria | 155778 |
| 101 | Ga0081455_10001108 | 3300005937 | Bacteria | 33842 |
| 102 | Ga0081455_10045047 | 3300005937 | Bacteria | 3842 |
| 103 | Ga0081455_10100945 | 3300005937 | Bacteria | 2317 |
| 104 | Ga0081538_10007910 | 3300005981 | Bacteria | 9109 |
| 105 | Ga0081538_10018206 | 3300005981 | Bacteria | 5289 |
| 106 | Ga0081538_10020695 | 3300005981 | Bacteria | 4831 |
| 107 | Ga0081538_10024985 | 3300005981 | Bacteria | 4235 |
| 108 | Ga0081540_1000060 | 3300005983 | Bacteria | 119707 |
| 109 | Ga0081540_1043059 | 3300005983 | Bacteria | 2321 |
| 110 | Ga0081539_10000977 | 3300005985 | Bacteria | 53347 |
| 111 | Ga0081539_10005453 | 3300005985 | Bacteria | 12976 |
| 112 | Ga0081539_10010261 | 3300005985 | Bacteria | 7651 |
| 113 | Ga0081539_10015990 | 3300005985 | Bacteria | 5403 |
| 114 | Ga0070717_10024871 | 3300006028 | Bacteria | 4757 |
| 115 | Ga0070717_10057481 | 3300006028 | Bacteria | 3215 |
| 116 | Ga0070717_10080726 | 3300006028 | Bacteria | 2729 |
| 117 | Ga0075365_10009401 | 3300006038 | Bacteria | 5617 |
| 118 | Ga0075365_10036665 | 3300006038 | Bacteria | 3178 |
| 119 | Ga0075363_100038942 | 3300006048 | Bacteria | 2501 |
| 120 | Ga0075364_10043851 | 3300006051 | Bacteria | 2908 |
| 121 | Ga0070715_10015199 | 3300006163 | Bacteria | 2866 |
| 122 | Ga0070716_100027329 | 3300006173 | Bacteria | 3064 |
| 123 | Ga0070716_100216075 | 3300006173 | Bacteria | 1285 |
| 124 | Ga0070712_100014972 | 3300006175 | Bacteria | 4986 |
| 125 | Ga0070712_100068020 | 3300006175 | Bacteria | 2536 |
| 126 | Ga0075366_10017931 | 3300006195 | Bacteria | 4084 |
| 127 | Ga0075370_10011338 | 3300006353 | Bacteria | 4681 |
| 128 | Ga0075370_10014893 | 3300006353 | Bacteria | 4154 |
| 129 | Ga0075428_100002387 | 3300006844 | Bacteria | 20393 |
| 130 | Ga0075428_100002525 | 3300006844 | Bacteria | 19895 |
| 131 | Ga0075428_100057384 | 3300006844 | Bacteria | 4262 |
| 132 | Ga0075430_100060823 | 3300006846 | Bacteria | 3174 |
| 133 | Ga0075430_100089607 | 3300006846 | Bacteria | 2573 |
| 134 | Ga0075431_100005137 | 3300006847 | Bacteria | 12878 |
| 135 | Ga0075431_100087766 | 3300006847 | Bacteria | 3210 |
| 136 | Ga0075433_10011214 | 3300006852 | Bacteria | 7213 |
| 137 | Ga0075433_10122881 | 3300006852 | Bacteria | 2306 |
| 138 | Ga0075434_100067556 | 3300006871 | Bacteria | 3560 |
| 139 | Ga0075434_100091899 | 3300006871 | Bacteria | 3036 |
| 140 | Ga0075434_100192022 | 3300006871 | Bacteria | 2063 |
| 141 | Ga0075436_100002374 | 3300006914 | Bacteria | 13001 |
| 142 | Ga0075436_100043110 | 3300006914 | Bacteria | 3110 |
| 143 | Ga0097620_100199661 | 3300006931 | Bacteria | 2084 |
| 144 | Ga0079104_1001990 | 3300006946 | Bacteria | 11958 |
| 145 | Ga0075435_100029369 | 3300007076 | Bacteria | 4314 |
| 146 | Ga0075435_100079607 | 3300007076 | Bacteria | 2689 |
| 147 | Ga0099794_10008524 | 3300007265 | Bacteria | 4264 |
| 148 | Ga0105251_10000064 | 3300009011 | Bacteria | 100095 |
| 149 | Ga0105251_10001689 | 3300009011 | Bacteria | 18557 |
| 150 | Ga0105251_10008061 | 3300009011 | Bacteria | 6386 |
| 151 | Ga0105251_10034656 | 3300009011 | Bacteria | 2496 |
| 152 | Ga0105250_10000053 | 3300009092 | Bacteria | 114563 |
| 153 | Ga0105250_10001882 | 3300009092 | Bacteria | 10908 |
| 154 | Ga0105250_10005639 | 3300009092 | Bacteria | 5591 |
| 155 | Ga0105250_10043755 | 3300009092 | Bacteria | 1795 |
| 156 | Ga0105240_10022032 | 3300009093 | Bacteria | 8460 |
| 157 | Ga0111539_10018998 | 3300009094 | Bacteria | 8497 |
| 158 | Ga0111539_10034619 | 3300009094 | Bacteria | 6120 |
| 159 | Ga0105245_10005334 | 3300009098 | Bacteria | 11294 |
| 160 | Ga0114129_10023661 | 3300009147 | Bacteria | 8707 |
| 161 | Ga0114129_10032683 | 3300009147 | Bacteria | 7352 |
| 162 | Ga0114129_10040156 | 3300009147 | Bacteria | 6597 |
| 163 | Ga0114129_10098515 | 3300009147 | Bacteria | 4046 |
| 164 | Ga0105241_10016604 | 3300009174 | Bacteria | 5402 |
| 165 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 166 | Ga0105248_10024110 | 3300009177 | Bacteria | 6762 |
| 167 | Ga0105248_10069958 | 3300009177 | Bacteria | 3941 |
| 168 | Ga0105249_10299309 | 3300009553 | Bacteria | 1613 |
| 169 | Ga0105148_100251 | 3300009978 | Bacteria | 7349 |
| 170 | Ga0099796_10000988 | 3300010159 | Bacteria | 5342 |
| 171 | Ga0099796_10004076 | 3300010159 | Bacteria | 3486 |
| 172 | Ga0105246_10004282 | 3300011119 | Bacteria | 8680 |
| 173 | Ga0157345_1000058 | 3300012498 | Bacteria | 23631 |
| 174 | Ga0157370_10004253 | 3300013104 | Bacteria | 16534 |
| 175 | Ga0157370_10110370 | 3300013104 | Bacteria | 2571 |
| 176 | Ga0157369_10002217 | 3300013105 | Bacteria | 23382 |
| 177 | Ga0157369_10002227 | 3300013105 | Bacteria | 23348 |
| 178 | Ga0157369_10007939 | 3300013105 | Bacteria | 12204 |
| 179 | Ga0157369_10298786 | 3300013105 | Bacteria | 1675 |
| 180 | Ga0157369_10406137 | 3300013105 | Bacteria | 1413 |
| 181 | Ga0157374_10098952 | 3300013296 | Bacteria | 2793 |
| 182 | Ga0163162_10201294 | 3300013306 | Bacteria | 2120 |
| 183 | Ga0157372_10337573 | 3300013307 | Bacteria | 1755 |
| 184 | Ga0157375_10254859 | 3300013308 | Bacteria | 1916 |
| 185 | Ga0163163_10245913 | 3300014325 | Bacteria | 1839 |
| 186 | Ga0182008_10101987 | 3300014497 | Bacteria | 1419 |
| 187 | Ga0183366_1001 | 3300015679 | Bacteria | 2743932 |
| 188 | Ga0183370_1001 | 3300015680 | Bacteria | 2743932 |
| 189 | Ga0183369_1001 | 3300015685 | Bacteria | 2743932 |
| 190 | Ga0183368_1001 | 3300015687 | Bacteria | 2743932 |
| 191 | Ga0163161_10006599 | 3300017792 | Bacteria | 8034 |
| 192 | Ga0206356_10667046 | 3300020070 | Bacteria | 1781 |
| 193 | Ga0213872_10000860 | 3300021361 | Bacteria | 21983 |
| 194 | Ga0213872_10022550 | 3300021361 | Bacteria | 2900 |
| 195 | Ga0213876_10000084 | 3300021384 | Bacteria | 107178 |
| 196 | Ga0213876_10000103 | 3300021384 | Bacteria | 94164 |
| 197 | Ga0247553_100221 | 3300023672 | Bacteria | 1911 |
| 198 | Ga0228598_1000875 | 3300024227 | Bacteria | 6508 |
| 199 | Ga0209784_100118 | 3300025224 | Bacteria | 83084 |
| 200 | Ga0209147_100080 | 3300025229 | Bacteria | 196308 |
| 201 | Ga0209147_100101 | 3300025229 | Bacteria | 161976 |
| 202 | Ga0209148_1000384 | 3300025254 | Bacteria | 53115 |
| 203 | Ga0209455_1000152 | 3300025272 | Bacteria | 125942 |
| 204 | Ga0209675_1005781 | 3300025291 | Bacteria | 5095 |
| 205 | Ga0209676_1000020 | 3300025292 | Bacteria | 617256 |
| 206 | Ga0209676_1000102 | 3300025292 | Bacteria | 227372 |
| 207 | Ga0209676_1000427 | 3300025292 | Bacteria | 73627 |
| 208 | Ga0209676_1001194 | 3300025292 | Bacteria | 27901 |
| 209 | Ga0209025_1000262 | 3300025294 | Bacteria | 123617 |
| 210 | Ga0209025_1002935 | 3300025294 | Bacteria | 16963 |
| 211 | Ga0209025_1004102 | 3300025294 | Bacteria | 12975 |
| 212 | Ga0209025_1005174 | 3300025294 | Bacteria | 10787 |
| 213 | Ga0209025_1008076 | 3300025294 | Bacteria | 7661 |
| 214 | Ga0209050_1000105 | 3300025298 | Bacteria | 227285 |
| 215 | Ga0209051_1000066 | 3300025303 | Bacteria | 227369 |
| 216 | Ga0209257_1000124 | 3300025304 | Bacteria | 218195 |
| 217 | Ga0207696_1000088 | 3300025711 | Bacteria | 190313 |
| 218 | Ga0207696_1000116 | 3300025711 | Bacteria | 148125 |
| 219 | Ga0207696_1002383 | 3300025711 | Bacteria | 9275 |
| 220 | Ga0207696_1005207 | 3300025711 | Bacteria | 5440 |
| 221 | Ga0207655_1007416 | 3300025728 | Bacteria | 7114 |
| 222 | Ga0207655_1026537 | 3300025728 | Bacteria | 2781 |
| 223 | Ga0207713_1000002 | 3300025735 | Bacteria | 1061749 |
| 224 | Ga0207713_1000370 | 3300025735 | Bacteria | 48903 |
| 225 | Ga0207713_1000883 | 3300025735 | Bacteria | 27325 |
| 226 | Ga0207713_1002682 | 3300025735 | Bacteria | 12729 |
| 227 | Ga0207713_1002965 | 3300025735 | Bacteria | 11859 |
| 228 | Ga0207713_1025470 | 3300025735 | Bacteria | 2731 |
| 229 | Ga0207713_1032114 | 3300025735 | Bacteria | 2310 |
| 230 | Ga0207713_1037039 | 3300025735 | Bacteria | 2085 |
| 231 | Ga0207653_10000724 | 3300025885 | Bacteria | 11298 |
| 232 | Ga0207692_10022673 | 3300025898 | Bacteria | 2893 |
| 233 | Ga0207692_10095516 | 3300025898 | Bacteria | 1621 |
| 234 | Ga0207688_10006050 | 3300025901 | Bacteria | 6583 |
| 235 | Ga0207680_10000192 | 3300025903 | Bacteria | 29474 |
| 236 | Ga0207685_10004693 | 3300025905 | Bacteria | 3511 |
| 237 | Ga0207699_10158718 | 3300025906 | Bacteria | 1503 |
| 238 | Ga0207645_10046281 | 3300025907 | Bacteria | 2779 |
| 239 | Ga0207684_10006877 | 3300025910 | Bacteria | 10292 |
| 240 | Ga0207684_10033976 | 3300025910 | Bacteria | 4336 |
| 241 | Ga0207707_10013817 | 3300025912 | Bacteria | 7041 |
| 242 | Ga0207707_10019402 | 3300025912 | Bacteria | 5935 |
| 243 | Ga0207695_10141179 | 3300025913 | Bacteria | 2357 |
| 244 | Ga0207693_10002296 | 3300025915 | Bacteria | 16616 |
| 245 | Ga0207693_10024341 | 3300025915 | Bacteria | 4805 |
| 246 | Ga0207693_10049456 | 3300025915 | Bacteria | 3301 |
| 247 | Ga0207693_10064671 | 3300025915 | Bacteria | 2865 |
| 248 | Ga0207663_10019794 | 3300025916 | Bacteria | 3799 |
| 249 | Ga0207660_10003986 | 3300025917 | Bacteria | 9626 |
| 250 | Ga0207660_10184586 | 3300025917 | Bacteria | 1622 |
| 251 | Ga0207646_10026623 | 3300025922 | Bacteria | 5275 |
| 252 | Ga0207650_10002443 | 3300025925 | Bacteria | 12941 |
| 253 | Ga0207650_10099874 | 3300025925 | Bacteria | 2232 |
| 254 | Ga0207659_10112886 | 3300025926 | Bacteria | 2069 |
| 255 | Ga0207687_10066936 | 3300025927 | Bacteria | 2554 |
| 256 | Ga0207700_10007976 | 3300025928 | Bacteria | 6520 |
| 257 | Ga0207700_10075251 | 3300025928 | Bacteria | 2616 |
| 258 | Ga0207700_10301932 | 3300025928 | Bacteria | 1383 |
| 259 | Ga0207664_10079190 | 3300025929 | Bacteria | 2667 |
| 260 | Ga0207670_10009459 | 3300025936 | Bacteria | 5562 |
| 261 | Ga0207670_10016209 | 3300025936 | Bacteria | 4471 |
| 262 | Ga0207670_10170450 | 3300025936 | Bacteria | 1632 |
| 263 | Ga0207665_10000117 | 3300025939 | Bacteria | 52204 |
| 264 | Ga0207665_10272203 | 3300025939 | Bacteria | 1258 |
| 265 | Ga0207691_10133928 | 3300025940 | Bacteria | 2187 |
| 266 | Ga0207711_10000001 | 3300025941 | Bacteria | 1325674 |
| 267 | Ga0207711_10013853 | 3300025941 | Bacteria | 6697 |
| 268 | Ga0207667_10108121 | 3300025949 | Bacteria | 2869 |
| 269 | Ga0207651_10014448 | 3300025960 | Bacteria | 4560 |
| 270 | Ga0207712_10014325 | 3300025961 | Bacteria | 5099 |
| 271 | Ga0207668_10000002 | 3300025972 | Bacteria | 209163 |
| 272 | Ga0207668_10025508 | 3300025972 | Bacteria | 3826 |
| 273 | Ga0207668_10033453 | 3300025972 | Bacteria | 3406 |
| 274 | Ga0207640_10073191 | 3300025981 | Bacteria | 2315 |
| 275 | Ga0207640_10096434 | 3300025981 | Bacteria | 2062 |
| 276 | Ga0207703_10003659 | 3300026035 | Bacteria | 12816 |
| 277 | Ga0207639_10000338 | 3300026041 | Bacteria | 32510 |
| 278 | Ga0207639_10017877 | 3300026041 | Bacteria | 5029 |
| 279 | Ga0207678_10029207 | 3300026067 | Bacteria | 4811 |
| 280 | Ga0207708_10013835 | 3300026075 | Bacteria | 6030 |
| 281 | Ga0207641_10165713 | 3300026088 | Bacteria | 2012 |
| 282 | Ga0207648_10040324 | 3300026089 | Bacteria | 4104 |
| 283 | Ga0207648_10160414 | 3300026089 | Bacteria | 1986 |
| 284 | Ga0207674_10004781 | 3300026116 | Bacteria | 16234 |
| 285 | Ga0207674_10013979 | 3300026116 | Bacteria | 8875 |
| 286 | Ga0207675_100267322 | 3300026118 | Bacteria | 1659 |
| 287 | Ga0207698_10142237 | 3300026142 | Bacteria | 2069 |
| 288 | Ga0209281_1000820 | 3300027111 | Bacteria | 28065 |
| 289 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 290 | Ga0209371_1000020 | 3300027312 | Bacteria | 556282 |
| 291 | Ga0209371_1001119 | 3300027312 | Bacteria | 19769 |
| 292 | Ga0209371_1002623 | 3300027312 | Bacteria | 9844 |
| 293 | Ga0209371_1006607 | 3300027312 | Bacteria | 4256 |
| 294 | Ga0209813_10012558 | 3300027866 | Bacteria | 2242 |
| 295 | Ga0209974_10026553 | 3300027876 | Bacteria | 1917 |
| 296 | Ga0268266_10000435 | 3300028379 | Bacteria | 62710 |
| 297 | Ga0268266_10000811 | 3300028379 | Bacteria | 41188 |
| 298 | Ga0268265_10006024 | 3300028380 | Bacteria | 8250 |
| 299 | Ga0268264_10000749 | 3300028381 | Bacteria | 36626 |
| 300 | Ga0268264_10035403 | 3300028381 | Bacteria | 4111 |
| 301 | Ga0268264_10049442 | 3300028381 | Bacteria | 3498 |
| 302 | Ga0307517_10008180 | 3300028786 | Bacteria | 15041 |
| 303 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 304 | Ga0268256_1000057 | 3300030500 | Bacteria | 229991 |
| 305 | Ga0268256_1000951 | 3300030500 | Bacteria | 19769 |
| 306 | Ga0268256_1002322 | 3300030500 | Bacteria | 9844 |
| 307 | Ga0268256_1006662 | 3300030500 | Bacteria | 4256 |
| 308 | Ga0316178_1118621 | 3300030735 | Bacteria | 29653 |
| 309 | Ga0265330_10055322 | 3300031235 | Bacteria | 1733 |
| 310 | Ga0265332_10001502 | 3300031238 | Bacteria | 12971 |
| 311 | Ga0265320_10000039 | 3300031240 | Bacteria | 134478 |
| 312 | Ga0265320_10000550 | 3300031240 | Bacteria | 28890 |
| 313 | Ga0265325_10048989 | 3300031241 | Bacteria | 2182 |
| 314 | Ga0265325_10058138 | 3300031241 | Bacteria | 1970 |
| 315 | Ga0265340_10040691 | 3300031247 | Bacteria | 2288 |
| 316 | Ga0265339_10011897 | 3300031249 | Bacteria | 5336 |
| 317 | Ga0265339_10036463 | 3300031249 | Bacteria | 2752 |
| 318 | Ga0307513_10000077 | 3300031456 | Bacteria | 134167 |
| 319 | Ga0307408_100006252 | 3300031548 | Bacteria | 7906 |
| 320 | Ga0307408_100029279 | 3300031548 | Bacteria | 3813 |
| 321 | Ga0307408_100058061 | 3300031548 | Bacteria | 2812 |
| 322 | Ga0316575_10017975 | 3300031665 | Bacteria | 2692 |
| 323 | Ga0265314_10013436 | 3300031711 | Bacteria | 6613 |
| 324 | Ga0265314_10014914 | 3300031711 | Bacteria | 6190 |
| 325 | Ga0265314_10019715 | 3300031711 | Bacteria | 5217 |
| 326 | Ga0265314_10097843 | 3300031711 | Bacteria | 1894 |
| 327 | Ga0265342_10008983 | 3300031712 | Bacteria | 7097 |
| 328 | Ga0265342_10092051 | 3300031712 | Bacteria | 1737 |
| 329 | Ga0316576_10034845 | 3300031727 | Bacteria | 3590 |
| 330 | Ga0316576_10042757 | 3300031727 | Bacteria | 3266 |
| 331 | Ga0316576_10155394 | 3300031727 | Bacteria | 1724 |
| 332 | Ga0316578_10000916 | 3300031728 | Bacteria | 11148 |
| 333 | Ga0316578_10014050 | 3300031728 | Bacteria | 4264 |
| 334 | Ga0316578_10092765 | 3300031728 | Bacteria | 1805 |
| 335 | Ga0307405_10082306 | 3300031731 | Bacteria | 2106 |
| 336 | Ga0307410_10023315 | 3300031852 | Bacteria | 3845 |
| 337 | Ga0307410_10110887 | 3300031852 | Bacteria | 1985 |
| 338 | Ga0307410_10154752 | 3300031852 | Bacteria | 1711 |
| 339 | Ga0307412_10085309 | 3300031911 | Bacteria | 2194 |
| 340 | Ga0307412_10117093 | 3300031911 | Bacteria | 1912 |
| 341 | Ga0307409_100042898 | 3300031995 | Bacteria | 3392 |
| 342 | Ga0307409_100219446 | 3300031995 | Bacteria | 1715 |
| 343 | Ga0307416_100053199 | 3300032002 | Bacteria | 3247 |
| 344 | Ga0307416_100087297 | 3300032002 | Bacteria | 2662 |
| 345 | Ga0307416_100194892 | 3300032002 | Bacteria | 1915 |
| 346 | Ga0307414_10156780 | 3300032004 | Bacteria | 1803 |
| 347 | Ga0316053_101354 | 3300032120 | Bacteria | 1289 |
| 348 | Ga0316585_10015583 | 3300032137 | Bacteria | 2283 |
| 349 | Ga0316580_10011049 | 3300032139 | Bacteria | 2736 |
| 350 | Ga0316580_10013050 | 3300032139 | Bacteria | 2532 |
| 351 | Ga0316588_1010906 | 3300033528 | Bacteria | 1927 |
| 352 | Ga0316596_1007729 | 3300033541 | Bacteria | 2547 |
| 353 | Ga0373926_0013371 | 3300035083 | Bacteria | 2783 |
| 354 | Ga0373926_0059021 | 3300035083 | Bacteria | 1396 |
| 355 | Ga0373940_0006440 | 3300035088 | Bacteria | 2604 |
| 356 | Ga0373944_0002385 | 3300035089 | Bacteria | 4783 |
| 357 | Ga0373949_0010649 | 3300035090 | Bacteria | 2017 |
| 358 | Ga0373923_0009386 | 3300035111 | Bacteria | 3530 |
| 359 | Ga0373932_0011803 | 3300035112 | Bacteria | 2141 |
| 360 | Ga0373939_0019131 | 3300035114 | Bacteria | 1844 |
| 361 | Ga0373941_0009585 | 3300035115 | Bacteria | 2443 |
| 362 | Ga0373956_0012242 | 3300035119 | Bacteria | 3552 |
| 363 | Ga0373956_0052707 | 3300035119 | Bacteria | 1830 |
| 364 | Ga0373943_0007037 | 3300035170 | Bacteria | 5046 |
| 365 | Ga0373955_0026576 | 3300035172 | Bacteria | 2983 |
| 366 | Ga0373961_0004207 | 3300035241 | Bacteria | 3493 |
| 367 | Ga0316574_0006329 | 3300035398 | Bacteria | 6390 |
| 368 | Ga0316574_0007076 | 3300035398 | Bacteria | 6122 |
| 369 | Ga0316574_0012119 | 3300035398 | Bacteria | 4924 |
| 370 | Ga0373924_0051158 | 3300035410 | Bacteria | 1712 |
| 371 | Ga0373931_0002980 | 3300035691 | Bacteria | 7564 |
| 372 | Ga0373931_0009777 | 3300035691 | Bacteria | 4592 |
| 373 | Ga0373935_0001583 | 3300035692 | Bacteria | 12687 |
| 374 | Ga0373935_0003507 | 3300035692 | Bacteria | 9123 |
| 375 | Ga0373935_0052567 | 3300035692 | Bacteria | 2590 |
| 376 | Ga0373927_0000243 | 3300035695 | Bacteria | 42834 |
| 377 | Ga0373927_0050482 | 3300035695 | Bacteria | 2690 |
| 378 | Ga0373933_0008345 | 3300035724 | Bacteria | 5656 |
| 379 | Ga0373933_0039115 | 3300035724 | Bacteria | 2789 |
| 380 | Ga0373933_0075339 | 3300035724 | Bacteria | 2060 |
| 381 | Ga0373947_0006288 | 3300035725 | Bacteria | 6904 |
| 382 | Ga0373937_0014589 | 3300036401 | Bacteria | 6940 |
| 383 | Ga0373937_0041928 | 3300036401 | Bacteria | 4176 |
| 384 | Ga0373937_0057447 | 3300036401 | Bacteria | 3574 |
| 385 | Ga0316582_0039051 | 3300036647 | Bacteria | 2954 |
| 386 | Ga0316582_0100345 | 3300036647 | Bacteria | 1916 |
| 387 | Ga0316584_0020718 | 3300036712 | Bacteria | 4771 |
| 388 | Ga0316584_0044039 | 3300036712 | Bacteria | 3328 |
| 389 | Ga0373925_0102445 | 3300037068 | Bacteria | 2202 |
| 390 | Ga0395898_0041459 | 3300037466 | Bacteria | 4547 |
| 391 | Ga0436364_0777042 | 3300037853 | Bacteria | 1376 |
| 392 | Ga0436364_0943381 | 3300037853 | Bacteria | 2572 |
| 393 | Ga0436364_0992727 | 3300037853 | Bacteria | 1286 |
| 394 | Ga0395901_0085923 | 3300038443 | Bacteria | 3289 |
| 395 | Ga0237819_00896 | 3300038705 | Bacteria | 9258 |
| 396 | Ga0400483_011703 | 3300039062 | Bacteria | 5250 |
| 397 | Ga0400483_144988 | 3300039062 | Bacteria | 3461 |
| 398 | Ga0400483_150944 | 3300039062 | Bacteria | 17535 |
| 399 | Ga0400489_33857 | 3300039093 | Bacteria | 3056 |
| 400 | Ga0436365_0203066 | 3300039437 | Bacteria | 111457 |
| 401 | Ga0436365_0924222 | 3300039437 | Bacteria | 2939 |
| 402 | Ga0436365_1805879 | 3300039437 | Bacteria | 2909 |
| 403 | Ga0436365_1861022 | 3300039437 | Bacteria | 74232 |
| 404 | Ga0436360_0886478 | 3300039438 | Bacteria | 2494 |
| 405 | Ga0436361_0453677 | 3300039447 | Bacteria | 28726 |
| 406 | Ga0436361_0984484 | 3300039447 | Bacteria | 2052 |
| 407 | Ga0436361_1001866 | 3300039447 | Bacteria | 37490 |
| 408 | Ga0436363_0439161 | 3300039450 | Bacteria | 2158 |
| 409 | Ga0436363_0452161 | 3300039450 | Bacteria | 1463 |
| 410 | Ga0436363_1190291 | 3300039450 | Bacteria | 1539 |
| 411 | Ga0436362_0660459 | 3300039453 | Bacteria | 1558 |
| 412 | Ga0439436_0001265 | 3300041404 | Bacteria | 7214 |
| 413 | Ga0439438_005534 | 3300041405 | Bacteria | 4626 |
| 414 | Ga0439438_006885 | 3300041405 | Bacteria | 3957 |
| 415 | Ga0439447_007714 | 3300041407 | Bacteria | 3389 |
| 416 | Ga0451853_1896193 | 3300041512 | Bacteria | 2018 |
| 417 | Ga0439432_013194 | 3300042006 | Bacteria | 2812 |
| 418 | Ga0439432_014713 | 3300042006 | Bacteria | 2646 |
| 419 | Ga0439450_000469 | 3300042008 | Bacteria | 5250 |
| 420 | Ga0439452_000142 | 3300042010 | Bacteria | 54077 |
| 421 | Ga0439452_000221 | 3300042010 | Bacteria | 40244 |
| 422 | Ga0439452_001405 | 3300042010 | Bacteria | 9905 |
| 423 | Ga0439455_0035371 | 3300042012 | Bacteria | 1260 |
| 424 | Ga0450902_015737 | 3300042137 | Bacteria | 1229 |
| 425 | Ga0450904_001512 | 3300042139 | Bacteria | 3203 |
| 426 | Ga0439434_0008880 | 3300042435 | Bacteria | 2953 |
| 427 | Ga0450916_001727 | 3300042530 | Bacteria | 2218 |
| 428 | Ga0453683_0005602 | 3300044673 | Bacteria | 8730 |
| 429 | Ga0453684_0003922 | 3300044712 | Bacteria | 32678 |
| 430 | Ga0453684_0011998 | 3300044712 | Bacteria | 14410 |
| 431 | Ga0453684_0048239 | 3300044712 | Bacteria | 5635 |
| 432 | Ga0453684_0244145 | 3300044712 | Bacteria | 2066 |
| 433 | Ga0453684_0278560 | 3300044712 | Bacteria | 1908 |
| 434 | Ga0466960_0136396 | 3300044901 | Bacteria | 1300 |
| 435 | Ga0466959_0035190 | 3300045049 | Bacteria | 3706 |
| 436 | Ga0451576_0000016 | 3300045051 | Bacteria | 565050 |
| 437 | Ga0451576_0000051 | 3300045051 | Bacteria | 313453 |
| 438 | Ga0451576_0000696 | 3300045051 | Bacteria | 68242 |
| 439 | Ga0451576_0013071 | 3300045051 | Bacteria | 9297 |
| 440 | Ga0495591_003608 | 3300046458 | Bacteria | 7885 |
| 441 | Ga0495629_0029522 | 3300046459 | Bacteria | 3887 |
| 442 | Ga0495638_0007527 | 3300046460 | Bacteria | 7793 |
| 443 | Ga0495641_0042091 | 3300046461 | Bacteria | 2119 |
| 444 | Ga0495651_0019514 | 3300046462 | Bacteria | 5256 |
| 445 | Ga0495651_0130188 | 3300046462 | Bacteria | 1838 |
| 446 | Ga0495653_0027546 | 3300046463 | Bacteria | 4547 |
| 447 | Ga0495650_0000005 | 3300046471 | Bacteria | 766553 |
| 448 | Ga0495580_0046745 | 3300046472 | Bacteria | 3070 |
| 449 | Ga0495662_0025639 | 3300046476 | Bacteria | 2847 |
| 450 | Ga0495662_0053389 | 3300046476 | Bacteria | 1951 |
| 451 | Ga0495664_0069604 | 3300046477 | Bacteria | 2100 |
| 452 | Ga0495584_0020115 | 3300046491 | Bacteria | 3391 |
| 453 | Ga0495584_0052579 | 3300046491 | Bacteria | 2050 |
| 454 | Ga0495585_0002318 | 3300046492 | Bacteria | 13716 |
| 455 | Ga0495607_0000668 | 3300046501 | Bacteria | 33232 |
| 456 | Ga0495583_0000447 | 3300046506 | Bacteria | 61780 |
| 457 | Ga0495583_0010816 | 3300046506 | Bacteria | 5283 |
| 458 | Ga0495606_0044385 | 3300046507 | Bacteria | 2956 |
| 459 | Ga0495608_0061405 | 3300046511 | Bacteria | 2471 |
| 460 | Ga0495610_0004539 | 3300046512 | Bacteria | 10212 |
| 461 | Ga0495618_0095864 | 3300046514 | Eukaryota | 1897 |
| 462 | Ga0495618_0131624 | 3300046514 | Bacteria | 1600 |
| 463 | Ga0495628_0045518 | 3300046516 | Bacteria | 3488 |
| 464 | Ga0495652_0077715 | 3300046529 | Bacteria | 2750 |
| 465 | Ga0495652_0094290 | 3300046529 | Bacteria | 2441 |
| 466 | Ga0495654_0003014 | 3300046530 | Bacteria | 10501 |
| 467 | Ga0495640_0005373 | 3300046533 | Bacteria | 10190 |
| 468 | Ga0495640_0061829 | 3300046533 | Bacteria | 2542 |
| 469 | Ga0495587_0018878 | 3300046536 | Bacteria | 4274 |
| 470 | Ga0495587_0069761 | 3300046536 | Bacteria | 2046 |
| 471 | Ga0495645_0001277 | 3300046543 | Bacteria | 17149 |
| 472 | Ga0495633_0024969 | 3300046558 | Bacteria | 2948 |
| 473 | Ga0495667_0128996 | 3300046559 | Bacteria | 1631 |
| 474 | Ga0495634_0066926 | 3300046642 | Bacteria | 2377 |
| 475 | Ga0495635_0020720 | 3300046663 | Bacteria | 4580 |
| 476 | Ga0495599_0033264 | 3300046678 | Bacteria | 3239 |
| 477 | Ga0495646_0031506 | 3300046680 | Bacteria | 3304 |
| 478 | Ga0495647_0091441 | 3300046681 | Bacteria | 1248 |
| 479 | Ga0495658_0075819 | 3300046683 | Bacteria | 1963 |
| 480 | Ga0495613_0001199 | 3300046689 | Bacteria | 19784 |
| 481 | Ga0495613_0187394 | 3300046689 | Bacteria | 1463 |
| 482 | Ga0495671_0074401 | 3300046692 | Bacteria | 1666 |
| 483 | Ga0495649_0000777 | 3300046694 | Bacteria | 25668 |
| 484 | Ga0495649_0001900 | 3300046694 | Bacteria | 15256 |
| 485 | Ga0495649_0005219 | 3300046694 | Bacteria | 8313 |
| 486 | Ga0495600_0068905 | 3300046809 | Bacteria | 2312 |
| 487 | Ga0495604_0024793 | 3300047317 | Bacteria | 4785 |
| 488 | Ga0495604_0094935 | 3300047317 | Bacteria | 2204 |
| 489 | Ga0495604_0203218 | 3300047317 | Bacteria | 1373 |
| 490 | Ga0495674_0002065 | 3300047319 | Bacteria | 19693 |
| 491 | Ga0495674_0018921 | 3300047319 | Bacteria | 6405 |
| 492 | Ga0495674_0109410 | 3300047319 | Bacteria | 2344 |
| 493 | Ga0495676_0124179 | 3300047321 | Bacteria | 1873 |
| 494 | Ga0495680_0074380 | 3300047322 | Bacteria | 2580 |
| 495 | Ga0495683_0022584 | 3300047323 | Bacteria | 3235 |
| 496 | Ga0495675_0059761 | 3300047444 | Bacteria | 2416 |
| 497 | Ga0495679_012913 | 3300047446 | Bacteria | 3158 |
| 498 | Ga0495684_0014934 | 3300047471 | Bacteria | 5981 |
| 499 | Ga0495684_0067146 | 3300047471 | Bacteria | 2727 |
| 500 | Ga0495684_0091239 | 3300047471 | Bacteria | 2308 |
| 501 | Ga0495593_0013645 | 3300047673 | Bacteria | 4629 |
| 502 | Ga0495593_0015025 | 3300047673 | Bacteria | 4397 |
| 503 | Ga0495593_0021887 | 3300047673 | Bacteria | 3567 |
| 504 | Ga0495602_0024310 | 3300048088 | Bacteria | 5879 |
| 505 | Ga0495602_0177774 | 3300048088 | Bacteria | 1645 |
| 506 | Ga0496100_0245144 | 3300048903 | Bacteria | 1323 |
| 507 | Ga0496101_0057632 | 3300048904 | Bacteria | 2810 |
| 508 | Ga0496102_0024135 | 3300048905 | Bacteria | 5404 |
| 509 | Ga0496102_0238494 | 3300048905 | Bacteria | 1715 |
| 510 | Ga0496102_0243049 | 3300048905 | Bacteria | 1697 |
| 511 | Ga0496103_0011761 | 3300048906 | Bacteria | 5192 |
| 512 | Ga0496104_0000449 | 3300048907 | Bacteria | 35646 |
| 513 | Ga0496104_0002199 | 3300048907 | Bacteria | 16874 |
| 514 | Ga0496104_0009135 | 3300048907 | Bacteria | 8813 |
| 515 | Ga0496104_0013664 | 3300048907 | Bacteria | 7320 |
| 516 | Ga0496104_0085492 | 3300048907 | Bacteria | 3011 |
| 517 | Ga0496104_0184392 | 3300048907 | Bacteria | 1997 |
| 518 | Ga0496105_0002469 | 3300048908 | Bacteria | 13385 |
| 519 | Ga0496105_0006002 | 3300048908 | Bacteria | 9278 |
| 520 | Ga0496105_0009008 | 3300048908 | Bacteria | 7787 |
| 521 | Ga0496105_0068782 | 3300048908 | Bacteria | 2926 |
| 522 | Ga0496105_0091271 | 3300048908 | Bacteria | 2515 |
| 523 | Ga0496106_0001760 | 3300048909 | Bacteria | 16160 |
| 524 | Ga0496106_0022779 | 3300048909 | Bacteria | 4653 |
| 525 | Ga0496106_0022817 | 3300048909 | Bacteria | 4649 |
| 526 | Ga0496107_0033613 | 3300048910 | Bacteria | 3670 |
| 527 | Ga0496107_0326795 | 3300048910 | Bacteria | 1141 |
| 528 | Ga0496108_0002321 | 3300048911 | Bacteria | 15223 |
| 529 | Ga0496108_0010630 | 3300048911 | Bacteria | 7466 |
| 530 | Ga0496108_0087161 | 3300048911 | Bacteria | 2651 |
| 531 | Ga0496109_0033184 | 3300048912 | Bacteria | 4643 |
| 532 | Ga0496110_0004012 | 3300048913 | Bacteria | 11346 |
| 533 | Ga0496110_0006378 | 3300048913 | Bacteria | 9328 |
| 534 | Ga0496110_0014478 | 3300048913 | Bacteria | 6552 |
| 535 | Ga0496110_0130943 | 3300048913 | Bacteria | 2265 |
| 536 | Ga0496110_0167942 | 3300048913 | Bacteria | 1990 |
| 537 | Ga0496110_0256996 | 3300048913 | Bacteria | 1590 |
| 538 | Ga0496111_0005262 | 3300048914 | Bacteria | 8258 |
| 539 | Ga0496111_0046266 | 3300048914 | Bacteria | 3133 |
| 540 | Ga0496111_0066041 | 3300048914 | Bacteria | 2626 |
| 541 | Ga0496111_0110256 | 3300048914 | Bacteria | 2027 |
| 542 | Ga0496112_0007190 | 3300048915 | Bacteria | 9862 |
| 543 | Ga0496112_0028322 | 3300048915 | Bacteria | 5406 |
| 544 | Ga0496112_0062681 | 3300048915 | Bacteria | 3668 |
| 545 | Ga0496113_0184103 | 3300048916 | Bacteria | 1656 |
| 546 | Ga0496113_0195128 | 3300048916 | Bacteria | 1608 |
| 547 | Ga0496114_0031868 | 3300048917 | Bacteria | 4337 |
| 548 | Ga0496115_0029287 | 3300048918 | Bacteria | 4323 |
| 549 | Ga0496115_0032343 | 3300048918 | Bacteria | 4127 |
| 550 | Ga0496116_0002683 | 3300048919 | Bacteria | 18391 |
| 551 | Ga0496116_0013421 | 3300048919 | Bacteria | 6606 |
| 552 | Ga0496116_0017493 | 3300048919 | Bacteria | 5560 |
| 553 | Ga0496116_0023278 | 3300048919 | Bacteria | 4616 |
| 554 | Ga0496116_0037362 | 3300048919 | Bacteria | 3387 |
| 555 | Ga0496116_0064856 | 3300048919 | Bacteria | 2345 |
| 556 | Ga0496117_0001622 | 3300048920 | Bacteria | 31785 |
| 557 | Ga0496117_0008046 | 3300048920 | Bacteria | 10108 |
| 558 | Ga0496117_0008546 | 3300048920 | Bacteria | 9710 |
| 559 | Ga0496117_0049826 | 3300048920 | Bacteria | 2974 |
| 560 | Ga0496117_0062267 | 3300048920 | Bacteria | 2557 |
| 561 | Ga0496117_0065527 | 3300048920 | Bacteria | 2469 |
| 562 | Ga0496117_0066130 | 3300048920 | Bacteria | 2453 |
| 563 | Ga0496118_0000015 | 3300048921 | Bacteria | 551359 |
| 564 | Ga0496118_0005930 | 3300048921 | Bacteria | 13661 |
| 565 | Ga0496119_0000841 | 3300048922 | Bacteria | 40637 |
| 566 | Ga0496119_0001419 | 3300048922 | Bacteria | 29009 |
| 567 | Ga0496119_0003785 | 3300048922 | Bacteria | 15466 |
| 568 | Ga0496119_0010725 | 3300048922 | Bacteria | 7680 |
| 569 | Ga0496120_0001068 | 3300048923 | Bacteria | 36230 |
| 570 | Ga0496120_0003719 | 3300048923 | Bacteria | 13569 |
| 571 | Ga0496120_0006370 | 3300048923 | Bacteria | 9077 |
| 572 | Ga0496120_0018028 | 3300048923 | Bacteria | 4561 |
| 573 | Ga0496120_0018282 | 3300048923 | Bacteria | 4523 |
| 574 | Ga0496120_0018283 | 3300048923 | Bacteria | 4523 |
| 575 | Ga0496121_0004213 | 3300048924 | Bacteria | 19602 |
| 576 | Ga0496121_0004271 | 3300048924 | Bacteria | 19402 |
| 577 | Ga0496121_0006970 | 3300048924 | Bacteria | 13755 |
| 578 | Ga0496121_0008075 | 3300048924 | Bacteria | 12536 |
| 579 | Ga0496121_0034501 | 3300048924 | Bacteria | 4553 |
| 580 | Ga0496121_0174712 | 3300048924 | Bacteria | 1556 |
| 581 | Ga0496122_0000202 | 3300048925 | Bacteria | 132984 |
| 582 | Ga0496122_0000259 | 3300048925 | Bacteria | 119366 |
| 583 | Ga0496122_0001139 | 3300048925 | Bacteria | 45609 |
| 584 | Ga0496122_0008382 | 3300048925 | Bacteria | 11170 |
| 585 | Ga0496122_0012999 | 3300048925 | Bacteria | 8207 |
| 586 | Ga0496122_0014310 | 3300048925 | Bacteria | 7680 |
| 587 | Ga0496122_0024755 | 3300048925 | Bacteria | 5242 |
| 588 | Ga0496122_0030357 | 3300048925 | Bacteria | 4529 |
| 589 | Ga0496122_0033844 | 3300048925 | Bacteria | 4194 |
| 590 | Ga0496122_0039679 | 3300048925 | Bacteria | 3751 |
| 591 | Ga0496122_0175949 | 3300048925 | Bacteria | 1282 |
| 592 | Ga0496123_0000144 | 3300048926 | Bacteria | 144603 |
| 593 | Ga0496123_0000209 | 3300048926 | Bacteria | 119480 |
| 594 | Ga0496123_0001178 | 3300048926 | Bacteria | 38532 |
| 595 | Ga0496123_0006680 | 3300048926 | Bacteria | 11118 |
| 596 | Ga0496123_0008091 | 3300048926 | Bacteria | 9725 |
| 597 | Ga0496123_0008482 | 3300048926 | Bacteria | 9434 |
| 598 | Ga0496123_0015055 | 3300048926 | Bacteria | 6369 |
| 599 | Ga0496123_0077027 | 3300048926 | Bacteria | 2050 |
| 600 | Ga0496123_0100344 | 3300048926 | Bacteria | 1686 |
| 601 | Ga0496123_0130560 | 3300048926 | Bacteria | 1392 |
| 602 | Ga0496124_0005265 | 3300048927 | Bacteria | 14637 |
| 603 | Ga0496124_0014963 | 3300048927 | Bacteria | 7468 |
| 604 | Ga0496124_0030441 | 3300048927 | Bacteria | 4790 |
| 605 | Ga0496124_0045115 | 3300048927 | Bacteria | 3779 |
| 606 | Ga0496124_0065945 | 3300048927 | Bacteria | 3017 |
| 607 | Ga0496124_0138639 | 3300048927 | Bacteria | 1922 |
| 608 | Ga0496124_0158960 | 3300048927 | Bacteria | 1764 |
| 609 | Ga0496124_0175192 | 3300048927 | Bacteria | 1656 |
| 610 | Ga0496125_0000009 | 3300048928 | Bacteria | 677678 |
| 611 | Ga0496125_0004716 | 3300048928 | Bacteria | 15541 |
| 612 | Ga0496125_0004820 | 3300048928 | Bacteria | 15335 |
| 613 | Ga0496125_0005489 | 3300048928 | Bacteria | 14066 |
| 614 | Ga0496125_0061793 | 3300048928 | Bacteria | 3001 |
| 615 | Ga0496125_0081889 | 3300048928 | Bacteria | 2463 |
| 616 | Ga0496126_0000779 | 3300048929 | Bacteria | 57561 |
| 617 | Ga0496126_0003414 | 3300048929 | Bacteria | 20080 |
| 618 | Ga0496126_0039952 | 3300048929 | Bacteria | 4350 |
| 619 | Ga0496126_0045247 | 3300048929 | Bacteria | 4046 |
| 620 | Ga0496126_0070293 | 3300048929 | Bacteria | 3119 |
| 621 | Ga0496126_0078009 | 3300048929 | Bacteria | 2935 |
| 622 | Ga0501305_000167 | 3300049161 | Bacteria | 4473 |
| 623 | Ga0501305_007969 | 3300049161 | Bacteria | 1359 |
| 624 | Ga0495678_004515 | 3300049459 | Bacteria | 8024 |
| 625 | Ga0501312_000134 | 3300049528 | Bacteria | 4637 |
| 626 | Ga0501314_003831 | 3300049530 | Bacteria | 1226 |
| 627 | Ga0501315_005212 | 3300049531 | Bacteria | 1399 |
| 628 | Ga0501316_004946 | 3300049532 | Bacteria | 1361 |
| 629 | Ga0501317_002748 | 3300049533 | Bacteria | 1692 |
| 630 | Ga0501317_005478 | 3300049533 | Bacteria | 1361 |
| 631 | Ga0501323_000290 | 3300049539 | Bacteria | 3467 |
| 632 | Ga0501323_007455 | 3300049539 | Bacteria | 1249 |
| 633 | Ga0501335_004207 | 3300049551 | Bacteria | 1250 |
| 634 | Ga0501031_0004673 | 3300049568 | Bacteria | 8892 |
| 635 | Ga0501032_0000006 | 3300049569 | Bacteria | 261727 |
| 636 | Ga0501032_0000045 | 3300049569 | Bacteria | 110632 |
| 637 | Ga0501032_0004902 | 3300049569 | Bacteria | 10016 |
| 638 | Ga0501033_0000053 | 3300049570 | Bacteria | 109042 |
| 639 | Ga0501033_0036195 | 3300049570 | Bacteria | 3700 |
| 640 | Ga0501033_0278252 | 3300049570 | Bacteria | 1182 |
| 641 | Ga0501034_0000001 | 3300049571 | Bacteria | 2184493 |
| 642 | Ga0501034_0000030 | 3300049571 | Bacteria | 248180 |
| 643 | Ga0501034_0049632 | 3300049571 | Bacteria | 4234 |
| 644 | Ga0501034_0080709 | 3300049571 | Bacteria | 3256 |
| 645 | Ga0501034_0116188 | 3300049571 | Bacteria | 2664 |
| 646 | Ga0501034_0120067 | 3300049571 | Bacteria | 2615 |
| 647 | Ga0501034_0158550 | 3300049571 | Bacteria | 2235 |
| 648 | Ga0501036_0000003 | 3300049572 | Bacteria | 261545 |
| 649 | Ga0501037_0000003 | 3300049573 | Bacteria | 261548 |
| 650 | Ga0501037_0003548 | 3300049573 | Bacteria | 11318 |
| 651 | Ga0501038_0000004 | 3300049574 | Bacteria | 261289 |
| 652 | Ga0501038_0001565 | 3300049574 | Bacteria | 21184 |
| 653 | Ga0501038_0059157 | 3300049574 | Bacteria | 3283 |
| 654 | Ga0501038_0128540 | 3300049574 | Bacteria | 2083 |
| 655 | Ga0501038_0363520 | 3300049574 | Bacteria | 1125 |
| 656 | Ga0501039_0000008 | 3300049575 | Bacteria | 274778 |
| 657 | Ga0501039_0000041 | 3300049575 | Bacteria | 113488 |
| 658 | Ga0501039_0004448 | 3300049575 | Bacteria | 10579 |
| 659 | Ga0501040_0000210 | 3300049576 | Bacteria | 34012 |
| 660 | Ga0501042_0004169 | 3300049578 | Bacteria | 9187 |
| 661 | Ga0501042_0147115 | 3300049578 | Bacteria | 1698 |
| 662 | Ga0501043_0000431 | 3300049579 | Bacteria | 37716 |
| 663 | Ga0501046_0003231 | 3300049580 | Bacteria | 14971 |
| 664 | Ga0501047_0002242 | 3300049581 | Bacteria | 18498 |
| 665 | Ga0501047_0172586 | 3300049581 | Bacteria | 2031 |
| 666 | Ga0501048_0004383 | 3300049582 | Bacteria | 10748 |
| 667 | Ga0501067_0002609 | 3300049583 | Bacteria | 9976 |
| 668 | Ga0501067_0036201 | 3300049583 | Bacteria | 2741 |
| 669 | Ga0501070_0022527 | 3300049586 | Bacteria | 5277 |
| 670 | Ga0501070_0102913 | 3300049586 | Bacteria | 2362 |
| 671 | Ga0501070_0187233 | 3300049586 | Bacteria | 1702 |
| 672 | Ga0501071_0027148 | 3300049587 | Bacteria | 4025 |
| 673 | Ga0501073_0050441 | 3300049589 | Bacteria | 2916 |
| 674 | Ga0501074_0005445 | 3300049590 | Bacteria | 9155 |
| 675 | Ga0501074_0136259 | 3300049590 | Bacteria | 1756 |
| 676 | Ga0501077_0101486 | 3300049593 | Bacteria | 1823 |
| 677 | Ga0501077_0134376 | 3300049593 | Bacteria | 1569 |
| 678 | Ga0501077_0195196 | 3300049593 | Bacteria | 1286 |
| 679 | Ga0501223_000043 | 3300049663 | Bacteria | 44137 |
| 680 | Ga0501224_000019 | 3300049664 | Bacteria | 78204 |
| 681 | Ga0501233_000077 | 3300049668 | Bacteria | 13013 |
| 682 | Ga0501225_0000065 | 3300049705 | Bacteria | 34445 |
| 683 | Ga0501079_0094950 | 3300049741 | Bacteria | 2311 |
| 684 | Ga0501083_0008771 | 3300049744 | Bacteria | 7135 |
| 685 | Ga0501035_0000031 | 3300049822 | Bacteria | 175591 |
| 686 | Ga0501044_0000008 | 3300049823 | Bacteria | 274778 |
| 687 | Ga0501044_0000509 | 3300049823 | Bacteria | 47320 |
| 688 | Ga0501044_0023168 | 3300049823 | Bacteria | 6608 |
| 689 | Ga0501044_0068659 | 3300049823 | Bacteria | 3610 |
| 690 | Ga0501044_0121115 | 3300049823 | Bacteria | 2617 |
| 691 | Ga0501044_0139541 | 3300049823 | Bacteria | 2413 |
| 692 | Ga0501226_000080 | 3300049853 | Bacteria | 29131 |
| 693 | nmdc:mga03683_8756_c1 | 3300050489 | Bacteria | 3570 |
| 694 | nmdc:mga00v17_15936_c1 | 3300050491 | Bacteria | 4229 |
| 695 | nmdc:mga00v17_18634_c1 | 3300050491 | Bacteria | 3947 |
| 696 | nmdc:mga00v17_49332_c1 | 3300050491 | Bacteria | 2553 |
| 697 | nmdc:mga0yw44_3196_c1 | 3300050492 | Bacteria | 7210 |
| 698 | nmdc:mga0yw44_56678_c1 | 3300050492 | Bacteria | 2389 |
| 699 | nmdc:mga0yw44_6604_c1 | 3300050492 | Bacteria | 5622 |
| 700 | nmdc:mga0k408_11707_c1 | 3300050493 | Bacteria | 4783 |
| 701 | nmdc:mga0k408_42615_c1 | 3300050493 | Bacteria | 2614 |
| 702 | nmdc:mga07m45_17202_c1 | 3300050496 | Bacteria | 3154 |
| 703 | nmdc:mga05p37_10714_c1 | 3300050507 | Bacteria | 10882 |
| 704 | nmdc:mga05p37_350142_c1 | 3300050507 | Bacteria | 1739 |
| 705 | nmdc:mga05p37_87537_c1 | 3300050507 | Bacteria | 3839 |
| 706 | nmdc:mga0qj67_43499_c1 | 3300050509 | Bacteria | 3537 |
| 707 | nmdc:mga0qj67_83049_c1 | 3300050509 | Bacteria | 2568 |
| 708 | nmdc:mga06r32_57677_c1 | 3300050510 | Bacteria | 3730 |
| 709 | nmdc:mga06r32_8428_c1 | 3300050510 | Bacteria | 9289 |
| 710 | nmdc:mga06r32_84974_c1 | 3300050510 | Bacteria | 3085 |
| 711 | nmdc:mga08y16_167369_c1 | 3300050511 | Bacteria | 2283 |
| 712 | nmdc:mga08y16_45093_c1 | 3300050511 | Bacteria | 4619 |
| 713 | nmdc:mga08y16_67799_c1 | 3300050511 | Bacteria | 3722 |
| 714 | nmdc:mga08y16_87369_c1 | 3300050511 | Bacteria | 3249 |
| 715 | nmdc:mga0n895_183322_c1 | 3300050512 | Bacteria | 2125 |
| 716 | nmdc:mga0n895_214691_c1 | 3300050512 | Bacteria | 1954 |
| 717 | nmdc:mga0n895_2737_c1 | 3300050512 | Bacteria | 13916 |
| 718 | nmdc:mga0n895_33904_c1 | 3300050512 | Bacteria | 4910 |
| 719 | nmdc:mga0n895_58450_c1 | 3300050512 | Bacteria | 3802 |
| 720 | nmdc:mga0n895_87600_c1 | 3300050512 | Bacteria | 3111 |
| 721 | nmdc:mga0rr50_29874_c1 | 3300050513 | Bacteria | 3850 |
| 722 | nmdc:mga0rr50_81888_c1 | 3300050513 | Bacteria | 2492 |
| 723 | nmdc:mga08x19_60609_c1 | 3300050514 | Bacteria | 2451 |
| 724 | nmdc:mga08x19_6_c2 | 3300050514 | Bacteria | 52011 |
| 725 | nmdc:mga08x19_99118_c1 | 3300050514 | Bacteria | 1931 |
| 726 | nmdc:mga0a205_105164_c1 | 3300050515 | Bacteria | 2721 |
| 727 | nmdc:mga0a205_125132_c1 | 3300050515 | Bacteria | 2470 |
| 728 | nmdc:mga0a205_190609_c1 | 3300050515 | Bacteria | 1942 |
| 729 | nmdc:mga0a205_26885_c1 | 3300050515 | Bacteria | 3025 |
| 730 | nmdc:mga0a205_3402_c1 | 3300050515 | Bacteria | 14185 |
| 731 | Ga0495601_0001526 | 3300053077 | Bacteria | 12769 |
| 732 | Ga0495601_0001594 | 3300053077 | Bacteria | 12527 |
| 733 | Ga0495601_0179478 | 3300053077 | Bacteria | 1384 |
| 734 | Ga0495612_0001337 | 3300053078 | Bacteria | 10155 |
| 735 | Ga0495612_0037001 | 3300053078 | Bacteria | 1981 |
| 736 | Ga0495595_0005548 | 3300053084 | Bacteria | 5106 |
| 737 | Ga0495595_0026650 | 3300053084 | Bacteria | 2570 |
| 738 | Ga0495595_0078953 | 3300053084 | Bacteria | 1565 |
| 739 | Ga0495619_0004091 | 3300053085 | Bacteria | 9333 |
| 740 | Ga0495619_0005185 | 3300053085 | Bacteria | 8260 |
| 741 | Ga0495619_0210745 | 3300053085 | Bacteria | 1345 |
| 742 | Ga0500643_001292 | 3300053087 | Bacteria | 14753 |
| 743 | Ga0500651_0036112 | 3300053093 | Bacteria | 3114 |
| 744 | Ga0500641_0004747 | 3300053096 | Bacteria | 4808 |
| 745 | Ga0500556_0002197 | 3300053104 | Bacteria | 6547 |
| 746 | Ga0500658_0023651 | 3300053134 | Bacteria | 2348 |
| 747 | Ga0500559_0000042 | 3300053136 | Bacteria | 101570 |
| 748 | Ga0500568_0000127 | 3300053139 | Bacteria | 68647 |
| 749 | Ga0500588_0002612 | 3300053146 | Bacteria | 3696 |
| 750 | Ga0500616_0013338 | 3300053153 | Bacteria | 4776 |
| 751 | Ga0500619_003726 | 3300053154 | Bacteria | 3169 |
| 752 | Ga0501084_0000234 | 3300054114 | Bacteria | 41758 |
| 753 | Ga0501084_0069303 | 3300054114 | Bacteria | 2953 |
| 754 | Ga0501084_0087990 | 3300054114 | Bacteria | 2608 |
| 755 | Ga0590074_006728 | 3300059423 | Bacteria | 1909 |
| 756 | Ga0590075_004026 | 3300059424 | Bacteria | 3477 |
| 757 | Ga0590075_016712 | 3300059424 | Bacteria | 1806 |
| 758 | Ga0501082_0017108 | 3300060353 | Bacteria | 6247 |
| 759 | Ga0501082_0017151 | 3300060353 | Bacteria | 6238 |
| 760 | Ga0501082_0030808 | 3300060353 | Bacteria | 4624 |
| 761 | Ga0530510_0196755 | 3300061734 | Bacteria | 1497 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042137 | Ga0450902_015737 | Ga0450902_015737_28_1029 | 329 |
| 2 | 3300037853 | Ga0436364_0992727 | Ga0436364_0992727_10_1029 | 338 |
| 3 | 3300049589 | Ga0501073_0050441 | Ga0501073_0050441_1860_2876 | 338 |
| 4 | 3300049574 | Ga0501038_0363520 | Ga0501038_0363520_90_1115 | 340 |
| 5 | 3300049571 | Ga0501034_0049632 | Ga0501034_0049632_1011_2216 | 344 |
| 6 | 3300005983 | Ga0081540_1000060 | Ga0081540_100006098 | 353 |
| 7 | 3300005444 | Ga0070694_100058197 | Ga0070694_1000581972 | 359 |
| 8 | 3300005719 | Ga0068861_100031979 | Ga0068861_1000319791 | 359 |
| 9 | 3300009094 | Ga0111539_10034619 | Ga0111539_100346193 | 359 |
| 10 | 3300042012 | Ga0439455_0035371 | Ga0439455_0035371_14_1105 | 359 |
| 11 | 3300048903 | Ga0496100_0245144 | Ga0496100_0245144_57_1238 | 359 |
| 12 | 3300048910 | Ga0496107_0326795 | Ga0496107_0326795_49_1131 | 359 |
| 13 | 3300048917 | Ga0496114_0031868 | Ga0496114_0031868_1391_2572 | 359 |
| 14 | 3300050515 | nmdc:mga0a205_3402_c1 | nmdc:mga0a205_3402_c1_9300_10487 | 359 |
| 15 | 3300039062 | Ga0400483_011703 | Ga0400483_011703_4065_5150 | 360 |
| 16 | 3300047673 | Ga0495593_0013645 | Ga0495593_0013645_3530_4615 | 360 |
| 17 | 3300048924 | Ga0496121_0174712 | Ga0496121_0174712_424_1506 | 360 |
| 18 | 3300048925 | Ga0496122_0175949 | Ga0496122_0175949_140_1222 | 360 |
| 19 | 3300050515 | nmdc:mga0a205_190609_c1 | nmdc:mga0a205_190609_c1_537_1724 | 360 |
| 20 | 3300046694 | Ga0495649_0000777 | Ga0495649_0000777_15_1103 | 361 |
| 21 | 3300046694 | Ga0495649_0001900 | Ga0495649_0001900_15_1103 | 361 |
| 22 | 3300039062 | Ga0400483_144988 | Ga0400483_144988_1838_2929 | 362 |
| 23 | 3300048927 | Ga0496124_0065945 | Ga0496124_0065945_886_2094 | 362 |
| 24 | 3300039453 | Ga0436362_0660459 | Ga0436362_0660459_119_1210 | 363 |
| 25 | 3300046514 | Ga0495618_0095864 | Ga0495618_0095864_61_1191 | 363 |
| 26 | 3300031240 | Ga0265320_10000550 | Ga0265320_100005506 | 365 |
| 27 | 3300031711 | Ga0265314_10013436 | Ga0265314_100134364 | 365 |
| 28 | 3300053139 | Ga0500568_0000127 | Ga0500568_0000127_13931_15109 | 365 |
| 29 | 3300005983 | Ga0081540_1043059 | Ga0081540_10430592 | 367 |
| 30 | 3300035088 | Ga0373940_0006440 | Ga0373940_0006440_161_1348 | 367 |
| 31 | 3300046491 | Ga0495584_0052579 | Ga0495584_0052579_410_1600 | 367 |
| 32 | 3300046681 | Ga0495647_0091441 | Ga0495647_0091441_125_1228 | 367 |
| 33 | 3300049569 | Ga0501032_0000006 | Ga0501032_0000006_43669_45003 | 367 |
| 34 | 3300049570 | Ga0501033_0000053 | Ga0501033_0000053_56720_58054 | 367 |
| 35 | 3300049570 | Ga0501033_0278252 | Ga0501033_0278252_17_1120 | 367 |
| 36 | 3300049571 | Ga0501034_0000030 | Ga0501034_0000030_190127_191461 | 367 |
| 37 | 3300049572 | Ga0501036_0000003 | Ga0501036_0000003_216725_218059 | 367 |
| 38 | 3300049573 | Ga0501037_0000003 | Ga0501037_0000003_216725_218059 | 367 |
| 39 | 3300049574 | Ga0501038_0000004 | Ga0501038_0000004_216725_218059 | 367 |
| 40 | 3300049575 | Ga0501039_0000008 | Ga0501039_0000008_216725_218059 | 367 |
| 41 | 3300049579 | Ga0501043_0000431 | Ga0501043_0000431_1639_2973 | 367 |
| 42 | 3300049581 | Ga0501047_0002242 | Ga0501047_0002242_15614_16948 | 367 |
| 43 | 3300049822 | Ga0501035_0000031 | Ga0501035_0000031_117538_118872 | 367 |
| 44 | 3300049823 | Ga0501044_0000008 | Ga0501044_0000008_216725_218059 | 367 |
| 45 | 3300050511 | nmdc:mga08y16_167369_c1 | nmdc:mga08y16_167369_c1_97_1287 | 367 |
| 46 | iso_pu_bacteria | 2512047018 | 2512328703 | 367 |
| 47 | 3300009147 | Ga0114129_10098515 | Ga0114129_100985155 | 368 |
| 48 | 3300047317 | Ga0495604_0094935 | Ga0495604_0094935_1060_2169 | 368 |
| 49 | 3300050507 | nmdc:mga05p37_350142_c1 | nmdc:mga05p37_350142_c1_204_1391 | 368 |
| 50 | 3300005937 | Ga0081455_10000028 | Ga0081455_10000028105 | 371 |
| 51 | 3300035090 | Ga0373949_0010649 | Ga0373949_0010649_594_1781 | 371 |
| 52 | 3300035115 | Ga0373941_0009585 | Ga0373941_0009585_539_1726 | 371 |
| 53 | 3300035398 | Ga0316574_0007076 | Ga0316574_0007076_3432_4610 | 371 |
| 54 | 3300035691 | Ga0373931_0002980 | Ga0373931_0002980_654_1841 | 371 |
| 55 | 3300048914 | Ga0496111_0046266 | Ga0496111_0046266_322_1443 | 372 |
| 56 | 3300001979 | JGI24740J21852_10006911 | JGI24740J21852_100069113 | 373 |
| 57 | 3300005548 | Ga0070665_100011615 | Ga0070665_1000116158 | 373 |
| 58 | 3300005614 | Ga0068856_100031657 | Ga0068856_1000316573 | 373 |
| 59 | 3300005616 | Ga0068852_100018197 | Ga0068852_1000181976 | 373 |
| 60 | 3300006051 | Ga0075364_10043851 | Ga0075364_100438513 | 373 |
| 61 | 3300006353 | Ga0075370_10014893 | Ga0075370_100148933 | 373 |
| 62 | 3300031852 | Ga0307410_10110887 | Ga0307410_101108872 | 373 |
| 63 | 3300031995 | Ga0307409_100042898 | Ga0307409_1000428982 | 373 |
| 64 | 3300049571 | Ga0501034_0158550 | Ga0501034_0158550_907_2091 | 373 |
| 65 | 3300050491 | nmdc:mga00v17_15936_c1 | nmdc:mga00v17_15936_c1_1001_2224 | 373 |
| 66 | 3300050492 | nmdc:mga0yw44_6604_c1 | nmdc:mga0yw44_6604_c1_1157_2380 | 373 |
| 67 | 3300050496 | nmdc:mga07m45_17202_c1 | nmdc:mga07m45_17202_c1_1159_2382 | 373 |
| 68 | 3300005331 | Ga0070670_100045743 | Ga0070670_1000457434 | 374 |
| 69 | 3300005347 | Ga0070668_100004391 | Ga0070668_1000043917 | 374 |
| 70 | 3300005618 | Ga0068864_100164996 | Ga0068864_1001649962 | 374 |
| 71 | 3300005843 | Ga0068860_100007718 | Ga0068860_1000077183 | 374 |
| 72 | 3300005844 | Ga0068862_100050025 | Ga0068862_1000500252 | 374 |
| 73 | 3300025925 | Ga0207650_10099874 | Ga0207650_100998742 | 374 |
| 74 | 3300025972 | Ga0207668_10025508 | Ga0207668_100255084 | 374 |
| 75 | 3300026088 | Ga0207641_10165713 | Ga0207641_101657132 | 374 |
| 76 | 3300026118 | Ga0207675_100267322 | Ga0207675_1002673221 | 374 |
| 77 | 3300028381 | Ga0268264_10049442 | Ga0268264_100494422 | 374 |
| 78 | 3300039450 | Ga0436363_0439161 | Ga0436363_0439161_254_1426 | 374 |
| 79 | 3300005455 | Ga0070663_100163365 | Ga0070663_1001633652 | 375 |
| 80 | 3300006852 | Ga0075433_10011214 | Ga0075433_100112143 | 375 |
| 81 | 3300006871 | Ga0075434_100067556 | Ga0075434_1000675563 | 375 |
| 82 | 3300045051 | Ga0451576_0000696 | Ga0451576_0000696_51246_52427 | 375 |
| 83 | 3300050511 | nmdc:mga08y16_45093_c1 | nmdc:mga08y16_45093_c1_288_1475 | 375 |
| 84 | 3300050512 | nmdc:mga0n895_2737_c1 | nmdc:mga0n895_2737_c1_8090_9277 | 375 |
| 85 | 3300005539 | Ga0068853_100000230 | Ga0068853_1000002305 | 376 |
| 86 | 3300026041 | Ga0207639_10000338 | Ga0207639_100003383 | 376 |
| 87 | 3300026089 | Ga0207648_10160414 | Ga0207648_101604142 | 376 |
| 88 | 3300048907 | Ga0496104_0009135 | Ga0496104_0009135_696_1883 | 376 |
| 89 | 3300048918 | Ga0496115_0032343 | Ga0496115_0032343_2788_3975 | 376 |
| 90 | iso_pu_bacteria | 2687453257 | 2688065515 | 376 |
| 91 | 3300005985 | Ga0081539_10005453 | Ga0081539_1000545310 | 377 |
| 92 | 3300006038 | Ga0075365_10036665 | Ga0075365_100366652 | 377 |
| 93 | 3300035083 | Ga0373926_0059021 | Ga0373926_0059021_247_1380 | 377 |
| 94 | 3300045051 | Ga0451576_0000051 | Ga0451576_0000051_137740_138918 | 377 |
| 95 | 3300005577 | Ga0068857_100006498 | Ga0068857_1000064984 | 379 |
| 96 | 3300025926 | Ga0207659_10112886 | Ga0207659_101128861 | 379 |
| 97 | 3300026116 | Ga0207674_10004781 | Ga0207674_100047815 | 379 |
| 98 | 3300046506 | Ga0495583_0010816 | Ga0495583_0010816_4129_5271 | 379 |
| 99 | 3300005335 | Ga0070666_10004186 | Ga0070666_100041861 | 380 |
| 100 | 3300005563 | Ga0068855_100161923 | Ga0068855_1001619231 | 380 |
| 101 | 3300025903 | Ga0207680_10000192 | Ga0207680_1000019216 | 380 |
| 102 | 3300025949 | Ga0207667_10108121 | Ga0207667_101081214 | 380 |
| 103 | 3300048929 | Ga0496126_0070293 | Ga0496126_0070293_1917_3095 | 380 |
| 104 | 3300039437 | Ga0436365_0924222 | Ga0436365_0924222_139_1317 | 381 |
| 105 | 3300039447 | Ga0436361_0984484 | Ga0436361_0984484_36_1220 | 381 |
| 106 | 3300048927 | Ga0496124_0158960 | Ga0496124_0158960_364_1740 | 381 |
| 107 | 3300049593 | Ga0501077_0134376 | Ga0501077_0134376_351_1538 | 381 |
| 108 | 3300053104 | Ga0500556_0002197 | Ga0500556_0002197_454_1608 | 381 |
| 109 | 3300054114 | Ga0501084_0087990 | Ga0501084_0087990_811_1998 | 381 |
| 110 | 3300003762 | Ga0055542_1000589 | Ga0055542_100058912 | 382 |
| 111 | 3300003763 | Ga0055529_1004088 | Ga0055529_10040882 | 382 |
| 112 | 3300003781 | Ga0055536_1000461 | Ga0055536_10004611 | 382 |
| 113 | 3300003781 | Ga0055536_1000666 | Ga0055536_10006661 | 382 |
| 114 | 3300003791 | Ga0055530_10000424 | Ga0055530_1000042429 | 382 |
| 115 | 3300003792 | Ga0055540_1000122 | Ga0055540_100012252 | 382 |
| 116 | 3300003794 | Ga0055531_10000146 | Ga0055531_1000014629 | 382 |
| 117 | 3300005288 | Ga0065714_10084763 | Ga0065714_100847632 | 382 |
| 118 | 3300005440 | Ga0070705_100049180 | Ga0070705_1000491803 | 382 |
| 119 | 3300005545 | Ga0070695_100010886 | Ga0070695_1000108866 | 382 |
| 120 | 3300006914 | Ga0075436_100002374 | Ga0075436_10000237415 | 382 |
| 121 | 3300009011 | Ga0105251_10034656 | Ga0105251_100346562 | 382 |
| 122 | 3300009092 | Ga0105250_10005639 | Ga0105250_100056396 | 382 |
| 123 | 3300009092 | Ga0105250_10043755 | Ga0105250_100437552 | 382 |
| 124 | 3300012498 | Ga0157345_1000058 | Ga0157345_10000581 | 382 |
| 125 | 3300013105 | Ga0157369_10002217 | Ga0157369_1000221719 | 382 |
| 126 | 3300013105 | Ga0157369_10002227 | Ga0157369_1000222720 | 382 |
| 127 | 3300013105 | Ga0157369_10298786 | Ga0157369_102987862 | 382 |
| 128 | 3300013105 | Ga0157369_10406137 | Ga0157369_104061371 | 382 |
| 129 | 3300017792 | Ga0163161_10006599 | Ga0163161_100065998 | 382 |
| 130 | 3300025254 | Ga0209148_1000384 | Ga0209148_100038423 | 382 |
| 131 | 3300025272 | Ga0209455_1000152 | Ga0209455_1000152104 | 382 |
| 132 | 3300025291 | Ga0209675_1005781 | Ga0209675_10057815 | 382 |
| 133 | 3300025292 | Ga0209676_1000020 | Ga0209676_1000020503 | 382 |
| 134 | 3300025292 | Ga0209676_1000102 | Ga0209676_1000102162 | 382 |
| 135 | 3300025298 | Ga0209050_1000105 | Ga0209050_1000105162 | 382 |
| 136 | 3300025303 | Ga0209051_1000066 | Ga0209051_1000066162 | 382 |
| 137 | 3300025304 | Ga0209257_1000124 | Ga0209257_100012428 | 382 |
| 138 | 3300025711 | Ga0207696_1002383 | Ga0207696_10023836 | 382 |
| 139 | 3300025711 | Ga0207696_1005207 | Ga0207696_10052072 | 382 |
| 140 | 3300025728 | Ga0207655_1007416 | Ga0207655_10074163 | 382 |
| 141 | 3300025735 | Ga0207713_1000883 | Ga0207713_100088324 | 382 |
| 142 | 3300030735 | Ga0316178_1118621 | Ga0316178_111862114 | 382 |
| 143 | 3300031548 | Ga0307408_100006252 | Ga0307408_1000062528 | 382 |
| 144 | 3300031548 | Ga0307408_100029279 | Ga0307408_1000292793 | 382 |
| 145 | 3300031911 | Ga0307412_10117093 | Ga0307412_101170931 | 382 |
| 146 | 3300032004 | Ga0307414_10156780 | Ga0307414_101567801 | 382 |
| 147 | 3300038705 | Ga0237819_00896 | Ga0237819_00896_3684_4865 | 382 |
| 148 | 3300041404 | Ga0439436_0001265 | Ga0439436_0001265_1828_3006 | 382 |
| 149 | 3300041405 | Ga0439438_005534 | Ga0439438_005534_707_1888 | 382 |
| 150 | 3300041405 | Ga0439438_006885 | Ga0439438_006885_2740_3921 | 382 |
| 151 | 3300041407 | Ga0439447_007714 | Ga0439447_007714_1581_2759 | 382 |
| 152 | 3300042006 | Ga0439432_013194 | Ga0439432_013194_570_1748 | 382 |
| 153 | 3300042006 | Ga0439432_014713 | Ga0439432_014713_1420_2601 | 382 |
| 154 | 3300042010 | Ga0439452_000221 | Ga0439452_000221_38994_40175 | 382 |
| 155 | 3300042435 | Ga0439434_0008880 | Ga0439434_0008880_815_1993 | 382 |
| 156 | 3300046458 | Ga0495591_003608 | Ga0495591_003608_6687_7868 | 382 |
| 157 | 3300046460 | Ga0495638_0007527 | Ga0495638_0007527_42_1223 | 382 |
| 158 | 3300046492 | Ga0495585_0002318 | Ga0495585_0002318_12481_13662 | 382 |
| 159 | 3300046501 | Ga0495607_0000668 | Ga0495607_0000668_32023_33204 | 382 |
| 160 | 3300046507 | Ga0495606_0044385 | Ga0495606_0044385_1725_2906 | 382 |
| 161 | 3300046512 | Ga0495610_0004539 | Ga0495610_0004539_8959_10140 | 382 |
| 162 | 3300046530 | Ga0495654_0003014 | Ga0495654_0003014_9284_10465 | 382 |
| 163 | 3300046692 | Ga0495671_0074401 | Ga0495671_0074401_51_1232 | 382 |
| 164 | 3300046694 | Ga0495649_0005219 | Ga0495649_0005219_66_1247 | 382 |
| 165 | 3300048925 | Ga0496122_0000259 | Ga0496122_0000259_84469_85662 | 382 |
| 166 | 3300048926 | Ga0496123_0000209 | Ga0496123_0000209_84498_85691 | 382 |
| 167 | 3300049459 | Ga0495678_004515 | Ga0495678_004515_33_1214 | 382 |
| 168 | 3300050513 | nmdc:mga0rr50_29874_c1 | nmdc:mga0rr50_29874_c1_2267_3445 | 382 |
| 169 | 3300050514 | nmdc:mga08x19_6_c2 | nmdc:mga08x19_6_c2_45196_46374 | 382 |
| 170 | 3300048923 | Ga0496120_0018028 | Ga0496120_0018028_1645_2868 | 383 |
| 171 | 3300048925 | Ga0496122_0012999 | Ga0496122_0012999_1322_2527 | 383 |
| 172 | 3300006847 | Ga0075431_100087766 | Ga0075431_1000877663 | 384 |
| 173 | 3300049741 | Ga0501079_0094950 | Ga0501079_0094950_453_1640 | 384 |
| 174 | 3300050510 | nmdc:mga06r32_84974_c1 | nmdc:mga06r32_84974_c1_485_1672 | 384 |
| 175 | 3300060353 | Ga0501082_0017108 | Ga0501082_0017108_3315_4502 | 384 |
| 176 | 3300006914 | Ga0075436_100043110 | Ga0075436_1000431102 | 385 |
| 177 | 3300007076 | Ga0075435_100079607 | Ga0075435_1000796072 | 385 |
| 178 | 3300050512 | nmdc:mga0n895_214691_c1 | nmdc:mga0n895_214691_c1_566_1741 | 385 |
| 179 | 3300050514 | nmdc:mga08x19_60609_c1 | nmdc:mga08x19_60609_c1_776_1951 | 385 |
| 180 | 3300050515 | nmdc:mga0a205_125132_c1 | nmdc:mga0a205_125132_c1_1134_2309 | 385 |
| 181 | iso_pu_bacteria | 2509276019 | 2509380352 | 385 |
| 182 | iso_pu_bacteria | 2522572158 | 2523102757 | 386 |
| 183 | iso_pu_bacteria | 2671180139 | 2671693840 | 386 |
| 184 | iso_pu_bacteria | 2834578030 | 2834579536 | 386 |
| 185 | iso_pu_bacteria | 2919138771 | 2919139565 | 386 |
| 186 | 3300031727 | Ga0316576_10042757 | Ga0316576_100427573 | 387 |
| 187 | iso_pu_bacteria | 2600254943 | 2600401724 | 387 |
| 188 | iso_pu_bacteria | 2615840698 | 2616550830 | 387 |
| 189 | iso_pu_bacteria | 2841957949 | 2841964569 | 387 |
| 190 | 3300005467 | Ga0070706_100004372 | Ga0070706_1000043726 | 388 |
| 191 | 3300005468 | Ga0070707_100064773 | Ga0070707_1000647732 | 388 |
| 192 | 3300005536 | Ga0070697_100127625 | Ga0070697_1001276252 | 388 |
| 193 | 3300025910 | Ga0207684_10006877 | Ga0207684_100068777 | 388 |
| 194 | 3300025922 | Ga0207646_10026623 | Ga0207646_100266234 | 388 |
| 195 | 3300049586 | Ga0501070_0187233 | Ga0501070_0187233_449_1663 | 388 |
| 196 | iso_pu_bacteria | 2609459761 | 2609914142 | 388 |
| 197 | iso_pu_bacteria | 2945874760 | 2945876230 | 388 |
| 198 | iso_pu_bacteria | 3007855910 | 3007856383 | 388 |
| 199 | iso_pu_bacteria | 8057304971 | 8057305068 | 388 |
| 200 | 3300005985 | Ga0081539_10010261 | Ga0081539_100102617 | 389 |
| 201 | 3300005985 | Ga0081539_10015990 | Ga0081539_100159904 | 389 |
| 202 | 3300021361 | Ga0213872_10000860 | Ga0213872_100008605 | 389 |
| 203 | 3300031235 | Ga0265330_10055322 | Ga0265330_100553222 | 389 |
| 204 | 3300031241 | Ga0265325_10058138 | Ga0265325_100581382 | 389 |
| 205 | 3300031249 | Ga0265339_10011897 | Ga0265339_100118975 | 389 |
| 206 | 3300031249 | Ga0265339_10036463 | Ga0265339_100364633 | 389 |
| 207 | 3300031665 | Ga0316575_10017975 | Ga0316575_100179752 | 389 |
| 208 | 3300031711 | Ga0265314_10014914 | Ga0265314_100149146 | 389 |
| 209 | 3300031712 | Ga0265342_10092051 | Ga0265342_100920512 | 389 |
| 210 | 3300031728 | Ga0316578_10000916 | Ga0316578_100009166 | 389 |
| 211 | 3300032002 | Ga0307416_100194892 | Ga0307416_1001948923 | 389 |
| 212 | 3300032137 | Ga0316585_10015583 | Ga0316585_100155832 | 389 |
| 213 | 3300032139 | Ga0316580_10013050 | Ga0316580_100130502 | 389 |
| 214 | 3300035398 | Ga0316574_0012119 | Ga0316574_0012119_2250_3428 | 389 |
| 215 | 3300038443 | Ga0395901_0085923 | Ga0395901_0085923_137_1309 | 389 |
| 216 | 3300039438 | Ga0436360_0886478 | Ga0436360_0886478_307_1485 | 389 |
| 217 | 3300039447 | Ga0436361_0453677 | Ga0436361_0453677_25395_26564 | 389 |
| 218 | 3300039447 | Ga0436361_1001866 | Ga0436361_1001866_20553_21722 | 389 |
| 219 | 3300045049 | Ga0466959_0035190 | Ga0466959_0035190_1875_3044 | 389 |
| 220 | 3300046689 | Ga0495613_0001199 | Ga0495613_0001199_3905_5074 | 389 |
| 221 | 3300053136 | Ga0500559_0000042 | Ga0500559_0000042_85674_86846 | 389 |
| 222 | iso_pu_bacteria | 2554235234 | 2555258593 | 389 |
| 223 | iso_pu_bacteria | 2593339131 | 2595091378 | 389 |
| 224 | iso_pu_bacteria | 2599185169 | 2599408997 | 389 |
| 225 | iso_pu_bacteria | 2600255254 | 2601522485 | 389 |
| 226 | iso_pu_bacteria | 2600255255 | 2601527512 | 389 |
| 227 | iso_pu_bacteria | 2600255280 | 2601614342 | 389 |
| 228 | iso_pu_bacteria | 2600255281 | 2601619063 | 389 |
| 229 | iso_pu_bacteria | 2600255287 | 2601642325 | 389 |
| 230 | iso_pu_bacteria | 2600255288 | 2601647179 | 389 |
| 231 | iso_pu_bacteria | 2600255289 | 2601652489 | 389 |
| 232 | iso_pu_bacteria | 2600255290 | 2601657816 | 389 |
| 233 | iso_pu_bacteria | 2600255291 | 2601662148 | 389 |
| 234 | iso_pu_bacteria | 2600255298 | 2601695106 | 389 |
| 235 | iso_pu_bacteria | 2600255299 | 2601699778 | 389 |
| 236 | iso_pu_bacteria | 2600255300 | 2601706335 | 389 |
| 237 | iso_pu_bacteria | 2600255301 | 2601710641 | 389 |
| 238 | iso_pu_bacteria | 2600255302 | 2601715655 | 389 |
| 239 | iso_pu_bacteria | 2600255303 | 2601720129 | 389 |
| 240 | iso_pu_bacteria | 2600255304 | 2601726060 | 389 |
| 241 | iso_pu_bacteria | 2600255305 | 2601730601 | 389 |
| 242 | iso_pu_bacteria | 2600255306 | 2601735618 | 389 |
| 243 | iso_pu_bacteria | 2600255307 | 2601740887 | 389 |
| 244 | iso_pu_bacteria | 2600255309 | 2601750817 | 389 |
| 245 | iso_pu_bacteria | 2600255392 | 2602018071 | 389 |
| 246 | iso_pu_bacteria | 2602042047 | 2603642730 | 389 |
| 247 | iso_pu_bacteria | 2602042052 | 2603659511 | 389 |
| 248 | iso_pu_bacteria | 2602042053 | 2603664787 | 389 |
| 249 | iso_pu_bacteria | 2602042067 | 2603703331 | 389 |
| 250 | iso_pu_bacteria | 2602042103 | 2603837993 | 389 |
| 251 | iso_pu_bacteria | 2602042104 | 2603843071 | 389 |
| 252 | iso_pu_bacteria | 2602042105 | 2603848144 | 389 |
| 253 | iso_pu_bacteria | 2602042106 | 2603853215 | 389 |
| 254 | iso_pu_bacteria | 2602042109 | 2603867150 | 389 |
| 255 | iso_pu_bacteria | 2602042110 | 2603871270 | 389 |
| 256 | iso_pu_bacteria | 2602042111 | 2603876192 | 389 |
| 257 | iso_pu_bacteria | 2603880178 | 2606048463 | 389 |
| 258 | iso_pu_bacteria | 2603880184 | 2606069214 | 389 |
| 259 | iso_pu_bacteria | 2603880202 | 2606145030 | 389 |
| 260 | iso_pu_bacteria | 2603880211 | 2606175864 | 389 |
| 261 | iso_pu_bacteria | 2609459761 | 2609912190 | 389 |
| 262 | iso_pu_bacteria | 2636415599 | 2637224901 | 389 |
| 263 | iso_pu_bacteria | 2667528172 | 2671103257 | 389 |
| 264 | iso_pu_bacteria | 2675903046 | 2676406137 | 389 |
| 265 | iso_pu_bacteria | 2681812866 | 2681997605 | 389 |
| 266 | iso_pu_bacteria | 2681812869 | 2682006883 | 389 |
| 267 | iso_pu_bacteria | 2738543017 | 2739269064 | 389 |
| 268 | iso_pu_bacteria | 2751185917 | 2753855684 | 389 |
| 269 | iso_pu_bacteria | 2765235842 | 2765588668 | 389 |
| 270 | iso_pu_bacteria | 2775506706 | 2775538672 | 389 |
| 271 | iso_pu_bacteria | 2775507074 | 2777022071 | 389 |
| 272 | iso_pu_bacteria | 2775507177 | 2777761910 | 389 |
| 273 | iso_pu_bacteria | 2775507192 | 2777839577 | 389 |
| 274 | iso_pu_bacteria | 2788500588 | 2791212505 | 389 |
| 275 | iso_pu_bacteria | 2818991451 | 2819626102 | 389 |
| 276 | iso_pu_bacteria | 2821118458 | 2821119487 | 389 |
| 277 | iso_pu_bacteria | 2823373977 | 2823374455 | 389 |
| 278 | iso_pu_bacteria | 2844425489 | 2844427226 | 389 |
| 279 | iso_pu_bacteria | 2852673933 | 2852675098 | 389 |
| 280 | iso_pu_bacteria | 2857586860 | 2857588011 | 389 |
| 281 | iso_pu_bacteria | 2904513164 | 2904514224 | 389 |
| 282 | iso_pu_bacteria | 2904606771 | 2904606772 | 389 |
| 283 | iso_pu_bacteria | 2919108558 | 2919110462 | 389 |
| 284 | iso_pu_bacteria | 2923634449 | 2923634548 | 389 |
| 285 | iso_pu_bacteria | 2927833300 | 2927834395 | 389 |
| 286 | iso_pu_bacteria | 2928510474 | 2928511811 | 389 |
| 287 | iso_pu_bacteria | 2936340661 | 2936345166 | 389 |
| 288 | iso_pu_bacteria | 2937539931 | 2937540260 | 389 |
| 289 | iso_pu_bacteria | 2939573065 | 2939573629 | 389 |
| 290 | iso_pu_bacteria | 2939593269 | 2939593417 | 389 |
| 291 | iso_pu_bacteria | 2945874760 | 2945877976 | 389 |
| 292 | iso_pu_bacteria | 2969079654 | 2969081884 | 389 |
| 293 | iso_pu_bacteria | 2971820967 | 2971821821 | 389 |
| 294 | iso_pu_bacteria | 2984559226 | 2984564313 | 389 |
| 295 | iso_pu_bacteria | 2984595703 | 2984597045 | 389 |
| 296 | iso_pu_bacteria | 3000376612 | 3000376911 | 389 |
| 297 | iso_pu_bacteria | 8018405270 | 8018408444 | 389 |
| 298 | iso_pu_bacteria | 8054844752 | 8054845071 | 389 |
| 299 | iso_pu_bacteria | 8055531788 | 8055533182 | 389 |
| 300 | 3300001904 | JGI24736J21556_1001340 | JGI24736J21556_10013403 | 390 |
| 301 | 3300002067 | JGI24735J21928_10001258 | JGI24735J21928_100012582 | 390 |
| 302 | 3300003162 | Ga0006778J45830_1026826 | Ga0006778J45830_10268261 | 390 |
| 303 | 3300003320 | rootH2_10023994 | rootH2_1002399416 | 390 |
| 304 | 3300003577 | Ga0007416J51690_1021970 | Ga0007416J51690_10219701 | 390 |
| 305 | 3300003579 | Ga0007429J51699_1018838 | Ga0007429J51699_10188381 | 390 |
| 306 | 3300005289 | Ga0065704_10083393 | Ga0065704_100833932 | 390 |
| 307 | 3300005295 | Ga0065707_10105464 | Ga0065707_101054642 | 390 |
| 308 | 3300005327 | Ga0070658_10006314 | Ga0070658_100063147 | 390 |
| 309 | 3300005328 | Ga0070676_10055192 | Ga0070676_100551921 | 390 |
| 310 | 3300005328 | Ga0070676_10061532 | Ga0070676_100615322 | 390 |
| 311 | 3300005330 | Ga0070690_100049678 | Ga0070690_1000496781 | 390 |
| 312 | 3300005331 | Ga0070670_100057539 | Ga0070670_1000575394 | 390 |
| 313 | 3300005336 | Ga0070680_100009507 | Ga0070680_1000095075 | 390 |
| 314 | 3300005340 | Ga0070689_100015633 | Ga0070689_1000156336 | 390 |
| 315 | 3300005340 | Ga0070689_100065480 | Ga0070689_1000654804 | 390 |
| 316 | 3300005345 | Ga0070692_10129027 | Ga0070692_101290271 | 390 |
| 317 | 3300005347 | Ga0070668_100000707 | Ga0070668_10000070720 | 390 |
| 318 | 3300005364 | Ga0070673_100067712 | Ga0070673_1000677121 | 390 |
| 319 | 3300005365 | Ga0070688_100022333 | Ga0070688_1000223333 | 390 |
| 320 | 3300005367 | Ga0070667_100003824 | Ga0070667_1000038246 | 390 |
| 321 | 3300005434 | Ga0070709_10065471 | Ga0070709_100654712 | 390 |
| 322 | 3300005435 | Ga0070714_100074276 | Ga0070714_1000742762 | 390 |
| 323 | 3300005436 | Ga0070713_100037681 | Ga0070713_1000376815 | 390 |
| 324 | 3300005436 | Ga0070713_100051297 | Ga0070713_1000512972 | 390 |
| 325 | 3300005436 | Ga0070713_100063212 | Ga0070713_1000632122 | 390 |
| 326 | 3300005437 | Ga0070710_10021576 | Ga0070710_100215763 | 390 |
| 327 | 3300005441 | Ga0070700_100006997 | Ga0070700_1000069974 | 390 |
| 328 | 3300005444 | Ga0070694_100001005 | Ga0070694_1000010057 | 390 |
| 329 | 3300005445 | Ga0070708_100026124 | Ga0070708_1000261245 | 390 |
| 330 | 3300005455 | Ga0070663_100020685 | Ga0070663_1000206854 | 390 |
| 331 | 3300005458 | Ga0070681_10004050 | Ga0070681_1000405012 | 390 |
| 332 | 3300005458 | Ga0070681_10078648 | Ga0070681_100786482 | 390 |
| 333 | 3300005458 | Ga0070681_10145752 | Ga0070681_101457522 | 390 |
| 334 | 3300005459 | Ga0068867_100027781 | Ga0068867_1000277813 | 390 |
| 335 | 3300005466 | Ga0070685_10093879 | Ga0070685_100938792 | 390 |
| 336 | 3300005467 | Ga0070706_100153608 | Ga0070706_1001536082 | 390 |
| 337 | 3300005518 | Ga0070699_100000540 | Ga0070699_10000054032 | 390 |
| 338 | 3300005518 | Ga0070699_100184242 | Ga0070699_1001842422 | 390 |
| 339 | 3300005530 | Ga0070679_100025738 | Ga0070679_1000257382 | 390 |
| 340 | 3300005530 | Ga0070679_100073177 | Ga0070679_1000731773 | 390 |
| 341 | 3300005535 | Ga0070684_100100836 | Ga0070684_1001008364 | 390 |
| 342 | 3300005539 | Ga0068853_100360062 | Ga0068853_1003600621 | 390 |
| 343 | 3300005545 | Ga0070695_100000710 | Ga0070695_1000007104 | 390 |
| 344 | 3300005546 | Ga0070696_100000156 | Ga0070696_10000015640 | 390 |
| 345 | 3300005548 | Ga0070665_100006587 | Ga0070665_1000065875 | 390 |
| 346 | 3300005563 | Ga0068855_100000034 | Ga0068855_10000003438 | 390 |
| 347 | 3300005578 | Ga0068854_100106278 | Ga0068854_1001062782 | 390 |
| 348 | 3300005578 | Ga0068854_100185818 | Ga0068854_1001858182 | 390 |
| 349 | 3300005617 | Ga0068859_100199657 | Ga0068859_1001996571 | 390 |
| 350 | 3300005842 | Ga0068858_100037806 | Ga0068858_1000378062 | 390 |
| 351 | 3300005843 | Ga0068860_100000351 | Ga0068860_10000035120 | 390 |
| 352 | 3300005843 | Ga0068860_100078572 | Ga0068860_1000785723 | 390 |
| 353 | 3300005844 | Ga0068862_100024035 | Ga0068862_1000240356 | 390 |
| 354 | 3300005844 | Ga0068862_100045374 | Ga0068862_1000453741 | 390 |
| 355 | 3300005844 | Ga0068862_100063471 | Ga0068862_1000634712 | 390 |
| 356 | 3300005937 | Ga0081455_10001108 | Ga0081455_1000110812 | 390 |
| 357 | 3300005937 | Ga0081455_10045047 | Ga0081455_100450474 | 390 |
| 358 | 3300005937 | Ga0081455_10100945 | Ga0081455_101009452 | 390 |
| 359 | 3300005981 | Ga0081538_10007910 | Ga0081538_100079106 | 390 |
| 360 | 3300005981 | Ga0081538_10018206 | Ga0081538_100182065 | 390 |
| 361 | 3300005981 | Ga0081538_10020695 | Ga0081538_100206954 | 390 |
| 362 | 3300005985 | Ga0081539_10000977 | Ga0081539_1000097712 | 390 |
| 363 | 3300006028 | Ga0070717_10024871 | Ga0070717_100248714 | 390 |
| 364 | 3300006028 | Ga0070717_10057481 | Ga0070717_100574813 | 390 |
| 365 | 3300006028 | Ga0070717_10080726 | Ga0070717_100807262 | 390 |
| 366 | 3300006038 | Ga0075365_10009401 | Ga0075365_100094016 | 390 |
| 367 | 3300006048 | Ga0075363_100038942 | Ga0075363_1000389422 | 390 |
| 368 | 3300006163 | Ga0070715_10015199 | Ga0070715_100151994 | 390 |
| 369 | 3300006173 | Ga0070716_100027329 | Ga0070716_1000273292 | 390 |
| 370 | 3300006173 | Ga0070716_100216075 | Ga0070716_1002160751 | 390 |
| 371 | 3300006175 | Ga0070712_100014972 | Ga0070712_1000149722 | 390 |
| 372 | 3300006175 | Ga0070712_100068020 | Ga0070712_1000680202 | 390 |
| 373 | 3300006195 | Ga0075366_10017931 | Ga0075366_100179312 | 390 |
| 374 | 3300006353 | Ga0075370_10011338 | Ga0075370_100113385 | 390 |
| 375 | 3300006844 | Ga0075428_100002387 | Ga0075428_10000238710 | 390 |
| 376 | 3300006844 | Ga0075428_100057384 | Ga0075428_1000573842 | 390 |
| 377 | 3300006846 | Ga0075430_100060823 | Ga0075430_1000608231 | 390 |
| 378 | 3300006846 | Ga0075430_100089607 | Ga0075430_1000896074 | 390 |
| 379 | 3300006847 | Ga0075431_100005137 | Ga0075431_1000051379 | 390 |
| 380 | 3300006871 | Ga0075434_100091899 | Ga0075434_1000918992 | 390 |
| 381 | 3300006871 | Ga0075434_100192022 | Ga0075434_1001920222 | 390 |
| 382 | 3300006931 | Ga0097620_100199661 | Ga0097620_1001996611 | 390 |
| 383 | 3300007076 | Ga0075435_100029369 | Ga0075435_1000293692 | 390 |
| 384 | 3300007265 | Ga0099794_10008524 | Ga0099794_100085242 | 390 |
| 385 | 3300009011 | Ga0105251_10001689 | Ga0105251_100016893 | 390 |
| 386 | 3300009093 | Ga0105240_10022032 | Ga0105240_100220325 | 390 |
| 387 | 3300009094 | Ga0111539_10018998 | Ga0111539_100189983 | 390 |
| 388 | 3300009098 | Ga0105245_10005334 | Ga0105245_100053349 | 390 |
| 389 | 3300009147 | Ga0114129_10023661 | Ga0114129_100236617 | 390 |
| 390 | 3300009147 | Ga0114129_10032683 | Ga0114129_100326835 | 390 |
| 391 | 3300009147 | Ga0114129_10040156 | Ga0114129_100401563 | 390 |
| 392 | 3300009174 | Ga0105241_10016604 | Ga0105241_100166042 | 390 |
| 393 | 3300009177 | Ga0105248_10000001 | Ga0105248_10000001573 | 390 |
| 394 | 3300009177 | Ga0105248_10024110 | Ga0105248_100241107 | 390 |
| 395 | 3300009177 | Ga0105248_10069958 | Ga0105248_100699583 | 390 |
| 396 | 3300009553 | Ga0105249_10299309 | Ga0105249_102993091 | 390 |
| 397 | 3300009978 | Ga0105148_100251 | Ga0105148_1002518 | 390 |
| 398 | 3300010159 | Ga0099796_10000988 | Ga0099796_100009885 | 390 |
| 399 | 3300010159 | Ga0099796_10004076 | Ga0099796_100040764 | 390 |
| 400 | 3300011119 | Ga0105246_10004282 | Ga0105246_100042823 | 390 |
| 401 | 3300013104 | Ga0157370_10110370 | Ga0157370_101103702 | 390 |
| 402 | 3300013296 | Ga0157374_10098952 | Ga0157374_100989522 | 390 |
| 403 | 3300013306 | Ga0163162_10201294 | Ga0163162_102012942 | 390 |
| 404 | 3300013307 | Ga0157372_10337573 | Ga0157372_103375732 | 390 |
| 405 | 3300013308 | Ga0157375_10254859 | Ga0157375_102548592 | 390 |
| 406 | 3300014325 | Ga0163163_10245913 | Ga0163163_102459131 | 390 |
| 407 | 3300014497 | Ga0182008_10101987 | Ga0182008_101019871 | 390 |
| 408 | 3300020070 | Ga0206356_10667046 | Ga0206356_106670462 | 390 |
| 409 | 3300021361 | Ga0213872_10022550 | Ga0213872_100225502 | 390 |
| 410 | 3300023672 | Ga0247553_100221 | Ga0247553_1002211 | 390 |
| 411 | 3300024227 | Ga0228598_1000875 | Ga0228598_10008757 | 390 |
| 412 | 3300025735 | Ga0207713_1000370 | Ga0207713_100037016 | 390 |
| 413 | 3300025885 | Ga0207653_10000724 | Ga0207653_100007241 | 390 |
| 414 | 3300025898 | Ga0207692_10022673 | Ga0207692_100226732 | 390 |
| 415 | 3300025898 | Ga0207692_10095516 | Ga0207692_100955161 | 390 |
| 416 | 3300025901 | Ga0207688_10006050 | Ga0207688_100060502 | 390 |
| 417 | 3300025905 | Ga0207685_10004693 | Ga0207685_100046932 | 390 |
| 418 | 3300025906 | Ga0207699_10158718 | Ga0207699_101587182 | 390 |
| 419 | 3300025907 | Ga0207645_10046281 | Ga0207645_100462814 | 390 |
| 420 | 3300025910 | Ga0207684_10033976 | Ga0207684_100339762 | 390 |
| 421 | 3300025912 | Ga0207707_10013817 | Ga0207707_100138177 | 390 |
| 422 | 3300025912 | Ga0207707_10019402 | Ga0207707_100194025 | 390 |
| 423 | 3300025913 | Ga0207695_10141179 | Ga0207695_101411792 | 390 |
| 424 | 3300025915 | Ga0207693_10002296 | Ga0207693_100022962 | 390 |
| 425 | 3300025915 | Ga0207693_10024341 | Ga0207693_100243412 | 390 |
| 426 | 3300025915 | Ga0207693_10049456 | Ga0207693_100494562 | 390 |
| 427 | 3300025915 | Ga0207693_10064671 | Ga0207693_100646712 | 390 |
| 428 | 3300025916 | Ga0207663_10019794 | Ga0207663_100197943 | 390 |
| 429 | 3300025917 | Ga0207660_10003986 | Ga0207660_100039862 | 390 |
| 430 | 3300025917 | Ga0207660_10184586 | Ga0207660_101845862 | 390 |
| 431 | 3300025925 | Ga0207650_10002443 | Ga0207650_100024438 | 390 |
| 432 | 3300025927 | Ga0207687_10066936 | Ga0207687_100669362 | 390 |
| 433 | 3300025928 | Ga0207700_10007976 | Ga0207700_100079765 | 390 |
| 434 | 3300025928 | Ga0207700_10075251 | Ga0207700_100752512 | 390 |
| 435 | 3300025928 | Ga0207700_10301932 | Ga0207700_103019321 | 390 |
| 436 | 3300025929 | Ga0207664_10079190 | Ga0207664_100791902 | 390 |
| 437 | 3300025936 | Ga0207670_10009459 | Ga0207670_100094592 | 390 |
| 438 | 3300025936 | Ga0207670_10016209 | Ga0207670_100162092 | 390 |
| 439 | 3300025936 | Ga0207670_10170450 | Ga0207670_101704501 | 390 |
| 440 | 3300025939 | Ga0207665_10000117 | Ga0207665_1000011747 | 390 |
| 441 | 3300025939 | Ga0207665_10272203 | Ga0207665_102722031 | 390 |
| 442 | 3300025940 | Ga0207691_10133928 | Ga0207691_101339282 | 390 |
| 443 | 3300025941 | Ga0207711_10000001 | Ga0207711_100000011297 | 390 |
| 444 | 3300025941 | Ga0207711_10013853 | Ga0207711_100138537 | 390 |
| 445 | 3300025960 | Ga0207651_10014448 | Ga0207651_100144482 | 390 |
| 446 | 3300025961 | Ga0207712_10014325 | Ga0207712_100143254 | 390 |
| 447 | 3300025972 | Ga0207668_10000002 | Ga0207668_10000002107 | 390 |
| 448 | 3300025972 | Ga0207668_10033453 | Ga0207668_100334532 | 390 |
| 449 | 3300025981 | Ga0207640_10073191 | Ga0207640_100731912 | 390 |
| 450 | 3300025981 | Ga0207640_10096434 | Ga0207640_100964342 | 390 |
| 451 | 3300026035 | Ga0207703_10003659 | Ga0207703_100036592 | 390 |
| 452 | 3300026041 | Ga0207639_10017877 | Ga0207639_100178775 | 390 |
| 453 | 3300026067 | Ga0207678_10029207 | Ga0207678_100292073 | 390 |
| 454 | 3300026075 | Ga0207708_10013835 | Ga0207708_100138352 | 390 |
| 455 | 3300026089 | Ga0207648_10040324 | Ga0207648_100403243 | 390 |
| 456 | 3300026116 | Ga0207674_10013979 | Ga0207674_100139796 | 390 |
| 457 | 3300026142 | Ga0207698_10142237 | Ga0207698_101422372 | 390 |
| 458 | 3300027312 | Ga0209371_1006607 | Ga0209371_10066073 | 390 |
| 459 | 3300027866 | Ga0209813_10012558 | Ga0209813_100125583 | 390 |
| 460 | 3300027876 | Ga0209974_10026553 | Ga0209974_100265532 | 390 |
| 461 | 3300028379 | Ga0268266_10000811 | Ga0268266_1000081137 | 390 |
| 462 | 3300028380 | Ga0268265_10006024 | Ga0268265_100060246 | 390 |
| 463 | 3300028381 | Ga0268264_10000749 | Ga0268264_1000074917 | 390 |
| 464 | 3300028381 | Ga0268264_10035403 | Ga0268264_100354033 | 390 |
| 465 | 3300028786 | Ga0307517_10008180 | Ga0307517_1000818014 | 390 |
| 466 | 3300030500 | Ga0268256_1006662 | Ga0268256_10066623 | 390 |
| 467 | 3300031240 | Ga0265320_10000039 | Ga0265320_1000003968 | 390 |
| 468 | 3300031241 | Ga0265325_10048989 | Ga0265325_100489892 | 390 |
| 469 | 3300031247 | Ga0265340_10040691 | Ga0265340_100406912 | 390 |
| 470 | 3300031456 | Ga0307513_10000077 | Ga0307513_1000007789 | 390 |
| 471 | 3300031711 | Ga0265314_10019715 | Ga0265314_100197153 | 390 |
| 472 | 3300031731 | Ga0307405_10082306 | Ga0307405_100823062 | 390 |
| 473 | 3300031852 | Ga0307410_10023315 | Ga0307410_100233152 | 390 |
| 474 | 3300031852 | Ga0307410_10154752 | Ga0307410_101547522 | 390 |
| 475 | 3300031911 | Ga0307412_10085309 | Ga0307412_100853092 | 390 |
| 476 | 3300031995 | Ga0307409_100219446 | Ga0307409_1002194462 | 390 |
| 477 | 3300032002 | Ga0307416_100053199 | Ga0307416_1000531992 | 390 |
| 478 | 3300032120 | Ga0316053_101354 | Ga0316053_1013541 | 390 |
| 479 | 3300035083 | Ga0373926_0013371 | Ga0373926_0013371_423_1601 | 390 |
| 480 | 3300035089 | Ga0373944_0002385 | Ga0373944_0002385_1076_2251 | 390 |
| 481 | 3300035111 | Ga0373923_0009386 | Ga0373923_0009386_1567_2814 | 390 |
| 482 | 3300035112 | Ga0373932_0011803 | Ga0373932_0011803_77_1330 | 390 |
| 483 | 3300035114 | Ga0373939_0019131 | Ga0373939_0019131_114_1289 | 390 |
| 484 | 3300035119 | Ga0373956_0012242 | Ga0373956_0012242_461_1708 | 390 |
| 485 | 3300035119 | Ga0373956_0052707 | Ga0373956_0052707_99_1286 | 390 |
| 486 | 3300035170 | Ga0373943_0007037 | Ga0373943_0007037_936_2111 | 390 |
| 487 | 3300035172 | Ga0373955_0026576 | Ga0373955_0026576_1146_2393 | 390 |
| 488 | 3300035241 | Ga0373961_0004207 | Ga0373961_0004207_1091_2266 | 390 |
| 489 | 3300035410 | Ga0373924_0051158 | Ga0373924_0051158_453_1628 | 390 |
| 490 | 3300035691 | Ga0373931_0009777 | Ga0373931_0009777_2850_4025 | 390 |
| 491 | 3300035692 | Ga0373935_0001583 | Ga0373935_0001583_1422_2597 | 390 |
| 492 | 3300035692 | Ga0373935_0003507 | Ga0373935_0003507_7269_8447 | 390 |
| 493 | 3300035692 | Ga0373935_0052567 | Ga0373935_0052567_614_1861 | 390 |
| 494 | 3300035695 | Ga0373927_0000243 | Ga0373927_0000243_10669_11844 | 390 |
| 495 | 3300035695 | Ga0373927_0050482 | Ga0373927_0050482_1213_2388 | 390 |
| 496 | 3300035724 | Ga0373933_0008345 | Ga0373933_0008345_1949_3136 | 390 |
| 497 | 3300035724 | Ga0373933_0039115 | Ga0373933_0039115_1177_2352 | 390 |
| 498 | 3300035724 | Ga0373933_0075339 | Ga0373933_0075339_589_1836 | 390 |
| 499 | 3300035725 | Ga0373947_0006288 | Ga0373947_0006288_4818_5993 | 390 |
| 500 | 3300036401 | Ga0373937_0014589 | Ga0373937_0014589_297_1472 | 390 |
| 501 | 3300036401 | Ga0373937_0041928 | Ga0373937_0041928_2622_3869 | 390 |
| 502 | 3300036401 | Ga0373937_0057447 | Ga0373937_0057447_1051_2238 | 390 |
| 503 | 3300036647 | Ga0316582_0039051 | Ga0316582_0039051_933_2129 | 390 |
| 504 | 3300037068 | Ga0373925_0102445 | Ga0373925_0102445_152_1327 | 390 |
| 505 | 3300037466 | Ga0395898_0041459 | Ga0395898_0041459_2178_3353 | 390 |
| 506 | 3300037853 | Ga0436364_0777042 | Ga0436364_0777042_61_1236 | 390 |
| 507 | 3300037853 | Ga0436364_0943381 | Ga0436364_0943381_794_1981 | 390 |
| 508 | 3300039437 | Ga0436365_1805879 | Ga0436365_1805879_1298_2473 | 390 |
| 509 | 3300039450 | Ga0436363_0452161 | Ga0436363_0452161_53_1225 | 390 |
| 510 | 3300039450 | Ga0436363_1190291 | Ga0436363_1190291_115_1359 | 390 |
| 511 | 3300042008 | Ga0439450_000469 | Ga0439450_000469_1587_2792 | 390 |
| 512 | 3300042139 | Ga0450904_001512 | Ga0450904_001512_819_2024 | 390 |
| 513 | 3300042530 | Ga0450916_001727 | Ga0450916_001727_598_1803 | 390 |
| 514 | 3300044712 | Ga0453684_0011998 | Ga0453684_0011998_9700_10872 | 390 |
| 515 | 3300044712 | Ga0453684_0244145 | Ga0453684_0244145_503_1789 | 390 |
| 516 | 3300044901 | Ga0466960_0136396 | Ga0466960_0136396_76_1281 | 390 |
| 517 | 3300046459 | Ga0495629_0029522 | Ga0495629_0029522_2359_3534 | 390 |
| 518 | 3300046461 | Ga0495641_0042091 | Ga0495641_0042091_107_1285 | 390 |
| 519 | 3300046462 | Ga0495651_0019514 | Ga0495651_0019514_299_1474 | 390 |
| 520 | 3300046462 | Ga0495651_0130188 | Ga0495651_0130188_294_1469 | 390 |
| 521 | 3300046463 | Ga0495653_0027546 | Ga0495653_0027546_3268_4443 | 390 |
| 522 | 3300046472 | Ga0495580_0046745 | Ga0495580_0046745_139_1317 | 390 |
| 523 | 3300046476 | Ga0495662_0025639 | Ga0495662_0025639_161_1336 | 390 |
| 524 | 3300046476 | Ga0495662_0053389 | Ga0495662_0053389_367_1545 | 390 |
| 525 | 3300046477 | Ga0495664_0069604 | Ga0495664_0069604_397_1575 | 390 |
| 526 | 3300046491 | Ga0495584_0020115 | Ga0495584_0020115_901_2076 | 390 |
| 527 | 3300046506 | Ga0495583_0000447 | Ga0495583_0000447_55186_56358 | 390 |
| 528 | 3300046511 | Ga0495608_0061405 | Ga0495608_0061405_1213_2388 | 390 |
| 529 | 3300046514 | Ga0495618_0131624 | Ga0495618_0131624_304_1482 | 390 |
| 530 | 3300046516 | Ga0495628_0045518 | Ga0495628_0045518_250_1425 | 390 |
| 531 | 3300046529 | Ga0495652_0077715 | Ga0495652_0077715_453_1628 | 390 |
| 532 | 3300046529 | Ga0495652_0094290 | Ga0495652_0094290_11_1186 | 390 |
| 533 | 3300046533 | Ga0495640_0005373 | Ga0495640_0005373_8134_9309 | 390 |
| 534 | 3300046533 | Ga0495640_0061829 | Ga0495640_0061829_69_1247 | 390 |
| 535 | 3300046536 | Ga0495587_0018878 | Ga0495587_0018878_1682_2857 | 390 |
| 536 | 3300046536 | Ga0495587_0069761 | Ga0495587_0069761_348_1574 | 390 |
| 537 | 3300046543 | Ga0495645_0001277 | Ga0495645_0001277_14941_16116 | 390 |
| 538 | 3300046559 | Ga0495667_0128996 | Ga0495667_0128996_250_1428 | 390 |
| 539 | 3300046642 | Ga0495634_0066926 | Ga0495634_0066926_663_1841 | 390 |
| 540 | 3300046663 | Ga0495635_0020720 | Ga0495635_0020720_88_1266 | 390 |
| 541 | 3300046678 | Ga0495599_0033264 | Ga0495599_0033264_2027_3202 | 390 |
| 542 | 3300046680 | Ga0495646_0031506 | Ga0495646_0031506_465_1640 | 390 |
| 543 | 3300046683 | Ga0495658_0075819 | Ga0495658_0075819_72_1247 | 390 |
| 544 | 3300046689 | Ga0495613_0187394 | Ga0495613_0187394_104_1279 | 390 |
| 545 | 3300046809 | Ga0495600_0068905 | Ga0495600_0068905_1085_2260 | 390 |
| 546 | 3300047317 | Ga0495604_0024793 | Ga0495604_0024793_2309_3484 | 390 |
| 547 | 3300047317 | Ga0495604_0203218 | Ga0495604_0203218_43_1218 | 390 |
| 548 | 3300047319 | Ga0495674_0002065 | Ga0495674_0002065_13754_14929 | 390 |
| 549 | 3300047319 | Ga0495674_0018921 | Ga0495674_0018921_3257_4435 | 390 |
| 550 | 3300047319 | Ga0495674_0109410 | Ga0495674_0109410_344_1519 | 390 |
| 551 | 3300047321 | Ga0495676_0124179 | Ga0495676_0124179_686_1861 | 390 |
| 552 | 3300047322 | Ga0495680_0074380 | Ga0495680_0074380_214_1389 | 390 |
| 553 | 3300047444 | Ga0495675_0059761 | Ga0495675_0059761_1023_2198 | 390 |
| 554 | 3300047471 | Ga0495684_0014934 | Ga0495684_0014934_1511_2686 | 390 |
| 555 | 3300047471 | Ga0495684_0067146 | Ga0495684_0067146_182_1357 | 390 |
| 556 | 3300047471 | Ga0495684_0091239 | Ga0495684_0091239_896_2071 | 390 |
| 557 | 3300047673 | Ga0495593_0015025 | Ga0495593_0015025_1430_2605 | 390 |
| 558 | 3300047673 | Ga0495593_0021887 | Ga0495593_0021887_2173_3351 | 390 |
| 559 | 3300048088 | Ga0495602_0024310 | Ga0495602_0024310_4055_5230 | 390 |
| 560 | 3300048088 | Ga0495602_0177774 | Ga0495602_0177774_79_1269 | 390 |
| 561 | 3300048904 | Ga0496101_0057632 | Ga0496101_0057632_167_1342 | 390 |
| 562 | 3300048905 | Ga0496102_0024135 | Ga0496102_0024135_4087_5274 | 390 |
| 563 | 3300048905 | Ga0496102_0238494 | Ga0496102_0238494_192_1367 | 390 |
| 564 | 3300048905 | Ga0496102_0243049 | Ga0496102_0243049_242_1417 | 390 |
| 565 | 3300048906 | Ga0496103_0011761 | Ga0496103_0011761_2526_3713 | 390 |
| 566 | 3300048907 | Ga0496104_0002199 | Ga0496104_0002199_7817_9004 | 390 |
| 567 | 3300048907 | Ga0496104_0013664 | Ga0496104_0013664_1627_2805 | 390 |
| 568 | 3300048907 | Ga0496104_0085492 | Ga0496104_0085492_893_2080 | 390 |
| 569 | 3300048908 | Ga0496105_0002469 | Ga0496105_0002469_8355_9542 | 390 |
| 570 | 3300048908 | Ga0496105_0006002 | Ga0496105_0006002_7070_8248 | 390 |
| 571 | 3300048908 | Ga0496105_0091271 | Ga0496105_0091271_167_1342 | 390 |
| 572 | 3300048909 | Ga0496106_0001760 | Ga0496106_0001760_4114_5301 | 390 |
| 573 | 3300048909 | Ga0496106_0022779 | Ga0496106_0022779_3248_4423 | 390 |
| 574 | 3300048909 | Ga0496106_0022817 | Ga0496106_0022817_955_2241 | 390 |
| 575 | 3300048910 | Ga0496107_0033613 | Ga0496107_0033613_675_1853 | 390 |
| 576 | 3300048911 | Ga0496108_0002321 | Ga0496108_0002321_10475_11662 | 390 |
| 577 | 3300048911 | Ga0496108_0010630 | Ga0496108_0010630_5727_7043 | 390 |
| 578 | 3300048911 | Ga0496108_0087161 | Ga0496108_0087161_436_1611 | 390 |
| 579 | 3300048912 | Ga0496109_0033184 | Ga0496109_0033184_511_1698 | 390 |
| 580 | 3300048913 | Ga0496110_0004012 | Ga0496110_0004012_2988_4175 | 390 |
| 581 | 3300048913 | Ga0496110_0006378 | Ga0496110_0006378_7583_8827 | 390 |
| 582 | 3300048913 | Ga0496110_0014478 | Ga0496110_0014478_3439_4614 | 390 |
| 583 | 3300048913 | Ga0496110_0167942 | Ga0496110_0167942_615_1820 | 390 |
| 584 | 3300048913 | Ga0496110_0256996 | Ga0496110_0256996_28_1203 | 390 |
| 585 | 3300048914 | Ga0496111_0005262 | Ga0496111_0005262_5660_6847 | 390 |
| 586 | 3300048914 | Ga0496111_0066041 | Ga0496111_0066041_1271_2446 | 390 |
| 587 | 3300048914 | Ga0496111_0110256 | Ga0496111_0110256_566_1852 | 390 |
| 588 | 3300048915 | Ga0496112_0007190 | Ga0496112_0007190_5775_6950 | 390 |
| 589 | 3300048915 | Ga0496112_0028322 | Ga0496112_0028322_2137_3312 | 390 |
| 590 | 3300048915 | Ga0496112_0062681 | Ga0496112_0062681_502_1677 | 390 |
| 591 | 3300048916 | Ga0496113_0184103 | Ga0496113_0184103_292_1467 | 390 |
| 592 | 3300048918 | Ga0496115_0029287 | Ga0496115_0029287_2255_3430 | 390 |
| 593 | 3300049530 | Ga0501314_003831 | Ga0501314_003831_19_1191 | 390 |
| 594 | 3300049568 | Ga0501031_0004673 | Ga0501031_0004673_106_1281 | 390 |
| 595 | 3300049569 | Ga0501032_0000045 | Ga0501032_0000045_25310_26530 | 390 |
| 596 | 3300049569 | Ga0501032_0004902 | Ga0501032_0004902_838_2013 | 390 |
| 597 | 3300049570 | Ga0501033_0036195 | Ga0501033_0036195_1468_2664 | 390 |
| 598 | 3300049571 | Ga0501034_0000001 | Ga0501034_0000001_1851183_1852403 | 390 |
| 599 | 3300049571 | Ga0501034_0080709 | Ga0501034_0080709_1227_2402 | 390 |
| 600 | 3300049571 | Ga0501034_0116188 | Ga0501034_0116188_682_1857 | 390 |
| 601 | 3300049571 | Ga0501034_0120067 | Ga0501034_0120067_1422_2594 | 390 |
| 602 | 3300049573 | Ga0501037_0003548 | Ga0501037_0003548_8792_9967 | 390 |
| 603 | 3300049574 | Ga0501038_0001565 | Ga0501038_0001565_7872_9047 | 390 |
| 604 | 3300049574 | Ga0501038_0059157 | Ga0501038_0059157_1338_2513 | 390 |
| 605 | 3300049574 | Ga0501038_0128540 | Ga0501038_0128540_835_2025 | 390 |
| 606 | 3300049575 | Ga0501039_0000041 | Ga0501039_0000041_70326_71546 | 390 |
| 607 | 3300049575 | Ga0501039_0004448 | Ga0501039_0004448_8294_9469 | 390 |
| 608 | 3300049580 | Ga0501046_0003231 | Ga0501046_0003231_4826_6001 | 390 |
| 609 | 3300049581 | Ga0501047_0172586 | Ga0501047_0172586_216_1391 | 390 |
| 610 | 3300049582 | Ga0501048_0004383 | Ga0501048_0004383_8109_9284 | 390 |
| 611 | 3300049583 | Ga0501067_0002609 | Ga0501067_0002609_5173_6348 | 390 |
| 612 | 3300049583 | Ga0501067_0036201 | Ga0501067_0036201_1320_2498 | 390 |
| 613 | 3300049586 | Ga0501070_0022527 | Ga0501070_0022527_3958_5133 | 390 |
| 614 | 3300049586 | Ga0501070_0102913 | Ga0501070_0102913_1005_2180 | 390 |
| 615 | 3300049587 | Ga0501071_0027148 | Ga0501071_0027148_2271_3446 | 390 |
| 616 | 3300049590 | Ga0501074_0005445 | Ga0501074_0005445_397_1572 | 390 |
| 617 | 3300049590 | Ga0501074_0136259 | Ga0501074_0136259_174_1349 | 390 |
| 618 | 3300049593 | Ga0501077_0101486 | Ga0501077_0101486_335_1510 | 390 |
| 619 | 3300049593 | Ga0501077_0195196 | Ga0501077_0195196_47_1222 | 390 |
| 620 | 3300049663 | Ga0501223_000043 | Ga0501223_000043_20868_22040 | 390 |
| 621 | 3300049664 | Ga0501224_000019 | Ga0501224_000019_55709_56881 | 390 |
| 622 | 3300049668 | Ga0501233_000077 | Ga0501233_000077_6224_7396 | 390 |
| 623 | 3300049705 | Ga0501225_0000065 | Ga0501225_0000065_20758_21930 | 390 |
| 624 | 3300049744 | Ga0501083_0008771 | Ga0501083_0008771_4076_5251 | 390 |
| 625 | 3300049823 | Ga0501044_0000509 | Ga0501044_0000509_12830_14005 | 390 |
| 626 | 3300049823 | Ga0501044_0023168 | Ga0501044_0023168_3730_4905 | 390 |
| 627 | 3300049823 | Ga0501044_0068659 | Ga0501044_0068659_1422_2612 | 390 |
| 628 | 3300049823 | Ga0501044_0121115 | Ga0501044_0121115_1080_2255 | 390 |
| 629 | 3300049823 | Ga0501044_0139541 | Ga0501044_0139541_243_1514 | 390 |
| 630 | 3300049853 | Ga0501226_000080 | Ga0501226_000080_7208_8380 | 390 |
| 631 | 3300050489 | nmdc:mga03683_8756_c1 | nmdc:mga03683_8756_c1_1733_2908 | 390 |
| 632 | 3300050491 | nmdc:mga00v17_18634_c1 | nmdc:mga00v17_18634_c1_1067_2242 | 390 |
| 633 | 3300050491 | nmdc:mga00v17_49332_c1 | nmdc:mga00v17_49332_c1_572_1756 | 390 |
| 634 | 3300050492 | nmdc:mga0yw44_3196_c1 | nmdc:mga0yw44_3196_c1_2629_3804 | 390 |
| 635 | 3300050492 | nmdc:mga0yw44_56678_c1 | nmdc:mga0yw44_56678_c1_1029_2204 | 390 |
| 636 | 3300050493 | nmdc:mga0k408_11707_c1 | nmdc:mga0k408_11707_c1_1306_2481 | 390 |
| 637 | 3300050493 | nmdc:mga0k408_42615_c1 | nmdc:mga0k408_42615_c1_538_1713 | 390 |
| 638 | 3300050507 | nmdc:mga05p37_10714_c1 | nmdc:mga05p37_10714_c1_2814_3989 | 390 |
| 639 | 3300050507 | nmdc:mga05p37_87537_c1 | nmdc:mga05p37_87537_c1_1217_2419 | 390 |
| 640 | 3300050509 | nmdc:mga0qj67_43499_c1 | nmdc:mga0qj67_43499_c1_252_1439 | 390 |
| 641 | 3300050509 | nmdc:mga0qj67_83049_c1 | nmdc:mga0qj67_83049_c1_83_1258 | 390 |
| 642 | 3300050510 | nmdc:mga06r32_57677_c1 | nmdc:mga06r32_57677_c1_2352_3527 | 390 |
| 643 | 3300050510 | nmdc:mga06r32_8428_c1 | nmdc:mga06r32_8428_c1_6482_7669 | 390 |
| 644 | 3300050511 | nmdc:mga08y16_67799_c1 | nmdc:mga08y16_67799_c1_1474_2661 | 390 |
| 645 | 3300050511 | nmdc:mga08y16_87369_c1 | nmdc:mga08y16_87369_c1_1230_2429 | 390 |
| 646 | 3300050512 | nmdc:mga0n895_183322_c1 | nmdc:mga0n895_183322_c1_546_1721 | 390 |
| 647 | 3300050512 | nmdc:mga0n895_33904_c1 | nmdc:mga0n895_33904_c1_322_1545 | 390 |
| 648 | 3300050512 | nmdc:mga0n895_58450_c1 | nmdc:mga0n895_58450_c1_610_1896 | 390 |
| 649 | 3300050512 | nmdc:mga0n895_87600_c1 | nmdc:mga0n895_87600_c1_1729_2973 | 390 |
| 650 | 3300050513 | nmdc:mga0rr50_81888_c1 | nmdc:mga0rr50_81888_c1_578_1864 | 390 |
| 651 | 3300050514 | nmdc:mga08x19_99118_c1 | nmdc:mga08x19_99118_c1_461_1711 | 390 |
| 652 | 3300053077 | Ga0495601_0001526 | Ga0495601_0001526_6727_7902 | 390 |
| 653 | 3300053077 | Ga0495601_0001594 | Ga0495601_0001594_6267_7445 | 390 |
| 654 | 3300053077 | Ga0495601_0179478 | Ga0495601_0179478_162_1337 | 390 |
| 655 | 3300053078 | Ga0495612_0001337 | Ga0495612_0001337_189_1364 | 390 |
| 656 | 3300053078 | Ga0495612_0037001 | Ga0495612_0037001_169_1344 | 390 |
| 657 | 3300053084 | Ga0495595_0005548 | Ga0495595_0005548_394_1572 | 390 |
| 658 | 3300053084 | Ga0495595_0026650 | Ga0495595_0026650_716_1891 | 390 |
| 659 | 3300053084 | Ga0495595_0078953 | Ga0495595_0078953_370_1545 | 390 |
| 660 | 3300053085 | Ga0495619_0004091 | Ga0495619_0004091_7602_8780 | 390 |
| 661 | 3300053085 | Ga0495619_0005185 | Ga0495619_0005185_4360_5535 | 390 |
| 662 | 3300053085 | Ga0495619_0210745 | Ga0495619_0210745_158_1333 | 390 |
| 663 | 3300053087 | Ga0500643_001292 | Ga0500643_001292_12403_13578 | 390 |
| 664 | 3300053093 | Ga0500651_0036112 | Ga0500651_0036112_1113_2285 | 390 |
| 665 | 3300053096 | Ga0500641_0004747 | Ga0500641_0004747_2545_3720 | 390 |
| 666 | 3300053134 | Ga0500658_0023651 | Ga0500658_0023651_1124_2302 | 390 |
| 667 | 3300053146 | Ga0500588_0002612 | Ga0500588_0002612_774_1949 | 390 |
| 668 | 3300053153 | Ga0500616_0013338 | Ga0500616_0013338_637_1818 | 390 |
| 669 | 3300053154 | Ga0500619_003726 | Ga0500619_003726_1274_2449 | 390 |
| 670 | 3300054114 | Ga0501084_0000234 | Ga0501084_0000234_1765_2937 | 390 |
| 671 | 3300054114 | Ga0501084_0069303 | Ga0501084_0069303_834_2009 | 390 |
| 672 | 3300059424 | Ga0590075_016712 | Ga0590075_016712_258_1463 | 390 |
| 673 | 3300060353 | Ga0501082_0017151 | Ga0501082_0017151_4717_5892 | 390 |
| 674 | 3300060353 | Ga0501082_0030808 | Ga0501082_0030808_3031_4206 | 390 |
| 675 | 3300061734 | Ga0530510_0196755 | Ga0530510_0196755_13_1188 | 390 |
| 676 | iso_pu_bacteria | 2510917027 | 2511180339 | 390 |
| 677 | iso_pu_bacteria | 2643221732 | 2644724222 | 390 |
| 678 | iso_pu_bacteria | 2818991465 | 2819709379 | 390 |
| 679 | iso_pu_bacteria | 2857460504 | 2857460768 | 390 |
| 680 | iso_pu_bacteria | 2857465823 | 2857471243 | 390 |
| 681 | iso_pu_bacteria | 2857591370 | 2857595433 | 390 |
| 682 | iso_pu_bacteria | 2881644220 | 2881644282 | 390 |
| 683 | iso_pu_bacteria | 2915597211 | 2915597836 | 390 |
| 684 | iso_pu_bacteria | 2915606848 | 2915610581 | 390 |
| 685 | iso_pu_bacteria | 2919138771 | 2919140319 | 390 |
| 686 | iso_pu_bacteria | 2919414237 | 2919414354 | 390 |
| 687 | iso_pu_bacteria | 2919720352 | 2919723097 | 390 |
| 688 | iso_pu_bacteria | 2929004312 | 2929006248 | 390 |
| 689 | iso_pu_bacteria | 2929183550 | 2929189345 | 390 |
| 690 | iso_pu_bacteria | 2960319331 | 2960319997 | 390 |
| 691 | iso_pu_bacteria | 8022948649 | 8022949707 | 390 |
| 692 | 3300005337 | Ga0070682_100059039 | Ga0070682_1000590392 | 391 |
| 693 | 3300005981 | Ga0081538_10024985 | Ga0081538_100249852 | 391 |
| 694 | 3300006844 | Ga0075428_100002525 | Ga0075428_1000025253 | 391 |
| 695 | 3300006852 | Ga0075433_10122881 | Ga0075433_101228812 | 391 |
| 696 | 3300031548 | Ga0307408_100058061 | Ga0307408_1000580613 | 391 |
| 697 | 3300032002 | Ga0307416_100087297 | Ga0307416_1000872974 | 391 |
| 698 | 3300039093 | Ga0400489_33857 | Ga0400489_33857_856_2061 | 391 |
| 699 | 3300042010 | Ga0439452_001405 | Ga0439452_001405_6880_8058 | 391 |
| 700 | 3300050515 | nmdc:mga0a205_105164_c1 | nmdc:mga0a205_105164_c1_693_1871 | 391 |
| 701 | 3300050515 | nmdc:mga0a205_26885_c1 | nmdc:mga0a205_26885_c1_508_1686 | 391 |
| 702 | 3300059423 | Ga0590074_006728 | Ga0590074_006728_320_1534 | 391 |
| 703 | 3300059424 | Ga0590075_004026 | Ga0590075_004026_1082_2296 | 391 |
| 704 | iso_pu_bacteria | 2744054657 | 2745166031 | 391 |
| 705 | iso_pu_bacteria | 2816332336 | 2817620822 | 391 |
| 706 | 3300003187 | JGI25151J46595_10000302 | JGI25151J46595_100003023 | 392 |
| 707 | 3300003187 | JGI25151J46595_10002958 | JGI25151J46595_100029587 | 392 |
| 708 | 3300003187 | JGI25151J46595_10007108 | JGI25151J46595_100071085 | 392 |
| 709 | 3300003187 | JGI25151J46595_10039571 | JGI25151J46595_100395712 | 392 |
| 710 | 3300003758 | Ga0055532_1000060 | Ga0055532_10000609 | 392 |
| 711 | 3300003758 | Ga0055532_1001176 | Ga0055532_10011766 | 392 |
| 712 | 3300003856 | Ga0058692_1000622 | Ga0058692_10006225 | 392 |
| 713 | 3300013105 | Ga0157369_10007939 | Ga0157369_100079391 | 392 |
| 714 | 3300021384 | Ga0213876_10000103 | Ga0213876_1000010326 | 392 |
| 715 | 3300025224 | Ga0209784_100118 | Ga0209784_1001183 | 392 |
| 716 | 3300025229 | Ga0209147_100080 | Ga0209147_100080142 | 392 |
| 717 | 3300025229 | Ga0209147_100101 | Ga0209147_100101147 | 392 |
| 718 | 3300025292 | Ga0209676_1000427 | Ga0209676_100042745 | 392 |
| 719 | 3300025292 | Ga0209676_1001194 | Ga0209676_100119421 | 392 |
| 720 | 3300025294 | Ga0209025_1000262 | Ga0209025_1000262147 | 392 |
| 721 | 3300025294 | Ga0209025_1002935 | Ga0209025_100293516 | 392 |
| 722 | 3300025294 | Ga0209025_1004102 | Ga0209025_10041024 | 392 |
| 723 | 3300025294 | Ga0209025_1005174 | Ga0209025_10051747 | 392 |
| 724 | 3300025294 | Ga0209025_1008076 | Ga0209025_10080768 | 392 |
| 725 | 3300025728 | Ga0207655_1026537 | Ga0207655_10265372 | 392 |
| 726 | 3300027312 | Ga0209371_1000020 | Ga0209371_1000020371 | 392 |
| 727 | 3300030500 | Ga0268256_1000057 | Ga0268256_1000057207 | 392 |
| 728 | 3300031238 | Ga0265332_10001502 | Ga0265332_1000150211 | 392 |
| 729 | 3300031711 | Ga0265314_10097843 | Ga0265314_100978432 | 392 |
| 730 | 3300031712 | Ga0265342_10008983 | Ga0265342_100089832 | 392 |
| 731 | 3300031727 | Ga0316576_10034845 | Ga0316576_100348452 | 392 |
| 732 | 3300031727 | Ga0316576_10155394 | Ga0316576_101553942 | 392 |
| 733 | 3300031728 | Ga0316578_10014050 | Ga0316578_100140505 | 392 |
| 734 | 3300031728 | Ga0316578_10092765 | Ga0316578_100927652 | 392 |
| 735 | 3300032139 | Ga0316580_10011049 | Ga0316580_100110494 | 392 |
| 736 | 3300033528 | Ga0316588_1010906 | Ga0316588_10109062 | 392 |
| 737 | 3300033541 | Ga0316596_1007729 | Ga0316596_10077295 | 392 |
| 738 | 3300035398 | Ga0316574_0006329 | Ga0316574_0006329_4135_5316 | 392 |
| 739 | 3300036647 | Ga0316582_0100345 | Ga0316582_0100345_597_1787 | 392 |
| 740 | 3300036712 | Ga0316584_0020718 | Ga0316584_0020718_1799_3010 | 392 |
| 741 | 3300036712 | Ga0316584_0044039 | Ga0316584_0044039_173_1384 | 392 |
| 742 | 3300039062 | Ga0400483_150944 | Ga0400483_150944_6393_7586 | 392 |
| 743 | 3300039437 | Ga0436365_1861022 | Ga0436365_1861022_41409_42590 | 392 |
| 744 | 3300044673 | Ga0453683_0005602 | Ga0453683_0005602_6821_8002 | 392 |
| 745 | 3300044712 | Ga0453684_0003922 | Ga0453684_0003922_13422_14603 | 392 |
| 746 | 3300044712 | Ga0453684_0048239 | Ga0453684_0048239_355_1533 | 392 |
| 747 | 3300044712 | Ga0453684_0278560 | Ga0453684_0278560_325_1506 | 392 |
| 748 | 3300045051 | Ga0451576_0000016 | Ga0451576_0000016_480461_481639 | 392 |
| 749 | 3300045051 | Ga0451576_0013071 | Ga0451576_0013071_899_2080 | 392 |
| 750 | 3300046558 | Ga0495633_0024969 | Ga0495633_0024969_291_1478 | 392 |
| 751 | 3300047323 | Ga0495683_0022584 | Ga0495683_0022584_655_1842 | 392 |
| 752 | 3300048913 | Ga0496110_0130943 | Ga0496110_0130943_928_2133 | 392 |
| 753 | 3300048916 | Ga0496113_0195128 | Ga0496113_0195128_139_1374 | 392 |
| 754 | 3300048925 | Ga0496122_0001139 | Ga0496122_0001139_38893_40074 | 392 |
| 755 | 3300048926 | Ga0496123_0001178 | Ga0496123_0001178_31814_32995 | 392 |
| 756 | 3300049161 | Ga0501305_000167 | Ga0501305_000167_456_1643 | 392 |
| 757 | 3300049161 | Ga0501305_007969 | Ga0501305_007969_27_1217 | 392 |
| 758 | 3300049528 | Ga0501312_000134 | Ga0501312_000134_2816_4003 | 392 |
| 759 | 3300049531 | Ga0501315_005212 | Ga0501315_005212_27_1217 | 392 |
| 760 | 3300049532 | Ga0501316_004946 | Ga0501316_004946_28_1218 | 392 |
| 761 | 3300049533 | Ga0501317_002748 | Ga0501317_002748_53_1240 | 392 |
| 762 | 3300049533 | Ga0501317_005478 | Ga0501317_005478_28_1218 | 392 |
| 763 | 3300049539 | Ga0501323_000290 | Ga0501323_000290_605_1792 | 392 |
| 764 | 3300049539 | Ga0501323_007455 | Ga0501323_007455_31_1221 | 392 |
| 765 | 3300049551 | Ga0501335_004207 | Ga0501335_004207_26_1216 | 392 |
| 766 | 3300049576 | Ga0501040_0000210 | Ga0501040_0000210_13848_15092 | 392 |
| 767 | 3300049578 | Ga0501042_0004169 | Ga0501042_0004169_1686_2864 | 392 |
| 768 | 3300049578 | Ga0501042_0147115 | Ga0501042_0147115_36_1280 | 392 |
| 769 | 2162886007 | SwRhRL2b_contig_2703074 | SwRhRL2b_0829.00000490 | 393 |
| 770 | 3300003320 | rootH2_10083643 | rootH2_100836432 | 393 |
| 771 | 3300003856 | Ga0058692_1000674 | Ga0058692_10006747 | 393 |
| 772 | 3300003856 | Ga0058692_1007359 | Ga0058692_10073592 | 393 |
| 773 | 3300005289 | Ga0065704_10070699 | Ga0065704_1007069910 | 393 |
| 774 | 3300005548 | Ga0070665_100000406 | Ga0070665_10000040647 | 393 |
| 775 | 3300006946 | Ga0079104_1001990 | Ga0079104_10019905 | 393 |
| 776 | 3300009011 | Ga0105251_10000064 | Ga0105251_1000006427 | 393 |
| 777 | 3300009011 | Ga0105251_10008061 | Ga0105251_100080615 | 393 |
| 778 | 3300009092 | Ga0105250_10000053 | Ga0105250_1000005329 | 393 |
| 779 | 3300009092 | Ga0105250_10001882 | Ga0105250_1000188211 | 393 |
| 780 | 3300013104 | Ga0157370_10004253 | Ga0157370_1000425313 | 393 |
| 781 | 3300015679 | Ga0183366_1001 | Ga0183366_10011051 | 393 |
| 782 | 3300015680 | Ga0183370_1001 | Ga0183370_10011051 | 393 |
| 783 | 3300015685 | Ga0183369_1001 | Ga0183369_10011051 | 393 |
| 784 | 3300015687 | Ga0183368_1001 | Ga0183368_10011051 | 393 |
| 785 | 3300021384 | Ga0213876_10000084 | Ga0213876_1000008466 | 393 |
| 786 | 3300025711 | Ga0207696_1000088 | Ga0207696_100008835 | 393 |
| 787 | 3300025711 | Ga0207696_1000116 | Ga0207696_1000116114 | 393 |
| 788 | 3300025735 | Ga0207713_1000002 | Ga0207713_1000002928 | 393 |
| 789 | 3300025735 | Ga0207713_1002682 | Ga0207713_10026822 | 393 |
| 790 | 3300025735 | Ga0207713_1002965 | Ga0207713_10029656 | 393 |
| 791 | 3300025735 | Ga0207713_1025470 | Ga0207713_10254702 | 393 |
| 792 | 3300025735 | Ga0207713_1032114 | Ga0207713_10321142 | 393 |
| 793 | 3300025735 | Ga0207713_1037039 | Ga0207713_10370393 | 393 |
| 794 | 3300027111 | Ga0209281_1000820 | Ga0209281_100082016 | 393 |
| 795 | 3300027312 | Ga0209371_1000001 | Ga0209371_1000001975 | 393 |
| 796 | 3300027312 | Ga0209371_1001119 | Ga0209371_100111910 | 393 |
| 797 | 3300027312 | Ga0209371_1002623 | Ga0209371_10026235 | 393 |
| 798 | 3300028379 | Ga0268266_10000435 | Ga0268266_100004359 | 393 |
| 799 | 3300030500 | Ga0268256_1000001 | Ga0268256_10000011665 | 393 |
| 800 | 3300030500 | Ga0268256_1000951 | Ga0268256_100095112 | 393 |
| 801 | 3300030500 | Ga0268256_1002322 | Ga0268256_10023225 | 393 |
| 802 | 3300039437 | Ga0436365_0203066 | Ga0436365_0203066_84194_85390 | 393 |
| 803 | 3300041512 | Ga0451853_1896193 | Ga0451853_1896193_498_1679 | 393 |
| 804 | 3300042010 | Ga0439452_000142 | Ga0439452_000142_44768_45949 | 393 |
| 805 | 3300046471 | Ga0495650_0000005 | Ga0495650_0000005_753438_754619 | 393 |
| 806 | 3300047446 | Ga0495679_012913 | Ga0495679_012913_813_2009 | 393 |
| 807 | 3300048907 | Ga0496104_0000449 | Ga0496104_0000449_5473_6654 | 393 |
| 808 | 3300048907 | Ga0496104_0184392 | Ga0496104_0184392_634_1830 | 393 |
| 809 | 3300048908 | Ga0496105_0009008 | Ga0496105_0009008_5460_6656 | 393 |
| 810 | 3300048908 | Ga0496105_0068782 | Ga0496105_0068782_245_1426 | 393 |
| 811 | 3300048919 | Ga0496116_0002683 | Ga0496116_0002683_12864_14051 | 393 |
| 812 | 3300048919 | Ga0496116_0013421 | Ga0496116_0013421_1449_2630 | 393 |
| 813 | 3300048919 | Ga0496116_0017493 | Ga0496116_0017493_2890_4071 | 393 |
| 814 | 3300048919 | Ga0496116_0023278 | Ga0496116_0023278_1859_3040 | 393 |
| 815 | 3300048919 | Ga0496116_0037362 | Ga0496116_0037362_758_1939 | 393 |
| 816 | 3300048919 | Ga0496116_0064856 | Ga0496116_0064856_920_2101 | 393 |
| 817 | 3300048920 | Ga0496117_0001622 | Ga0496117_0001622_21964_23145 | 393 |
| 818 | 3300048920 | Ga0496117_0008046 | Ga0496117_0008046_2602_3798 | 393 |
| 819 | 3300048920 | Ga0496117_0008546 | Ga0496117_0008546_4833_6014 | 393 |
| 820 | 3300048920 | Ga0496117_0049826 | Ga0496117_0049826_1067_2248 | 393 |
| 821 | 3300048920 | Ga0496117_0062267 | Ga0496117_0062267_178_1359 | 393 |
| 822 | 3300048920 | Ga0496117_0065527 | Ga0496117_0065527_1239_2420 | 393 |
| 823 | 3300048920 | Ga0496117_0066130 | Ga0496117_0066130_131_1312 | 393 |
| 824 | 3300048921 | Ga0496118_0000015 | Ga0496118_0000015_542050_543231 | 393 |
| 825 | 3300048921 | Ga0496118_0005930 | Ga0496118_0005930_1182_2378 | 393 |
| 826 | 3300048922 | Ga0496119_0000841 | Ga0496119_0000841_31323_32510 | 393 |
| 827 | 3300048922 | Ga0496119_0001419 | Ga0496119_0001419_8712_9908 | 393 |
| 828 | 3300048922 | Ga0496119_0003785 | Ga0496119_0003785_9435_10616 | 393 |
| 829 | 3300048922 | Ga0496119_0010725 | Ga0496119_0010725_1041_2222 | 393 |
| 830 | 3300048923 | Ga0496120_0001068 | Ga0496120_0001068_19164_20360 | 393 |
| 831 | 3300048923 | Ga0496120_0003719 | Ga0496120_0003719_10455_11636 | 393 |
| 832 | 3300048923 | Ga0496120_0006370 | Ga0496120_0006370_3327_4514 | 393 |
| 833 | 3300048923 | Ga0496120_0018282 | Ga0496120_0018282_3001_4182 | 393 |
| 834 | 3300048923 | Ga0496120_0018283 | Ga0496120_0018283_342_1523 | 393 |
| 835 | 3300048924 | Ga0496121_0004213 | Ga0496121_0004213_10723_11904 | 393 |
| 836 | 3300048924 | Ga0496121_0004271 | Ga0496121_0004271_10523_11704 | 393 |
| 837 | 3300048924 | Ga0496121_0006970 | Ga0496121_0006970_4543_5724 | 393 |
| 838 | 3300048924 | Ga0496121_0008075 | Ga0496121_0008075_10941_12122 | 393 |
| 839 | 3300048924 | Ga0496121_0034501 | Ga0496121_0034501_2962_4143 | 393 |
| 840 | 3300048925 | Ga0496122_0000202 | Ga0496122_0000202_71892_73088 | 393 |
| 841 | 3300048925 | Ga0496122_0008382 | Ga0496122_0008382_6014_7201 | 393 |
| 842 | 3300048925 | Ga0496122_0014310 | Ga0496122_0014310_5458_6639 | 393 |
| 843 | 3300048925 | Ga0496122_0024755 | Ga0496122_0024755_3798_4979 | 393 |
| 844 | 3300048925 | Ga0496122_0030357 | Ga0496122_0030357_193_1374 | 393 |
| 845 | 3300048925 | Ga0496122_0033844 | Ga0496122_0033844_2680_3861 | 393 |
| 846 | 3300048925 | Ga0496122_0039679 | Ga0496122_0039679_411_1592 | 393 |
| 847 | 3300048926 | Ga0496123_0000144 | Ga0496123_0000144_71172_72368 | 393 |
| 848 | 3300048926 | Ga0496123_0006680 | Ga0496123_0006680_9674_10855 | 393 |
| 849 | 3300048926 | Ga0496123_0008091 | Ga0496123_0008091_3813_4994 | 393 |
| 850 | 3300048926 | Ga0496123_0008482 | Ga0496123_0008482_2905_4086 | 393 |
| 851 | 3300048926 | Ga0496123_0015055 | Ga0496123_0015055_2236_3417 | 393 |
| 852 | 3300048926 | Ga0496123_0077027 | Ga0496123_0077027_736_1977 | 393 |
| 853 | 3300048926 | Ga0496123_0100344 | Ga0496123_0100344_366_1547 | 393 |
| 854 | 3300048926 | Ga0496123_0130560 | Ga0496123_0130560_178_1359 | 393 |
| 855 | 3300048927 | Ga0496124_0005265 | Ga0496124_0005265_2890_4071 | 393 |
| 856 | 3300048927 | Ga0496124_0014963 | Ga0496124_0014963_2890_4071 | 393 |
| 857 | 3300048927 | Ga0496124_0030441 | Ga0496124_0030441_1505_2686 | 393 |
| 858 | 3300048927 | Ga0496124_0045115 | Ga0496124_0045115_2491_3672 | 393 |
| 859 | 3300048927 | Ga0496124_0138639 | Ga0496124_0138639_478_1659 | 393 |
| 860 | 3300048927 | Ga0496124_0175192 | Ga0496124_0175192_51_1232 | 393 |
| 861 | 3300048928 | Ga0496125_0000009 | Ga0496125_0000009_366854_368059 | 393 |
| 862 | 3300048928 | Ga0496125_0004716 | Ga0496125_0004716_3799_4980 | 393 |
| 863 | 3300048928 | Ga0496125_0004820 | Ga0496125_0004820_3799_4980 | 393 |
| 864 | 3300048928 | Ga0496125_0005489 | Ga0496125_0005489_10952_12133 | 393 |
| 865 | 3300048928 | Ga0496125_0061793 | Ga0496125_0061793_734_1915 | 393 |
| 866 | 3300048928 | Ga0496125_0081889 | Ga0496125_0081889_1077_2258 | 393 |
| 867 | 3300048929 | Ga0496126_0000779 | Ga0496126_0000779_1156_2337 | 393 |
| 868 | 3300048929 | Ga0496126_0003414 | Ga0496126_0003414_7979_9160 | 393 |
| 869 | 3300048929 | Ga0496126_0039952 | Ga0496126_0039952_1506_2687 | 393 |
| 870 | 3300048929 | Ga0496126_0045247 | Ga0496126_0045247_2481_3662 | 393 |
| 871 | 3300048929 | Ga0496126_0078009 | Ga0496126_0078009_1642_2823 | 393 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1m3k-assembly1.cif.gz_A | biosynthetic thiolase, inactive c89a mutant | 0.9929 | 2 | 392 |
| 1dlu-assembly1.cif.gz_A | unliganded biosynthetic thiolase from zoogloea ramigera | 0.9923 | 4 | 392 |
| 7lcl-assembly1.cif.gz_D | zoogloea ramigera biosynthetic thiolase q183y mutant | 0.9921 | 3 | 392 |
| 2wkt-assembly1.cif.gz_C | biosynthetic thiolase from z. ramigera. complex of the n316a mutant with coenzyme a. | 0.992 | 4 | 392 |
| 1m4s-assembly1.cif.gz_A | biosynthetic thiolase, cys89 acetylated, unliganded form | 0.9917 | 1 | 392 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A096MJY8_281_393_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 1.001 | 278 | 388 | 3.40.47.10 |
| af_O53871_287_399_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9911 | 278 | 388 | 3.40.47.10 |
| af_P76461_265_393_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9908 | 266 | 393 | 3.40.47.10 |
| af_Q8CAY6_6_396_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9903 | 2 | 393 | 3.40.47.10 |
| af_Q8CAY6_6_396_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9877 | 2 | 393 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X6WFA2-F1-model_v4 | Acetyl-CoA C-acyltransferase (EC 2.3.1.9) | 1.001 | 284 | 393 |
GO:0003985
GO:0006635 GO:0010124 |
| AF-M5BJ77-F1-model_v4 | Acetyl-CoA C-acetyltransferase (EC 2.3.1.9) | 0.9971 | 2 | 122 |
GO:0003985
GO:0005739 GO:0006635 |
| AF-A0A3D6CKC3-F1-model_v4 | Acetyl-CoA C-acetyltransferase (EC 2.3.1.9) | 0.9965 | 1 | 107 |
GO:0003985
GO:0006635 |
| AF-X1NTI0-F1-model_v4 | Electron transfer flavoprotein alpha/beta-subunit N-terminal domain-containing protein | 0.996 | 275 | 393 |
GO:0016747
|
| AF-A0A098ME79-F1-model_v4 | Thiolase C-terminal domain-containing protein | 0.9956 | 277 | 393 |
GO:0003988
GO:0006635 GO:0010124 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar