F484071
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 868 | 448 | 848 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10146194|Ga0070658_101461942 |
| Length | 261 |
| Sequence | MSSTLVASRTALPSEGEPTPVRGSGGSGAAEMLRIEGLNAWYGESHILHGVDLAVQEGEVVCLLGRNGAGRTTTLRAIVGLTGARKGSIRIRGQEAIRLPPHRVARLGVGYCPEERGIFSTLSAEENLRLPPVTAQGGMSIEEIYAMFPNLQERANSPGTRLSGGEQQMLAVARILRTGARLLLLDEISEGLAPVIVQKLAEMVTTLRAQGYTIVMVEQNFRFAAPLADRFLVMEHGQVIQHFTQAELPSKLATLHEYLGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 3 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 4 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 5 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 6 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 7 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 8 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 9 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 10 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 11 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 12 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 13 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 14 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 15 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 16 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 17 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 18 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 19 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 20 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 21 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 22 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 23 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 24 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 25 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 26 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 27 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 28 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 29 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 30 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 38 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 39 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 40 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 44 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 45 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 54 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 57 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 59 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 86 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 88 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 89 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 90 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 92 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 93 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 94 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 102 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 103 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 104 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 105 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 106 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 107 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 109 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 110 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 111 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 112 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 114 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 115 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 116 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 117 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 121 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 144 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 148 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 149 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 150 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 151 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 157 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 158 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 161 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 237 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 238 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 242 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 243 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 244 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 246 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 247 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 250 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 251 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 252 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 253 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 254 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 255 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 256 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 257 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 258 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 259 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 260 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 261 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 262 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 263 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 264 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 265 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 266 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 267 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 268 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 269 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 270 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 271 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 272 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 274 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 276 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 277 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 278 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 279 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 282 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 283 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 284 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 285 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 286 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 287 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 288 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 289 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 290 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 291 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 292 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 293 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 294 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 295 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 296 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 297 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 298 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 299 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 300 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 301 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 302 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 303 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 304 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 305 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 306 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 307 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 308 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 309 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 310 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 311 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 312 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 313 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 314 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 315 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 316 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 317 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 318 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 319 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 320 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 321 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 322 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 323 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 324 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 325 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 326 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 327 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 328 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 329 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 330 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 331 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 387 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 388 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 389 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 390 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 391 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 392 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 395 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 396 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 397 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 398 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 399 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 400 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 401 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 402 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 403 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 404 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 412 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 413 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 417 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 418 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 419 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 420 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 421 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 422 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 427 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 431 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 432 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 433 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 434 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 435 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 436 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 437 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 438 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 439 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 440 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 441 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 442 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 443 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 444 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 445 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 446 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 447 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.47 |
| Metatranscriptomes | 0.23 |
| Isolates | 2.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.66 |
| Nodule | 0.46 |
| Rhizoplane | 3.23 |
| Rhizosphere | 70.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1012990 | 3300000546 | Bacteria | 887 |
| 2 | JGI25155J39150_1000035 | 3300002704 | Bacteria | 99118 |
| 3 | JGI25156J39149_1000012 | 3300002705 | Bacteria | 194393 |
| 4 | JGI25154J39366_1000029 | 3300002738 | Bacteria | 194393 |
| 5 | JGI25154J39366_1001259 | 3300002738 | Bacteria | 9494 |
| 6 | JGI25157J39369_1000014 | 3300002741 | Bacteria | 194393 |
| 7 | JGI25157J39369_1000179 | 3300002741 | Bacteria | 53655 |
| 8 | JGI25159J45721_1000334 | 3300002987 | Bacteria | 21726 |
| 9 | JGI25159J45721_1003179 | 3300002987 | Bacteria | 5896 |
| 10 | JGI25151J46595_10008323 | 3300003187 | Bacteria | 4996 |
| 11 | JGI25151J46595_10008820 | 3300003187 | Bacteria | 4819 |
| 12 | JGI25160J50197_1000303 | 3300003354 | Bacteria | 34764 |
| 13 | JGI25160J50197_1044611 | 3300003354 | Bacteria | 987 |
| 14 | JGI25161J50226_1000094 | 3300003374 | Bacteria | 72451 |
| 15 | Ga0055539_1000509 | 3300003752 | Bacteria | 11986 |
| 16 | Ga0055539_1001998 | 3300003752 | Bacteria | 3362 |
| 17 | Ga0055533_1000008 | 3300003756 | Bacteria | 575861 |
| 18 | Ga0055535_1000346 | 3300003761 | Bacteria | 46216 |
| 19 | Ga0055535_1000467 | 3300003761 | Bacteria | 37033 |
| 20 | Ga0055535_1007880 | 3300003761 | Bacteria | 1978 |
| 21 | Ga0055529_1000156 | 3300003763 | Bacteria | 93167 |
| 22 | Ga0055526_1000854 | 3300003771 | Bacteria | 22695 |
| 23 | Ga0055526_1004656 | 3300003771 | Bacteria | 8159 |
| 24 | Ga0055537_1000092 | 3300003773 | Bacteria | 66301 |
| 25 | Ga0055524_1000306 | 3300003775 | Bacteria | 46611 |
| 26 | Ga0055536_1020051 | 3300003781 | Bacteria | 2078 |
| 27 | Ga0055534_1006822 | 3300003784 | Bacteria | 2817 |
| 28 | Ga0055528_1000480 | 3300003790 | Bacteria | 31747 |
| 29 | Ga0055530_10000863 | 3300003791 | Bacteria | 24942 |
| 30 | Ga0055540_1000449 | 3300003792 | Bacteria | 32166 |
| 31 | Ga0055540_1006320 | 3300003792 | Bacteria | 4732 |
| 32 | Ga0055531_10002683 | 3300003794 | Bacteria | 11722 |
| 33 | Ga0055531_10002832 | 3300003794 | Bacteria | 11351 |
| 34 | Ga0055543_1000780 | 3300004625 | Bacteria | 15806 |
| 35 | Ga0065165_1001186 | 3300005262 | Bacteria | 30210 |
| 36 | Ga0065714_10018971 | 3300005288 | Bacteria | 2440 |
| 37 | Ga0065707_10176353 | 3300005295 | Bacteria | 1448 |
| 38 | Ga0070658_10115923 | 3300005327 | Bacteria | 2222 |
| 39 | Ga0070658_10146194 | 3300005327 | Bacteria | 1977 |
| 40 | Ga0070658_10589056 | 3300005327 | Bacteria | 963 |
| 41 | Ga0070676_10006298 | 3300005328 | Bacteria | 6338 |
| 42 | Ga0070683_100040327 | 3300005329 | Bacteria | 4293 |
| 43 | Ga0070683_100065230 | 3300005329 | Bacteria | 3390 |
| 44 | Ga0070690_100062871 | 3300005330 | Bacteria | 2394 |
| 45 | Ga0070670_100040562 | 3300005331 | Bacteria | 4002 |
| 46 | Ga0070670_100042619 | 3300005331 | Bacteria | 3902 |
| 47 | Ga0070670_100409341 | 3300005331 | Bacteria | 1198 |
| 48 | Ga0070670_100512908 | 3300005331 | Bacteria | 1067 |
| 49 | Ga0070677_10067027 | 3300005333 | Bacteria | 1498 |
| 50 | Ga0068869_100108125 | 3300005334 | Bacteria | 2112 |
| 51 | Ga0070680_100462302 | 3300005336 | Bacteria | 1084 |
| 52 | Ga0070682_100104091 | 3300005337 | Bacteria | 1879 |
| 53 | Ga0068868_100011018 | 3300005338 | Bacteria | 6571 |
| 54 | Ga0068868_100015797 | 3300005338 | Bacteria | 5593 |
| 55 | Ga0068868_100555220 | 3300005338 | Bacteria | 1012 |
| 56 | Ga0070660_100025973 | 3300005339 | Bacteria | 4358 |
| 57 | Ga0070660_100061955 | 3300005339 | Bacteria | 2905 |
| 58 | Ga0070660_100140920 | 3300005339 | Bacteria | 1934 |
| 59 | Ga0070689_100128466 | 3300005340 | Bacteria | 2031 |
| 60 | Ga0070661_100112646 | 3300005344 | Bacteria | 2032 |
| 61 | Ga0070668_100004185 | 3300005347 | Bacteria | 10693 |
| 62 | Ga0070669_100025707 | 3300005353 | Bacteria | 4229 |
| 63 | Ga0070669_100455366 | 3300005353 | Bacteria | 1055 |
| 64 | Ga0070675_100009133 | 3300005354 | Bacteria | 7700 |
| 65 | Ga0070675_100080463 | 3300005354 | Bacteria | 2716 |
| 66 | Ga0070671_100113696 | 3300005355 | Bacteria | 2275 |
| 67 | Ga0070671_100531978 | 3300005355 | Bacteria | 1013 |
| 68 | Ga0070674_100019585 | 3300005356 | Bacteria | 4302 |
| 69 | Ga0070674_100088035 | 3300005356 | Bacteria | 2234 |
| 70 | Ga0070674_100321063 | 3300005356 | Bacteria | 1241 |
| 71 | Ga0070659_100067511 | 3300005366 | Bacteria | 2836 |
| 72 | Ga0070659_100176025 | 3300005366 | Bacteria | 1754 |
| 73 | Ga0070667_100260497 | 3300005367 | Bacteria | 1553 |
| 74 | Ga0070701_10160769 | 3300005438 | Bacteria | 1301 |
| 75 | Ga0070700_100020552 | 3300005441 | Bacteria | 3826 |
| 76 | Ga0070694_100240688 | 3300005444 | Bacteria | 1365 |
| 77 | Ga0070708_100246996 | 3300005445 | Bacteria | 1676 |
| 78 | Ga0070663_100008867 | 3300005455 | Bacteria | 6208 |
| 79 | Ga0070662_100004805 | 3300005457 | Bacteria | 8563 |
| 80 | Ga0070662_100094281 | 3300005457 | Bacteria | 2253 |
| 81 | Ga0070681_10031139 | 3300005458 | Bacteria | 5355 |
| 82 | Ga0070681_10732200 | 3300005458 | Bacteria | 905 |
| 83 | Ga0068867_100058847 | 3300005459 | Bacteria | 2847 |
| 84 | Ga0068867_100408129 | 3300005459 | Bacteria | 1147 |
| 85 | Ga0070706_100000367 | 3300005467 | Bacteria | 54314 |
| 86 | Ga0070698_100139972 | 3300005471 | Bacteria | 2372 |
| 87 | Ga0070679_100004721 | 3300005530 | Bacteria | 12564 |
| 88 | Ga0070679_100134851 | 3300005530 | Bacteria | 2450 |
| 89 | Ga0070679_100230597 | 3300005530 | Bacteria | 1811 |
| 90 | Ga0070684_100131782 | 3300005535 | Bacteria | 2255 |
| 91 | Ga0068853_100031519 | 3300005539 | Bacteria | 4484 |
| 92 | Ga0068853_100063215 | 3300005539 | Bacteria | 3206 |
| 93 | Ga0068853_100095812 | 3300005539 | Bacteria | 2617 |
| 94 | Ga0068853_100315396 | 3300005539 | Bacteria | 1448 |
| 95 | Ga0068853_100490830 | 3300005539 | Bacteria | 1159 |
| 96 | Ga0070672_100021949 | 3300005543 | Bacteria | 4680 |
| 97 | Ga0070672_100100367 | 3300005543 | Bacteria | 2347 |
| 98 | Ga0070686_100334627 | 3300005544 | Bacteria | 1133 |
| 99 | Ga0070696_100264630 | 3300005546 | Bacteria | 1305 |
| 100 | Ga0070693_100052404 | 3300005547 | Bacteria | 2339 |
| 101 | Ga0070693_100101508 | 3300005547 | Bacteria | 1753 |
| 102 | Ga0070665_100033015 | 3300005548 | Bacteria | 5208 |
| 103 | Ga0070665_100501096 | 3300005548 | Bacteria | 1225 |
| 104 | Ga0070665_100625402 | 3300005548 | Bacteria | 1090 |
| 105 | Ga0068855_100024131 | 3300005563 | Bacteria | 7279 |
| 106 | Ga0068855_100173573 | 3300005563 | Bacteria | 2440 |
| 107 | Ga0068855_100189798 | 3300005563 | Bacteria | 2318 |
| 108 | Ga0068855_100255777 | 3300005563 | Bacteria | 1953 |
| 109 | Ga0070664_100057283 | 3300005564 | Bacteria | 3312 |
| 110 | Ga0070664_100263031 | 3300005564 | Bacteria | 1552 |
| 111 | Ga0070664_100366849 | 3300005564 | Bacteria | 1312 |
| 112 | Ga0068857_100023783 | 3300005577 | Bacteria | 5394 |
| 113 | Ga0068857_100087284 | 3300005577 | Bacteria | 2790 |
| 114 | Ga0068857_100268815 | 3300005577 | Bacteria | 1566 |
| 115 | Ga0068854_100026160 | 3300005578 | Bacteria | 4008 |
| 116 | Ga0068854_100206692 | 3300005578 | Bacteria | 1546 |
| 117 | Ga0068854_100206956 | 3300005578 | Bacteria | 1545 |
| 118 | Ga0068856_100012272 | 3300005614 | Bacteria | 8299 |
| 119 | Ga0068856_100021189 | 3300005614 | Bacteria | 6313 |
| 120 | Ga0068856_100083459 | 3300005614 | Bacteria | 3173 |
| 121 | Ga0068856_100275801 | 3300005614 | Bacteria | 1698 |
| 122 | Ga0068856_100392910 | 3300005614 | Bacteria | 1406 |
| 123 | Ga0068856_100583872 | 3300005614 | Bacteria | 1139 |
| 124 | Ga0070702_100184225 | 3300005615 | Bacteria | 1369 |
| 125 | Ga0070702_100241977 | 3300005615 | Bacteria | 1218 |
| 126 | Ga0070702_100577765 | 3300005615 | Bacteria | 839 |
| 127 | Ga0068852_100032795 | 3300005616 | Bacteria | 4304 |
| 128 | Ga0068852_100324762 | 3300005616 | Bacteria | 1495 |
| 129 | Ga0068852_100331606 | 3300005616 | Bacteria | 1481 |
| 130 | Ga0068852_100364378 | 3300005616 | Bacteria | 1414 |
| 131 | Ga0068859_100019359 | 3300005617 | Bacteria | 6839 |
| 132 | Ga0068859_100442113 | 3300005617 | Bacteria | 1397 |
| 133 | Ga0068864_100009062 | 3300005618 | Bacteria | 8203 |
| 134 | Ga0068864_100011997 | 3300005618 | Bacteria | 7155 |
| 135 | Ga0068864_100017095 | 3300005618 | Bacteria | 6047 |
| 136 | Ga0068866_10073079 | 3300005718 | Bacteria | 1818 |
| 137 | Ga0068861_100001656 | 3300005719 | Bacteria | 14245 |
| 138 | Ga0068861_100019378 | 3300005719 | Bacteria | 4860 |
| 139 | Ga0068861_100045356 | 3300005719 | Bacteria | 3310 |
| 140 | Ga0068851_10032935 | 3300005834 | Bacteria | 2580 |
| 141 | Ga0068851_10089997 | 3300005834 | Bacteria | 1614 |
| 142 | Ga0068863_100463299 | 3300005841 | Bacteria | 1245 |
| 143 | Ga0068858_100002470 | 3300005842 | Bacteria | 18659 |
| 144 | Ga0068858_100008215 | 3300005842 | Bacteria | 10036 |
| 145 | Ga0068858_100175626 | 3300005842 | Bacteria | 2021 |
| 146 | Ga0068858_100259239 | 3300005842 | Bacteria | 1652 |
| 147 | Ga0068860_100001365 | 3300005843 | Bacteria | 26507 |
| 148 | Ga0068860_100103887 | 3300005843 | Bacteria | 2712 |
| 149 | Ga0068862_100538947 | 3300005844 | Bacteria | 1113 |
| 150 | Ga0081539_10017388 | 3300005985 | Bacteria | 5052 |
| 151 | Ga0075365_10013289 | 3300006038 | Bacteria | 4915 |
| 152 | Ga0075365_10016664 | 3300006038 | Bacteria | 4475 |
| 153 | Ga0075365_10087742 | 3300006038 | Bacteria | 2115 |
| 154 | Ga0075365_10096082 | 3300006038 | Bacteria | 2025 |
| 155 | Ga0075368_10040676 | 3300006042 | Bacteria | 1825 |
| 156 | Ga0075363_100080638 | 3300006048 | Bacteria | 1780 |
| 157 | Ga0075363_100086368 | 3300006048 | Bacteria | 1722 |
| 158 | Ga0075364_10022311 | 3300006051 | Bacteria | 3996 |
| 159 | Ga0075364_10049231 | 3300006051 | Bacteria | 2747 |
| 160 | Ga0075432_10006527 | 3300006058 | Bacteria | 3973 |
| 161 | Ga0075432_10016456 | 3300006058 | Bacteria | 2524 |
| 162 | Ga0070716_100168069 | 3300006173 | Bacteria | 1429 |
| 163 | Ga0075362_10032249 | 3300006177 | Bacteria | 2272 |
| 164 | Ga0075362_10080073 | 3300006177 | Bacteria | 1505 |
| 165 | Ga0075362_10081004 | 3300006177 | Bacteria | 1496 |
| 166 | Ga0075362_10160324 | 3300006177 | Bacteria | 1083 |
| 167 | Ga0075367_10015436 | 3300006178 | Bacteria | 4151 |
| 168 | Ga0075367_10018865 | 3300006178 | Bacteria | 3813 |
| 169 | Ga0075367_10043243 | 3300006178 | Bacteria | 2638 |
| 170 | Ga0075367_10094747 | 3300006178 | Bacteria | 1820 |
| 171 | Ga0075369_10014645 | 3300006186 | Bacteria | 3137 |
| 172 | Ga0075366_10007983 | 3300006195 | Bacteria | 5861 |
| 173 | Ga0075366_10015005 | 3300006195 | Bacteria | 4430 |
| 174 | Ga0075366_10041892 | 3300006195 | Bacteria | 2711 |
| 175 | Ga0075366_10043723 | 3300006195 | Bacteria | 2654 |
| 176 | Ga0075366_10091374 | 3300006195 | Bacteria | 1823 |
| 177 | Ga0097621_100020754 | 3300006237 | Bacteria | 5068 |
| 178 | Ga0097621_100078702 | 3300006237 | Bacteria | 2739 |
| 179 | Ga0097621_100085195 | 3300006237 | Bacteria | 2635 |
| 180 | Ga0097621_100842200 | 3300006237 | Bacteria | 851 |
| 181 | Ga0075370_10000151 | 3300006353 | Bacteria | 23643 |
| 182 | Ga0075370_10002757 | 3300006353 | Bacteria | 8231 |
| 183 | Ga0075370_10003232 | 3300006353 | Bacteria | 7714 |
| 184 | Ga0075370_10003626 | 3300006353 | Bacteria | 7385 |
| 185 | Ga0075370_10346862 | 3300006353 | Bacteria | 887 |
| 186 | Ga0068871_100054136 | 3300006358 | Bacteria | 3254 |
| 187 | Ga0068871_100096935 | 3300006358 | Bacteria | 2464 |
| 188 | Ga0075428_100406219 | 3300006844 | Bacteria | 1459 |
| 189 | Ga0075428_101159703 | 3300006844 | Bacteria | 815 |
| 190 | Ga0075430_100221789 | 3300006846 | Bacteria | 1569 |
| 191 | Ga0075431_100155082 | 3300006847 | Bacteria | 2356 |
| 192 | Ga0075431_100555548 | 3300006847 | Bacteria | 1135 |
| 193 | Ga0075429_100008410 | 3300006880 | Bacteria | 8980 |
| 194 | Ga0097620_100019361 | 3300006931 | Bacteria | 6839 |
| 195 | Ga0097620_100442089 | 3300006931 | Bacteria | 1397 |
| 196 | Ga0099795_10017584 | 3300007788 | Bacteria | 2282 |
| 197 | Ga0105240_10009978 | 3300009093 | Bacteria | 13386 |
| 198 | Ga0105240_10016101 | 3300009093 | Bacteria | 10132 |
| 199 | Ga0105240_10429932 | 3300009093 | Bacteria | 1482 |
| 200 | Ga0105240_10682907 | 3300009093 | Bacteria | 1122 |
| 201 | Ga0111539_10405288 | 3300009094 | Bacteria | 1588 |
| 202 | Ga0105245_10114171 | 3300009098 | Bacteria | 2515 |
| 203 | Ga0105245_10189923 | 3300009098 | Bacteria | 1967 |
| 204 | Ga0105245_11182731 | 3300009098 | Bacteria | 812 |
| 205 | Ga0105247_10532069 | 3300009101 | Bacteria | 861 |
| 206 | Ga0114129_10058968 | 3300009147 | Bacteria | 5368 |
| 207 | Ga0105243_10119990 | 3300009148 | Bacteria | 2215 |
| 208 | Ga0105243_10140765 | 3300009148 | Bacteria | 2058 |
| 209 | Ga0105241_10066756 | 3300009174 | Bacteria | 2783 |
| 210 | Ga0105248_10025188 | 3300009177 | Bacteria | 6613 |
| 211 | Ga0105248_10034909 | 3300009177 | Bacteria | 5628 |
| 212 | Ga0105248_10071563 | 3300009177 | Bacteria | 3896 |
| 213 | Ga0105248_10098068 | 3300009177 | Bacteria | 3302 |
| 214 | Ga0105237_10008751 | 3300009545 | Bacteria | 10924 |
| 215 | Ga0105237_10010803 | 3300009545 | Bacteria | 9691 |
| 216 | Ga0105237_10015804 | 3300009545 | Bacteria | 7851 |
| 217 | Ga0105237_10489490 | 3300009545 | Bacteria | 1236 |
| 218 | Ga0105237_10723080 | 3300009545 | Bacteria | 1002 |
| 219 | Ga0105238_10016417 | 3300009551 | Bacteria | 7496 |
| 220 | Ga0105238_10020457 | 3300009551 | Bacteria | 6737 |
| 221 | Ga0105238_10086366 | 3300009551 | Bacteria | 3125 |
| 222 | Ga0105238_10153244 | 3300009551 | Bacteria | 2280 |
| 223 | Ga0105239_10001543 | 3300010375 | Bacteria | 30425 |
| 224 | Ga0105239_10050326 | 3300010375 | Bacteria | 4570 |
| 225 | Ga0105239_10506477 | 3300010375 | Bacteria | 1373 |
| 226 | Ga0105239_10531343 | 3300010375 | Bacteria | 1339 |
| 227 | Ga0105239_10640138 | 3300010375 | Bacteria | 1214 |
| 228 | Ga0105239_11085710 | 3300010375 | Bacteria | 921 |
| 229 | Ga0157373_10054846 | 3300013100 | Bacteria | 2832 |
| 230 | Ga0157371_10271449 | 3300013102 | Bacteria | 1224 |
| 231 | Ga0157370_10187911 | 3300013104 | Bacteria | 1918 |
| 232 | Ga0157369_10092084 | 3300013105 | Bacteria | 3235 |
| 233 | Ga0157369_10177351 | 3300013105 | Bacteria | 2243 |
| 234 | Ga0157374_10576139 | 3300013296 | Bacteria | 1134 |
| 235 | Ga0157378_10340944 | 3300013297 | Bacteria | 1461 |
| 236 | Ga0157378_10653201 | 3300013297 | Bacteria | 1067 |
| 237 | Ga0163162_10036736 | 3300013306 | Bacteria | 4884 |
| 238 | Ga0163162_10437512 | 3300013306 | Bacteria | 1440 |
| 239 | Ga0163162_10468804 | 3300013306 | Bacteria | 1391 |
| 240 | Ga0157372_10206397 | 3300013307 | Bacteria | 2277 |
| 241 | Ga0157372_10365023 | 3300013307 | Bacteria | 1682 |
| 242 | Ga0157375_10157383 | 3300013308 | Bacteria | 2411 |
| 243 | Ga0157375_10269437 | 3300013308 | Bacteria | 1865 |
| 244 | Ga0157375_10402262 | 3300013308 | Bacteria | 1536 |
| 245 | Ga0157375_10578590 | 3300013308 | Bacteria | 1283 |
| 246 | Ga0163163_10286818 | 3300014325 | Bacteria | 1698 |
| 247 | Ga0163163_10327258 | 3300014325 | Bacteria | 1587 |
| 248 | Ga0157380_10075509 | 3300014326 | Bacteria | 2739 |
| 249 | Ga0182008_10185237 | 3300014497 | Bacteria | 1055 |
| 250 | Ga0157377_10001260 | 3300014745 | Bacteria | 10825 |
| 251 | Ga0157379_10012658 | 3300014968 | Bacteria | 7373 |
| 252 | Ga0157379_10196358 | 3300014968 | Bacteria | 1824 |
| 253 | Ga0157376_10006493 | 3300014969 | Bacteria | 8266 |
| 254 | Ga0157376_10035440 | 3300014969 | Bacteria | 4037 |
| 255 | Ga0157376_11129019 | 3300014969 | Bacteria | 810 |
| 256 | Ga0182007_10061376 | 3300015262 | Bacteria | 1232 |
| 257 | Ga0182007_10118646 | 3300015262 | Bacteria | 884 |
| 258 | Ga0213876_10043510 | 3300021384 | Bacteria | 2374 |
| 259 | Ga0213875_10001372 | 3300021388 | Bacteria | 15985 |
| 260 | Ga0209435_100002 | 3300025206 | Bacteria | 794178 |
| 261 | Ga0209674_100015 | 3300025226 | Bacteria | 697299 |
| 262 | Ga0209563_100017 | 3300025230 | Bacteria | 796449 |
| 263 | Ga0209563_107053 | 3300025230 | Bacteria | 1876 |
| 264 | Ga0207427_100989 | 3300025231 | Bacteria | 11980 |
| 265 | Ga0209258_100025 | 3300025242 | Bacteria | 534777 |
| 266 | Ga0209258_100557 | 3300025242 | Bacteria | 32937 |
| 267 | Ga0207425_1003954 | 3300025245 | Bacteria | 4570 |
| 268 | Ga0207425_1017783 | 3300025245 | Bacteria | 1554 |
| 269 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 270 | Ga0209646_1000131 | 3300025246 | Bacteria | 128289 |
| 271 | Ga0209026_1000038 | 3300025250 | Bacteria | 281227 |
| 272 | Ga0209026_1000040 | 3300025250 | Bacteria | 277470 |
| 273 | Ga0209677_100022 | 3300025253 | Bacteria | 410724 |
| 274 | Ga0209677_100074 | 3300025253 | Bacteria | 133019 |
| 275 | Ga0209677_100832 | 3300025253 | Bacteria | 15305 |
| 276 | Ga0209148_1002620 | 3300025254 | Bacteria | 5873 |
| 277 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 278 | Ga0209759_1000031 | 3300025256 | Bacteria | 281227 |
| 279 | Ga0209759_1004903 | 3300025256 | Bacteria | 4845 |
| 280 | Ga0209759_1007462 | 3300025256 | Bacteria | 3514 |
| 281 | Ga0209129_1011540 | 3300025258 | Bacteria | 2101 |
| 282 | Ga0209565_1000026 | 3300025263 | Bacteria | 365910 |
| 283 | Ga0209565_1001255 | 3300025263 | Bacteria | 11855 |
| 284 | Ga0209565_1005280 | 3300025263 | Bacteria | 3781 |
| 285 | Ga0209565_1014193 | 3300025263 | Bacteria | 1838 |
| 286 | Ga0207666_1001927 | 3300025271 | Bacteria | 2468 |
| 287 | Ga0209455_1000089 | 3300025272 | Bacteria | 235612 |
| 288 | Ga0209455_1012267 | 3300025272 | Bacteria | 2061 |
| 289 | Ga0209673_1000009 | 3300025273 | Bacteria | 620735 |
| 290 | Ga0209673_1000012 | 3300025273 | Bacteria | 579480 |
| 291 | Ga0209673_1051404 | 3300025273 | Bacteria | 1088 |
| 292 | Ga0209130_1000183 | 3300025284 | Bacteria | 87887 |
| 293 | Ga0209130_1000644 | 3300025284 | Bacteria | 32528 |
| 294 | Ga0209675_1000308 | 3300025291 | Bacteria | 44127 |
| 295 | Ga0209675_1006996 | 3300025291 | Bacteria | 4409 |
| 296 | Ga0209675_1012555 | 3300025291 | Bacteria | 2717 |
| 297 | Ga0209675_1017411 | 3300025291 | Bacteria | 2053 |
| 298 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 299 | Ga0209676_1003161 | 3300025292 | Bacteria | 10492 |
| 300 | Ga0209025_1005365 | 3300025294 | Bacteria | 10492 |
| 301 | Ga0209025_1006206 | 3300025294 | Bacteria | 9380 |
| 302 | Ga0209025_1031654 | 3300025294 | Bacteria | 2496 |
| 303 | Ga0209564_1001304 | 3300025295 | Bacteria | 26859 |
| 304 | Ga0209564_1004427 | 3300025295 | Bacteria | 8605 |
| 305 | Ga0209564_1004860 | 3300025295 | Bacteria | 7983 |
| 306 | Ga0209758_1000304 | 3300025297 | Bacteria | 95770 |
| 307 | Ga0209758_1007970 | 3300025297 | Bacteria | 7015 |
| 308 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 309 | Ga0209050_1000266 | 3300025298 | Bacteria | 111792 |
| 310 | Ga0209050_1001933 | 3300025298 | Bacteria | 19735 |
| 311 | Ga0209050_1006110 | 3300025298 | Bacteria | 7265 |
| 312 | Ga0209050_1025810 | 3300025298 | Bacteria | 1986 |
| 313 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 314 | Ga0209256_1000049 | 3300025299 | Bacteria | 310696 |
| 315 | Ga0209256_1001148 | 3300025299 | Bacteria | 30046 |
| 316 | Ga0207426_1000062 | 3300025302 | Bacteria | 362040 |
| 317 | Ga0207426_1003042 | 3300025302 | Bacteria | 9688 |
| 318 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 319 | Ga0209051_1000025 | 3300025303 | Bacteria | 415397 |
| 320 | Ga0209051_1009298 | 3300025303 | Bacteria | 5078 |
| 321 | Ga0209051_1042094 | 3300025303 | Bacteria | 1617 |
| 322 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 323 | Ga0209257_1000048 | 3300025304 | Bacteria | 455536 |
| 324 | Ga0209257_1012197 | 3300025304 | Bacteria | 4012 |
| 325 | Ga0207697_10098276 | 3300025315 | Bacteria | 1246 |
| 326 | Ga0207656_10017653 | 3300025321 | Bacteria | 2798 |
| 327 | Ga0207656_10322762 | 3300025321 | Bacteria | 767 |
| 328 | Ga0207682_10024170 | 3300025893 | Bacteria | 2404 |
| 329 | Ga0207688_10086801 | 3300025901 | Bacteria | 1793 |
| 330 | Ga0207688_10120969 | 3300025901 | Bacteria | 1528 |
| 331 | Ga0207680_10097179 | 3300025903 | Bacteria | 1885 |
| 332 | Ga0207680_10100226 | 3300025903 | Bacteria | 1860 |
| 333 | Ga0207680_10131443 | 3300025903 | Bacteria | 1650 |
| 334 | Ga0207699_10000129 | 3300025906 | Bacteria | 52416 |
| 335 | Ga0207645_10008065 | 3300025907 | Bacteria | 7387 |
| 336 | Ga0207645_10022328 | 3300025907 | Bacteria | 4119 |
| 337 | Ga0207645_10023553 | 3300025907 | Bacteria | 4001 |
| 338 | Ga0207645_10111785 | 3300025907 | Bacteria | 1769 |
| 339 | Ga0207705_10145984 | 3300025909 | Bacteria | 1770 |
| 340 | Ga0207684_10005313 | 3300025910 | Bacteria | 11914 |
| 341 | Ga0207654_10030295 | 3300025911 | Bacteria | 2969 |
| 342 | Ga0207654_10035373 | 3300025911 | Bacteria | 2783 |
| 343 | Ga0207654_10128404 | 3300025911 | Bacteria | 1601 |
| 344 | Ga0207707_10022477 | 3300025912 | Bacteria | 5513 |
| 345 | Ga0207707_10178613 | 3300025912 | Bacteria | 1854 |
| 346 | Ga0207707_10683737 | 3300025912 | Bacteria | 863 |
| 347 | Ga0207695_10014227 | 3300025913 | Bacteria | 9438 |
| 348 | Ga0207695_10065783 | 3300025913 | Bacteria | 3726 |
| 349 | Ga0207695_10197632 | 3300025913 | Bacteria | 1926 |
| 350 | Ga0207671_10010930 | 3300025914 | Bacteria | 7438 |
| 351 | Ga0207671_10022450 | 3300025914 | Bacteria | 4772 |
| 352 | Ga0207671_10064598 | 3300025914 | Bacteria | 2721 |
| 353 | Ga0207671_10088141 | 3300025914 | Bacteria | 2334 |
| 354 | Ga0207660_10169553 | 3300025917 | Bacteria | 1689 |
| 355 | Ga0207662_10021765 | 3300025918 | Bacteria | 3668 |
| 356 | Ga0207657_10010934 | 3300025919 | Bacteria | 9027 |
| 357 | Ga0207657_10074502 | 3300025919 | Bacteria | 2866 |
| 358 | Ga0207657_10112162 | 3300025919 | Bacteria | 2251 |
| 359 | Ga0207657_10188518 | 3300025919 | Bacteria | 1665 |
| 360 | Ga0207649_10235302 | 3300025920 | Bacteria | 1312 |
| 361 | Ga0207652_10022385 | 3300025921 | Bacteria | 5228 |
| 362 | Ga0207652_10049913 | 3300025921 | Bacteria | 3584 |
| 363 | Ga0207681_10023814 | 3300025923 | Bacteria | 3921 |
| 364 | Ga0207681_10191883 | 3300025923 | Bacteria | 1563 |
| 365 | Ga0207681_10564861 | 3300025923 | Bacteria | 937 |
| 366 | Ga0207694_10061758 | 3300025924 | Bacteria | 2916 |
| 367 | Ga0207694_10135696 | 3300025924 | Bacteria | 1976 |
| 368 | Ga0207694_10183779 | 3300025924 | Bacteria | 1696 |
| 369 | Ga0207694_10428311 | 3300025924 | Bacteria | 1103 |
| 370 | Ga0207694_10732629 | 3300025924 | Bacteria | 834 |
| 371 | Ga0207650_10023362 | 3300025925 | Bacteria | 4382 |
| 372 | Ga0207650_10060524 | 3300025925 | Bacteria | 2826 |
| 373 | Ga0207650_10101250 | 3300025925 | Bacteria | 2218 |
| 374 | Ga0207659_10022700 | 3300025926 | Bacteria | 4180 |
| 375 | Ga0207687_10024102 | 3300025927 | Bacteria | 4062 |
| 376 | Ga0207687_10033528 | 3300025927 | Bacteria | 3483 |
| 377 | Ga0207687_10358276 | 3300025927 | Bacteria | 1190 |
| 378 | Ga0207687_10460726 | 3300025927 | Bacteria | 1056 |
| 379 | Ga0207644_10032713 | 3300025931 | Bacteria | 3630 |
| 380 | Ga0207644_10423898 | 3300025931 | Bacteria | 1090 |
| 381 | Ga0207690_10126632 | 3300025932 | Bacteria | 1863 |
| 382 | Ga0207690_10288059 | 3300025932 | Bacteria | 1281 |
| 383 | Ga0207690_10439131 | 3300025932 | Bacteria | 1047 |
| 384 | Ga0207706_10001995 | 3300025933 | Bacteria | 19971 |
| 385 | Ga0207706_10119541 | 3300025933 | Bacteria | 2317 |
| 386 | Ga0207706_10170119 | 3300025933 | Bacteria | 1915 |
| 387 | Ga0207706_10509612 | 3300025933 | Bacteria | 1038 |
| 388 | Ga0207709_10050782 | 3300025935 | Bacteria | 2538 |
| 389 | Ga0207709_10133921 | 3300025935 | Bacteria | 1693 |
| 390 | Ga0207670_10145065 | 3300025936 | Bacteria | 1755 |
| 391 | Ga0207669_10099865 | 3300025937 | Bacteria | 1915 |
| 392 | Ga0207669_10137672 | 3300025937 | Bacteria | 1689 |
| 393 | Ga0207669_10684543 | 3300025937 | Bacteria | 841 |
| 394 | Ga0207704_10111724 | 3300025938 | Bacteria | 1849 |
| 395 | Ga0207691_10004985 | 3300025940 | Bacteria | 12806 |
| 396 | Ga0207691_10027031 | 3300025940 | Bacteria | 5384 |
| 397 | Ga0207711_10009070 | 3300025941 | Bacteria | 8311 |
| 398 | Ga0207711_10011255 | 3300025941 | Bacteria | 7434 |
| 399 | Ga0207711_10046878 | 3300025941 | Bacteria | 3693 |
| 400 | Ga0207711_10060141 | 3300025941 | Bacteria | 3273 |
| 401 | Ga0207711_10463249 | 3300025941 | Bacteria | 1180 |
| 402 | Ga0207689_10000996 | 3300025942 | Bacteria | 27158 |
| 403 | Ga0207689_10011569 | 3300025942 | Bacteria | 7560 |
| 404 | Ga0207689_10198912 | 3300025942 | Bacteria | 1654 |
| 405 | Ga0207661_10043857 | 3300025944 | Bacteria | 3531 |
| 406 | Ga0207661_10180601 | 3300025944 | Bacteria | 1843 |
| 407 | Ga0207679_10015982 | 3300025945 | Bacteria | 4974 |
| 408 | Ga0207679_10122608 | 3300025945 | Bacteria | 2072 |
| 409 | Ga0207667_10021835 | 3300025949 | Bacteria | 7084 |
| 410 | Ga0207667_10453804 | 3300025949 | Bacteria | 1302 |
| 411 | Ga0207651_10030894 | 3300025960 | Bacteria | 3417 |
| 412 | Ga0207651_10134764 | 3300025960 | Bacteria | 1897 |
| 413 | Ga0207712_10233178 | 3300025961 | Bacteria | 1479 |
| 414 | Ga0207668_10090770 | 3300025972 | Bacteria | 2243 |
| 415 | Ga0207640_10221288 | 3300025981 | Bacteria | 1450 |
| 416 | Ga0207640_10345284 | 3300025981 | Bacteria | 1194 |
| 417 | Ga0207658_10012023 | 3300025986 | Bacteria | 5904 |
| 418 | Ga0207658_10073606 | 3300025986 | Bacteria | 2593 |
| 419 | Ga0207658_10583726 | 3300025986 | Bacteria | 1003 |
| 420 | Ga0207677_10000853 | 3300026023 | Bacteria | 17454 |
| 421 | Ga0207677_10057976 | 3300026023 | Bacteria | 2663 |
| 422 | Ga0207703_10003620 | 3300026035 | Bacteria | 12891 |
| 423 | Ga0207703_10009640 | 3300026035 | Bacteria | 7581 |
| 424 | Ga0207703_10044880 | 3300026035 | Bacteria | 3553 |
| 425 | Ga0207703_10214019 | 3300026035 | Bacteria | 1720 |
| 426 | Ga0207639_10006133 | 3300026041 | Bacteria | 8160 |
| 427 | Ga0207639_10272831 | 3300026041 | Bacteria | 1484 |
| 428 | Ga0207639_10273608 | 3300026041 | Bacteria | 1482 |
| 429 | Ga0207678_10062737 | 3300026067 | Bacteria | 3194 |
| 430 | Ga0207678_10103777 | 3300026067 | Bacteria | 2426 |
| 431 | Ga0207708_10019046 | 3300026075 | Bacteria | 5168 |
| 432 | Ga0207708_10043438 | 3300026075 | Bacteria | 3425 |
| 433 | Ga0207708_10185426 | 3300026075 | Bacteria | 1653 |
| 434 | Ga0207702_10004240 | 3300026078 | Bacteria | 12805 |
| 435 | Ga0207702_10014759 | 3300026078 | Bacteria | 6480 |
| 436 | Ga0207702_10087741 | 3300026078 | Bacteria | 2717 |
| 437 | Ga0207641_10139494 | 3300026088 | Bacteria | 2185 |
| 438 | Ga0207641_10333084 | 3300026088 | Bacteria | 1442 |
| 439 | Ga0207648_10129602 | 3300026089 | Bacteria | 2220 |
| 440 | Ga0207648_10408558 | 3300026089 | Bacteria | 1231 |
| 441 | Ga0207648_10691485 | 3300026089 | Bacteria | 945 |
| 442 | Ga0207648_10949846 | 3300026089 | Bacteria | 804 |
| 443 | Ga0207676_10003408 | 3300026095 | Bacteria | 11239 |
| 444 | Ga0207676_10028197 | 3300026095 | Bacteria | 4192 |
| 445 | Ga0207676_10029223 | 3300026095 | Bacteria | 4125 |
| 446 | Ga0207674_10021307 | 3300026116 | Bacteria | 6984 |
| 447 | Ga0207674_10022527 | 3300026116 | Bacteria | 6763 |
| 448 | Ga0207674_10031102 | 3300026116 | Bacteria | 5608 |
| 449 | Ga0207674_10257168 | 3300026116 | Bacteria | 1693 |
| 450 | Ga0207674_10643093 | 3300026116 | Bacteria | 1024 |
| 451 | Ga0207675_100002360 | 3300026118 | Bacteria | 18687 |
| 452 | Ga0207675_100090758 | 3300026118 | Bacteria | 2873 |
| 453 | Ga0207675_100262784 | 3300026118 | Bacteria | 1673 |
| 454 | Ga0207683_10009600 | 3300026121 | Bacteria | 8247 |
| 455 | Ga0207698_10020822 | 3300026142 | Bacteria | 4522 |
| 456 | Ga0207698_10027402 | 3300026142 | Bacteria | 4044 |
| 457 | Ga0207698_10065102 | 3300026142 | Bacteria | 2861 |
| 458 | Ga0207698_11071726 | 3300026142 | Bacteria | 818 |
| 459 | Ga0207698_11078538 | 3300026142 | Bacteria | 815 |
| 460 | Ga0209995_1000160 | 3300027471 | Bacteria | 10708 |
| 461 | Ga0209982_1021798 | 3300027552 | Bacteria | 987 |
| 462 | Ga0209998_10015322 | 3300027717 | Bacteria | 1604 |
| 463 | Ga0209813_10063458 | 3300027866 | Bacteria | 1185 |
| 464 | Ga0209974_10003807 | 3300027876 | Bacteria | 5407 |
| 465 | Ga0207428_10152541 | 3300027907 | Bacteria | 1758 |
| 466 | Ga0265354_1002175 | 3300028016 | Bacteria | 2508 |
| 467 | Ga0268266_10117960 | 3300028379 | Bacteria | 2359 |
| 468 | Ga0268265_10792347 | 3300028380 | Bacteria | 923 |
| 469 | Ga0268265_10891596 | 3300028380 | Bacteria | 873 |
| 470 | Ga0268264_10011726 | 3300028381 | Bacteria | 7228 |
| 471 | Ga0268264_10068442 | 3300028381 | Bacteria | 3000 |
| 472 | Ga0265336_10000029 | 3300028666 | Bacteria | 178897 |
| 473 | Ga0307517_10297086 | 3300028786 | Bacteria | 908 |
| 474 | Ga0307515_10000123 | 3300028794 | Bacteria | 186601 |
| 475 | Ga0307515_10001456 | 3300028794 | Bacteria | 53165 |
| 476 | Ga0307515_10002728 | 3300028794 | Bacteria | 37759 |
| 477 | Ga0307515_10009581 | 3300028794 | Bacteria | 18707 |
| 478 | Ga0307515_10175757 | 3300028794 | Bacteria | 2113 |
| 479 | Ga0307515_10424713 | 3300028794 | Bacteria | 949 |
| 480 | Ga0265324_10000326 | 3300029957 | Bacteria | 34966 |
| 481 | Ga0307511_10000092 | 3300030521 | Bacteria | 76188 |
| 482 | Ga0307511_10059059 | 3300030521 | Bacteria | 2955 |
| 483 | Ga0307512_10090121 | 3300030522 | Bacteria | 2141 |
| 484 | Ga0307512_10114850 | 3300030522 | Bacteria | 1756 |
| 485 | Ga0265763_1001692 | 3300030763 | Bacteria | 1608 |
| 486 | Ga0265770_1001763 | 3300030878 | Bacteria | 2952 |
| 487 | Ga0265330_10037955 | 3300031235 | Bacteria | 2142 |
| 488 | Ga0265325_10004429 | 3300031241 | Bacteria | 8878 |
| 489 | Ga0265325_10029087 | 3300031241 | Bacteria | 2972 |
| 490 | Ga0265329_10060855 | 3300031242 | Bacteria | 1196 |
| 491 | Ga0265327_10000049 | 3300031251 | Bacteria | 268046 |
| 492 | Ga0265327_10113012 | 3300031251 | Bacteria | 1295 |
| 493 | Ga0265316_10038848 | 3300031344 | Bacteria | 3829 |
| 494 | Ga0265316_10054144 | 3300031344 | Bacteria | 3142 |
| 495 | Ga0307513_10000057 | 3300031456 | Bacteria | 146564 |
| 496 | Ga0307513_10041778 | 3300031456 | Bacteria | 5056 |
| 497 | Ga0307513_10240657 | 3300031456 | Bacteria | 1615 |
| 498 | Ga0307509_10069245 | 3300031507 | Bacteria | 3689 |
| 499 | Ga0307408_100062798 | 3300031548 | Bacteria | 2716 |
| 500 | Ga0307408_100148179 | 3300031548 | Bacteria | 1850 |
| 501 | Ga0265313_10142367 | 3300031595 | Bacteria | 1030 |
| 502 | Ga0307508_10008033 | 3300031616 | Bacteria | 9780 |
| 503 | Ga0307508_10298811 | 3300031616 | Bacteria | 1203 |
| 504 | Ga0307508_10363596 | 3300031616 | Bacteria | 1038 |
| 505 | Ga0307514_10008631 | 3300031649 | Bacteria | 8644 |
| 506 | Ga0265314_10002601 | 3300031711 | Bacteria | 18259 |
| 507 | Ga0265314_10023252 | 3300031711 | Bacteria | 4730 |
| 508 | Ga0265314_10313544 | 3300031711 | Bacteria | 875 |
| 509 | Ga0307516_10000017 | 3300031730 | Bacteria | 202506 |
| 510 | Ga0307516_10005729 | 3300031730 | Bacteria | 14730 |
| 511 | Ga0307516_10016806 | 3300031730 | Bacteria | 7641 |
| 512 | Ga0307516_10021030 | 3300031730 | Bacteria | 6728 |
| 513 | Ga0307516_10176861 | 3300031730 | Bacteria | 1870 |
| 514 | Ga0307516_10400243 | 3300031730 | Bacteria | 1032 |
| 515 | Ga0307406_10537104 | 3300031901 | Bacteria | 954 |
| 516 | Ga0307412_10264747 | 3300031911 | Bacteria | 1342 |
| 517 | Ga0307412_10369013 | 3300031911 | Bacteria | 1158 |
| 518 | Ga0307507_10040352 | 3300033179 | Bacteria | 4690 |
| 519 | Ga0307507_10040381 | 3300033179 | Bacteria | 4688 |
| 520 | Ga0373959_0053251 | 3300034820 | Bacteria | 879 |
| 521 | Ga0373926_0030127 | 3300035083 | Bacteria | 1909 |
| 522 | Ga0373944_0007686 | 3300035089 | Bacteria | 2895 |
| 523 | Ga0373952_0020702 | 3300035092 | Bacteria | 1381 |
| 524 | Ga0373923_0016948 | 3300035111 | Bacteria | 2779 |
| 525 | Ga0373936_0042331 | 3300035113 | Bacteria | 1828 |
| 526 | Ga0373936_0189988 | 3300035113 | Bacteria | 904 |
| 527 | Ga0373945_0000417 | 3300035116 | Bacteria | 12078 |
| 528 | Ga0373945_0062883 | 3300035116 | Bacteria | 1389 |
| 529 | Ga0373954_0029214 | 3300035118 | Bacteria | 2538 |
| 530 | Ga0373954_0089060 | 3300035118 | Bacteria | 1481 |
| 531 | Ga0373943_0000245 | 3300035170 | Bacteria | 22472 |
| 532 | Ga0373955_0432428 | 3300035172 | Bacteria | 801 |
| 533 | Ga0373931_0011040 | 3300035691 | Bacteria | 4355 |
| 534 | Ga0373935_0001774 | 3300035692 | Bacteria | 12135 |
| 535 | Ga0373927_0000215 | 3300035695 | Bacteria | 46040 |
| 536 | Ga0373927_0278597 | 3300035695 | Bacteria | 1100 |
| 537 | Ga0373927_0356018 | 3300035695 | Bacteria | 965 |
| 538 | Ga0373947_0000242 | 3300035725 | Bacteria | 30738 |
| 539 | Ga0373937_0196091 | 3300036401 | Bacteria | 1898 |
| 540 | Ga0373937_0233384 | 3300036401 | Bacteria | 1733 |
| 541 | Ga0373925_0000700 | 3300037068 | Bacteria | 31392 |
| 542 | Ga0373925_0177241 | 3300037068 | Bacteria | 1685 |
| 543 | Ga0395899_0002984 | 3300037312 | Bacteria | 13533 |
| 544 | Ga0395899_0004579 | 3300037312 | Bacteria | 10775 |
| 545 | Ga0395900_0000387 | 3300037418 | Bacteria | 63605 |
| 546 | Ga0395900_0006516 | 3300037418 | Bacteria | 12165 |
| 547 | Ga0395900_0010859 | 3300037418 | Bacteria | 9314 |
| 548 | Ga0395900_0020030 | 3300037418 | Bacteria | 6821 |
| 549 | Ga0395900_0044597 | 3300037418 | Bacteria | 4568 |
| 550 | Ga0395900_0267418 | 3300037418 | Bacteria | 1705 |
| 551 | Ga0395898_0000958 | 3300037466 | Bacteria | 45958 |
| 552 | Ga0395898_0002933 | 3300037466 | Bacteria | 19401 |
| 553 | Ga0395898_0010476 | 3300037466 | Bacteria | 9691 |
| 554 | Ga0395898_0012459 | 3300037466 | Bacteria | 8791 |
| 555 | Ga0395898_0028246 | 3300037466 | Bacteria | 5625 |
| 556 | Ga0395905_0002575 | 3300037471 | Bacteria | 19972 |
| 557 | Ga0395905_0004104 | 3300037471 | Bacteria | 15258 |
| 558 | Ga0395905_0005907 | 3300037471 | Bacteria | 12410 |
| 559 | Ga0395905_0006007 | 3300037471 | Bacteria | 12291 |
| 560 | Ga0395905_0007574 | 3300037471 | Bacteria | 10789 |
| 561 | Ga0395905_0009071 | 3300037471 | Bacteria | 9755 |
| 562 | Ga0395905_0023096 | 3300037471 | Bacteria | 5879 |
| 563 | Ga0395905_0104621 | 3300037471 | Bacteria | 2657 |
| 564 | Ga0395905_0105356 | 3300037471 | Bacteria | 2648 |
| 565 | Ga0395905_0112958 | 3300037471 | Bacteria | 2552 |
| 566 | Ga0395905_0113088 | 3300037471 | Bacteria | 2550 |
| 567 | Ga0395905_0139673 | 3300037471 | Bacteria | 2279 |
| 568 | Ga0395905_0190377 | 3300037471 | Bacteria | 1924 |
| 569 | Ga0395905_0198583 | 3300037471 | Bacteria | 1881 |
| 570 | Ga0395905_0348044 | 3300037471 | Unclassified | 1374 |
| 571 | Ga0436364_0252687 | 3300037853 | Bacteria | 823 |
| 572 | Ga0395901_0003137 | 3300038443 | Bacteria | 16603 |
| 573 | Ga0395901_0038125 | 3300038443 | Bacteria | 4971 |
| 574 | Ga0395901_0144544 | 3300038443 | Bacteria | 2500 |
| 575 | Ga0395901_0250782 | 3300038443 | Bacteria | 1844 |
| 576 | Ga0395901_0424467 | 3300038443 | Bacteria | 1363 |
| 577 | Ga0395901_0679900 | 3300038443 | Bacteria | 1029 |
| 578 | Ga0237819_05419 | 3300038705 | Bacteria | 2005 |
| 579 | Ga0436365_1382513 | 3300039437 | Bacteria | 6411 |
| 580 | Ga0436361_0010685 | 3300039447 | Bacteria | 1105 |
| 581 | Ga0436363_0491254 | 3300039450 | Bacteria | 1420 |
| 582 | Ga0436363_1157161 | 3300039450 | Bacteria | 7889 |
| 583 | Ga0439447_005815 | 3300041407 | Bacteria | 4065 |
| 584 | Ga0439453_0029934 | 3300041408 | Bacteria | 1027 |
| 585 | Ga0439465_0126018 | 3300041413 | Bacteria | 901 |
| 586 | Ga0451789_0890581 | 3300041443 | Bacteria | 1569 |
| 587 | Ga0451798_0006129 | 3300041458 | Bacteria | 2028 |
| 588 | Ga0451800_1231896 | 3300041459 | Bacteria | 2598 |
| 589 | Ga0439431_0006681 | 3300041997 | Bacteria | 2557 |
| 590 | Ga0439433_0009143 | 3300041999 | Bacteria | 2157 |
| 591 | Ga0439449_0012132 | 3300042007 | Bacteria | 3239 |
| 592 | Ga0439450_016327 | 3300042008 | Bacteria | 1534 |
| 593 | Ga0439451_013034 | 3300042009 | Bacteria | 1679 |
| 594 | Ga0439456_020582 | 3300042013 | Bacteria | 1392 |
| 595 | Ga0439457_057648 | 3300042014 | Bacteria | 877 |
| 596 | Ga0439462_0009145 | 3300042015 | Bacteria | 2505 |
| 597 | Ga0450898_009171 | 3300042134 | Bacteria | 1577 |
| 598 | Ga0450902_008026 | 3300042137 | Bacteria | 1641 |
| 599 | Ga0450903_001354 | 3300042138 | Bacteria | 4584 |
| 600 | Ga0450903_002112 | 3300042138 | Bacteria | 3571 |
| 601 | Ga0450905_010419 | 3300042142 | Bacteria | 1287 |
| 602 | Ga0439446_0012973 | 3300042156 | Bacteria | 2281 |
| 603 | Ga0439446_0019921 | 3300042156 | Bacteria | 1887 |
| 604 | Ga0450908_007790 | 3300042184 | Bacteria | 2013 |
| 605 | Ga0439434_0047294 | 3300042435 | Bacteria | 1329 |
| 606 | Ga0439460_0033721 | 3300042461 | Bacteria | 1472 |
| 607 | Ga0451577_0001028 | 3300042876 | Bacteria | 40476 |
| 608 | Ga0451577_0027391 | 3300042876 | Bacteria | 5159 |
| 609 | Ga0451577_0178976 | 3300042876 | Bacteria | 1911 |
| 610 | Ga0466969_0000009 | 3300044656 | Bacteria | 125464 |
| 611 | Ga0466969_0013911 | 3300044656 | Bacteria | 4235 |
| 612 | Ga0466969_0032818 | 3300044656 | Bacteria | 2638 |
| 613 | Ga0466969_0036236 | 3300044656 | Bacteria | 2493 |
| 614 | Ga0453683_0012323 | 3300044673 | Bacteria | 5605 |
| 615 | Ga0453683_0068463 | 3300044673 | Bacteria | 2220 |
| 616 | Ga0466965_0003719 | 3300044683 | Bacteria | 6735 |
| 617 | Ga0466966_0000818 | 3300044684 | Bacteria | 19809 |
| 618 | Ga0466966_0021372 | 3300044684 | Bacteria | 4249 |
| 619 | Ga0466966_0228245 | 3300044684 | Bacteria | 1123 |
| 620 | Ga0466961_0038195 | 3300044693 | Bacteria | 3079 |
| 621 | Ga0466961_0111823 | 3300044693 | Bacteria | 1718 |
| 622 | Ga0466961_0168319 | 3300044693 | Bacteria | 1363 |
| 623 | Ga0466961_0217074 | 3300044693 | Bacteria | 1179 |
| 624 | Ga0466963_0050472 | 3300044694 | Bacteria | 2753 |
| 625 | Ga0466963_0121342 | 3300044694 | Bacteria | 1799 |
| 626 | Ga0466963_0410234 | 3300044694 | Bacteria | 955 |
| 627 | Ga0466964_0004255 | 3300044706 | Bacteria | 5272 |
| 628 | Ga0453684_0000280 | 3300044712 | Bacteria | 219955 |
| 629 | Ga0453684_0030004 | 3300044712 | Bacteria | 7698 |
| 630 | Ga0453684_0492545 | 3300044712 | Bacteria | 1358 |
| 631 | Ga0453684_0501604 | 3300044712 | Bacteria | 1344 |
| 632 | Ga0466971_0009634 | 3300044719 | Bacteria | 4216 |
| 633 | Ga0466968_0018776 | 3300044735 | Bacteria | 2775 |
| 634 | Ga0466968_0024344 | 3300044735 | Bacteria | 2472 |
| 635 | Ga0466970_0166066 | 3300044765 | Bacteria | 1222 |
| 636 | Ga0466957_0003611 | 3300044842 | Bacteria | 8522 |
| 637 | Ga0466957_0044811 | 3300044842 | Bacteria | 2681 |
| 638 | Ga0466957_0076160 | 3300044842 | Bacteria | 2082 |
| 639 | Ga0466960_0093818 | 3300044901 | Bacteria | 1534 |
| 640 | Ga0466959_0005772 | 3300045049 | Bacteria | 8522 |
| 641 | Ga0466959_0009501 | 3300045049 | Bacteria | 6919 |
| 642 | Ga0466959_0023548 | 3300045049 | Bacteria | 4556 |
| 643 | Ga0466959_0041525 | 3300045049 | Bacteria | 3395 |
| 644 | Ga0466959_0064165 | 3300045049 | Bacteria | 2666 |
| 645 | Ga0466959_0173392 | 3300045049 | Bacteria | 1512 |
| 646 | Ga0451576_0003797 | 3300045051 | Bacteria | 20361 |
| 647 | Ga0451576_0004140 | 3300045051 | Bacteria | 19114 |
| 648 | Ga0451576_0027493 | 3300045051 | Bacteria | 6109 |
| 649 | Ga0451576_0309203 | 3300045051 | Bacteria | 1653 |
| 650 | Ga0451576_0343726 | 3300045051 | Bacteria | 1562 |
| 651 | Ga0451576_0406597 | 3300045051 | Bacteria | 1427 |
| 652 | Ga0451576_0543329 | 3300045051 | Bacteria | 1221 |
| 653 | Ga0466958_0032521 | 3300045836 | Bacteria | 3103 |
| 654 | Ga0466958_0037418 | 3300045836 | Bacteria | 2907 |
| 655 | Ga0466958_0098498 | 3300045836 | Bacteria | 1815 |
| 656 | Ga0466967_0016859 | 3300045976 | Bacteria | 5776 |
| 657 | Ga0466967_0021050 | 3300045976 | Bacteria | 5283 |
| 658 | Ga0466967_0312674 | 3300045976 | Bacteria | 1513 |
| 659 | Ga0495592_0001331 | 3300046454 | Bacteria | 17151 |
| 660 | Ga0495592_0350457 | 3300046454 | Bacteria | 947 |
| 661 | Ga0495603_0034923 | 3300046455 | Bacteria | 3022 |
| 662 | Ga0495590_0000939 | 3300046457 | Bacteria | 12918 |
| 663 | Ga0495590_0015656 | 3300046457 | Bacteria | 2748 |
| 664 | Ga0495638_0000224 | 3300046460 | Bacteria | 77870 |
| 665 | Ga0495638_0002166 | 3300046460 | Bacteria | 16488 |
| 666 | Ga0495638_0002585 | 3300046460 | Bacteria | 14627 |
| 667 | Ga0495580_0000118 | 3300046472 | Bacteria | 54013 |
| 668 | Ga0495580_0003172 | 3300046472 | Bacteria | 14094 |
| 669 | Ga0495580_0404365 | 3300046472 | Bacteria | 920 |
| 670 | Ga0495582_0226193 | 3300046473 | Bacteria | 1071 |
| 671 | Ga0495664_0187568 | 3300046477 | Bacteria | 1254 |
| 672 | Ga0495594_0026445 | 3300046499 | Bacteria | 3122 |
| 673 | Ga0495594_0304463 | 3300046499 | Bacteria | 908 |
| 674 | Ga0495583_0000071 | 3300046506 | Bacteria | 183691 |
| 675 | Ga0495583_0084614 | 3300046506 | Bacteria | 1374 |
| 676 | Ga0495606_0000560 | 3300046507 | Bacteria | 59169 |
| 677 | Ga0495608_0156099 | 3300046511 | Bacteria | 1453 |
| 678 | Ga0495620_0050297 | 3300046515 | Bacteria | 1779 |
| 679 | Ga0495620_0052557 | 3300046515 | Bacteria | 1730 |
| 680 | Ga0495628_0005510 | 3300046516 | Bacteria | 11076 |
| 681 | Ga0495630_0001053 | 3300046517 | Bacteria | 19016 |
| 682 | Ga0495632_0011670 | 3300046519 | Bacteria | 5116 |
| 683 | Ga0495632_0035966 | 3300046519 | Bacteria | 2522 |
| 684 | Ga0495632_0050326 | 3300046519 | Bacteria | 2055 |
| 685 | Ga0495632_0051520 | 3300046519 | Bacteria | 2026 |
| 686 | Ga0495663_0014896 | 3300046525 | Bacteria | 2185 |
| 687 | Ga0495666_0174275 | 3300046526 | Bacteria | 994 |
| 688 | Ga0495642_0203357 | 3300046528 | Bacteria | 863 |
| 689 | Ga0495652_0227862 | 3300046529 | Bacteria | 1396 |
| 690 | Ga0495652_0251536 | 3300046529 | Bacteria | 1309 |
| 691 | Ga0495654_0090777 | 3300046530 | Bacteria | 1418 |
| 692 | Ga0495665_0007571 | 3300046531 | Bacteria | 5881 |
| 693 | Ga0495665_0092298 | 3300046531 | Bacteria | 1591 |
| 694 | Ga0495640_0011409 | 3300046533 | Bacteria | 6838 |
| 695 | Ga0495640_0094616 | 3300046533 | Bacteria | 1968 |
| 696 | Ga0495586_0033151 | 3300046535 | Bacteria | 2771 |
| 697 | Ga0495586_0219923 | 3300046535 | Bacteria | 1079 |
| 698 | Ga0495597_0012332 | 3300046542 | Bacteria | 4124 |
| 699 | Ga0495667_0015443 | 3300046559 | Bacteria | 5159 |
| 700 | Ga0495656_0021763 | 3300046615 | Bacteria | 2500 |
| 701 | Ga0495656_0022579 | 3300046615 | Bacteria | 2466 |
| 702 | Ga0495634_0016833 | 3300046642 | Bacteria | 5223 |
| 703 | Ga0495625_0000990 | 3300046660 | Bacteria | 37644 |
| 704 | Ga0495625_0013676 | 3300046660 | Bacteria | 6508 |
| 705 | Ga0495635_0012723 | 3300046663 | Bacteria | 5900 |
| 706 | Ga0495635_0136506 | 3300046663 | Bacteria | 1672 |
| 707 | Ga0495635_0146342 | 3300046663 | Bacteria | 1608 |
| 708 | Ga0495659_0104335 | 3300046664 | Bacteria | 1101 |
| 709 | Ga0495588_0084029 | 3300046674 | Bacteria | 1663 |
| 710 | Ga0495658_0030201 | 3300046683 | Bacteria | 2941 |
| 711 | Ga0495613_0029473 | 3300046689 | Bacteria | 4080 |
| 712 | Ga0495613_0561293 | 3300046689 | Bacteria | 763 |
| 713 | Ga0495624_0003524 | 3300046690 | Bacteria | 11602 |
| 714 | Ga0495670_0101905 | 3300046691 | Bacteria | 1479 |
| 715 | Ga0495671_0042279 | 3300046692 | Bacteria | 2291 |
| 716 | Ga0495649_0000144 | 3300046694 | Bacteria | 62066 |
| 717 | Ga0495649_0001813 | 3300046694 | Bacteria | 15681 |
| 718 | Ga0495589_0022802 | 3300046794 | Bacteria | 3192 |
| 719 | Ga0495600_0103555 | 3300046809 | Bacteria | 1855 |
| 720 | Ga0495660_0041610 | 3300046810 | Bacteria | 2542 |
| 721 | Ga0495581_0012636 | 3300047315 | Bacteria | 4893 |
| 722 | Ga0495604_0002984 | 3300047317 | Bacteria | 13551 |
| 723 | Ga0495674_0050007 | 3300047319 | Bacteria | 3690 |
| 724 | Ga0495674_0463555 | 3300047319 | Bacteria | 1017 |
| 725 | Ga0495676_0053068 | 3300047321 | Bacteria | 3233 |
| 726 | Ga0495680_0263007 | 3300047322 | Bacteria | 1220 |
| 727 | Ga0495687_000454 | 3300047443 | Bacteria | 50500 |
| 728 | Ga0495687_007504 | 3300047443 | Bacteria | 6410 |
| 729 | Ga0495685_019184 | 3300047447 | Bacteria | 2349 |
| 730 | Ga0495673_0070024 | 3300047469 | Bacteria | 1478 |
| 731 | Ga0495673_0091723 | 3300047469 | Bacteria | 1241 |
| 732 | Ga0495681_0164801 | 3300047470 | Bacteria | 921 |
| 733 | Ga0495684_0004024 | 3300047471 | Bacteria | 11468 |
| 734 | Ga0495684_0037777 | 3300047471 | Bacteria | 3704 |
| 735 | Ga0495684_0437164 | 3300047471 | Bacteria | 912 |
| 736 | Ga0495686_0001272 | 3300047472 | Bacteria | 28580 |
| 737 | Ga0495593_0024039 | 3300047673 | Bacteria | 3380 |
| 738 | Ga0495614_0160986 | 3300048089 | Bacteria | 1004 |
| 739 | Ga0495626_0102388 | 3300048091 | Bacteria | 1247 |
| 740 | Ga0496101_0099560 | 3300048904 | Bacteria | 2173 |
| 741 | Ga0496102_0001271 | 3300048905 | Bacteria | 22770 |
| 742 | Ga0496102_0027990 | 3300048905 | Bacteria | 5036 |
| 743 | Ga0496102_0041644 | 3300048905 | Bacteria | 4160 |
| 744 | Ga0496102_0910253 | 3300048905 | Bacteria | 801 |
| 745 | Ga0496103_0095447 | 3300048906 | Bacteria | 1879 |
| 746 | Ga0496104_0037358 | 3300048907 | Bacteria | 4542 |
| 747 | Ga0496105_0307559 | 3300048908 | Bacteria | 1273 |
| 748 | Ga0496106_0308786 | 3300048909 | Bacteria | 1269 |
| 749 | Ga0496106_0411920 | 3300048909 | Bacteria | 1086 |
| 750 | Ga0496107_0059744 | 3300048910 | Bacteria | 2759 |
| 751 | Ga0496107_0468999 | 3300048910 | Bacteria | 935 |
| 752 | Ga0496108_0154503 | 3300048911 | Bacteria | 1981 |
| 753 | Ga0496108_0456468 | 3300048911 | Bacteria | 1116 |
| 754 | Ga0496108_0475369 | 3300048911 | Bacteria | 1092 |
| 755 | Ga0496109_0122282 | 3300048912 | Bacteria | 2425 |
| 756 | Ga0496109_0359833 | 3300048912 | Bacteria | 1375 |
| 757 | Ga0496109_0382153 | 3300048912 | Bacteria | 1330 |
| 758 | Ga0496110_0030521 | 3300048913 | Bacteria | 4647 |
| 759 | Ga0496111_0544345 | 3300048914 | Bacteria | 852 |
| 760 | Ga0496113_0075019 | 3300048916 | Bacteria | 2580 |
| 761 | Ga0496114_0019358 | 3300048917 | Bacteria | 5516 |
| 762 | Ga0496114_0047036 | 3300048917 | Bacteria | 3587 |
| 763 | Ga0496114_0155840 | 3300048917 | Bacteria | 1983 |
| 764 | Ga0496115_0050330 | 3300048918 | Bacteria | 3337 |
| 765 | Ga0496121_0002728 | 3300048924 | Bacteria | 26312 |
| 766 | Ga0496122_0134255 | 3300048925 | Bacteria | 1564 |
| 767 | Ga0496123_0235711 | 3300048926 | Bacteria | 912 |
| 768 | Ga0496125_0297340 | 3300048928 | Bacteria | 991 |
| 769 | Ga0496126_0137269 | 3300048929 | Bacteria | 2108 |
| 770 | Ga0496126_0229384 | 3300048929 | Bacteria | 1556 |
| 771 | Ga0501034_0000106 | 3300049571 | Bacteria | 153523 |
| 772 | Ga0501034_0035657 | 3300049571 | Bacteria | 5042 |
| 773 | Ga0501038_0115715 | 3300049574 | Bacteria | 2216 |
| 774 | Ga0501043_0050928 | 3300049579 | Bacteria | 3255 |
| 775 | Ga0501046_0007148 | 3300049580 | Bacteria | 9821 |
| 776 | Ga0501046_0374205 | 3300049580 | Bacteria | 1032 |
| 777 | Ga0501047_0028441 | 3300049581 | Bacteria | 5389 |
| 778 | Ga0501071_0314737 | 3300049587 | Bacteria | 1188 |
| 779 | Ga0501076_0278236 | 3300049592 | Bacteria | 1371 |
| 780 | Ga0501198_000023 | 3300049649 | Bacteria | 69100 |
| 781 | Ga0501222_000031 | 3300049662 | Bacteria | 56867 |
| 782 | Ga0501080_0064774 | 3300049742 | Bacteria | 3399 |
| 783 | Ga0501035_0018506 | 3300049822 | Bacteria | 6418 |
| 784 | Ga0501035_0104532 | 3300049822 | Bacteria | 2483 |
| 785 | Ga0501035_0120588 | 3300049822 | Bacteria | 2293 |
| 786 | Ga0501044_0013961 | 3300049823 | Bacteria | 8676 |
| 787 | Ga0501044_0148737 | 3300049823 | Bacteria | 2325 |
| 788 | nmdc:mga03n38_33245_c1 | 3300050490 | Bacteria | 2192 |
| 789 | nmdc:mga03n38_348948_c1 | 3300050490 | Bacteria | 805 |
| 790 | nmdc:mga00v17_78683_c1 | 3300050491 | Bacteria | 2055 |
| 791 | nmdc:mga0yw44_324650_c1 | 3300050492 | Bacteria | 1034 |
| 792 | nmdc:mga0yw44_339383_c1 | 3300050492 | Bacteria | 1010 |
| 793 | nmdc:mga0yw44_410945_c1 | 3300050492 | Bacteria | 916 |
| 794 | nmdc:mga0yw44_96825_c1 | 3300050492 | Bacteria | 1874 |
| 795 | nmdc:mga0k408_10501_c1 | 3300050493 | Bacteria | 5009 |
| 796 | nmdc:mga0k408_111545_c1 | 3300050493 | Bacteria | 1617 |
| 797 | nmdc:mga0k408_14119_c2 | 3300050493 | Bacteria | 2484 |
| 798 | nmdc:mga0k408_14745_c1 | 3300050493 | Bacteria | 4312 |
| 799 | nmdc:mga0k408_201630_c1 | 3300050493 | Bacteria | 1188 |
| 800 | nmdc:mga0k408_323732_c1 | 3300050493 | Bacteria | 920 |
| 801 | nmdc:mga0k408_35013_c1 | 3300050493 | Bacteria | 2878 |
| 802 | nmdc:mga0k408_40610_c1 | 3300050493 | Bacteria | 2678 |
| 803 | nmdc:mga0k408_4653_c1 | 3300050493 | Bacteria | 7271 |
| 804 | nmdc:mga06z11_61813_c1 | 3300050494 | Bacteria | 1955 |
| 805 | nmdc:mga07m45_179357_c1 | 3300050496 | Bacteria | 1232 |
| 806 | nmdc:mga07m45_18581_c1 | 3300050496 | Bacteria | 3756 |
| 807 | nmdc:mga07m45_26255_c1 | 3300050496 | Bacteria | 3201 |
| 808 | nmdc:mga07m45_3277_c1 | 3300050496 | Bacteria | 7785 |
| 809 | nmdc:mga07m45_3995_c1 | 3300050496 | Bacteria | 7174 |
| 810 | nmdc:mga07m45_4628_c1 | 3300050496 | Bacteria | 6747 |
| 811 | nmdc:mga07m45_468_c1 | 3300050496 | Bacteria | 16990 |
| 812 | nmdc:mga07m45_49006_c1 | 3300050496 | Bacteria | 2377 |
| 813 | nmdc:mga07m45_494_c1 | 3300050496 | Bacteria | 16679 |
| 814 | nmdc:mga05p37_28163_c1 | 3300050507 | Bacteria | 6848 |
| 815 | nmdc:mga09592_1109_c1 | 3300050508 | Bacteria | 21409 |
| 816 | nmdc:mga0qj67_194221_c1 | 3300050509 | Bacteria | 1649 |
| 817 | nmdc:mga0n895_93044_c1 | 3300050512 | Bacteria | 3018 |
| 818 | nmdc:mga0sz30_115229_c1 | 3300050516 | Bacteria | 1179 |
| 819 | nmdc:mga0sz30_17015_c1 | 3300050516 | Bacteria | 2895 |
| 820 | nmdc:mga0sz30_4255_c1 | 3300050516 | Bacteria | 3021 |
| 821 | Ga0495601_0000453 | 3300053077 | Bacteria | 21492 |
| 822 | Ga0495601_0325694 | 3300053077 | Bacteria | 1000 |
| 823 | Ga0495612_0129886 | 3300053078 | Bacteria | 1088 |
| 824 | Ga0495619_0041407 | 3300053085 | Bacteria | 3013 |
| 825 | Ga0495619_0067162 | 3300053085 | Bacteria | 2394 |
| 826 | Ga0500578_0000057 | 3300053086 | Bacteria | 120178 |
| 827 | Ga0500646_0001133 | 3300053090 | Bacteria | 7188 |
| 828 | Ga0500646_0017240 | 3300053090 | Bacteria | 1892 |
| 829 | Ga0500583_0039612 | 3300053092 | Bacteria | 2129 |
| 830 | Ga0500651_0035425 | 3300053093 | Bacteria | 3145 |
| 831 | Ga0500562_049598 | 3300053108 | Bacteria | 1122 |
| 832 | Ga0500569_061511 | 3300053109 | Bacteria | 1160 |
| 833 | Ga0500593_000186 | 3300053117 | Bacteria | 25186 |
| 834 | Ga0500593_000199 | 3300053117 | Bacteria | 24418 |
| 835 | Ga0500595_010356 | 3300053119 | Bacteria | 3709 |
| 836 | Ga0500652_002632 | 3300053131 | Bacteria | 5421 |
| 837 | Ga0500655_035354 | 3300053133 | Bacteria | 970 |
| 838 | Ga0500658_0001951 | 3300053134 | Bacteria | 8075 |
| 839 | Ga0500658_0062796 | 3300053134 | Bacteria | 1549 |
| 840 | Ga0500604_0028653 | 3300053151 | Bacteria | 1618 |
| 841 | Ga0500616_0000028 | 3300053153 | Bacteria | 435722 |
| 842 | Ga0500622_0000530 | 3300053156 | Bacteria | 35364 |
| 843 | Ga0500627_0144519 | 3300053158 | Bacteria | 1074 |
| 844 | Ga0500645_000978 | 3300053730 | Bacteria | 16206 |
| 845 | Ga0500645_008154 | 3300053730 | Bacteria | 3598 |
| 846 | Ga0500661_010782 | 3300055283 | Bacteria | 1661 |
| 847 | Ga0501082_0469980 | 3300060353 | Bacteria | 1099 |
| 848 | Ga0466962_0012685 | 3300061719 | Bacteria | 4053 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049587 | Ga0501071_0314737 | Ga0501071_0314737_516_1151 | 210 |
| 2 | 3300053158 | Ga0500627_0144519 | Ga0500627_0144519_415_1050 | 210 |
| 3 | 3300035172 | Ga0373955_0432428 | Ga0373955_0432428_14_661 | 214 |
| 4 | 3300035695 | Ga0373927_0278597 | Ga0373927_0278597_440_1087 | 214 |
| 5 | 3300046689 | Ga0495613_0561293 | Ga0495613_0561293_13_660 | 214 |
| 6 | 3300047471 | Ga0495684_0037777 | Ga0495684_0037777_15_662 | 214 |
| 7 | 3300053153 | Ga0500616_0000028 | Ga0500616_0000028_149945_150670 | 215 |
| 8 | 3300046533 | Ga0495640_0094616 | Ga0495640_0094616_151_822 | 222 |
| 9 | 3300005445 | Ga0070708_100246996 | Ga0070708_1002469962 | 223 |
| 10 | 3300050492 | nmdc:mga0yw44_324650_c1 | nmdc:mga0yw44_324650_c1_17_703 | 227 |
| 11 | 3300037471 | Ga0395905_0348044 | Ga0395905_0348044_96_785 | 228 |
| 12 | 3300042184 | Ga0450908_007790 | Ga0450908_007790_1311_2000 | 228 |
| 13 | 3300042461 | Ga0439460_0033721 | Ga0439460_0033721_426_1118 | 229 |
| 14 | 3300046454 | Ga0495592_0001331 | Ga0495592_0001331_11896_12588 | 229 |
| 15 | 3300046477 | Ga0495664_0187568 | Ga0495664_0187568_245_937 | 229 |
| 16 | 3300046516 | Ga0495628_0005510 | Ga0495628_0005510_8852_9544 | 229 |
| 17 | 3300046529 | Ga0495652_0251536 | Ga0495652_0251536_216_908 | 229 |
| 18 | 3300046535 | Ga0495586_0033151 | Ga0495586_0033151_21_713 | 229 |
| 19 | 3300053077 | Ga0495601_0000453 | Ga0495601_0000453_6217_6909 | 229 |
| 20 | iso_pu_bacteria | 2511231002 | 2511245469 | 229 |
| 21 | iso_pu_bacteria | 2513237165 | 2514040420 | 229 |
| 22 | iso_pu_bacteria | 2585428057 | 2587726033 | 229 |
| 23 | iso_pu_bacteria | 2585428058 | 2587737094 | 229 |
| 24 | iso_pu_bacteria | 2585428062 | 2587758103 | 229 |
| 25 | iso_pu_bacteria | 2588253510 | 2588290361 | 229 |
| 26 | iso_pu_bacteria | 2643221592 | 2643967670 | 229 |
| 27 | iso_pu_bacteria | 2643221625 | 2644140492 | 229 |
| 28 | iso_pu_bacteria | 2643221648 | 2644273459 | 229 |
| 29 | iso_pu_bacteria | 2901300506 | 2901312698 | 229 |
| 30 | 3300005356 | Ga0070674_100088035 | Ga0070674_1000880352 | 230 |
| 31 | 3300005444 | Ga0070694_100240688 | Ga0070694_1002406881 | 230 |
| 32 | 3300005548 | Ga0070665_100033015 | Ga0070665_1000330155 | 230 |
| 33 | 3300005564 | Ga0070664_100366849 | Ga0070664_1003668492 | 230 |
| 34 | 3300005615 | Ga0070702_100241977 | Ga0070702_1002419772 | 230 |
| 35 | 3300006847 | Ga0075431_100555548 | Ga0075431_1005555482 | 230 |
| 36 | 3300013102 | Ga0157371_10271449 | Ga0157371_102714492 | 230 |
| 37 | 3300013308 | Ga0157375_10269437 | Ga0157375_102694372 | 230 |
| 38 | 3300025937 | Ga0207669_10099865 | Ga0207669_100998652 | 230 |
| 39 | 3300026075 | Ga0207708_10043438 | Ga0207708_100434384 | 230 |
| 40 | iso_pu_bacteria | 2881101125 | 2881103107 | 230 |
| 41 | 3300007788 | Ga0099795_10017584 | Ga0099795_100175842 | 231 |
| 42 | 3300028016 | Ga0265354_1002175 | Ga0265354_10021752 | 231 |
| 43 | 3300030878 | Ga0265770_1001763 | Ga0265770_10017634 | 231 |
| 44 | 3300031251 | Ga0265327_10113012 | Ga0265327_101130122 | 231 |
| 45 | 3300031730 | Ga0307516_10005729 | Ga0307516_100057298 | 231 |
| 46 | 3300041407 | Ga0439447_005815 | Ga0439447_005815_115_825 | 231 |
| 47 | 3300042137 | Ga0450902_008026 | Ga0450902_008026_668_1378 | 231 |
| 48 | 3300042138 | Ga0450903_001354 | Ga0450903_001354_269_979 | 231 |
| 49 | 3300046460 | Ga0495638_0002166 | Ga0495638_0002166_7843_8553 | 231 |
| 50 | 3300053119 | Ga0500595_010356 | Ga0500595_010356_2333_3046 | 231 |
| 51 | iso_pu_bacteria | 2511231021 | 2511358074 | 231 |
| 52 | iso_pu_bacteria | 2738541277 | 2738723559 | 231 |
| 53 | iso_pu_bacteria | 2738543019 | 2739284290 | 231 |
| 54 | iso_pu_bacteria | 2838122688 | 2838127292 | 231 |
| 55 | iso_pu_bacteria | 2841983080 | 2841987392 | 231 |
| 56 | iso_pu_bacteria | 2904615490 | 2904618506 | 231 |
| 57 | iso_pu_bacteria | 2917699015 | 2917701080 | 231 |
| 58 | 3300002738 | JGI25154J39366_1001259 | JGI25154J39366_10012593 | 232 |
| 59 | 3300002741 | JGI25157J39369_1000179 | JGI25157J39369_100017910 | 232 |
| 60 | 3300003752 | Ga0055539_1000509 | Ga0055539_10005092 | 232 |
| 61 | 3300003752 | Ga0055539_1001998 | Ga0055539_10019982 | 232 |
| 62 | 3300003756 | Ga0055533_1000008 | Ga0055533_1000008539 | 232 |
| 63 | 3300003761 | Ga0055535_1007880 | Ga0055535_10078802 | 232 |
| 64 | 3300005331 | Ga0070670_100409341 | Ga0070670_1004093411 | 232 |
| 65 | 3300005336 | Ga0070680_100462302 | Ga0070680_1004623022 | 232 |
| 66 | 3300005438 | Ga0070701_10160769 | Ga0070701_101607692 | 232 |
| 67 | 3300005441 | Ga0070700_100020552 | Ga0070700_1000205521 | 232 |
| 68 | 3300005458 | Ga0070681_10031139 | Ga0070681_100311392 | 232 |
| 69 | 3300005530 | Ga0070679_100230597 | Ga0070679_1002305972 | 232 |
| 70 | 3300005539 | Ga0068853_100031519 | Ga0068853_1000315194 | 232 |
| 71 | 3300005539 | Ga0068853_100490830 | Ga0068853_1004908302 | 232 |
| 72 | 3300005546 | Ga0070696_100264630 | Ga0070696_1002646302 | 232 |
| 73 | 3300005563 | Ga0068855_100173573 | Ga0068855_1001735733 | 232 |
| 74 | 3300005577 | Ga0068857_100023783 | Ga0068857_1000237833 | 232 |
| 75 | 3300005578 | Ga0068854_100026160 | Ga0068854_1000261603 | 232 |
| 76 | 3300005614 | Ga0068856_100012272 | Ga0068856_1000122723 | 232 |
| 77 | 3300005614 | Ga0068856_100275801 | Ga0068856_1002758012 | 232 |
| 78 | 3300005617 | Ga0068859_100019359 | Ga0068859_1000193593 | 232 |
| 79 | 3300005617 | Ga0068859_100442113 | Ga0068859_1004421132 | 232 |
| 80 | 3300005842 | Ga0068858_100175626 | Ga0068858_1001756262 | 232 |
| 81 | 3300006237 | Ga0097621_100085195 | Ga0097621_1000851952 | 232 |
| 82 | 3300006358 | Ga0068871_100096935 | Ga0068871_1000969352 | 232 |
| 83 | 3300006844 | Ga0075428_101159703 | Ga0075428_1011597031 | 232 |
| 84 | 3300006931 | Ga0097620_100019361 | Ga0097620_1000193613 | 232 |
| 85 | 3300006931 | Ga0097620_100442089 | Ga0097620_1004420892 | 232 |
| 86 | 3300009174 | Ga0105241_10066756 | Ga0105241_100667563 | 232 |
| 87 | 3300009177 | Ga0105248_10025188 | Ga0105248_100251883 | 232 |
| 88 | 3300009545 | Ga0105237_10010803 | Ga0105237_1001080310 | 232 |
| 89 | 3300009545 | Ga0105237_10489490 | Ga0105237_104894902 | 232 |
| 90 | 3300009551 | Ga0105238_10020457 | Ga0105238_100204574 | 232 |
| 91 | 3300010375 | Ga0105239_10050326 | Ga0105239_100503263 | 232 |
| 92 | 3300010375 | Ga0105239_10506477 | Ga0105239_105064772 | 232 |
| 93 | 3300013296 | Ga0157374_10576139 | Ga0157374_105761392 | 232 |
| 94 | 3300013306 | Ga0163162_10468804 | Ga0163162_104688042 | 232 |
| 95 | 3300025226 | Ga0209674_100015 | Ga0209674_100015131 | 232 |
| 96 | 3300025230 | Ga0209563_100017 | Ga0209563_100017228 | 232 |
| 97 | 3300025242 | Ga0209258_100557 | Ga0209258_10055723 | 232 |
| 98 | 3300025246 | Ga0209646_1000131 | Ga0209646_1000131133 | 232 |
| 99 | 3300025250 | Ga0209026_1000038 | Ga0209026_1000038133 | 232 |
| 100 | 3300025253 | Ga0209677_100022 | Ga0209677_100022274 | 232 |
| 101 | 3300025253 | Ga0209677_100074 | Ga0209677_10007458 | 232 |
| 102 | 3300025256 | Ga0209759_1000031 | Ga0209759_1000031133 | 232 |
| 103 | 3300025272 | Ga0209455_1012267 | Ga0209455_10122672 | 232 |
| 104 | 3300025911 | Ga0207654_10035373 | Ga0207654_100353732 | 232 |
| 105 | 3300025912 | Ga0207707_10022477 | Ga0207707_100224772 | 232 |
| 106 | 3300025914 | Ga0207671_10064598 | Ga0207671_100645983 | 232 |
| 107 | 3300025917 | Ga0207660_10169553 | Ga0207660_101695533 | 232 |
| 108 | 3300025920 | Ga0207649_10235302 | Ga0207649_102353022 | 232 |
| 109 | 3300025931 | Ga0207644_10032713 | Ga0207644_100327134 | 232 |
| 110 | 3300025941 | Ga0207711_10011255 | Ga0207711_100112554 | 232 |
| 111 | 3300025944 | Ga0207661_10180601 | Ga0207661_101806012 | 232 |
| 112 | 3300025986 | Ga0207658_10583726 | Ga0207658_105837261 | 232 |
| 113 | 3300026035 | Ga0207703_10214019 | Ga0207703_102140192 | 232 |
| 114 | 3300026041 | Ga0207639_10006133 | Ga0207639_100061333 | 232 |
| 115 | 3300026075 | Ga0207708_10185426 | Ga0207708_101854262 | 232 |
| 116 | 3300026078 | Ga0207702_10004240 | Ga0207702_100042406 | 232 |
| 117 | 3300026088 | Ga0207641_10333084 | Ga0207641_103330842 | 232 |
| 118 | 3300026116 | Ga0207674_10021307 | Ga0207674_100213073 | 232 |
| 119 | 3300026116 | Ga0207674_10031102 | Ga0207674_100311023 | 232 |
| 120 | 3300027471 | Ga0209995_1000160 | Ga0209995_10001606 | 232 |
| 121 | 3300027876 | Ga0209974_10003807 | Ga0209974_100038074 | 232 |
| 122 | 3300027907 | Ga0207428_10152541 | Ga0207428_101525412 | 232 |
| 123 | 3300028786 | Ga0307517_10297086 | Ga0307517_102970862 | 232 |
| 124 | 3300031241 | Ga0265325_10029087 | Ga0265325_100290873 | 232 |
| 125 | 3300031730 | Ga0307516_10021030 | Ga0307516_100210306 | 232 |
| 126 | 3300035118 | Ga0373954_0029214 | Ga0373954_0029214_1441_2160 | 232 |
| 127 | 3300037471 | Ga0395905_0198583 | Ga0395905_0198583_656_1393 | 232 |
| 128 | 3300044735 | Ga0466968_0018776 | Ga0466968_0018776_1579_2280 | 232 |
| 129 | 3300046499 | Ga0495594_0304463 | Ga0495594_0304463_164_877 | 232 |
| 130 | 3300046511 | Ga0495608_0156099 | Ga0495608_0156099_575_1294 | 232 |
| 131 | 3300046559 | Ga0495667_0015443 | Ga0495667_0015443_2043_2762 | 232 |
| 132 | 3300046663 | Ga0495635_0136506 | Ga0495635_0136506_55_756 | 232 |
| 133 | 3300047322 | Ga0495680_0263007 | Ga0495680_0263007_443_1162 | 232 |
| 134 | 3300047471 | Ga0495684_0437164 | Ga0495684_0437164_49_768 | 232 |
| 135 | 3300048905 | Ga0496102_0041644 | Ga0496102_0041644_2857_3558 | 232 |
| 136 | 3300048905 | Ga0496102_0910253 | Ga0496102_0910253_69_782 | 232 |
| 137 | 3300049592 | Ga0501076_0278236 | Ga0501076_0278236_480_1181 | 232 |
| 138 | 3300053117 | Ga0500593_000186 | Ga0500593_000186_22555_23256 | 232 |
| 139 | 3300060353 | Ga0501082_0469980 | Ga0501082_0469980_91_792 | 232 |
| 140 | iso_pu_bacteria | 2939631187 | 2939633203 | 232 |
| 141 | 3300002704 | JGI25155J39150_1000035 | JGI25155J39150_100003550 | 233 |
| 142 | 3300002705 | JGI25156J39149_1000012 | JGI25156J39149_100001235 | 233 |
| 143 | 3300002738 | JGI25154J39366_1000029 | JGI25154J39366_1000029136 | 233 |
| 144 | 3300002741 | JGI25157J39369_1000014 | JGI25157J39369_100001435 | 233 |
| 145 | 3300002987 | JGI25159J45721_1000334 | JGI25159J45721_100033416 | 233 |
| 146 | 3300002987 | JGI25159J45721_1003179 | JGI25159J45721_10031792 | 233 |
| 147 | 3300003187 | JGI25151J46595_10008323 | JGI25151J46595_100083236 | 233 |
| 148 | 3300003187 | JGI25151J46595_10008820 | JGI25151J46595_100088203 | 233 |
| 149 | 3300003354 | JGI25160J50197_1000303 | JGI25160J50197_100030315 | 233 |
| 150 | 3300003354 | JGI25160J50197_1044611 | JGI25160J50197_10446111 | 233 |
| 151 | 3300003374 | JGI25161J50226_1000094 | JGI25161J50226_100009445 | 233 |
| 152 | 3300003761 | Ga0055535_1000346 | Ga0055535_100034648 | 233 |
| 153 | 3300003761 | Ga0055535_1000467 | Ga0055535_100046727 | 233 |
| 154 | 3300003763 | Ga0055529_1000156 | Ga0055529_100015666 | 233 |
| 155 | 3300003771 | Ga0055526_1000854 | Ga0055526_10008543 | 233 |
| 156 | 3300003771 | Ga0055526_1004656 | Ga0055526_10046563 | 233 |
| 157 | 3300003773 | Ga0055537_1000092 | Ga0055537_10000923 | 233 |
| 158 | 3300003775 | Ga0055524_1000306 | Ga0055524_100030626 | 233 |
| 159 | 3300003781 | Ga0055536_1020051 | Ga0055536_10200512 | 233 |
| 160 | 3300003784 | Ga0055534_1006822 | Ga0055534_10068222 | 233 |
| 161 | 3300003790 | Ga0055528_1000480 | Ga0055528_100048010 | 233 |
| 162 | 3300003791 | Ga0055530_10000863 | Ga0055530_1000086311 | 233 |
| 163 | 3300003792 | Ga0055540_1000449 | Ga0055540_100044915 | 233 |
| 164 | 3300003792 | Ga0055540_1006320 | Ga0055540_10063203 | 233 |
| 165 | 3300003794 | Ga0055531_10002683 | Ga0055531_100026833 | 233 |
| 166 | 3300003794 | Ga0055531_10002832 | Ga0055531_100028324 | 233 |
| 167 | 3300004625 | Ga0055543_1000780 | Ga0055543_100078010 | 233 |
| 168 | 3300005262 | Ga0065165_1001186 | Ga0065165_100118626 | 233 |
| 169 | 3300005288 | Ga0065714_10018971 | Ga0065714_100189712 | 233 |
| 170 | 3300005295 | Ga0065707_10176353 | Ga0065707_101763531 | 233 |
| 171 | 3300005327 | Ga0070658_10115923 | Ga0070658_101159233 | 233 |
| 172 | 3300005327 | Ga0070658_10146194 | Ga0070658_101461942 | 233 |
| 173 | 3300005327 | Ga0070658_10589056 | Ga0070658_105890561 | 233 |
| 174 | 3300005328 | Ga0070676_10006298 | Ga0070676_100062984 | 233 |
| 175 | 3300005329 | Ga0070683_100040327 | Ga0070683_1000403272 | 233 |
| 176 | 3300005329 | Ga0070683_100065230 | Ga0070683_1000652303 | 233 |
| 177 | 3300005330 | Ga0070690_100062871 | Ga0070690_1000628713 | 233 |
| 178 | 3300005331 | Ga0070670_100040562 | Ga0070670_1000405624 | 233 |
| 179 | 3300005331 | Ga0070670_100042619 | Ga0070670_1000426193 | 233 |
| 180 | 3300005331 | Ga0070670_100512908 | Ga0070670_1005129082 | 233 |
| 181 | 3300005333 | Ga0070677_10067027 | Ga0070677_100670272 | 233 |
| 182 | 3300005334 | Ga0068869_100108125 | Ga0068869_1001081253 | 233 |
| 183 | 3300005337 | Ga0070682_100104091 | Ga0070682_1001040913 | 233 |
| 184 | 3300005338 | Ga0068868_100011018 | Ga0068868_1000110187 | 233 |
| 185 | 3300005338 | Ga0068868_100015797 | Ga0068868_1000157973 | 233 |
| 186 | 3300005338 | Ga0068868_100555220 | Ga0068868_1005552201 | 233 |
| 187 | 3300005339 | Ga0070660_100025973 | Ga0070660_1000259734 | 233 |
| 188 | 3300005339 | Ga0070660_100061955 | Ga0070660_1000619552 | 233 |
| 189 | 3300005339 | Ga0070660_100140920 | Ga0070660_1001409201 | 233 |
| 190 | 3300005340 | Ga0070689_100128466 | Ga0070689_1001284662 | 233 |
| 191 | 3300005344 | Ga0070661_100112646 | Ga0070661_1001126462 | 233 |
| 192 | 3300005347 | Ga0070668_100004185 | Ga0070668_10000418512 | 233 |
| 193 | 3300005353 | Ga0070669_100025707 | Ga0070669_1000257074 | 233 |
| 194 | 3300005353 | Ga0070669_100455366 | Ga0070669_1004553661 | 233 |
| 195 | 3300005354 | Ga0070675_100009133 | Ga0070675_1000091334 | 233 |
| 196 | 3300005354 | Ga0070675_100080463 | Ga0070675_1000804632 | 233 |
| 197 | 3300005355 | Ga0070671_100113696 | Ga0070671_1001136961 | 233 |
| 198 | 3300005355 | Ga0070671_100531978 | Ga0070671_1005319782 | 233 |
| 199 | 3300005356 | Ga0070674_100019585 | Ga0070674_1000195854 | 233 |
| 200 | 3300005356 | Ga0070674_100321063 | Ga0070674_1003210632 | 233 |
| 201 | 3300005366 | Ga0070659_100067511 | Ga0070659_1000675112 | 233 |
| 202 | 3300005366 | Ga0070659_100176025 | Ga0070659_1001760252 | 233 |
| 203 | 3300005367 | Ga0070667_100260497 | Ga0070667_1002604972 | 233 |
| 204 | 3300005455 | Ga0070663_100008867 | Ga0070663_1000088677 | 233 |
| 205 | 3300005457 | Ga0070662_100004805 | Ga0070662_1000048053 | 233 |
| 206 | 3300005457 | Ga0070662_100094281 | Ga0070662_1000942813 | 233 |
| 207 | 3300005458 | Ga0070681_10732200 | Ga0070681_107322002 | 233 |
| 208 | 3300005459 | Ga0068867_100058847 | Ga0068867_1000588472 | 233 |
| 209 | 3300005459 | Ga0068867_100408129 | Ga0068867_1004081291 | 233 |
| 210 | 3300005467 | Ga0070706_100000367 | Ga0070706_10000036738 | 233 |
| 211 | 3300005471 | Ga0070698_100139972 | Ga0070698_1001399722 | 233 |
| 212 | 3300005530 | Ga0070679_100004721 | Ga0070679_1000047217 | 233 |
| 213 | 3300005530 | Ga0070679_100134851 | Ga0070679_1001348512 | 233 |
| 214 | 3300005535 | Ga0070684_100131782 | Ga0070684_1001317822 | 233 |
| 215 | 3300005539 | Ga0068853_100063215 | Ga0068853_1000632153 | 233 |
| 216 | 3300005539 | Ga0068853_100095812 | Ga0068853_1000958122 | 233 |
| 217 | 3300005539 | Ga0068853_100315396 | Ga0068853_1003153962 | 233 |
| 218 | 3300005543 | Ga0070672_100021949 | Ga0070672_1000219494 | 233 |
| 219 | 3300005543 | Ga0070672_100100367 | Ga0070672_1001003673 | 233 |
| 220 | 3300005544 | Ga0070686_100334627 | Ga0070686_1003346272 | 233 |
| 221 | 3300005547 | Ga0070693_100052404 | Ga0070693_1000524042 | 233 |
| 222 | 3300005547 | Ga0070693_100101508 | Ga0070693_1001015082 | 233 |
| 223 | 3300005548 | Ga0070665_100501096 | Ga0070665_1005010962 | 233 |
| 224 | 3300005548 | Ga0070665_100625402 | Ga0070665_1006254022 | 233 |
| 225 | 3300005563 | Ga0068855_100024131 | Ga0068855_1000241312 | 233 |
| 226 | 3300005563 | Ga0068855_100189798 | Ga0068855_1001897983 | 233 |
| 227 | 3300005563 | Ga0068855_100255777 | Ga0068855_1002557772 | 233 |
| 228 | 3300005564 | Ga0070664_100057283 | Ga0070664_1000572832 | 233 |
| 229 | 3300005564 | Ga0070664_100263031 | Ga0070664_1002630312 | 233 |
| 230 | 3300005577 | Ga0068857_100087284 | Ga0068857_1000872843 | 233 |
| 231 | 3300005577 | Ga0068857_100268815 | Ga0068857_1002688152 | 233 |
| 232 | 3300005578 | Ga0068854_100206692 | Ga0068854_1002066922 | 233 |
| 233 | 3300005578 | Ga0068854_100206956 | Ga0068854_1002069562 | 233 |
| 234 | 3300005614 | Ga0068856_100021189 | Ga0068856_1000211896 | 233 |
| 235 | 3300005614 | Ga0068856_100083459 | Ga0068856_1000834592 | 233 |
| 236 | 3300005614 | Ga0068856_100392910 | Ga0068856_1003929102 | 233 |
| 237 | 3300005614 | Ga0068856_100583872 | Ga0068856_1005838722 | 233 |
| 238 | 3300005615 | Ga0070702_100184225 | Ga0070702_1001842251 | 233 |
| 239 | 3300005615 | Ga0070702_100577765 | Ga0070702_1005777651 | 233 |
| 240 | 3300005616 | Ga0068852_100032795 | Ga0068852_1000327952 | 233 |
| 241 | 3300005616 | Ga0068852_100324762 | Ga0068852_1003247622 | 233 |
| 242 | 3300005616 | Ga0068852_100331606 | Ga0068852_1003316062 | 233 |
| 243 | 3300005616 | Ga0068852_100364378 | Ga0068852_1003643782 | 233 |
| 244 | 3300005618 | Ga0068864_100009062 | Ga0068864_1000090629 | 233 |
| 245 | 3300005618 | Ga0068864_100011997 | Ga0068864_1000119973 | 233 |
| 246 | 3300005618 | Ga0068864_100017095 | Ga0068864_1000170952 | 233 |
| 247 | 3300005718 | Ga0068866_10073079 | Ga0068866_100730792 | 233 |
| 248 | 3300005719 | Ga0068861_100001656 | Ga0068861_10000165613 | 233 |
| 249 | 3300005719 | Ga0068861_100019378 | Ga0068861_1000193787 | 233 |
| 250 | 3300005719 | Ga0068861_100045356 | Ga0068861_1000453562 | 233 |
| 251 | 3300005834 | Ga0068851_10032935 | Ga0068851_100329352 | 233 |
| 252 | 3300005834 | Ga0068851_10089997 | Ga0068851_100899972 | 233 |
| 253 | 3300005841 | Ga0068863_100463299 | Ga0068863_1004632992 | 233 |
| 254 | 3300005842 | Ga0068858_100002470 | Ga0068858_1000024703 | 233 |
| 255 | 3300005842 | Ga0068858_100008215 | Ga0068858_1000082152 | 233 |
| 256 | 3300005842 | Ga0068858_100259239 | Ga0068858_1002592392 | 233 |
| 257 | 3300005843 | Ga0068860_100001365 | Ga0068860_10000136518 | 233 |
| 258 | 3300005843 | Ga0068860_100103887 | Ga0068860_1001038873 | 233 |
| 259 | 3300005844 | Ga0068862_100538947 | Ga0068862_1005389472 | 233 |
| 260 | 3300005985 | Ga0081539_10017388 | Ga0081539_100173884 | 233 |
| 261 | 3300006038 | Ga0075365_10013289 | Ga0075365_100132893 | 233 |
| 262 | 3300006038 | Ga0075365_10016664 | Ga0075365_100166642 | 233 |
| 263 | 3300006038 | Ga0075365_10087742 | Ga0075365_100877422 | 233 |
| 264 | 3300006038 | Ga0075365_10096082 | Ga0075365_100960822 | 233 |
| 265 | 3300006042 | Ga0075368_10040676 | Ga0075368_100406762 | 233 |
| 266 | 3300006048 | Ga0075363_100080638 | Ga0075363_1000806382 | 233 |
| 267 | 3300006048 | Ga0075363_100086368 | Ga0075363_1000863682 | 233 |
| 268 | 3300006051 | Ga0075364_10022311 | Ga0075364_100223113 | 233 |
| 269 | 3300006051 | Ga0075364_10049231 | Ga0075364_100492312 | 233 |
| 270 | 3300006058 | Ga0075432_10006527 | Ga0075432_100065273 | 233 |
| 271 | 3300006058 | Ga0075432_10016456 | Ga0075432_100164562 | 233 |
| 272 | 3300006173 | Ga0070716_100168069 | Ga0070716_1001680692 | 233 |
| 273 | 3300006177 | Ga0075362_10032249 | Ga0075362_100322493 | 233 |
| 274 | 3300006177 | Ga0075362_10080073 | Ga0075362_100800732 | 233 |
| 275 | 3300006177 | Ga0075362_10081004 | Ga0075362_100810042 | 233 |
| 276 | 3300006177 | Ga0075362_10160324 | Ga0075362_101603242 | 233 |
| 277 | 3300006178 | Ga0075367_10015436 | Ga0075367_100154363 | 233 |
| 278 | 3300006178 | Ga0075367_10018865 | Ga0075367_100188653 | 233 |
| 279 | 3300006178 | Ga0075367_10043243 | Ga0075367_100432432 | 233 |
| 280 | 3300006178 | Ga0075367_10094747 | Ga0075367_100947472 | 233 |
| 281 | 3300006186 | Ga0075369_10014645 | Ga0075369_100146453 | 233 |
| 282 | 3300006195 | Ga0075366_10007983 | Ga0075366_100079832 | 233 |
| 283 | 3300006195 | Ga0075366_10015005 | Ga0075366_100150052 | 233 |
| 284 | 3300006195 | Ga0075366_10041892 | Ga0075366_100418922 | 233 |
| 285 | 3300006195 | Ga0075366_10043723 | Ga0075366_100437233 | 233 |
| 286 | 3300006195 | Ga0075366_10091374 | Ga0075366_100913742 | 233 |
| 287 | 3300006237 | Ga0097621_100020754 | Ga0097621_1000207545 | 233 |
| 288 | 3300006237 | Ga0097621_100078702 | Ga0097621_1000787023 | 233 |
| 289 | 3300006237 | Ga0097621_100842200 | Ga0097621_1008422001 | 233 |
| 290 | 3300006353 | Ga0075370_10000151 | Ga0075370_100001517 | 233 |
| 291 | 3300006353 | Ga0075370_10002757 | Ga0075370_100027579 | 233 |
| 292 | 3300006353 | Ga0075370_10003232 | Ga0075370_100032324 | 233 |
| 293 | 3300006353 | Ga0075370_10003626 | Ga0075370_100036268 | 233 |
| 294 | 3300006353 | Ga0075370_10346862 | Ga0075370_103468622 | 233 |
| 295 | 3300006358 | Ga0068871_100054136 | Ga0068871_1000541363 | 233 |
| 296 | 3300006844 | Ga0075428_100406219 | Ga0075428_1004062192 | 233 |
| 297 | 3300006846 | Ga0075430_100221789 | Ga0075430_1002217892 | 233 |
| 298 | 3300006847 | Ga0075431_100155082 | Ga0075431_1001550822 | 233 |
| 299 | 3300006880 | Ga0075429_100008410 | Ga0075429_1000084104 | 233 |
| 300 | 3300009093 | Ga0105240_10009978 | Ga0105240_1000997815 | 233 |
| 301 | 3300009093 | Ga0105240_10016101 | Ga0105240_100161017 | 233 |
| 302 | 3300009093 | Ga0105240_10429932 | Ga0105240_104299322 | 233 |
| 303 | 3300009093 | Ga0105240_10682907 | Ga0105240_106829072 | 233 |
| 304 | 3300009094 | Ga0111539_10405288 | Ga0111539_104052882 | 233 |
| 305 | 3300009098 | Ga0105245_10114171 | Ga0105245_101141713 | 233 |
| 306 | 3300009098 | Ga0105245_10189923 | Ga0105245_101899232 | 233 |
| 307 | 3300009098 | Ga0105245_11182731 | Ga0105245_111827312 | 233 |
| 308 | 3300009101 | Ga0105247_10532069 | Ga0105247_105320691 | 233 |
| 309 | 3300009147 | Ga0114129_10058968 | Ga0114129_100589685 | 233 |
| 310 | 3300009148 | Ga0105243_10119990 | Ga0105243_101199901 | 233 |
| 311 | 3300009148 | Ga0105243_10140765 | Ga0105243_101407651 | 233 |
| 312 | 3300009177 | Ga0105248_10034909 | Ga0105248_100349096 | 233 |
| 313 | 3300009177 | Ga0105248_10071563 | Ga0105248_100715631 | 233 |
| 314 | 3300009177 | Ga0105248_10098068 | Ga0105248_100980683 | 233 |
| 315 | 3300009545 | Ga0105237_10008751 | Ga0105237_100087511 | 233 |
| 316 | 3300009545 | Ga0105237_10015804 | Ga0105237_100158043 | 233 |
| 317 | 3300009545 | Ga0105237_10723080 | Ga0105237_107230802 | 233 |
| 318 | 3300009551 | Ga0105238_10016417 | Ga0105238_100164173 | 233 |
| 319 | 3300009551 | Ga0105238_10086366 | Ga0105238_100863663 | 233 |
| 320 | 3300009551 | Ga0105238_10153244 | Ga0105238_101532443 | 233 |
| 321 | 3300010375 | Ga0105239_10001543 | Ga0105239_100015435 | 233 |
| 322 | 3300010375 | Ga0105239_10531343 | Ga0105239_105313432 | 233 |
| 323 | 3300010375 | Ga0105239_10640138 | Ga0105239_106401382 | 233 |
| 324 | 3300010375 | Ga0105239_11085710 | Ga0105239_110857102 | 233 |
| 325 | 3300013100 | Ga0157373_10054846 | Ga0157373_100548462 | 233 |
| 326 | 3300013104 | Ga0157370_10187911 | Ga0157370_101879111 | 233 |
| 327 | 3300013105 | Ga0157369_10092084 | Ga0157369_100920843 | 233 |
| 328 | 3300013105 | Ga0157369_10177351 | Ga0157369_101773512 | 233 |
| 329 | 3300013297 | Ga0157378_10340944 | Ga0157378_103409442 | 233 |
| 330 | 3300013297 | Ga0157378_10653201 | Ga0157378_106532011 | 233 |
| 331 | 3300013306 | Ga0163162_10036736 | Ga0163162_100367362 | 233 |
| 332 | 3300013306 | Ga0163162_10437512 | Ga0163162_104375122 | 233 |
| 333 | 3300013307 | Ga0157372_10206397 | Ga0157372_102063973 | 233 |
| 334 | 3300013307 | Ga0157372_10365023 | Ga0157372_103650232 | 233 |
| 335 | 3300013308 | Ga0157375_10157383 | Ga0157375_101573833 | 233 |
| 336 | 3300013308 | Ga0157375_10402262 | Ga0157375_104022622 | 233 |
| 337 | 3300013308 | Ga0157375_10578590 | Ga0157375_105785902 | 233 |
| 338 | 3300014325 | Ga0163163_10286818 | Ga0163163_102868182 | 233 |
| 339 | 3300014325 | Ga0163163_10327258 | Ga0163163_103272582 | 233 |
| 340 | 3300014326 | Ga0157380_10075509 | Ga0157380_100755092 | 233 |
| 341 | 3300014497 | Ga0182008_10185237 | Ga0182008_101852371 | 233 |
| 342 | 3300014745 | Ga0157377_10001260 | Ga0157377_1000126010 | 233 |
| 343 | 3300014968 | Ga0157379_10012658 | Ga0157379_100126587 | 233 |
| 344 | 3300014968 | Ga0157379_10196358 | Ga0157379_101963582 | 233 |
| 345 | 3300014969 | Ga0157376_10006493 | Ga0157376_100064936 | 233 |
| 346 | 3300014969 | Ga0157376_10035440 | Ga0157376_100354402 | 233 |
| 347 | 3300014969 | Ga0157376_11129019 | Ga0157376_111290191 | 233 |
| 348 | 3300015262 | Ga0182007_10061376 | Ga0182007_100613762 | 233 |
| 349 | 3300015262 | Ga0182007_10118646 | Ga0182007_101186461 | 233 |
| 350 | 3300021384 | Ga0213876_10043510 | Ga0213876_100435102 | 233 |
| 351 | 3300021388 | Ga0213875_10001372 | Ga0213875_100013725 | 233 |
| 352 | 3300025206 | Ga0209435_100002 | Ga0209435_100002437 | 233 |
| 353 | 3300025230 | Ga0209563_107053 | Ga0209563_1070532 | 233 |
| 354 | 3300025231 | Ga0207427_100989 | Ga0207427_1009893 | 233 |
| 355 | 3300025242 | Ga0209258_100025 | Ga0209258_100025300 | 233 |
| 356 | 3300025245 | Ga0207425_1003954 | Ga0207425_10039544 | 233 |
| 357 | 3300025245 | Ga0207425_1017783 | Ga0207425_10177831 | 233 |
| 358 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000012580 | 233 |
| 359 | 3300025250 | Ga0209026_1000040 | Ga0209026_1000040195 | 233 |
| 360 | 3300025253 | Ga0209677_100832 | Ga0209677_1008324 | 233 |
| 361 | 3300025254 | Ga0209148_1002620 | Ga0209148_10026203 | 233 |
| 362 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000012211 | 233 |
| 363 | 3300025256 | Ga0209759_1004903 | Ga0209759_10049034 | 233 |
| 364 | 3300025256 | Ga0209759_1007462 | Ga0209759_10074622 | 233 |
| 365 | 3300025258 | Ga0209129_1011540 | Ga0209129_10115402 | 233 |
| 366 | 3300025263 | Ga0209565_1000026 | Ga0209565_1000026224 | 233 |
| 367 | 3300025263 | Ga0209565_1001255 | Ga0209565_10012556 | 233 |
| 368 | 3300025263 | Ga0209565_1005280 | Ga0209565_10052802 | 233 |
| 369 | 3300025263 | Ga0209565_1014193 | Ga0209565_10141932 | 233 |
| 370 | 3300025271 | Ga0207666_1001927 | Ga0207666_10019273 | 233 |
| 371 | 3300025272 | Ga0209455_1000089 | Ga0209455_1000089203 | 233 |
| 372 | 3300025273 | Ga0209673_1000009 | Ga0209673_1000009231 | 233 |
| 373 | 3300025273 | Ga0209673_1000012 | Ga0209673_1000012132 | 233 |
| 374 | 3300025273 | Ga0209673_1051404 | Ga0209673_10514042 | 233 |
| 375 | 3300025284 | Ga0209130_1000183 | Ga0209130_100018313 | 233 |
| 376 | 3300025284 | Ga0209130_1000644 | Ga0209130_100064410 | 233 |
| 377 | 3300025291 | Ga0209675_1000308 | Ga0209675_100030824 | 233 |
| 378 | 3300025291 | Ga0209675_1006996 | Ga0209675_10069963 | 233 |
| 379 | 3300025291 | Ga0209675_1012555 | Ga0209675_10125552 | 233 |
| 380 | 3300025291 | Ga0209675_1017411 | Ga0209675_10174112 | 233 |
| 381 | 3300025292 | Ga0209676_1000013 | Ga0209676_100001310 | 233 |
| 382 | 3300025292 | Ga0209676_1003161 | Ga0209676_10031618 | 233 |
| 383 | 3300025294 | Ga0209025_1005365 | Ga0209025_10053656 | 233 |
| 384 | 3300025294 | Ga0209025_1006206 | Ga0209025_10062067 | 233 |
| 385 | 3300025294 | Ga0209025_1031654 | Ga0209025_10316542 | 233 |
| 386 | 3300025295 | Ga0209564_1001304 | Ga0209564_100130415 | 233 |
| 387 | 3300025295 | Ga0209564_1004427 | Ga0209564_10044273 | 233 |
| 388 | 3300025295 | Ga0209564_1004860 | Ga0209564_10048601 | 233 |
| 389 | 3300025297 | Ga0209758_1000304 | Ga0209758_100030418 | 233 |
| 390 | 3300025297 | Ga0209758_1007970 | Ga0209758_10079706 | 233 |
| 391 | 3300025298 | Ga0209050_1000008 | Ga0209050_100000810 | 233 |
| 392 | 3300025298 | Ga0209050_1000266 | Ga0209050_100026636 | 233 |
| 393 | 3300025298 | Ga0209050_1001933 | Ga0209050_100193314 | 233 |
| 394 | 3300025298 | Ga0209050_1006110 | Ga0209050_10061105 | 233 |
| 395 | 3300025298 | Ga0209050_1025810 | Ga0209050_10258102 | 233 |
| 396 | 3300025299 | Ga0209256_1000003 | Ga0209256_1000003386 | 233 |
| 397 | 3300025299 | Ga0209256_1000049 | Ga0209256_1000049207 | 233 |
| 398 | 3300025299 | Ga0209256_1001148 | Ga0209256_100114812 | 233 |
| 399 | 3300025302 | Ga0207426_1000062 | Ga0207426_1000062121 | 233 |
| 400 | 3300025302 | Ga0207426_1003042 | Ga0207426_10030423 | 233 |
| 401 | 3300025303 | Ga0209051_1000005 | Ga0209051_100000510 | 233 |
| 402 | 3300025303 | Ga0209051_1000025 | Ga0209051_1000025326 | 233 |
| 403 | 3300025303 | Ga0209051_1009298 | Ga0209051_10092984 | 233 |
| 404 | 3300025303 | Ga0209051_1042094 | Ga0209051_10420942 | 233 |
| 405 | 3300025304 | Ga0209257_1000039 | Ga0209257_1000039282 | 233 |
| 406 | 3300025304 | Ga0209257_1000048 | Ga0209257_100004810 | 233 |
| 407 | 3300025304 | Ga0209257_1012197 | Ga0209257_10121974 | 233 |
| 408 | 3300025315 | Ga0207697_10098276 | Ga0207697_100982762 | 233 |
| 409 | 3300025321 | Ga0207656_10017653 | Ga0207656_100176533 | 233 |
| 410 | 3300025321 | Ga0207656_10322762 | Ga0207656_103227621 | 233 |
| 411 | 3300025893 | Ga0207682_10024170 | Ga0207682_100241703 | 233 |
| 412 | 3300025901 | Ga0207688_10086801 | Ga0207688_100868012 | 233 |
| 413 | 3300025901 | Ga0207688_10120969 | Ga0207688_101209692 | 233 |
| 414 | 3300025903 | Ga0207680_10097179 | Ga0207680_100971792 | 233 |
| 415 | 3300025903 | Ga0207680_10100226 | Ga0207680_101002262 | 233 |
| 416 | 3300025903 | Ga0207680_10131443 | Ga0207680_101314432 | 233 |
| 417 | 3300025906 | Ga0207699_10000129 | Ga0207699_1000012917 | 233 |
| 418 | 3300025907 | Ga0207645_10008065 | Ga0207645_100080652 | 233 |
| 419 | 3300025907 | Ga0207645_10022328 | Ga0207645_100223283 | 233 |
| 420 | 3300025907 | Ga0207645_10023553 | Ga0207645_100235532 | 233 |
| 421 | 3300025907 | Ga0207645_10111785 | Ga0207645_101117852 | 233 |
| 422 | 3300025909 | Ga0207705_10145984 | Ga0207705_101459842 | 233 |
| 423 | 3300025910 | Ga0207684_10005313 | Ga0207684_100053137 | 233 |
| 424 | 3300025911 | Ga0207654_10030295 | Ga0207654_100302953 | 233 |
| 425 | 3300025911 | Ga0207654_10128404 | Ga0207654_101284042 | 233 |
| 426 | 3300025912 | Ga0207707_10178613 | Ga0207707_101786133 | 233 |
| 427 | 3300025912 | Ga0207707_10683737 | Ga0207707_106837371 | 233 |
| 428 | 3300025913 | Ga0207695_10014227 | Ga0207695_1001422710 | 233 |
| 429 | 3300025913 | Ga0207695_10065783 | Ga0207695_100657833 | 233 |
| 430 | 3300025913 | Ga0207695_10197632 | Ga0207695_101976322 | 233 |
| 431 | 3300025914 | Ga0207671_10010930 | Ga0207671_100109306 | 233 |
| 432 | 3300025914 | Ga0207671_10022450 | Ga0207671_100224503 | 233 |
| 433 | 3300025914 | Ga0207671_10088141 | Ga0207671_100881412 | 233 |
| 434 | 3300025918 | Ga0207662_10021765 | Ga0207662_100217652 | 233 |
| 435 | 3300025919 | Ga0207657_10010934 | Ga0207657_100109347 | 233 |
| 436 | 3300025919 | Ga0207657_10074502 | Ga0207657_100745022 | 233 |
| 437 | 3300025919 | Ga0207657_10112162 | Ga0207657_101121622 | 233 |
| 438 | 3300025919 | Ga0207657_10188518 | Ga0207657_101885182 | 233 |
| 439 | 3300025921 | Ga0207652_10022385 | Ga0207652_100223852 | 233 |
| 440 | 3300025921 | Ga0207652_10049913 | Ga0207652_100499132 | 233 |
| 441 | 3300025923 | Ga0207681_10023814 | Ga0207681_100238142 | 233 |
| 442 | 3300025923 | Ga0207681_10191883 | Ga0207681_101918832 | 233 |
| 443 | 3300025923 | Ga0207681_10564861 | Ga0207681_105648612 | 233 |
| 444 | 3300025924 | Ga0207694_10061758 | Ga0207694_100617582 | 233 |
| 445 | 3300025924 | Ga0207694_10135696 | Ga0207694_101356962 | 233 |
| 446 | 3300025924 | Ga0207694_10183779 | Ga0207694_101837792 | 233 |
| 447 | 3300025924 | Ga0207694_10428311 | Ga0207694_104283112 | 233 |
| 448 | 3300025924 | Ga0207694_10732629 | Ga0207694_107326292 | 233 |
| 449 | 3300025925 | Ga0207650_10023362 | Ga0207650_100233622 | 233 |
| 450 | 3300025925 | Ga0207650_10060524 | Ga0207650_100605242 | 233 |
| 451 | 3300025925 | Ga0207650_10101250 | Ga0207650_101012502 | 233 |
| 452 | 3300025926 | Ga0207659_10022700 | Ga0207659_100227002 | 233 |
| 453 | 3300025927 | Ga0207687_10024102 | Ga0207687_100241024 | 233 |
| 454 | 3300025927 | Ga0207687_10033528 | Ga0207687_100335282 | 233 |
| 455 | 3300025927 | Ga0207687_10358276 | Ga0207687_103582762 | 233 |
| 456 | 3300025927 | Ga0207687_10460726 | Ga0207687_104607262 | 233 |
| 457 | 3300025931 | Ga0207644_10423898 | Ga0207644_104238982 | 233 |
| 458 | 3300025932 | Ga0207690_10126632 | Ga0207690_101266322 | 233 |
| 459 | 3300025932 | Ga0207690_10288059 | Ga0207690_102880592 | 233 |
| 460 | 3300025932 | Ga0207690_10439131 | Ga0207690_104391311 | 233 |
| 461 | 3300025933 | Ga0207706_10001995 | Ga0207706_100019957 | 233 |
| 462 | 3300025933 | Ga0207706_10119541 | Ga0207706_101195412 | 233 |
| 463 | 3300025933 | Ga0207706_10170119 | Ga0207706_101701192 | 233 |
| 464 | 3300025933 | Ga0207706_10509612 | Ga0207706_105096121 | 233 |
| 465 | 3300025935 | Ga0207709_10050782 | Ga0207709_100507823 | 233 |
| 466 | 3300025935 | Ga0207709_10133921 | Ga0207709_101339212 | 233 |
| 467 | 3300025936 | Ga0207670_10145065 | Ga0207670_101450652 | 233 |
| 468 | 3300025937 | Ga0207669_10137672 | Ga0207669_101376722 | 233 |
| 469 | 3300025937 | Ga0207669_10684543 | Ga0207669_106845432 | 233 |
| 470 | 3300025938 | Ga0207704_10111724 | Ga0207704_101117242 | 233 |
| 471 | 3300025940 | Ga0207691_10004985 | Ga0207691_100049852 | 233 |
| 472 | 3300025940 | Ga0207691_10027031 | Ga0207691_100270314 | 233 |
| 473 | 3300025941 | Ga0207711_10009070 | Ga0207711_100090708 | 233 |
| 474 | 3300025941 | Ga0207711_10046878 | Ga0207711_100468783 | 233 |
| 475 | 3300025941 | Ga0207711_10060141 | Ga0207711_100601412 | 233 |
| 476 | 3300025941 | Ga0207711_10463249 | Ga0207711_104632492 | 233 |
| 477 | 3300025942 | Ga0207689_10000996 | Ga0207689_100009967 | 233 |
| 478 | 3300025942 | Ga0207689_10011569 | Ga0207689_100115694 | 233 |
| 479 | 3300025942 | Ga0207689_10198912 | Ga0207689_101989122 | 233 |
| 480 | 3300025944 | Ga0207661_10043857 | Ga0207661_100438573 | 233 |
| 481 | 3300025945 | Ga0207679_10015982 | Ga0207679_100159822 | 233 |
| 482 | 3300025945 | Ga0207679_10122608 | Ga0207679_101226082 | 233 |
| 483 | 3300025949 | Ga0207667_10021835 | Ga0207667_100218353 | 233 |
| 484 | 3300025949 | Ga0207667_10453804 | Ga0207667_104538042 | 233 |
| 485 | 3300025960 | Ga0207651_10030894 | Ga0207651_100308945 | 233 |
| 486 | 3300025960 | Ga0207651_10134764 | Ga0207651_101347642 | 233 |
| 487 | 3300025961 | Ga0207712_10233178 | Ga0207712_102331782 | 233 |
| 488 | 3300025972 | Ga0207668_10090770 | Ga0207668_100907703 | 233 |
| 489 | 3300025981 | Ga0207640_10221288 | Ga0207640_102212882 | 233 |
| 490 | 3300025981 | Ga0207640_10345284 | Ga0207640_103452841 | 233 |
| 491 | 3300025986 | Ga0207658_10012023 | Ga0207658_100120232 | 233 |
| 492 | 3300025986 | Ga0207658_10073606 | Ga0207658_100736062 | 233 |
| 493 | 3300026023 | Ga0207677_10000853 | Ga0207677_100008539 | 233 |
| 494 | 3300026023 | Ga0207677_10057976 | Ga0207677_100579763 | 233 |
| 495 | 3300026035 | Ga0207703_10003620 | Ga0207703_100036202 | 233 |
| 496 | 3300026035 | Ga0207703_10009640 | Ga0207703_100096408 | 233 |
| 497 | 3300026035 | Ga0207703_10044880 | Ga0207703_100448804 | 233 |
| 498 | 3300026041 | Ga0207639_10272831 | Ga0207639_102728312 | 233 |
| 499 | 3300026041 | Ga0207639_10273608 | Ga0207639_102736082 | 233 |
| 500 | 3300026067 | Ga0207678_10062737 | Ga0207678_100627373 | 233 |
| 501 | 3300026067 | Ga0207678_10103777 | Ga0207678_101037772 | 233 |
| 502 | 3300026075 | Ga0207708_10019046 | Ga0207708_100190464 | 233 |
| 503 | 3300026078 | Ga0207702_10014759 | Ga0207702_100147592 | 233 |
| 504 | 3300026078 | Ga0207702_10087741 | Ga0207702_100877413 | 233 |
| 505 | 3300026088 | Ga0207641_10139494 | Ga0207641_101394942 | 233 |
| 506 | 3300026089 | Ga0207648_10129602 | Ga0207648_101296022 | 233 |
| 507 | 3300026089 | Ga0207648_10408558 | Ga0207648_104085582 | 233 |
| 508 | 3300026089 | Ga0207648_10691485 | Ga0207648_106914851 | 233 |
| 509 | 3300026089 | Ga0207648_10949846 | Ga0207648_109498461 | 233 |
| 510 | 3300026095 | Ga0207676_10003408 | Ga0207676_100034085 | 233 |
| 511 | 3300026095 | Ga0207676_10028197 | Ga0207676_100281972 | 233 |
| 512 | 3300026095 | Ga0207676_10029223 | Ga0207676_100292232 | 233 |
| 513 | 3300026116 | Ga0207674_10022527 | Ga0207674_100225275 | 233 |
| 514 | 3300026116 | Ga0207674_10257168 | Ga0207674_102571682 | 233 |
| 515 | 3300026116 | Ga0207674_10643093 | Ga0207674_106430931 | 233 |
| 516 | 3300026118 | Ga0207675_100002360 | Ga0207675_1000023602 | 233 |
| 517 | 3300026118 | Ga0207675_100090758 | Ga0207675_1000907582 | 233 |
| 518 | 3300026118 | Ga0207675_100262784 | Ga0207675_1002627842 | 233 |
| 519 | 3300026121 | Ga0207683_10009600 | Ga0207683_1000960010 | 233 |
| 520 | 3300026142 | Ga0207698_10020822 | Ga0207698_100208223 | 233 |
| 521 | 3300026142 | Ga0207698_10027402 | Ga0207698_100274025 | 233 |
| 522 | 3300026142 | Ga0207698_10065102 | Ga0207698_100651021 | 233 |
| 523 | 3300026142 | Ga0207698_11071726 | Ga0207698_110717262 | 233 |
| 524 | 3300026142 | Ga0207698_11078538 | Ga0207698_110785382 | 233 |
| 525 | 3300027552 | Ga0209982_1021798 | Ga0209982_10217982 | 233 |
| 526 | 3300027717 | Ga0209998_10015322 | Ga0209998_100153222 | 233 |
| 527 | 3300027866 | Ga0209813_10063458 | Ga0209813_100634582 | 233 |
| 528 | 3300028379 | Ga0268266_10117960 | Ga0268266_101179603 | 233 |
| 529 | 3300028380 | Ga0268265_10792347 | Ga0268265_107923472 | 233 |
| 530 | 3300028380 | Ga0268265_10891596 | Ga0268265_108915961 | 233 |
| 531 | 3300028381 | Ga0268264_10011726 | Ga0268264_100117268 | 233 |
| 532 | 3300028381 | Ga0268264_10068442 | Ga0268264_100684421 | 233 |
| 533 | 3300028666 | Ga0265336_10000029 | Ga0265336_10000029181 | 233 |
| 534 | 3300028794 | Ga0307515_10000123 | Ga0307515_10000123123 | 233 |
| 535 | 3300028794 | Ga0307515_10001456 | Ga0307515_100014566 | 233 |
| 536 | 3300028794 | Ga0307515_10002728 | Ga0307515_100027289 | 233 |
| 537 | 3300028794 | Ga0307515_10009581 | Ga0307515_100095819 | 233 |
| 538 | 3300028794 | Ga0307515_10175757 | Ga0307515_101757572 | 233 |
| 539 | 3300028794 | Ga0307515_10424713 | Ga0307515_104247132 | 233 |
| 540 | 3300029957 | Ga0265324_10000326 | Ga0265324_100003268 | 233 |
| 541 | 3300030521 | Ga0307511_10000092 | Ga0307511_1000009269 | 233 |
| 542 | 3300030521 | Ga0307511_10059059 | Ga0307511_100590593 | 233 |
| 543 | 3300030522 | Ga0307512_10090121 | Ga0307512_100901212 | 233 |
| 544 | 3300030522 | Ga0307512_10114850 | Ga0307512_101148502 | 233 |
| 545 | 3300031235 | Ga0265330_10037955 | Ga0265330_100379552 | 233 |
| 546 | 3300031241 | Ga0265325_10004429 | Ga0265325_100044292 | 233 |
| 547 | 3300031242 | Ga0265329_10060855 | Ga0265329_100608552 | 233 |
| 548 | 3300031251 | Ga0265327_10000049 | Ga0265327_1000004912 | 233 |
| 549 | 3300031344 | Ga0265316_10038848 | Ga0265316_100388484 | 233 |
| 550 | 3300031344 | Ga0265316_10054144 | Ga0265316_100541442 | 233 |
| 551 | 3300031456 | Ga0307513_10000057 | Ga0307513_1000005789 | 233 |
| 552 | 3300031456 | Ga0307513_10041778 | Ga0307513_100417786 | 233 |
| 553 | 3300031456 | Ga0307513_10240657 | Ga0307513_102406572 | 233 |
| 554 | 3300031507 | Ga0307509_10069245 | Ga0307509_100692454 | 233 |
| 555 | 3300031548 | Ga0307408_100062798 | Ga0307408_1000627982 | 233 |
| 556 | 3300031548 | Ga0307408_100148179 | Ga0307408_1001481792 | 233 |
| 557 | 3300031595 | Ga0265313_10142367 | Ga0265313_101423672 | 233 |
| 558 | 3300031616 | Ga0307508_10008033 | Ga0307508_100080334 | 233 |
| 559 | 3300031616 | Ga0307508_10298811 | Ga0307508_102988112 | 233 |
| 560 | 3300031616 | Ga0307508_10363596 | Ga0307508_103635961 | 233 |
| 561 | 3300031649 | Ga0307514_10008631 | Ga0307514_100086313 | 233 |
| 562 | 3300031711 | Ga0265314_10002601 | Ga0265314_100026013 | 233 |
| 563 | 3300031711 | Ga0265314_10023252 | Ga0265314_100232522 | 233 |
| 564 | 3300031711 | Ga0265314_10313544 | Ga0265314_103135442 | 233 |
| 565 | 3300031730 | Ga0307516_10000017 | Ga0307516_10000017139 | 233 |
| 566 | 3300031730 | Ga0307516_10016806 | Ga0307516_100168065 | 233 |
| 567 | 3300031730 | Ga0307516_10176861 | Ga0307516_101768612 | 233 |
| 568 | 3300031730 | Ga0307516_10400243 | Ga0307516_104002432 | 233 |
| 569 | 3300031901 | Ga0307406_10537104 | Ga0307406_105371041 | 233 |
| 570 | 3300031911 | Ga0307412_10264747 | Ga0307412_102647472 | 233 |
| 571 | 3300031911 | Ga0307412_10369013 | Ga0307412_103690132 | 233 |
| 572 | 3300033179 | Ga0307507_10040381 | Ga0307507_100403814 | 233 |
| 573 | 3300034820 | Ga0373959_0053251 | Ga0373959_0053251_130_834 | 233 |
| 574 | 3300035083 | Ga0373926_0030127 | Ga0373926_0030127_518_1231 | 233 |
| 575 | 3300035089 | Ga0373944_0007686 | Ga0373944_0007686_1529_2242 | 233 |
| 576 | 3300035092 | Ga0373952_0020702 | Ga0373952_0020702_417_1121 | 233 |
| 577 | 3300035111 | Ga0373923_0016948 | Ga0373923_0016948_1459_2163 | 233 |
| 578 | 3300035113 | Ga0373936_0042331 | Ga0373936_0042331_1095_1808 | 233 |
| 579 | 3300035113 | Ga0373936_0189988 | Ga0373936_0189988_28_732 | 233 |
| 580 | 3300035116 | Ga0373945_0000417 | Ga0373945_0000417_9462_10175 | 233 |
| 581 | 3300035116 | Ga0373945_0062883 | Ga0373945_0062883_286_990 | 233 |
| 582 | 3300035118 | Ga0373954_0089060 | Ga0373954_0089060_229_933 | 233 |
| 583 | 3300035170 | Ga0373943_0000245 | Ga0373943_0000245_4241_4954 | 233 |
| 584 | 3300035691 | Ga0373931_0011040 | Ga0373931_0011040_2916_3620 | 233 |
| 585 | 3300035692 | Ga0373935_0001774 | Ga0373935_0001774_3794_4507 | 233 |
| 586 | 3300035695 | Ga0373927_0000215 | Ga0373927_0000215_19946_20659 | 233 |
| 587 | 3300035725 | Ga0373947_0000242 | Ga0373947_0000242_26169_26882 | 233 |
| 588 | 3300036401 | Ga0373937_0196091 | Ga0373937_0196091_636_1340 | 233 |
| 589 | 3300037068 | Ga0373925_0000700 | Ga0373925_0000700_14479_15192 | 233 |
| 590 | 3300037068 | Ga0373925_0177241 | Ga0373925_0177241_664_1368 | 233 |
| 591 | 3300037312 | Ga0395899_0002984 | Ga0395899_0002984_140_844 | 233 |
| 592 | 3300037312 | Ga0395899_0004579 | Ga0395899_0004579_8450_9157 | 233 |
| 593 | 3300037418 | Ga0395900_0006516 | Ga0395900_0006516_6260_6964 | 233 |
| 594 | 3300037418 | Ga0395900_0010859 | Ga0395900_0010859_5410_6117 | 233 |
| 595 | 3300037418 | Ga0395900_0020030 | Ga0395900_0020030_3780_4487 | 233 |
| 596 | 3300037418 | Ga0395900_0044597 | Ga0395900_0044597_3581_4288 | 233 |
| 597 | 3300037466 | Ga0395898_0002933 | Ga0395898_0002933_2779_3486 | 233 |
| 598 | 3300037466 | Ga0395898_0010476 | Ga0395898_0010476_2728_3432 | 233 |
| 599 | 3300037466 | Ga0395898_0012459 | Ga0395898_0012459_2818_3525 | 233 |
| 600 | 3300037471 | Ga0395905_0002575 | Ga0395905_0002575_17069_17779 | 233 |
| 601 | 3300037471 | Ga0395905_0004104 | Ga0395905_0004104_1182_1886 | 233 |
| 602 | 3300037471 | Ga0395905_0005907 | Ga0395905_0005907_8984_9787 | 233 |
| 603 | 3300037471 | Ga0395905_0006007 | Ga0395905_0006007_7357_8064 | 233 |
| 604 | 3300037471 | Ga0395905_0007574 | Ga0395905_0007574_2484_3191 | 233 |
| 605 | 3300037471 | Ga0395905_0009071 | Ga0395905_0009071_2006_2713 | 233 |
| 606 | 3300037471 | Ga0395905_0023096 | Ga0395905_0023096_1570_2274 | 233 |
| 607 | 3300037471 | Ga0395905_0104621 | Ga0395905_0104621_1158_1865 | 233 |
| 608 | 3300037471 | Ga0395905_0105356 | Ga0395905_0105356_1629_2333 | 233 |
| 609 | 3300037471 | Ga0395905_0112958 | Ga0395905_0112958_914_1621 | 233 |
| 610 | 3300037471 | Ga0395905_0113088 | Ga0395905_0113088_941_1648 | 233 |
| 611 | 3300037471 | Ga0395905_0139673 | Ga0395905_0139673_147_854 | 233 |
| 612 | 3300037471 | Ga0395905_0190377 | Ga0395905_0190377_680_1387 | 233 |
| 613 | 3300037853 | Ga0436364_0252687 | Ga0436364_0252687_77_781 | 233 |
| 614 | 3300038443 | Ga0395901_0003137 | Ga0395901_0003137_5864_6568 | 233 |
| 615 | 3300038443 | Ga0395901_0038125 | Ga0395901_0038125_3821_4528 | 233 |
| 616 | 3300038443 | Ga0395901_0144544 | Ga0395901_0144544_264_971 | 233 |
| 617 | 3300038443 | Ga0395901_0250782 | Ga0395901_0250782_952_1659 | 233 |
| 618 | 3300038443 | Ga0395901_0424467 | Ga0395901_0424467_312_1016 | 233 |
| 619 | 3300038443 | Ga0395901_0679900 | Ga0395901_0679900_86_793 | 233 |
| 620 | 3300038705 | Ga0237819_05419 | Ga0237819_05419_785_1519 | 233 |
| 621 | 3300039437 | Ga0436365_1382513 | Ga0436365_1382513_1744_2448 | 233 |
| 622 | 3300039447 | Ga0436361_0010685 | Ga0436361_0010685_325_1047 | 233 |
| 623 | 3300039450 | Ga0436363_0491254 | Ga0436363_0491254_183_887 | 233 |
| 624 | 3300039450 | Ga0436363_1157161 | Ga0436363_1157161_4265_4969 | 233 |
| 625 | 3300041408 | Ga0439453_0029934 | Ga0439453_0029934_293_1003 | 233 |
| 626 | 3300041413 | Ga0439465_0126018 | Ga0439465_0126018_74_778 | 233 |
| 627 | 3300041443 | Ga0451789_0890581 | Ga0451789_0890581_337_1041 | 233 |
| 628 | 3300041458 | Ga0451798_0006129 | Ga0451798_0006129_123_827 | 233 |
| 629 | 3300041459 | Ga0451800_1231896 | Ga0451800_1231896_1224_1928 | 233 |
| 630 | 3300041997 | Ga0439431_0006681 | Ga0439431_0006681_239_946 | 233 |
| 631 | 3300041999 | Ga0439433_0009143 | Ga0439433_0009143_499_1203 | 233 |
| 632 | 3300042007 | Ga0439449_0012132 | Ga0439449_0012132_2058_2765 | 233 |
| 633 | 3300042008 | Ga0439450_016327 | Ga0439450_016327_348_1055 | 233 |
| 634 | 3300042009 | Ga0439451_013034 | Ga0439451_013034_74_796 | 233 |
| 635 | 3300042013 | Ga0439456_020582 | Ga0439456_020582_499_1221 | 233 |
| 636 | 3300042014 | Ga0439457_057648 | Ga0439457_057648_128_838 | 233 |
| 637 | 3300042015 | Ga0439462_0009145 | Ga0439462_0009145_1113_1820 | 233 |
| 638 | 3300042134 | Ga0450898_009171 | Ga0450898_009171_615_1325 | 233 |
| 639 | 3300042138 | Ga0450903_002112 | Ga0450903_002112_455_1165 | 233 |
| 640 | 3300042142 | Ga0450905_010419 | Ga0450905_010419_447_1157 | 233 |
| 641 | 3300042156 | Ga0439446_0012973 | Ga0439446_0012973_1496_2203 | 233 |
| 642 | 3300042156 | Ga0439446_0019921 | Ga0439446_0019921_1157_1876 | 233 |
| 643 | 3300042435 | Ga0439434_0047294 | Ga0439434_0047294_173_880 | 233 |
| 644 | 3300042876 | Ga0451577_0001028 | Ga0451577_0001028_34251_34955 | 233 |
| 645 | 3300042876 | Ga0451577_0027391 | Ga0451577_0027391_1562_2266 | 233 |
| 646 | 3300042876 | Ga0451577_0178976 | Ga0451577_0178976_1010_1720 | 233 |
| 647 | 3300044656 | Ga0466969_0000009 | Ga0466969_0000009_6799_7503 | 233 |
| 648 | 3300044656 | Ga0466969_0013911 | Ga0466969_0013911_2213_2917 | 233 |
| 649 | 3300044656 | Ga0466969_0032818 | Ga0466969_0032818_1615_2322 | 233 |
| 650 | 3300044656 | Ga0466969_0036236 | Ga0466969_0036236_1450_2157 | 233 |
| 651 | 3300044673 | Ga0453683_0012323 | Ga0453683_0012323_1271_1978 | 233 |
| 652 | 3300044673 | Ga0453683_0068463 | Ga0453683_0068463_1255_1965 | 233 |
| 653 | 3300044683 | Ga0466965_0003719 | Ga0466965_0003719_5022_5726 | 233 |
| 654 | 3300044684 | Ga0466966_0000818 | Ga0466966_0000818_5540_6244 | 233 |
| 655 | 3300044684 | Ga0466966_0021372 | Ga0466966_0021372_2125_2832 | 233 |
| 656 | 3300044693 | Ga0466961_0038195 | Ga0466961_0038195_1859_2563 | 233 |
| 657 | 3300044693 | Ga0466961_0111823 | Ga0466961_0111823_68_775 | 233 |
| 658 | 3300044693 | Ga0466961_0168319 | Ga0466961_0168319_573_1280 | 233 |
| 659 | 3300044693 | Ga0466961_0217074 | Ga0466961_0217074_206_910 | 233 |
| 660 | 3300044694 | Ga0466963_0050472 | Ga0466963_0050472_1507_2211 | 233 |
| 661 | 3300044694 | Ga0466963_0121342 | Ga0466963_0121342_1045_1749 | 233 |
| 662 | 3300044694 | Ga0466963_0410234 | Ga0466963_0410234_205_909 | 233 |
| 663 | 3300044706 | Ga0466964_0004255 | Ga0466964_0004255_2995_3699 | 233 |
| 664 | 3300044712 | Ga0453684_0000280 | Ga0453684_0000280_30767_31477 | 233 |
| 665 | 3300044712 | Ga0453684_0030004 | Ga0453684_0030004_2457_3167 | 233 |
| 666 | 3300044712 | Ga0453684_0492545 | Ga0453684_0492545_140_844 | 233 |
| 667 | 3300044712 | Ga0453684_0501604 | Ga0453684_0501604_16_720 | 233 |
| 668 | 3300044719 | Ga0466971_0009634 | Ga0466971_0009634_1768_2472 | 233 |
| 669 | 3300044735 | Ga0466968_0024344 | Ga0466968_0024344_1194_1901 | 233 |
| 670 | 3300044765 | Ga0466970_0166066 | Ga0466970_0166066_360_1070 | 233 |
| 671 | 3300044842 | Ga0466957_0003611 | Ga0466957_0003611_6055_6759 | 233 |
| 672 | 3300044842 | Ga0466957_0076160 | Ga0466957_0076160_274_978 | 233 |
| 673 | 3300044901 | Ga0466960_0093818 | Ga0466960_0093818_83_790 | 233 |
| 674 | 3300045049 | Ga0466959_0005772 | Ga0466959_0005772_1091_1795 | 233 |
| 675 | 3300045049 | Ga0466959_0009501 | Ga0466959_0009501_5456_6172 | 233 |
| 676 | 3300045049 | Ga0466959_0023548 | Ga0466959_0023548_1507_2211 | 233 |
| 677 | 3300045049 | Ga0466959_0041525 | Ga0466959_0041525_1584_2294 | 233 |
| 678 | 3300045049 | Ga0466959_0173392 | Ga0466959_0173392_530_1255 | 233 |
| 679 | 3300045051 | Ga0451576_0003797 | Ga0451576_0003797_10627_11337 | 233 |
| 680 | 3300045051 | Ga0451576_0004140 | Ga0451576_0004140_12575_13282 | 233 |
| 681 | 3300045051 | Ga0451576_0027493 | Ga0451576_0027493_4029_4733 | 233 |
| 682 | 3300045051 | Ga0451576_0309203 | Ga0451576_0309203_170_880 | 233 |
| 683 | 3300045051 | Ga0451576_0343726 | Ga0451576_0343726_636_1340 | 233 |
| 684 | 3300045051 | Ga0451576_0406597 | Ga0451576_0406597_109_813 | 233 |
| 685 | 3300045051 | Ga0451576_0543329 | Ga0451576_0543329_97_807 | 233 |
| 686 | 3300045836 | Ga0466958_0032521 | Ga0466958_0032521_2126_2830 | 233 |
| 687 | 3300045836 | Ga0466958_0098498 | Ga0466958_0098498_517_1221 | 233 |
| 688 | 3300045976 | Ga0466967_0021050 | Ga0466967_0021050_3791_4495 | 233 |
| 689 | 3300045976 | Ga0466967_0312674 | Ga0466967_0312674_34_738 | 233 |
| 690 | 3300046454 | Ga0495592_0350457 | Ga0495592_0350457_176_880 | 233 |
| 691 | 3300046455 | Ga0495603_0034923 | Ga0495603_0034923_1877_2581 | 233 |
| 692 | 3300046457 | Ga0495590_0000939 | Ga0495590_0000939_62_865 | 233 |
| 693 | 3300046457 | Ga0495590_0015656 | Ga0495590_0015656_1685_2392 | 233 |
| 694 | 3300046460 | Ga0495638_0000224 | Ga0495638_0000224_35294_36028 | 233 |
| 695 | 3300046460 | Ga0495638_0002585 | Ga0495638_0002585_11813_12535 | 233 |
| 696 | 3300046472 | Ga0495580_0000118 | Ga0495580_0000118_19936_20640 | 233 |
| 697 | 3300046472 | Ga0495580_0003172 | Ga0495580_0003172_10577_11281 | 233 |
| 698 | 3300046472 | Ga0495580_0404365 | Ga0495580_0404365_204_908 | 233 |
| 699 | 3300046473 | Ga0495582_0226193 | Ga0495582_0226193_340_1044 | 233 |
| 700 | 3300046499 | Ga0495594_0026445 | Ga0495594_0026445_480_1184 | 233 |
| 701 | 3300046506 | Ga0495583_0000071 | Ga0495583_0000071_41190_41894 | 233 |
| 702 | 3300046506 | Ga0495583_0084614 | Ga0495583_0084614_552_1259 | 233 |
| 703 | 3300046507 | Ga0495606_0000560 | Ga0495606_0000560_31456_32160 | 233 |
| 704 | 3300046515 | Ga0495620_0050297 | Ga0495620_0050297_746_1450 | 233 |
| 705 | 3300046515 | Ga0495620_0052557 | Ga0495620_0052557_225_929 | 233 |
| 706 | 3300046517 | Ga0495630_0001053 | Ga0495630_0001053_5538_6251 | 233 |
| 707 | 3300046519 | Ga0495632_0011670 | Ga0495632_0011670_2487_3194 | 233 |
| 708 | 3300046519 | Ga0495632_0035966 | Ga0495632_0035966_150_854 | 233 |
| 709 | 3300046519 | Ga0495632_0050326 | Ga0495632_0050326_259_981 | 233 |
| 710 | 3300046519 | Ga0495632_0051520 | Ga0495632_0051520_274_984 | 233 |
| 711 | 3300046525 | Ga0495663_0014896 | Ga0495663_0014896_117_821 | 233 |
| 712 | 3300046526 | Ga0495666_0174275 | Ga0495666_0174275_105_818 | 233 |
| 713 | 3300046528 | Ga0495642_0203357 | Ga0495642_0203357_66_770 | 233 |
| 714 | 3300046530 | Ga0495654_0090777 | Ga0495654_0090777_577_1281 | 233 |
| 715 | 3300046531 | Ga0495665_0007571 | Ga0495665_0007571_1418_2122 | 233 |
| 716 | 3300046531 | Ga0495665_0092298 | Ga0495665_0092298_287_1000 | 233 |
| 717 | 3300046533 | Ga0495640_0011409 | Ga0495640_0011409_5151_5864 | 233 |
| 718 | 3300046535 | Ga0495586_0219923 | Ga0495586_0219923_344_1048 | 233 |
| 719 | 3300046542 | Ga0495597_0012332 | Ga0495597_0012332_1512_2216 | 233 |
| 720 | 3300046615 | Ga0495656_0021763 | Ga0495656_0021763_460_1164 | 233 |
| 721 | 3300046615 | Ga0495656_0022579 | Ga0495656_0022579_1355_2059 | 233 |
| 722 | 3300046642 | Ga0495634_0016833 | Ga0495634_0016833_3801_4514 | 233 |
| 723 | 3300046660 | Ga0495625_0000990 | Ga0495625_0000990_31153_31857 | 233 |
| 724 | 3300046660 | Ga0495625_0013676 | Ga0495625_0013676_1980_2684 | 233 |
| 725 | 3300046663 | Ga0495635_0012723 | Ga0495635_0012723_3558_4271 | 233 |
| 726 | 3300046663 | Ga0495635_0146342 | Ga0495635_0146342_218_922 | 233 |
| 727 | 3300046664 | Ga0495659_0104335 | Ga0495659_0104335_154_858 | 233 |
| 728 | 3300046674 | Ga0495588_0084029 | Ga0495588_0084029_117_827 | 233 |
| 729 | 3300046683 | Ga0495658_0030201 | Ga0495658_0030201_1628_2332 | 233 |
| 730 | 3300046689 | Ga0495613_0029473 | Ga0495613_0029473_2119_2832 | 233 |
| 731 | 3300046690 | Ga0495624_0003524 | Ga0495624_0003524_1417_2130 | 233 |
| 732 | 3300046691 | Ga0495670_0101905 | Ga0495670_0101905_632_1336 | 233 |
| 733 | 3300046692 | Ga0495671_0042279 | Ga0495671_0042279_886_1596 | 233 |
| 734 | 3300046694 | Ga0495649_0000144 | Ga0495649_0000144_33309_34013 | 233 |
| 735 | 3300046694 | Ga0495649_0001813 | Ga0495649_0001813_12878_13585 | 233 |
| 736 | 3300046794 | Ga0495589_0022802 | Ga0495589_0022802_1760_2464 | 233 |
| 737 | 3300046809 | Ga0495600_0103555 | Ga0495600_0103555_181_885 | 233 |
| 738 | 3300046810 | Ga0495660_0041610 | Ga0495660_0041610_356_1063 | 233 |
| 739 | 3300047315 | Ga0495581_0012636 | Ga0495581_0012636_658_1371 | 233 |
| 740 | 3300047317 | Ga0495604_0002984 | Ga0495604_0002984_1285_1989 | 233 |
| 741 | 3300047319 | Ga0495674_0050007 | Ga0495674_0050007_1293_2006 | 233 |
| 742 | 3300047319 | Ga0495674_0463555 | Ga0495674_0463555_265_969 | 233 |
| 743 | 3300047321 | Ga0495676_0053068 | Ga0495676_0053068_1120_1833 | 233 |
| 744 | 3300047443 | Ga0495687_000454 | Ga0495687_000454_45322_46026 | 233 |
| 745 | 3300047443 | Ga0495687_007504 | Ga0495687_007504_2539_3246 | 233 |
| 746 | 3300047447 | Ga0495685_019184 | Ga0495685_019184_474_1178 | 233 |
| 747 | 3300047469 | Ga0495673_0070024 | Ga0495673_0070024_103_825 | 233 |
| 748 | 3300047469 | Ga0495673_0091723 | Ga0495673_0091723_204_908 | 233 |
| 749 | 3300047470 | Ga0495681_0164801 | Ga0495681_0164801_79_783 | 233 |
| 750 | 3300047471 | Ga0495684_0004024 | Ga0495684_0004024_5314_6027 | 233 |
| 751 | 3300047472 | Ga0495686_0001272 | Ga0495686_0001272_13816_14520 | 233 |
| 752 | 3300047673 | Ga0495593_0024039 | Ga0495593_0024039_135_848 | 233 |
| 753 | 3300048089 | Ga0495614_0160986 | Ga0495614_0160986_240_953 | 233 |
| 754 | 3300048091 | Ga0495626_0102388 | Ga0495626_0102388_191_895 | 233 |
| 755 | 3300048904 | Ga0496101_0099560 | Ga0496101_0099560_663_1367 | 233 |
| 756 | 3300048905 | Ga0496102_0001271 | Ga0496102_0001271_17395_18099 | 233 |
| 757 | 3300048905 | Ga0496102_0027990 | Ga0496102_0027990_1879_2583 | 233 |
| 758 | 3300048906 | Ga0496103_0095447 | Ga0496103_0095447_580_1284 | 233 |
| 759 | 3300048907 | Ga0496104_0037358 | Ga0496104_0037358_3319_4023 | 233 |
| 760 | 3300048908 | Ga0496105_0307559 | Ga0496105_0307559_239_943 | 233 |
| 761 | 3300048909 | Ga0496106_0308786 | Ga0496106_0308786_413_1129 | 233 |
| 762 | 3300048909 | Ga0496106_0411920 | Ga0496106_0411920_285_989 | 233 |
| 763 | 3300048910 | Ga0496107_0059744 | Ga0496107_0059744_1513_2217 | 233 |
| 764 | 3300048910 | Ga0496107_0468999 | Ga0496107_0468999_56_760 | 233 |
| 765 | 3300048911 | Ga0496108_0154503 | Ga0496108_0154503_1056_1760 | 233 |
| 766 | 3300048911 | Ga0496108_0456468 | Ga0496108_0456468_105_809 | 233 |
| 767 | 3300048911 | Ga0496108_0475369 | Ga0496108_0475369_42_746 | 233 |
| 768 | 3300048912 | Ga0496109_0122282 | Ga0496109_0122282_1705_2409 | 233 |
| 769 | 3300048912 | Ga0496109_0359833 | Ga0496109_0359833_325_1029 | 233 |
| 770 | 3300048912 | Ga0496109_0382153 | Ga0496109_0382153_447_1151 | 233 |
| 771 | 3300048913 | Ga0496110_0030521 | Ga0496110_0030521_2383_3087 | 233 |
| 772 | 3300048914 | Ga0496111_0544345 | Ga0496111_0544345_67_771 | 233 |
| 773 | 3300048916 | Ga0496113_0075019 | Ga0496113_0075019_1711_2415 | 233 |
| 774 | 3300048917 | Ga0496114_0019358 | Ga0496114_0019358_238_942 | 233 |
| 775 | 3300048917 | Ga0496114_0047036 | Ga0496114_0047036_831_1535 | 233 |
| 776 | 3300048917 | Ga0496114_0155840 | Ga0496114_0155840_727_1431 | 233 |
| 777 | 3300048918 | Ga0496115_0050330 | Ga0496115_0050330_2506_3210 | 233 |
| 778 | 3300048924 | Ga0496121_0002728 | Ga0496121_0002728_8828_9562 | 233 |
| 779 | 3300048925 | Ga0496122_0134255 | Ga0496122_0134255_693_1427 | 233 |
| 780 | 3300048926 | Ga0496123_0235711 | Ga0496123_0235711_94_828 | 233 |
| 781 | 3300048928 | Ga0496125_0297340 | Ga0496125_0297340_120_854 | 233 |
| 782 | 3300048929 | Ga0496126_0137269 | Ga0496126_0137269_420_1154 | 233 |
| 783 | 3300048929 | Ga0496126_0229384 | Ga0496126_0229384_397_1131 | 233 |
| 784 | 3300049571 | Ga0501034_0000106 | Ga0501034_0000106_48973_49677 | 233 |
| 785 | 3300049571 | Ga0501034_0035657 | Ga0501034_0035657_2909_3613 | 233 |
| 786 | 3300049574 | Ga0501038_0115715 | Ga0501038_0115715_721_1425 | 233 |
| 787 | 3300049579 | Ga0501043_0050928 | Ga0501043_0050928_1232_1936 | 233 |
| 788 | 3300049580 | Ga0501046_0007148 | Ga0501046_0007148_7622_8326 | 233 |
| 789 | 3300049580 | Ga0501046_0374205 | Ga0501046_0374205_37_741 | 233 |
| 790 | 3300049581 | Ga0501047_0028441 | Ga0501047_0028441_3784_4488 | 233 |
| 791 | 3300049649 | Ga0501198_000023 | Ga0501198_000023_45074_45778 | 233 |
| 792 | 3300049662 | Ga0501222_000031 | Ga0501222_000031_23339_24043 | 233 |
| 793 | 3300049742 | Ga0501080_0064774 | Ga0501080_0064774_1422_2126 | 233 |
| 794 | 3300049822 | Ga0501035_0104532 | Ga0501035_0104532_862_1566 | 233 |
| 795 | 3300049822 | Ga0501035_0120588 | Ga0501035_0120588_594_1304 | 233 |
| 796 | 3300049823 | Ga0501044_0013961 | Ga0501044_0013961_6303_7007 | 233 |
| 797 | 3300049823 | Ga0501044_0148737 | Ga0501044_0148737_859_1563 | 233 |
| 798 | 3300050490 | nmdc:mga03n38_33245_c1 | nmdc:mga03n38_33245_c1_296_1000 | 233 |
| 799 | 3300050490 | nmdc:mga03n38_348948_c1 | nmdc:mga03n38_348948_c1_59_763 | 233 |
| 800 | 3300050491 | nmdc:mga00v17_78683_c1 | nmdc:mga00v17_78683_c1_1151_1855 | 233 |
| 801 | 3300050492 | nmdc:mga0yw44_339383_c1 | nmdc:mga0yw44_339383_c1_241_945 | 233 |
| 802 | 3300050492 | nmdc:mga0yw44_410945_c1 | nmdc:mga0yw44_410945_c1_201_905 | 233 |
| 803 | 3300050492 | nmdc:mga0yw44_96825_c1 | nmdc:mga0yw44_96825_c1_83_787 | 233 |
| 804 | 3300050493 | nmdc:mga0k408_10501_c1 | nmdc:mga0k408_10501_c1_2684_3388 | 233 |
| 805 | 3300050493 | nmdc:mga0k408_111545_c1 | nmdc:mga0k408_111545_c1_818_1531 | 233 |
| 806 | 3300050493 | nmdc:mga0k408_14119_c2 | nmdc:mga0k408_14119_c2_1440_2162 | 233 |
| 807 | 3300050493 | nmdc:mga0k408_14745_c1 | nmdc:mga0k408_14745_c1_677_1381 | 233 |
| 808 | 3300050493 | nmdc:mga0k408_201630_c1 | nmdc:mga0k408_201630_c1_389_1093 | 233 |
| 809 | 3300050493 | nmdc:mga0k408_323732_c1 | nmdc:mga0k408_323732_c1_173_877 | 233 |
| 810 | 3300050493 | nmdc:mga0k408_35013_c1 | nmdc:mga0k408_35013_c1_1730_2434 | 233 |
| 811 | 3300050493 | nmdc:mga0k408_40610_c1 | nmdc:mga0k408_40610_c1_1752_2468 | 233 |
| 812 | 3300050493 | nmdc:mga0k408_4653_c1 | nmdc:mga0k408_4653_c1_1139_1843 | 233 |
| 813 | 3300050494 | nmdc:mga06z11_61813_c1 | nmdc:mga06z11_61813_c1_533_1237 | 233 |
| 814 | 3300050496 | nmdc:mga07m45_179357_c1 | nmdc:mga07m45_179357_c1_209_913 | 233 |
| 815 | 3300050496 | nmdc:mga07m45_18581_c1 | nmdc:mga07m45_18581_c1_1408_2124 | 233 |
| 816 | 3300050496 | nmdc:mga07m45_26255_c1 | nmdc:mga07m45_26255_c1_1260_1964 | 233 |
| 817 | 3300050496 | nmdc:mga07m45_3277_c1 | nmdc:mga07m45_3277_c1_6858_7571 | 233 |
| 818 | 3300050496 | nmdc:mga07m45_3995_c1 | nmdc:mga07m45_3995_c1_5587_6291 | 233 |
| 819 | 3300050496 | nmdc:mga07m45_4628_c1 | nmdc:mga07m45_4628_c1_2113_2817 | 233 |
| 820 | 3300050496 | nmdc:mga07m45_468_c1 | nmdc:mga07m45_468_c1_11314_12021 | 233 |
| 821 | 3300050496 | nmdc:mga07m45_49006_c1 | nmdc:mga07m45_49006_c1_227_931 | 233 |
| 822 | 3300050496 | nmdc:mga07m45_494_c1 | nmdc:mga07m45_494_c1_681_1385 | 233 |
| 823 | 3300050507 | nmdc:mga05p37_28163_c1 | nmdc:mga05p37_28163_c1_3014_3718 | 233 |
| 824 | 3300050508 | nmdc:mga09592_1109_c1 | nmdc:mga09592_1109_c1_11673_12389 | 233 |
| 825 | 3300050509 | nmdc:mga0qj67_194221_c1 | nmdc:mga0qj67_194221_c1_509_1216 | 233 |
| 826 | 3300050512 | nmdc:mga0n895_93044_c1 | nmdc:mga0n895_93044_c1_718_1422 | 233 |
| 827 | 3300050516 | nmdc:mga0sz30_115229_c1 | nmdc:mga0sz30_115229_c1_269_973 | 233 |
| 828 | 3300050516 | nmdc:mga0sz30_17015_c1 | nmdc:mga0sz30_17015_c1_668_1372 | 233 |
| 829 | 3300050516 | nmdc:mga0sz30_4255_c1 | nmdc:mga0sz30_4255_c1_1916_2620 | 233 |
| 830 | 3300053077 | Ga0495601_0325694 | Ga0495601_0325694_204_908 | 233 |
| 831 | 3300053078 | Ga0495612_0129886 | Ga0495612_0129886_289_993 | 233 |
| 832 | 3300053085 | Ga0495619_0041407 | Ga0495619_0041407_18_722 | 233 |
| 833 | 3300053085 | Ga0495619_0067162 | Ga0495619_0067162_979_1683 | 233 |
| 834 | 3300053086 | Ga0500578_0000057 | Ga0500578_0000057_74650_75354 | 233 |
| 835 | 3300053090 | Ga0500646_0001133 | Ga0500646_0001133_1359_2063 | 233 |
| 836 | 3300053090 | Ga0500646_0017240 | Ga0500646_0017240_202_906 | 233 |
| 837 | 3300053092 | Ga0500583_0039612 | Ga0500583_0039612_1049_1753 | 233 |
| 838 | 3300053093 | Ga0500651_0035425 | Ga0500651_0035425_336_1040 | 233 |
| 839 | 3300053108 | Ga0500562_049598 | Ga0500562_049598_263_967 | 233 |
| 840 | 3300053109 | Ga0500569_061511 | Ga0500569_061511_298_1002 | 233 |
| 841 | 3300053117 | Ga0500593_000199 | Ga0500593_000199_21560_22264 | 233 |
| 842 | 3300053131 | Ga0500652_002632 | Ga0500652_002632_1829_2533 | 233 |
| 843 | 3300053133 | Ga0500655_035354 | Ga0500655_035354_102_806 | 233 |
| 844 | 3300053134 | Ga0500658_0001951 | Ga0500658_0001951_6072_6779 | 233 |
| 845 | 3300053134 | Ga0500658_0062796 | Ga0500658_0062796_217_948 | 233 |
| 846 | 3300053151 | Ga0500604_0028653 | Ga0500604_0028653_601_1305 | 233 |
| 847 | 3300053156 | Ga0500622_0000530 | Ga0500622_0000530_20972_21676 | 233 |
| 848 | 3300053730 | Ga0500645_000978 | Ga0500645_000978_1142_1846 | 233 |
| 849 | 3300053730 | Ga0500645_008154 | Ga0500645_008154_298_1002 | 233 |
| 850 | 3300055283 | Ga0500661_010782 | Ga0500661_010782_763_1467 | 233 |
| 851 | 3300061719 | Ga0466962_0012685 | Ga0466962_0012685_645_1349 | 233 |
| 852 | iso_pu_bacteria | 2900634093 | 2900643337 | 233 |
| 853 | 3300033179 | Ga0307507_10040352 | Ga0307507_100403524 | 234 |
| 854 | 3300037418 | Ga0395900_0000387 | Ga0395900_0000387_62032_62745 | 234 |
| 855 | 3300037418 | Ga0395900_0267418 | Ga0395900_0267418_125_835 | 234 |
| 856 | 3300037466 | Ga0395898_0000958 | Ga0395898_0000958_44270_44983 | 234 |
| 857 | 3300037466 | Ga0395898_0028246 | Ga0395898_0028246_897_1607 | 234 |
| 858 | 3300044684 | Ga0466966_0228245 | Ga0466966_0228245_30_740 | 234 |
| 859 | 3300044842 | Ga0466957_0044811 | Ga0466957_0044811_433_1143 | 234 |
| 860 | 3300045049 | Ga0466959_0064165 | Ga0466959_0064165_1520_2230 | 234 |
| 861 | 3300045836 | Ga0466958_0037418 | Ga0466958_0037418_1261_1971 | 234 |
| 862 | 3300045976 | Ga0466967_0016859 | Ga0466967_0016859_3556_4266 | 234 |
| 863 | 3300000546 | LJNas_1012990 | LJNas_10129902 | 235 |
| 864 | 3300030763 | Ga0265763_1001692 | Ga0265763_10016922 | 235 |
| 865 | 3300035695 | Ga0373927_0356018 | Ga0373927_0356018_157_864 | 235 |
| 866 | 3300036401 | Ga0373937_0233384 | Ga0373937_0233384_89_796 | 235 |
| 867 | 3300046529 | Ga0495652_0227862 | Ga0495652_0227862_614_1321 | 235 |
| 868 | 3300049822 | Ga0501035_0018506 | Ga0501035_0018506_4906_5643 | 235 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.8983 | 1 | 235 |
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.8946 | 1 | 235 |
| 3rlf-assembly1.cif.gz_B | crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp | 0.8916 | 6 | 222 |
| 4yer-assembly1.cif.gz_B | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.8901 | 4 | 225 |
| 4yer-assembly1.cif.gz_A | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.8885 | 4 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9134 | 1 | 235 | 3.40.50.300 |
| af_O86311_2_235_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9133 | 3 | 224 | 3.40.50.300 |
| af_O53149_2_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9128 | 1 | 227 | 3.40.50.300 |
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9096 | 1 | 235 | 3.40.50.300 |
| af_Q58664_1_235_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9008 | 5 | 234 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A127JQP1-F1-model_v4 | Histidinol dehydrogenase | 0.9951 | 2 | 235 |
GO:0005524
GO:0005886 GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A4Y7B3T8-F1-model_v4 | deleted | 0.994 | 5 | 235 |
|
| AF-A0A7H0GJX1-F1-model_v4 | ABC transporter ATP-binding protein | 0.9932 | 1 | 235 |
GO:0005524
GO:0005886 GO:0015658 GO:0015807 GO:0016887 |
| AF-M1SDV6-F1-model_v4 | ABC transporter related protein | 0.9926 | 5 | 235 |
GO:0005524
GO:0005886 GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A0Q6TCL7-F1-model_v4 | ABC transporter ATP-binding protein | 0.9925 | 3 | 235 |
GO:0005524
GO:0005886 GO:0015658 GO:0015807 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar