F484071

General Info

Members Datasets Scaffolds Average Seq Length
868 448 848 235

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10146194|Ga0070658_101461942
Length 261
Sequence MSSTLVASRTALPSEGEPTPVRGSGGSGAAEMLRIEGLNAWYGESHILHGVDLAVQEGEVVCLLGRNGAGRTTTLRAIVGLTGARKGSIRIRGQEAIRLPPHRVARLGVGYCPEERGIFSTLSAEENLRLPPVTAQGGMSIEEIYAMFPNLQERANSPGTRLSGGEQQMLAVARILRTGARLLLLDEISEGLAPVIVQKLAEMVTTLRAQGYTIVMVEQNFRFAAPLADRFLVMEHGQVIQHFTQAELPSKLATLHEYLGV

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2511231021 Pseudomonas sp. GM78 Isolate Nodule
3 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
6 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
7 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
8 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
9 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
10 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
11 2738541277 Variovorax sp. GV051 Isolate Unclassified
12 2738543019 Variovorax sp. GV040 Isolate Unclassified
13 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
14 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
15 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
16 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
17 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
18 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
19 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
20 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
21 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
22 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
23 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
24 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
25 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
26 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
27 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
28 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
29 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
30 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
31 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
32 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
33 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
34 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
35 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
36 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
37 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
38 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
39 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
46 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
49 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
50 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
51 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
52 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
56 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
57 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
58 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
70 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
76 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
81 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
82 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
83 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
84 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
87 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
102 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
103 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
107 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
108 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
111 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
116 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
117 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
121 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
122 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
143 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
144 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
148 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
149 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
150 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
151 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
156 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
157 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
158 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
161 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
162 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
170 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
172 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
175 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
235 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
237 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
242 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
243 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
244 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
245 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
246 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
247 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
250 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
251 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
252 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
253 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
254 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
255 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
256 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
257 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
258 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
259 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
260 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
261 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
262 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
263 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
264 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
265 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
266 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
267 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
268 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
269 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
270 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
271 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
272 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
273 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
274 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
275 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
276 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
277 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
278 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
279 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
280 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
281 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
282 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
283 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
284 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
285 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
286 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
287 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
288 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
289 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
290 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
291 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
292 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
293 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
294 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
295 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
296 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
297 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
298 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
299 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
300 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
301 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
302 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
303 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
304 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
305 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
306 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
307 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
308 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
309 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
310 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
311 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
312 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
313 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
314 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
315 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
316 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
317 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
318 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
319 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
320 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
321 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
322 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
323 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
324 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
325 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
326 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
327 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
328 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
329 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
330 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
331 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
332 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
333 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
334 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
335 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
336 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
337 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
338 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
339 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
340 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
341 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
342 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
343 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
344 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
345 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
346 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
347 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
348 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
349 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
350 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
351 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
352 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
353 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
354 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
355 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
356 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
357 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
358 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
359 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
360 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
361 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
362 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
363 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
364 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
365 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
366 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
367 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
368 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
369 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
370 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
371 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
372 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
373 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
374 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
375 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
376 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
377 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
378 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
379 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
380 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
381 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
382 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
383 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
384 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
385 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
386 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
387 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
388 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
389 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
390 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
391 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
392 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
393 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
394 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
395 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
396 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
397 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
398 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
399 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
400 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
401 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
402 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
403 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
404 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
410 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
411 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
412 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
413 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
414 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
416 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
417 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
418 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
419 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
420 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
421 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
422 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
423 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
424 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
425 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
426 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
427 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
428 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
429 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
430 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
431 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
432 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
433 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
434 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
435 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
436 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
437 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
438 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
439 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
440 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
441 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
442 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
443 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
444 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
445 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
446 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
447 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
448 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.47
Metatranscriptomes 0.23
Isolates 2.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.66
Nodule 0.46
Rhizoplane 3.23
Rhizosphere 70.39
Stem 0
Stem Tuber 0
Unclassified 7.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1012990 3300000546 Bacteria 887
2 JGI25155J39150_1000035 3300002704 Bacteria 99118
3 JGI25156J39149_1000012 3300002705 Bacteria 194393
4 JGI25154J39366_1000029 3300002738 Bacteria 194393
5 JGI25154J39366_1001259 3300002738 Bacteria 9494
6 JGI25157J39369_1000014 3300002741 Bacteria 194393
7 JGI25157J39369_1000179 3300002741 Bacteria 53655
8 JGI25159J45721_1000334 3300002987 Bacteria 21726
9 JGI25159J45721_1003179 3300002987 Bacteria 5896
10 JGI25151J46595_10008323 3300003187 Bacteria 4996
11 JGI25151J46595_10008820 3300003187 Bacteria 4819
12 JGI25160J50197_1000303 3300003354 Bacteria 34764
13 JGI25160J50197_1044611 3300003354 Bacteria 987
14 JGI25161J50226_1000094 3300003374 Bacteria 72451
15 Ga0055539_1000509 3300003752 Bacteria 11986
16 Ga0055539_1001998 3300003752 Bacteria 3362
17 Ga0055533_1000008 3300003756 Bacteria 575861
18 Ga0055535_1000346 3300003761 Bacteria 46216
19 Ga0055535_1000467 3300003761 Bacteria 37033
20 Ga0055535_1007880 3300003761 Bacteria 1978
21 Ga0055529_1000156 3300003763 Bacteria 93167
22 Ga0055526_1000854 3300003771 Bacteria 22695
23 Ga0055526_1004656 3300003771 Bacteria 8159
24 Ga0055537_1000092 3300003773 Bacteria 66301
25 Ga0055524_1000306 3300003775 Bacteria 46611
26 Ga0055536_1020051 3300003781 Bacteria 2078
27 Ga0055534_1006822 3300003784 Bacteria 2817
28 Ga0055528_1000480 3300003790 Bacteria 31747
29 Ga0055530_10000863 3300003791 Bacteria 24942
30 Ga0055540_1000449 3300003792 Bacteria 32166
31 Ga0055540_1006320 3300003792 Bacteria 4732
32 Ga0055531_10002683 3300003794 Bacteria 11722
33 Ga0055531_10002832 3300003794 Bacteria 11351
34 Ga0055543_1000780 3300004625 Bacteria 15806
35 Ga0065165_1001186 3300005262 Bacteria 30210
36 Ga0065714_10018971 3300005288 Bacteria 2440
37 Ga0065707_10176353 3300005295 Bacteria 1448
38 Ga0070658_10115923 3300005327 Bacteria 2222
39 Ga0070658_10146194 3300005327 Bacteria 1977
40 Ga0070658_10589056 3300005327 Bacteria 963
41 Ga0070676_10006298 3300005328 Bacteria 6338
42 Ga0070683_100040327 3300005329 Bacteria 4293
43 Ga0070683_100065230 3300005329 Bacteria 3390
44 Ga0070690_100062871 3300005330 Bacteria 2394
45 Ga0070670_100040562 3300005331 Bacteria 4002
46 Ga0070670_100042619 3300005331 Bacteria 3902
47 Ga0070670_100409341 3300005331 Bacteria 1198
48 Ga0070670_100512908 3300005331 Bacteria 1067
49 Ga0070677_10067027 3300005333 Bacteria 1498
50 Ga0068869_100108125 3300005334 Bacteria 2112
51 Ga0070680_100462302 3300005336 Bacteria 1084
52 Ga0070682_100104091 3300005337 Bacteria 1879
53 Ga0068868_100011018 3300005338 Bacteria 6571
54 Ga0068868_100015797 3300005338 Bacteria 5593
55 Ga0068868_100555220 3300005338 Bacteria 1012
56 Ga0070660_100025973 3300005339 Bacteria 4358
57 Ga0070660_100061955 3300005339 Bacteria 2905
58 Ga0070660_100140920 3300005339 Bacteria 1934
59 Ga0070689_100128466 3300005340 Bacteria 2031
60 Ga0070661_100112646 3300005344 Bacteria 2032
61 Ga0070668_100004185 3300005347 Bacteria 10693
62 Ga0070669_100025707 3300005353 Bacteria 4229
63 Ga0070669_100455366 3300005353 Bacteria 1055
64 Ga0070675_100009133 3300005354 Bacteria 7700
65 Ga0070675_100080463 3300005354 Bacteria 2716
66 Ga0070671_100113696 3300005355 Bacteria 2275
67 Ga0070671_100531978 3300005355 Bacteria 1013
68 Ga0070674_100019585 3300005356 Bacteria 4302
69 Ga0070674_100088035 3300005356 Bacteria 2234
70 Ga0070674_100321063 3300005356 Bacteria 1241
71 Ga0070659_100067511 3300005366 Bacteria 2836
72 Ga0070659_100176025 3300005366 Bacteria 1754
73 Ga0070667_100260497 3300005367 Bacteria 1553
74 Ga0070701_10160769 3300005438 Bacteria 1301
75 Ga0070700_100020552 3300005441 Bacteria 3826
76 Ga0070694_100240688 3300005444 Bacteria 1365
77 Ga0070708_100246996 3300005445 Bacteria 1676
78 Ga0070663_100008867 3300005455 Bacteria 6208
79 Ga0070662_100004805 3300005457 Bacteria 8563
80 Ga0070662_100094281 3300005457 Bacteria 2253
81 Ga0070681_10031139 3300005458 Bacteria 5355
82 Ga0070681_10732200 3300005458 Bacteria 905
83 Ga0068867_100058847 3300005459 Bacteria 2847
84 Ga0068867_100408129 3300005459 Bacteria 1147
85 Ga0070706_100000367 3300005467 Bacteria 54314
86 Ga0070698_100139972 3300005471 Bacteria 2372
87 Ga0070679_100004721 3300005530 Bacteria 12564
88 Ga0070679_100134851 3300005530 Bacteria 2450
89 Ga0070679_100230597 3300005530 Bacteria 1811
90 Ga0070684_100131782 3300005535 Bacteria 2255
91 Ga0068853_100031519 3300005539 Bacteria 4484
92 Ga0068853_100063215 3300005539 Bacteria 3206
93 Ga0068853_100095812 3300005539 Bacteria 2617
94 Ga0068853_100315396 3300005539 Bacteria 1448
95 Ga0068853_100490830 3300005539 Bacteria 1159
96 Ga0070672_100021949 3300005543 Bacteria 4680
97 Ga0070672_100100367 3300005543 Bacteria 2347
98 Ga0070686_100334627 3300005544 Bacteria 1133
99 Ga0070696_100264630 3300005546 Bacteria 1305
100 Ga0070693_100052404 3300005547 Bacteria 2339
101 Ga0070693_100101508 3300005547 Bacteria 1753
102 Ga0070665_100033015 3300005548 Bacteria 5208
103 Ga0070665_100501096 3300005548 Bacteria 1225
104 Ga0070665_100625402 3300005548 Bacteria 1090
105 Ga0068855_100024131 3300005563 Bacteria 7279
106 Ga0068855_100173573 3300005563 Bacteria 2440
107 Ga0068855_100189798 3300005563 Bacteria 2318
108 Ga0068855_100255777 3300005563 Bacteria 1953
109 Ga0070664_100057283 3300005564 Bacteria 3312
110 Ga0070664_100263031 3300005564 Bacteria 1552
111 Ga0070664_100366849 3300005564 Bacteria 1312
112 Ga0068857_100023783 3300005577 Bacteria 5394
113 Ga0068857_100087284 3300005577 Bacteria 2790
114 Ga0068857_100268815 3300005577 Bacteria 1566
115 Ga0068854_100026160 3300005578 Bacteria 4008
116 Ga0068854_100206692 3300005578 Bacteria 1546
117 Ga0068854_100206956 3300005578 Bacteria 1545
118 Ga0068856_100012272 3300005614 Bacteria 8299
119 Ga0068856_100021189 3300005614 Bacteria 6313
120 Ga0068856_100083459 3300005614 Bacteria 3173
121 Ga0068856_100275801 3300005614 Bacteria 1698
122 Ga0068856_100392910 3300005614 Bacteria 1406
123 Ga0068856_100583872 3300005614 Bacteria 1139
124 Ga0070702_100184225 3300005615 Bacteria 1369
125 Ga0070702_100241977 3300005615 Bacteria 1218
126 Ga0070702_100577765 3300005615 Bacteria 839
127 Ga0068852_100032795 3300005616 Bacteria 4304
128 Ga0068852_100324762 3300005616 Bacteria 1495
129 Ga0068852_100331606 3300005616 Bacteria 1481
130 Ga0068852_100364378 3300005616 Bacteria 1414
131 Ga0068859_100019359 3300005617 Bacteria 6839
132 Ga0068859_100442113 3300005617 Bacteria 1397
133 Ga0068864_100009062 3300005618 Bacteria 8203
134 Ga0068864_100011997 3300005618 Bacteria 7155
135 Ga0068864_100017095 3300005618 Bacteria 6047
136 Ga0068866_10073079 3300005718 Bacteria 1818
137 Ga0068861_100001656 3300005719 Bacteria 14245
138 Ga0068861_100019378 3300005719 Bacteria 4860
139 Ga0068861_100045356 3300005719 Bacteria 3310
140 Ga0068851_10032935 3300005834 Bacteria 2580
141 Ga0068851_10089997 3300005834 Bacteria 1614
142 Ga0068863_100463299 3300005841 Bacteria 1245
143 Ga0068858_100002470 3300005842 Bacteria 18659
144 Ga0068858_100008215 3300005842 Bacteria 10036
145 Ga0068858_100175626 3300005842 Bacteria 2021
146 Ga0068858_100259239 3300005842 Bacteria 1652
147 Ga0068860_100001365 3300005843 Bacteria 26507
148 Ga0068860_100103887 3300005843 Bacteria 2712
149 Ga0068862_100538947 3300005844 Bacteria 1113
150 Ga0081539_10017388 3300005985 Bacteria 5052
151 Ga0075365_10013289 3300006038 Bacteria 4915
152 Ga0075365_10016664 3300006038 Bacteria 4475
153 Ga0075365_10087742 3300006038 Bacteria 2115
154 Ga0075365_10096082 3300006038 Bacteria 2025
155 Ga0075368_10040676 3300006042 Bacteria 1825
156 Ga0075363_100080638 3300006048 Bacteria 1780
157 Ga0075363_100086368 3300006048 Bacteria 1722
158 Ga0075364_10022311 3300006051 Bacteria 3996
159 Ga0075364_10049231 3300006051 Bacteria 2747
160 Ga0075432_10006527 3300006058 Bacteria 3973
161 Ga0075432_10016456 3300006058 Bacteria 2524
162 Ga0070716_100168069 3300006173 Bacteria 1429
163 Ga0075362_10032249 3300006177 Bacteria 2272
164 Ga0075362_10080073 3300006177 Bacteria 1505
165 Ga0075362_10081004 3300006177 Bacteria 1496
166 Ga0075362_10160324 3300006177 Bacteria 1083
167 Ga0075367_10015436 3300006178 Bacteria 4151
168 Ga0075367_10018865 3300006178 Bacteria 3813
169 Ga0075367_10043243 3300006178 Bacteria 2638
170 Ga0075367_10094747 3300006178 Bacteria 1820
171 Ga0075369_10014645 3300006186 Bacteria 3137
172 Ga0075366_10007983 3300006195 Bacteria 5861
173 Ga0075366_10015005 3300006195 Bacteria 4430
174 Ga0075366_10041892 3300006195 Bacteria 2711
175 Ga0075366_10043723 3300006195 Bacteria 2654
176 Ga0075366_10091374 3300006195 Bacteria 1823
177 Ga0097621_100020754 3300006237 Bacteria 5068
178 Ga0097621_100078702 3300006237 Bacteria 2739
179 Ga0097621_100085195 3300006237 Bacteria 2635
180 Ga0097621_100842200 3300006237 Bacteria 851
181 Ga0075370_10000151 3300006353 Bacteria 23643
182 Ga0075370_10002757 3300006353 Bacteria 8231
183 Ga0075370_10003232 3300006353 Bacteria 7714
184 Ga0075370_10003626 3300006353 Bacteria 7385
185 Ga0075370_10346862 3300006353 Bacteria 887
186 Ga0068871_100054136 3300006358 Bacteria 3254
187 Ga0068871_100096935 3300006358 Bacteria 2464
188 Ga0075428_100406219 3300006844 Bacteria 1459
189 Ga0075428_101159703 3300006844 Bacteria 815
190 Ga0075430_100221789 3300006846 Bacteria 1569
191 Ga0075431_100155082 3300006847 Bacteria 2356
192 Ga0075431_100555548 3300006847 Bacteria 1135
193 Ga0075429_100008410 3300006880 Bacteria 8980
194 Ga0097620_100019361 3300006931 Bacteria 6839
195 Ga0097620_100442089 3300006931 Bacteria 1397
196 Ga0099795_10017584 3300007788 Bacteria 2282
197 Ga0105240_10009978 3300009093 Bacteria 13386
198 Ga0105240_10016101 3300009093 Bacteria 10132
199 Ga0105240_10429932 3300009093 Bacteria 1482
200 Ga0105240_10682907 3300009093 Bacteria 1122
201 Ga0111539_10405288 3300009094 Bacteria 1588
202 Ga0105245_10114171 3300009098 Bacteria 2515
203 Ga0105245_10189923 3300009098 Bacteria 1967
204 Ga0105245_11182731 3300009098 Bacteria 812
205 Ga0105247_10532069 3300009101 Bacteria 861
206 Ga0114129_10058968 3300009147 Bacteria 5368
207 Ga0105243_10119990 3300009148 Bacteria 2215
208 Ga0105243_10140765 3300009148 Bacteria 2058
209 Ga0105241_10066756 3300009174 Bacteria 2783
210 Ga0105248_10025188 3300009177 Bacteria 6613
211 Ga0105248_10034909 3300009177 Bacteria 5628
212 Ga0105248_10071563 3300009177 Bacteria 3896
213 Ga0105248_10098068 3300009177 Bacteria 3302
214 Ga0105237_10008751 3300009545 Bacteria 10924
215 Ga0105237_10010803 3300009545 Bacteria 9691
216 Ga0105237_10015804 3300009545 Bacteria 7851
217 Ga0105237_10489490 3300009545 Bacteria 1236
218 Ga0105237_10723080 3300009545 Bacteria 1002
219 Ga0105238_10016417 3300009551 Bacteria 7496
220 Ga0105238_10020457 3300009551 Bacteria 6737
221 Ga0105238_10086366 3300009551 Bacteria 3125
222 Ga0105238_10153244 3300009551 Bacteria 2280
223 Ga0105239_10001543 3300010375 Bacteria 30425
224 Ga0105239_10050326 3300010375 Bacteria 4570
225 Ga0105239_10506477 3300010375 Bacteria 1373
226 Ga0105239_10531343 3300010375 Bacteria 1339
227 Ga0105239_10640138 3300010375 Bacteria 1214
228 Ga0105239_11085710 3300010375 Bacteria 921
229 Ga0157373_10054846 3300013100 Bacteria 2832
230 Ga0157371_10271449 3300013102 Bacteria 1224
231 Ga0157370_10187911 3300013104 Bacteria 1918
232 Ga0157369_10092084 3300013105 Bacteria 3235
233 Ga0157369_10177351 3300013105 Bacteria 2243
234 Ga0157374_10576139 3300013296 Bacteria 1134
235 Ga0157378_10340944 3300013297 Bacteria 1461
236 Ga0157378_10653201 3300013297 Bacteria 1067
237 Ga0163162_10036736 3300013306 Bacteria 4884
238 Ga0163162_10437512 3300013306 Bacteria 1440
239 Ga0163162_10468804 3300013306 Bacteria 1391
240 Ga0157372_10206397 3300013307 Bacteria 2277
241 Ga0157372_10365023 3300013307 Bacteria 1682
242 Ga0157375_10157383 3300013308 Bacteria 2411
243 Ga0157375_10269437 3300013308 Bacteria 1865
244 Ga0157375_10402262 3300013308 Bacteria 1536
245 Ga0157375_10578590 3300013308 Bacteria 1283
246 Ga0163163_10286818 3300014325 Bacteria 1698
247 Ga0163163_10327258 3300014325 Bacteria 1587
248 Ga0157380_10075509 3300014326 Bacteria 2739
249 Ga0182008_10185237 3300014497 Bacteria 1055
250 Ga0157377_10001260 3300014745 Bacteria 10825
251 Ga0157379_10012658 3300014968 Bacteria 7373
252 Ga0157379_10196358 3300014968 Bacteria 1824
253 Ga0157376_10006493 3300014969 Bacteria 8266
254 Ga0157376_10035440 3300014969 Bacteria 4037
255 Ga0157376_11129019 3300014969 Bacteria 810
256 Ga0182007_10061376 3300015262 Bacteria 1232
257 Ga0182007_10118646 3300015262 Bacteria 884
258 Ga0213876_10043510 3300021384 Bacteria 2374
259 Ga0213875_10001372 3300021388 Bacteria 15985
260 Ga0209435_100002 3300025206 Bacteria 794178
261 Ga0209674_100015 3300025226 Bacteria 697299
262 Ga0209563_100017 3300025230 Bacteria 796449
263 Ga0209563_107053 3300025230 Bacteria 1876
264 Ga0207427_100989 3300025231 Bacteria 11980
265 Ga0209258_100025 3300025242 Bacteria 534777
266 Ga0209258_100557 3300025242 Bacteria 32937
267 Ga0207425_1003954 3300025245 Bacteria 4570
268 Ga0207425_1017783 3300025245 Bacteria 1554
269 Ga0209646_1000001 3300025246 Bacteria 3092932
270 Ga0209646_1000131 3300025246 Bacteria 128289
271 Ga0209026_1000038 3300025250 Bacteria 281227
272 Ga0209026_1000040 3300025250 Bacteria 277470
273 Ga0209677_100022 3300025253 Bacteria 410724
274 Ga0209677_100074 3300025253 Bacteria 133019
275 Ga0209677_100832 3300025253 Bacteria 15305
276 Ga0209148_1002620 3300025254 Bacteria 5873
277 Ga0209759_1000001 3300025256 Bacteria 2799452
278 Ga0209759_1000031 3300025256 Bacteria 281227
279 Ga0209759_1004903 3300025256 Bacteria 4845
280 Ga0209759_1007462 3300025256 Bacteria 3514
281 Ga0209129_1011540 3300025258 Bacteria 2101
282 Ga0209565_1000026 3300025263 Bacteria 365910
283 Ga0209565_1001255 3300025263 Bacteria 11855
284 Ga0209565_1005280 3300025263 Bacteria 3781
285 Ga0209565_1014193 3300025263 Bacteria 1838
286 Ga0207666_1001927 3300025271 Bacteria 2468
287 Ga0209455_1000089 3300025272 Bacteria 235612
288 Ga0209455_1012267 3300025272 Bacteria 2061
289 Ga0209673_1000009 3300025273 Bacteria 620735
290 Ga0209673_1000012 3300025273 Bacteria 579480
291 Ga0209673_1051404 3300025273 Bacteria 1088
292 Ga0209130_1000183 3300025284 Bacteria 87887
293 Ga0209130_1000644 3300025284 Bacteria 32528
294 Ga0209675_1000308 3300025291 Bacteria 44127
295 Ga0209675_1006996 3300025291 Bacteria 4409
296 Ga0209675_1012555 3300025291 Bacteria 2717
297 Ga0209675_1017411 3300025291 Bacteria 2053
298 Ga0209676_1000013 3300025292 Bacteria 816080
299 Ga0209676_1003161 3300025292 Bacteria 10492
300 Ga0209025_1005365 3300025294 Bacteria 10492
301 Ga0209025_1006206 3300025294 Bacteria 9380
302 Ga0209025_1031654 3300025294 Bacteria 2496
303 Ga0209564_1001304 3300025295 Bacteria 26859
304 Ga0209564_1004427 3300025295 Bacteria 8605
305 Ga0209564_1004860 3300025295 Bacteria 7983
306 Ga0209758_1000304 3300025297 Bacteria 95770
307 Ga0209758_1007970 3300025297 Bacteria 7015
308 Ga0209050_1000008 3300025298 Bacteria 1144179
309 Ga0209050_1000266 3300025298 Bacteria 111792
310 Ga0209050_1001933 3300025298 Bacteria 19735
311 Ga0209050_1006110 3300025298 Bacteria 7265
312 Ga0209050_1025810 3300025298 Bacteria 1986
313 Ga0209256_1000003 3300025299 Bacteria 1661127
314 Ga0209256_1000049 3300025299 Bacteria 310696
315 Ga0209256_1001148 3300025299 Bacteria 30046
316 Ga0207426_1000062 3300025302 Bacteria 362040
317 Ga0207426_1003042 3300025302 Bacteria 9688
318 Ga0209051_1000005 3300025303 Bacteria 1142353
319 Ga0209051_1000025 3300025303 Bacteria 415397
320 Ga0209051_1009298 3300025303 Bacteria 5078
321 Ga0209051_1042094 3300025303 Bacteria 1617
322 Ga0209257_1000039 3300025304 Bacteria 591694
323 Ga0209257_1000048 3300025304 Bacteria 455536
324 Ga0209257_1012197 3300025304 Bacteria 4012
325 Ga0207697_10098276 3300025315 Bacteria 1246
326 Ga0207656_10017653 3300025321 Bacteria 2798
327 Ga0207656_10322762 3300025321 Bacteria 767
328 Ga0207682_10024170 3300025893 Bacteria 2404
329 Ga0207688_10086801 3300025901 Bacteria 1793
330 Ga0207688_10120969 3300025901 Bacteria 1528
331 Ga0207680_10097179 3300025903 Bacteria 1885
332 Ga0207680_10100226 3300025903 Bacteria 1860
333 Ga0207680_10131443 3300025903 Bacteria 1650
334 Ga0207699_10000129 3300025906 Bacteria 52416
335 Ga0207645_10008065 3300025907 Bacteria 7387
336 Ga0207645_10022328 3300025907 Bacteria 4119
337 Ga0207645_10023553 3300025907 Bacteria 4001
338 Ga0207645_10111785 3300025907 Bacteria 1769
339 Ga0207705_10145984 3300025909 Bacteria 1770
340 Ga0207684_10005313 3300025910 Bacteria 11914
341 Ga0207654_10030295 3300025911 Bacteria 2969
342 Ga0207654_10035373 3300025911 Bacteria 2783
343 Ga0207654_10128404 3300025911 Bacteria 1601
344 Ga0207707_10022477 3300025912 Bacteria 5513
345 Ga0207707_10178613 3300025912 Bacteria 1854
346 Ga0207707_10683737 3300025912 Bacteria 863
347 Ga0207695_10014227 3300025913 Bacteria 9438
348 Ga0207695_10065783 3300025913 Bacteria 3726
349 Ga0207695_10197632 3300025913 Bacteria 1926
350 Ga0207671_10010930 3300025914 Bacteria 7438
351 Ga0207671_10022450 3300025914 Bacteria 4772
352 Ga0207671_10064598 3300025914 Bacteria 2721
353 Ga0207671_10088141 3300025914 Bacteria 2334
354 Ga0207660_10169553 3300025917 Bacteria 1689
355 Ga0207662_10021765 3300025918 Bacteria 3668
356 Ga0207657_10010934 3300025919 Bacteria 9027
357 Ga0207657_10074502 3300025919 Bacteria 2866
358 Ga0207657_10112162 3300025919 Bacteria 2251
359 Ga0207657_10188518 3300025919 Bacteria 1665
360 Ga0207649_10235302 3300025920 Bacteria 1312
361 Ga0207652_10022385 3300025921 Bacteria 5228
362 Ga0207652_10049913 3300025921 Bacteria 3584
363 Ga0207681_10023814 3300025923 Bacteria 3921
364 Ga0207681_10191883 3300025923 Bacteria 1563
365 Ga0207681_10564861 3300025923 Bacteria 937
366 Ga0207694_10061758 3300025924 Bacteria 2916
367 Ga0207694_10135696 3300025924 Bacteria 1976
368 Ga0207694_10183779 3300025924 Bacteria 1696
369 Ga0207694_10428311 3300025924 Bacteria 1103
370 Ga0207694_10732629 3300025924 Bacteria 834
371 Ga0207650_10023362 3300025925 Bacteria 4382
372 Ga0207650_10060524 3300025925 Bacteria 2826
373 Ga0207650_10101250 3300025925 Bacteria 2218
374 Ga0207659_10022700 3300025926 Bacteria 4180
375 Ga0207687_10024102 3300025927 Bacteria 4062
376 Ga0207687_10033528 3300025927 Bacteria 3483
377 Ga0207687_10358276 3300025927 Bacteria 1190
378 Ga0207687_10460726 3300025927 Bacteria 1056
379 Ga0207644_10032713 3300025931 Bacteria 3630
380 Ga0207644_10423898 3300025931 Bacteria 1090
381 Ga0207690_10126632 3300025932 Bacteria 1863
382 Ga0207690_10288059 3300025932 Bacteria 1281
383 Ga0207690_10439131 3300025932 Bacteria 1047
384 Ga0207706_10001995 3300025933 Bacteria 19971
385 Ga0207706_10119541 3300025933 Bacteria 2317
386 Ga0207706_10170119 3300025933 Bacteria 1915
387 Ga0207706_10509612 3300025933 Bacteria 1038
388 Ga0207709_10050782 3300025935 Bacteria 2538
389 Ga0207709_10133921 3300025935 Bacteria 1693
390 Ga0207670_10145065 3300025936 Bacteria 1755
391 Ga0207669_10099865 3300025937 Bacteria 1915
392 Ga0207669_10137672 3300025937 Bacteria 1689
393 Ga0207669_10684543 3300025937 Bacteria 841
394 Ga0207704_10111724 3300025938 Bacteria 1849
395 Ga0207691_10004985 3300025940 Bacteria 12806
396 Ga0207691_10027031 3300025940 Bacteria 5384
397 Ga0207711_10009070 3300025941 Bacteria 8311
398 Ga0207711_10011255 3300025941 Bacteria 7434
399 Ga0207711_10046878 3300025941 Bacteria 3693
400 Ga0207711_10060141 3300025941 Bacteria 3273
401 Ga0207711_10463249 3300025941 Bacteria 1180
402 Ga0207689_10000996 3300025942 Bacteria 27158
403 Ga0207689_10011569 3300025942 Bacteria 7560
404 Ga0207689_10198912 3300025942 Bacteria 1654
405 Ga0207661_10043857 3300025944 Bacteria 3531
406 Ga0207661_10180601 3300025944 Bacteria 1843
407 Ga0207679_10015982 3300025945 Bacteria 4974
408 Ga0207679_10122608 3300025945 Bacteria 2072
409 Ga0207667_10021835 3300025949 Bacteria 7084
410 Ga0207667_10453804 3300025949 Bacteria 1302
411 Ga0207651_10030894 3300025960 Bacteria 3417
412 Ga0207651_10134764 3300025960 Bacteria 1897
413 Ga0207712_10233178 3300025961 Bacteria 1479
414 Ga0207668_10090770 3300025972 Bacteria 2243
415 Ga0207640_10221288 3300025981 Bacteria 1450
416 Ga0207640_10345284 3300025981 Bacteria 1194
417 Ga0207658_10012023 3300025986 Bacteria 5904
418 Ga0207658_10073606 3300025986 Bacteria 2593
419 Ga0207658_10583726 3300025986 Bacteria 1003
420 Ga0207677_10000853 3300026023 Bacteria 17454
421 Ga0207677_10057976 3300026023 Bacteria 2663
422 Ga0207703_10003620 3300026035 Bacteria 12891
423 Ga0207703_10009640 3300026035 Bacteria 7581
424 Ga0207703_10044880 3300026035 Bacteria 3553
425 Ga0207703_10214019 3300026035 Bacteria 1720
426 Ga0207639_10006133 3300026041 Bacteria 8160
427 Ga0207639_10272831 3300026041 Bacteria 1484
428 Ga0207639_10273608 3300026041 Bacteria 1482
429 Ga0207678_10062737 3300026067 Bacteria 3194
430 Ga0207678_10103777 3300026067 Bacteria 2426
431 Ga0207708_10019046 3300026075 Bacteria 5168
432 Ga0207708_10043438 3300026075 Bacteria 3425
433 Ga0207708_10185426 3300026075 Bacteria 1653
434 Ga0207702_10004240 3300026078 Bacteria 12805
435 Ga0207702_10014759 3300026078 Bacteria 6480
436 Ga0207702_10087741 3300026078 Bacteria 2717
437 Ga0207641_10139494 3300026088 Bacteria 2185
438 Ga0207641_10333084 3300026088 Bacteria 1442
439 Ga0207648_10129602 3300026089 Bacteria 2220
440 Ga0207648_10408558 3300026089 Bacteria 1231
441 Ga0207648_10691485 3300026089 Bacteria 945
442 Ga0207648_10949846 3300026089 Bacteria 804
443 Ga0207676_10003408 3300026095 Bacteria 11239
444 Ga0207676_10028197 3300026095 Bacteria 4192
445 Ga0207676_10029223 3300026095 Bacteria 4125
446 Ga0207674_10021307 3300026116 Bacteria 6984
447 Ga0207674_10022527 3300026116 Bacteria 6763
448 Ga0207674_10031102 3300026116 Bacteria 5608
449 Ga0207674_10257168 3300026116 Bacteria 1693
450 Ga0207674_10643093 3300026116 Bacteria 1024
451 Ga0207675_100002360 3300026118 Bacteria 18687
452 Ga0207675_100090758 3300026118 Bacteria 2873
453 Ga0207675_100262784 3300026118 Bacteria 1673
454 Ga0207683_10009600 3300026121 Bacteria 8247
455 Ga0207698_10020822 3300026142 Bacteria 4522
456 Ga0207698_10027402 3300026142 Bacteria 4044
457 Ga0207698_10065102 3300026142 Bacteria 2861
458 Ga0207698_11071726 3300026142 Bacteria 818
459 Ga0207698_11078538 3300026142 Bacteria 815
460 Ga0209995_1000160 3300027471 Bacteria 10708
461 Ga0209982_1021798 3300027552 Bacteria 987
462 Ga0209998_10015322 3300027717 Bacteria 1604
463 Ga0209813_10063458 3300027866 Bacteria 1185
464 Ga0209974_10003807 3300027876 Bacteria 5407
465 Ga0207428_10152541 3300027907 Bacteria 1758
466 Ga0265354_1002175 3300028016 Bacteria 2508
467 Ga0268266_10117960 3300028379 Bacteria 2359
468 Ga0268265_10792347 3300028380 Bacteria 923
469 Ga0268265_10891596 3300028380 Bacteria 873
470 Ga0268264_10011726 3300028381 Bacteria 7228
471 Ga0268264_10068442 3300028381 Bacteria 3000
472 Ga0265336_10000029 3300028666 Bacteria 178897
473 Ga0307517_10297086 3300028786 Bacteria 908
474 Ga0307515_10000123 3300028794 Bacteria 186601
475 Ga0307515_10001456 3300028794 Bacteria 53165
476 Ga0307515_10002728 3300028794 Bacteria 37759
477 Ga0307515_10009581 3300028794 Bacteria 18707
478 Ga0307515_10175757 3300028794 Bacteria 2113
479 Ga0307515_10424713 3300028794 Bacteria 949
480 Ga0265324_10000326 3300029957 Bacteria 34966
481 Ga0307511_10000092 3300030521 Bacteria 76188
482 Ga0307511_10059059 3300030521 Bacteria 2955
483 Ga0307512_10090121 3300030522 Bacteria 2141
484 Ga0307512_10114850 3300030522 Bacteria 1756
485 Ga0265763_1001692 3300030763 Bacteria 1608
486 Ga0265770_1001763 3300030878 Bacteria 2952
487 Ga0265330_10037955 3300031235 Bacteria 2142
488 Ga0265325_10004429 3300031241 Bacteria 8878
489 Ga0265325_10029087 3300031241 Bacteria 2972
490 Ga0265329_10060855 3300031242 Bacteria 1196
491 Ga0265327_10000049 3300031251 Bacteria 268046
492 Ga0265327_10113012 3300031251 Bacteria 1295
493 Ga0265316_10038848 3300031344 Bacteria 3829
494 Ga0265316_10054144 3300031344 Bacteria 3142
495 Ga0307513_10000057 3300031456 Bacteria 146564
496 Ga0307513_10041778 3300031456 Bacteria 5056
497 Ga0307513_10240657 3300031456 Bacteria 1615
498 Ga0307509_10069245 3300031507 Bacteria 3689
499 Ga0307408_100062798 3300031548 Bacteria 2716
500 Ga0307408_100148179 3300031548 Bacteria 1850
501 Ga0265313_10142367 3300031595 Bacteria 1030
502 Ga0307508_10008033 3300031616 Bacteria 9780
503 Ga0307508_10298811 3300031616 Bacteria 1203
504 Ga0307508_10363596 3300031616 Bacteria 1038
505 Ga0307514_10008631 3300031649 Bacteria 8644
506 Ga0265314_10002601 3300031711 Bacteria 18259
507 Ga0265314_10023252 3300031711 Bacteria 4730
508 Ga0265314_10313544 3300031711 Bacteria 875
509 Ga0307516_10000017 3300031730 Bacteria 202506
510 Ga0307516_10005729 3300031730 Bacteria 14730
511 Ga0307516_10016806 3300031730 Bacteria 7641
512 Ga0307516_10021030 3300031730 Bacteria 6728
513 Ga0307516_10176861 3300031730 Bacteria 1870
514 Ga0307516_10400243 3300031730 Bacteria 1032
515 Ga0307406_10537104 3300031901 Bacteria 954
516 Ga0307412_10264747 3300031911 Bacteria 1342
517 Ga0307412_10369013 3300031911 Bacteria 1158
518 Ga0307507_10040352 3300033179 Bacteria 4690
519 Ga0307507_10040381 3300033179 Bacteria 4688
520 Ga0373959_0053251 3300034820 Bacteria 879
521 Ga0373926_0030127 3300035083 Bacteria 1909
522 Ga0373944_0007686 3300035089 Bacteria 2895
523 Ga0373952_0020702 3300035092 Bacteria 1381
524 Ga0373923_0016948 3300035111 Bacteria 2779
525 Ga0373936_0042331 3300035113 Bacteria 1828
526 Ga0373936_0189988 3300035113 Bacteria 904
527 Ga0373945_0000417 3300035116 Bacteria 12078
528 Ga0373945_0062883 3300035116 Bacteria 1389
529 Ga0373954_0029214 3300035118 Bacteria 2538
530 Ga0373954_0089060 3300035118 Bacteria 1481
531 Ga0373943_0000245 3300035170 Bacteria 22472
532 Ga0373955_0432428 3300035172 Bacteria 801
533 Ga0373931_0011040 3300035691 Bacteria 4355
534 Ga0373935_0001774 3300035692 Bacteria 12135
535 Ga0373927_0000215 3300035695 Bacteria 46040
536 Ga0373927_0278597 3300035695 Bacteria 1100
537 Ga0373927_0356018 3300035695 Bacteria 965
538 Ga0373947_0000242 3300035725 Bacteria 30738
539 Ga0373937_0196091 3300036401 Bacteria 1898
540 Ga0373937_0233384 3300036401 Bacteria 1733
541 Ga0373925_0000700 3300037068 Bacteria 31392
542 Ga0373925_0177241 3300037068 Bacteria 1685
543 Ga0395899_0002984 3300037312 Bacteria 13533
544 Ga0395899_0004579 3300037312 Bacteria 10775
545 Ga0395900_0000387 3300037418 Bacteria 63605
546 Ga0395900_0006516 3300037418 Bacteria 12165
547 Ga0395900_0010859 3300037418 Bacteria 9314
548 Ga0395900_0020030 3300037418 Bacteria 6821
549 Ga0395900_0044597 3300037418 Bacteria 4568
550 Ga0395900_0267418 3300037418 Bacteria 1705
551 Ga0395898_0000958 3300037466 Bacteria 45958
552 Ga0395898_0002933 3300037466 Bacteria 19401
553 Ga0395898_0010476 3300037466 Bacteria 9691
554 Ga0395898_0012459 3300037466 Bacteria 8791
555 Ga0395898_0028246 3300037466 Bacteria 5625
556 Ga0395905_0002575 3300037471 Bacteria 19972
557 Ga0395905_0004104 3300037471 Bacteria 15258
558 Ga0395905_0005907 3300037471 Bacteria 12410
559 Ga0395905_0006007 3300037471 Bacteria 12291
560 Ga0395905_0007574 3300037471 Bacteria 10789
561 Ga0395905_0009071 3300037471 Bacteria 9755
562 Ga0395905_0023096 3300037471 Bacteria 5879
563 Ga0395905_0104621 3300037471 Bacteria 2657
564 Ga0395905_0105356 3300037471 Bacteria 2648
565 Ga0395905_0112958 3300037471 Bacteria 2552
566 Ga0395905_0113088 3300037471 Bacteria 2550
567 Ga0395905_0139673 3300037471 Bacteria 2279
568 Ga0395905_0190377 3300037471 Bacteria 1924
569 Ga0395905_0198583 3300037471 Bacteria 1881
570 Ga0395905_0348044 3300037471 Unclassified 1374
571 Ga0436364_0252687 3300037853 Bacteria 823
572 Ga0395901_0003137 3300038443 Bacteria 16603
573 Ga0395901_0038125 3300038443 Bacteria 4971
574 Ga0395901_0144544 3300038443 Bacteria 2500
575 Ga0395901_0250782 3300038443 Bacteria 1844
576 Ga0395901_0424467 3300038443 Bacteria 1363
577 Ga0395901_0679900 3300038443 Bacteria 1029
578 Ga0237819_05419 3300038705 Bacteria 2005
579 Ga0436365_1382513 3300039437 Bacteria 6411
580 Ga0436361_0010685 3300039447 Bacteria 1105
581 Ga0436363_0491254 3300039450 Bacteria 1420
582 Ga0436363_1157161 3300039450 Bacteria 7889
583 Ga0439447_005815 3300041407 Bacteria 4065
584 Ga0439453_0029934 3300041408 Bacteria 1027
585 Ga0439465_0126018 3300041413 Bacteria 901
586 Ga0451789_0890581 3300041443 Bacteria 1569
587 Ga0451798_0006129 3300041458 Bacteria 2028
588 Ga0451800_1231896 3300041459 Bacteria 2598
589 Ga0439431_0006681 3300041997 Bacteria 2557
590 Ga0439433_0009143 3300041999 Bacteria 2157
591 Ga0439449_0012132 3300042007 Bacteria 3239
592 Ga0439450_016327 3300042008 Bacteria 1534
593 Ga0439451_013034 3300042009 Bacteria 1679
594 Ga0439456_020582 3300042013 Bacteria 1392
595 Ga0439457_057648 3300042014 Bacteria 877
596 Ga0439462_0009145 3300042015 Bacteria 2505
597 Ga0450898_009171 3300042134 Bacteria 1577
598 Ga0450902_008026 3300042137 Bacteria 1641
599 Ga0450903_001354 3300042138 Bacteria 4584
600 Ga0450903_002112 3300042138 Bacteria 3571
601 Ga0450905_010419 3300042142 Bacteria 1287
602 Ga0439446_0012973 3300042156 Bacteria 2281
603 Ga0439446_0019921 3300042156 Bacteria 1887
604 Ga0450908_007790 3300042184 Bacteria 2013
605 Ga0439434_0047294 3300042435 Bacteria 1329
606 Ga0439460_0033721 3300042461 Bacteria 1472
607 Ga0451577_0001028 3300042876 Bacteria 40476
608 Ga0451577_0027391 3300042876 Bacteria 5159
609 Ga0451577_0178976 3300042876 Bacteria 1911
610 Ga0466969_0000009 3300044656 Bacteria 125464
611 Ga0466969_0013911 3300044656 Bacteria 4235
612 Ga0466969_0032818 3300044656 Bacteria 2638
613 Ga0466969_0036236 3300044656 Bacteria 2493
614 Ga0453683_0012323 3300044673 Bacteria 5605
615 Ga0453683_0068463 3300044673 Bacteria 2220
616 Ga0466965_0003719 3300044683 Bacteria 6735
617 Ga0466966_0000818 3300044684 Bacteria 19809
618 Ga0466966_0021372 3300044684 Bacteria 4249
619 Ga0466966_0228245 3300044684 Bacteria 1123
620 Ga0466961_0038195 3300044693 Bacteria 3079
621 Ga0466961_0111823 3300044693 Bacteria 1718
622 Ga0466961_0168319 3300044693 Bacteria 1363
623 Ga0466961_0217074 3300044693 Bacteria 1179
624 Ga0466963_0050472 3300044694 Bacteria 2753
625 Ga0466963_0121342 3300044694 Bacteria 1799
626 Ga0466963_0410234 3300044694 Bacteria 955
627 Ga0466964_0004255 3300044706 Bacteria 5272
628 Ga0453684_0000280 3300044712 Bacteria 219955
629 Ga0453684_0030004 3300044712 Bacteria 7698
630 Ga0453684_0492545 3300044712 Bacteria 1358
631 Ga0453684_0501604 3300044712 Bacteria 1344
632 Ga0466971_0009634 3300044719 Bacteria 4216
633 Ga0466968_0018776 3300044735 Bacteria 2775
634 Ga0466968_0024344 3300044735 Bacteria 2472
635 Ga0466970_0166066 3300044765 Bacteria 1222
636 Ga0466957_0003611 3300044842 Bacteria 8522
637 Ga0466957_0044811 3300044842 Bacteria 2681
638 Ga0466957_0076160 3300044842 Bacteria 2082
639 Ga0466960_0093818 3300044901 Bacteria 1534
640 Ga0466959_0005772 3300045049 Bacteria 8522
641 Ga0466959_0009501 3300045049 Bacteria 6919
642 Ga0466959_0023548 3300045049 Bacteria 4556
643 Ga0466959_0041525 3300045049 Bacteria 3395
644 Ga0466959_0064165 3300045049 Bacteria 2666
645 Ga0466959_0173392 3300045049 Bacteria 1512
646 Ga0451576_0003797 3300045051 Bacteria 20361
647 Ga0451576_0004140 3300045051 Bacteria 19114
648 Ga0451576_0027493 3300045051 Bacteria 6109
649 Ga0451576_0309203 3300045051 Bacteria 1653
650 Ga0451576_0343726 3300045051 Bacteria 1562
651 Ga0451576_0406597 3300045051 Bacteria 1427
652 Ga0451576_0543329 3300045051 Bacteria 1221
653 Ga0466958_0032521 3300045836 Bacteria 3103
654 Ga0466958_0037418 3300045836 Bacteria 2907
655 Ga0466958_0098498 3300045836 Bacteria 1815
656 Ga0466967_0016859 3300045976 Bacteria 5776
657 Ga0466967_0021050 3300045976 Bacteria 5283
658 Ga0466967_0312674 3300045976 Bacteria 1513
659 Ga0495592_0001331 3300046454 Bacteria 17151
660 Ga0495592_0350457 3300046454 Bacteria 947
661 Ga0495603_0034923 3300046455 Bacteria 3022
662 Ga0495590_0000939 3300046457 Bacteria 12918
663 Ga0495590_0015656 3300046457 Bacteria 2748
664 Ga0495638_0000224 3300046460 Bacteria 77870
665 Ga0495638_0002166 3300046460 Bacteria 16488
666 Ga0495638_0002585 3300046460 Bacteria 14627
667 Ga0495580_0000118 3300046472 Bacteria 54013
668 Ga0495580_0003172 3300046472 Bacteria 14094
669 Ga0495580_0404365 3300046472 Bacteria 920
670 Ga0495582_0226193 3300046473 Bacteria 1071
671 Ga0495664_0187568 3300046477 Bacteria 1254
672 Ga0495594_0026445 3300046499 Bacteria 3122
673 Ga0495594_0304463 3300046499 Bacteria 908
674 Ga0495583_0000071 3300046506 Bacteria 183691
675 Ga0495583_0084614 3300046506 Bacteria 1374
676 Ga0495606_0000560 3300046507 Bacteria 59169
677 Ga0495608_0156099 3300046511 Bacteria 1453
678 Ga0495620_0050297 3300046515 Bacteria 1779
679 Ga0495620_0052557 3300046515 Bacteria 1730
680 Ga0495628_0005510 3300046516 Bacteria 11076
681 Ga0495630_0001053 3300046517 Bacteria 19016
682 Ga0495632_0011670 3300046519 Bacteria 5116
683 Ga0495632_0035966 3300046519 Bacteria 2522
684 Ga0495632_0050326 3300046519 Bacteria 2055
685 Ga0495632_0051520 3300046519 Bacteria 2026
686 Ga0495663_0014896 3300046525 Bacteria 2185
687 Ga0495666_0174275 3300046526 Bacteria 994
688 Ga0495642_0203357 3300046528 Bacteria 863
689 Ga0495652_0227862 3300046529 Bacteria 1396
690 Ga0495652_0251536 3300046529 Bacteria 1309
691 Ga0495654_0090777 3300046530 Bacteria 1418
692 Ga0495665_0007571 3300046531 Bacteria 5881
693 Ga0495665_0092298 3300046531 Bacteria 1591
694 Ga0495640_0011409 3300046533 Bacteria 6838
695 Ga0495640_0094616 3300046533 Bacteria 1968
696 Ga0495586_0033151 3300046535 Bacteria 2771
697 Ga0495586_0219923 3300046535 Bacteria 1079
698 Ga0495597_0012332 3300046542 Bacteria 4124
699 Ga0495667_0015443 3300046559 Bacteria 5159
700 Ga0495656_0021763 3300046615 Bacteria 2500
701 Ga0495656_0022579 3300046615 Bacteria 2466
702 Ga0495634_0016833 3300046642 Bacteria 5223
703 Ga0495625_0000990 3300046660 Bacteria 37644
704 Ga0495625_0013676 3300046660 Bacteria 6508
705 Ga0495635_0012723 3300046663 Bacteria 5900
706 Ga0495635_0136506 3300046663 Bacteria 1672
707 Ga0495635_0146342 3300046663 Bacteria 1608
708 Ga0495659_0104335 3300046664 Bacteria 1101
709 Ga0495588_0084029 3300046674 Bacteria 1663
710 Ga0495658_0030201 3300046683 Bacteria 2941
711 Ga0495613_0029473 3300046689 Bacteria 4080
712 Ga0495613_0561293 3300046689 Bacteria 763
713 Ga0495624_0003524 3300046690 Bacteria 11602
714 Ga0495670_0101905 3300046691 Bacteria 1479
715 Ga0495671_0042279 3300046692 Bacteria 2291
716 Ga0495649_0000144 3300046694 Bacteria 62066
717 Ga0495649_0001813 3300046694 Bacteria 15681
718 Ga0495589_0022802 3300046794 Bacteria 3192
719 Ga0495600_0103555 3300046809 Bacteria 1855
720 Ga0495660_0041610 3300046810 Bacteria 2542
721 Ga0495581_0012636 3300047315 Bacteria 4893
722 Ga0495604_0002984 3300047317 Bacteria 13551
723 Ga0495674_0050007 3300047319 Bacteria 3690
724 Ga0495674_0463555 3300047319 Bacteria 1017
725 Ga0495676_0053068 3300047321 Bacteria 3233
726 Ga0495680_0263007 3300047322 Bacteria 1220
727 Ga0495687_000454 3300047443 Bacteria 50500
728 Ga0495687_007504 3300047443 Bacteria 6410
729 Ga0495685_019184 3300047447 Bacteria 2349
730 Ga0495673_0070024 3300047469 Bacteria 1478
731 Ga0495673_0091723 3300047469 Bacteria 1241
732 Ga0495681_0164801 3300047470 Bacteria 921
733 Ga0495684_0004024 3300047471 Bacteria 11468
734 Ga0495684_0037777 3300047471 Bacteria 3704
735 Ga0495684_0437164 3300047471 Bacteria 912
736 Ga0495686_0001272 3300047472 Bacteria 28580
737 Ga0495593_0024039 3300047673 Bacteria 3380
738 Ga0495614_0160986 3300048089 Bacteria 1004
739 Ga0495626_0102388 3300048091 Bacteria 1247
740 Ga0496101_0099560 3300048904 Bacteria 2173
741 Ga0496102_0001271 3300048905 Bacteria 22770
742 Ga0496102_0027990 3300048905 Bacteria 5036
743 Ga0496102_0041644 3300048905 Bacteria 4160
744 Ga0496102_0910253 3300048905 Bacteria 801
745 Ga0496103_0095447 3300048906 Bacteria 1879
746 Ga0496104_0037358 3300048907 Bacteria 4542
747 Ga0496105_0307559 3300048908 Bacteria 1273
748 Ga0496106_0308786 3300048909 Bacteria 1269
749 Ga0496106_0411920 3300048909 Bacteria 1086
750 Ga0496107_0059744 3300048910 Bacteria 2759
751 Ga0496107_0468999 3300048910 Bacteria 935
752 Ga0496108_0154503 3300048911 Bacteria 1981
753 Ga0496108_0456468 3300048911 Bacteria 1116
754 Ga0496108_0475369 3300048911 Bacteria 1092
755 Ga0496109_0122282 3300048912 Bacteria 2425
756 Ga0496109_0359833 3300048912 Bacteria 1375
757 Ga0496109_0382153 3300048912 Bacteria 1330
758 Ga0496110_0030521 3300048913 Bacteria 4647
759 Ga0496111_0544345 3300048914 Bacteria 852
760 Ga0496113_0075019 3300048916 Bacteria 2580
761 Ga0496114_0019358 3300048917 Bacteria 5516
762 Ga0496114_0047036 3300048917 Bacteria 3587
763 Ga0496114_0155840 3300048917 Bacteria 1983
764 Ga0496115_0050330 3300048918 Bacteria 3337
765 Ga0496121_0002728 3300048924 Bacteria 26312
766 Ga0496122_0134255 3300048925 Bacteria 1564
767 Ga0496123_0235711 3300048926 Bacteria 912
768 Ga0496125_0297340 3300048928 Bacteria 991
769 Ga0496126_0137269 3300048929 Bacteria 2108
770 Ga0496126_0229384 3300048929 Bacteria 1556
771 Ga0501034_0000106 3300049571 Bacteria 153523
772 Ga0501034_0035657 3300049571 Bacteria 5042
773 Ga0501038_0115715 3300049574 Bacteria 2216
774 Ga0501043_0050928 3300049579 Bacteria 3255
775 Ga0501046_0007148 3300049580 Bacteria 9821
776 Ga0501046_0374205 3300049580 Bacteria 1032
777 Ga0501047_0028441 3300049581 Bacteria 5389
778 Ga0501071_0314737 3300049587 Bacteria 1188
779 Ga0501076_0278236 3300049592 Bacteria 1371
780 Ga0501198_000023 3300049649 Bacteria 69100
781 Ga0501222_000031 3300049662 Bacteria 56867
782 Ga0501080_0064774 3300049742 Bacteria 3399
783 Ga0501035_0018506 3300049822 Bacteria 6418
784 Ga0501035_0104532 3300049822 Bacteria 2483
785 Ga0501035_0120588 3300049822 Bacteria 2293
786 Ga0501044_0013961 3300049823 Bacteria 8676
787 Ga0501044_0148737 3300049823 Bacteria 2325
788 nmdc:mga03n38_33245_c1 3300050490 Bacteria 2192
789 nmdc:mga03n38_348948_c1 3300050490 Bacteria 805
790 nmdc:mga00v17_78683_c1 3300050491 Bacteria 2055
791 nmdc:mga0yw44_324650_c1 3300050492 Bacteria 1034
792 nmdc:mga0yw44_339383_c1 3300050492 Bacteria 1010
793 nmdc:mga0yw44_410945_c1 3300050492 Bacteria 916
794 nmdc:mga0yw44_96825_c1 3300050492 Bacteria 1874
795 nmdc:mga0k408_10501_c1 3300050493 Bacteria 5009
796 nmdc:mga0k408_111545_c1 3300050493 Bacteria 1617
797 nmdc:mga0k408_14119_c2 3300050493 Bacteria 2484
798 nmdc:mga0k408_14745_c1 3300050493 Bacteria 4312
799 nmdc:mga0k408_201630_c1 3300050493 Bacteria 1188
800 nmdc:mga0k408_323732_c1 3300050493 Bacteria 920
801 nmdc:mga0k408_35013_c1 3300050493 Bacteria 2878
802 nmdc:mga0k408_40610_c1 3300050493 Bacteria 2678
803 nmdc:mga0k408_4653_c1 3300050493 Bacteria 7271
804 nmdc:mga06z11_61813_c1 3300050494 Bacteria 1955
805 nmdc:mga07m45_179357_c1 3300050496 Bacteria 1232
806 nmdc:mga07m45_18581_c1 3300050496 Bacteria 3756
807 nmdc:mga07m45_26255_c1 3300050496 Bacteria 3201
808 nmdc:mga07m45_3277_c1 3300050496 Bacteria 7785
809 nmdc:mga07m45_3995_c1 3300050496 Bacteria 7174
810 nmdc:mga07m45_4628_c1 3300050496 Bacteria 6747
811 nmdc:mga07m45_468_c1 3300050496 Bacteria 16990
812 nmdc:mga07m45_49006_c1 3300050496 Bacteria 2377
813 nmdc:mga07m45_494_c1 3300050496 Bacteria 16679
814 nmdc:mga05p37_28163_c1 3300050507 Bacteria 6848
815 nmdc:mga09592_1109_c1 3300050508 Bacteria 21409
816 nmdc:mga0qj67_194221_c1 3300050509 Bacteria 1649
817 nmdc:mga0n895_93044_c1 3300050512 Bacteria 3018
818 nmdc:mga0sz30_115229_c1 3300050516 Bacteria 1179
819 nmdc:mga0sz30_17015_c1 3300050516 Bacteria 2895
820 nmdc:mga0sz30_4255_c1 3300050516 Bacteria 3021
821 Ga0495601_0000453 3300053077 Bacteria 21492
822 Ga0495601_0325694 3300053077 Bacteria 1000
823 Ga0495612_0129886 3300053078 Bacteria 1088
824 Ga0495619_0041407 3300053085 Bacteria 3013
825 Ga0495619_0067162 3300053085 Bacteria 2394
826 Ga0500578_0000057 3300053086 Bacteria 120178
827 Ga0500646_0001133 3300053090 Bacteria 7188
828 Ga0500646_0017240 3300053090 Bacteria 1892
829 Ga0500583_0039612 3300053092 Bacteria 2129
830 Ga0500651_0035425 3300053093 Bacteria 3145
831 Ga0500562_049598 3300053108 Bacteria 1122
832 Ga0500569_061511 3300053109 Bacteria 1160
833 Ga0500593_000186 3300053117 Bacteria 25186
834 Ga0500593_000199 3300053117 Bacteria 24418
835 Ga0500595_010356 3300053119 Bacteria 3709
836 Ga0500652_002632 3300053131 Bacteria 5421
837 Ga0500655_035354 3300053133 Bacteria 970
838 Ga0500658_0001951 3300053134 Bacteria 8075
839 Ga0500658_0062796 3300053134 Bacteria 1549
840 Ga0500604_0028653 3300053151 Bacteria 1618
841 Ga0500616_0000028 3300053153 Bacteria 435722
842 Ga0500622_0000530 3300053156 Bacteria 35364
843 Ga0500627_0144519 3300053158 Bacteria 1074
844 Ga0500645_000978 3300053730 Bacteria 16206
845 Ga0500645_008154 3300053730 Bacteria 3598
846 Ga0500661_010782 3300055283 Bacteria 1661
847 Ga0501082_0469980 3300060353 Bacteria 1099
848 Ga0466962_0012685 3300061719 Bacteria 4053

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049587 Ga0501071_0314737 Ga0501071_0314737_516_1151 210
2 3300053158 Ga0500627_0144519 Ga0500627_0144519_415_1050 210
3 3300035172 Ga0373955_0432428 Ga0373955_0432428_14_661 214
4 3300035695 Ga0373927_0278597 Ga0373927_0278597_440_1087 214
5 3300046689 Ga0495613_0561293 Ga0495613_0561293_13_660 214
6 3300047471 Ga0495684_0037777 Ga0495684_0037777_15_662 214
7 3300053153 Ga0500616_0000028 Ga0500616_0000028_149945_150670 215
8 3300046533 Ga0495640_0094616 Ga0495640_0094616_151_822 222
9 3300005445 Ga0070708_100246996 Ga0070708_1002469962 223
10 3300050492 nmdc:mga0yw44_324650_c1 nmdc:mga0yw44_324650_c1_17_703 227
11 3300037471 Ga0395905_0348044 Ga0395905_0348044_96_785 228
12 3300042184 Ga0450908_007790 Ga0450908_007790_1311_2000 228
13 3300042461 Ga0439460_0033721 Ga0439460_0033721_426_1118 229
14 3300046454 Ga0495592_0001331 Ga0495592_0001331_11896_12588 229
15 3300046477 Ga0495664_0187568 Ga0495664_0187568_245_937 229
16 3300046516 Ga0495628_0005510 Ga0495628_0005510_8852_9544 229
17 3300046529 Ga0495652_0251536 Ga0495652_0251536_216_908 229
18 3300046535 Ga0495586_0033151 Ga0495586_0033151_21_713 229
19 3300053077 Ga0495601_0000453 Ga0495601_0000453_6217_6909 229
20 iso_pu_bacteria 2511231002 2511245469 229
21 iso_pu_bacteria 2513237165 2514040420 229
22 iso_pu_bacteria 2585428057 2587726033 229
23 iso_pu_bacteria 2585428058 2587737094 229
24 iso_pu_bacteria 2585428062 2587758103 229
25 iso_pu_bacteria 2588253510 2588290361 229
26 iso_pu_bacteria 2643221592 2643967670 229
27 iso_pu_bacteria 2643221625 2644140492 229
28 iso_pu_bacteria 2643221648 2644273459 229
29 iso_pu_bacteria 2901300506 2901312698 229
30 3300005356 Ga0070674_100088035 Ga0070674_1000880352 230
31 3300005444 Ga0070694_100240688 Ga0070694_1002406881 230
32 3300005548 Ga0070665_100033015 Ga0070665_1000330155 230
33 3300005564 Ga0070664_100366849 Ga0070664_1003668492 230
34 3300005615 Ga0070702_100241977 Ga0070702_1002419772 230
35 3300006847 Ga0075431_100555548 Ga0075431_1005555482 230
36 3300013102 Ga0157371_10271449 Ga0157371_102714492 230
37 3300013308 Ga0157375_10269437 Ga0157375_102694372 230
38 3300025937 Ga0207669_10099865 Ga0207669_100998652 230
39 3300026075 Ga0207708_10043438 Ga0207708_100434384 230
40 iso_pu_bacteria 2881101125 2881103107 230
41 3300007788 Ga0099795_10017584 Ga0099795_100175842 231
42 3300028016 Ga0265354_1002175 Ga0265354_10021752 231
43 3300030878 Ga0265770_1001763 Ga0265770_10017634 231
44 3300031251 Ga0265327_10113012 Ga0265327_101130122 231
45 3300031730 Ga0307516_10005729 Ga0307516_100057298 231
46 3300041407 Ga0439447_005815 Ga0439447_005815_115_825 231
47 3300042137 Ga0450902_008026 Ga0450902_008026_668_1378 231
48 3300042138 Ga0450903_001354 Ga0450903_001354_269_979 231
49 3300046460 Ga0495638_0002166 Ga0495638_0002166_7843_8553 231
50 3300053119 Ga0500595_010356 Ga0500595_010356_2333_3046 231
51 iso_pu_bacteria 2511231021 2511358074 231
52 iso_pu_bacteria 2738541277 2738723559 231
53 iso_pu_bacteria 2738543019 2739284290 231
54 iso_pu_bacteria 2838122688 2838127292 231
55 iso_pu_bacteria 2841983080 2841987392 231
56 iso_pu_bacteria 2904615490 2904618506 231
57 iso_pu_bacteria 2917699015 2917701080 231
58 3300002738 JGI25154J39366_1001259 JGI25154J39366_10012593 232
59 3300002741 JGI25157J39369_1000179 JGI25157J39369_100017910 232
60 3300003752 Ga0055539_1000509 Ga0055539_10005092 232
61 3300003752 Ga0055539_1001998 Ga0055539_10019982 232
62 3300003756 Ga0055533_1000008 Ga0055533_1000008539 232
63 3300003761 Ga0055535_1007880 Ga0055535_10078802 232
64 3300005331 Ga0070670_100409341 Ga0070670_1004093411 232
65 3300005336 Ga0070680_100462302 Ga0070680_1004623022 232
66 3300005438 Ga0070701_10160769 Ga0070701_101607692 232
67 3300005441 Ga0070700_100020552 Ga0070700_1000205521 232
68 3300005458 Ga0070681_10031139 Ga0070681_100311392 232
69 3300005530 Ga0070679_100230597 Ga0070679_1002305972 232
70 3300005539 Ga0068853_100031519 Ga0068853_1000315194 232
71 3300005539 Ga0068853_100490830 Ga0068853_1004908302 232
72 3300005546 Ga0070696_100264630 Ga0070696_1002646302 232
73 3300005563 Ga0068855_100173573 Ga0068855_1001735733 232
74 3300005577 Ga0068857_100023783 Ga0068857_1000237833 232
75 3300005578 Ga0068854_100026160 Ga0068854_1000261603 232
76 3300005614 Ga0068856_100012272 Ga0068856_1000122723 232
77 3300005614 Ga0068856_100275801 Ga0068856_1002758012 232
78 3300005617 Ga0068859_100019359 Ga0068859_1000193593 232
79 3300005617 Ga0068859_100442113 Ga0068859_1004421132 232
80 3300005842 Ga0068858_100175626 Ga0068858_1001756262 232
81 3300006237 Ga0097621_100085195 Ga0097621_1000851952 232
82 3300006358 Ga0068871_100096935 Ga0068871_1000969352 232
83 3300006844 Ga0075428_101159703 Ga0075428_1011597031 232
84 3300006931 Ga0097620_100019361 Ga0097620_1000193613 232
85 3300006931 Ga0097620_100442089 Ga0097620_1004420892 232
86 3300009174 Ga0105241_10066756 Ga0105241_100667563 232
87 3300009177 Ga0105248_10025188 Ga0105248_100251883 232
88 3300009545 Ga0105237_10010803 Ga0105237_1001080310 232
89 3300009545 Ga0105237_10489490 Ga0105237_104894902 232
90 3300009551 Ga0105238_10020457 Ga0105238_100204574 232
91 3300010375 Ga0105239_10050326 Ga0105239_100503263 232
92 3300010375 Ga0105239_10506477 Ga0105239_105064772 232
93 3300013296 Ga0157374_10576139 Ga0157374_105761392 232
94 3300013306 Ga0163162_10468804 Ga0163162_104688042 232
95 3300025226 Ga0209674_100015 Ga0209674_100015131 232
96 3300025230 Ga0209563_100017 Ga0209563_100017228 232
97 3300025242 Ga0209258_100557 Ga0209258_10055723 232
98 3300025246 Ga0209646_1000131 Ga0209646_1000131133 232
99 3300025250 Ga0209026_1000038 Ga0209026_1000038133 232
100 3300025253 Ga0209677_100022 Ga0209677_100022274 232
101 3300025253 Ga0209677_100074 Ga0209677_10007458 232
102 3300025256 Ga0209759_1000031 Ga0209759_1000031133 232
103 3300025272 Ga0209455_1012267 Ga0209455_10122672 232
104 3300025911 Ga0207654_10035373 Ga0207654_100353732 232
105 3300025912 Ga0207707_10022477 Ga0207707_100224772 232
106 3300025914 Ga0207671_10064598 Ga0207671_100645983 232
107 3300025917 Ga0207660_10169553 Ga0207660_101695533 232
108 3300025920 Ga0207649_10235302 Ga0207649_102353022 232
109 3300025931 Ga0207644_10032713 Ga0207644_100327134 232
110 3300025941 Ga0207711_10011255 Ga0207711_100112554 232
111 3300025944 Ga0207661_10180601 Ga0207661_101806012 232
112 3300025986 Ga0207658_10583726 Ga0207658_105837261 232
113 3300026035 Ga0207703_10214019 Ga0207703_102140192 232
114 3300026041 Ga0207639_10006133 Ga0207639_100061333 232
115 3300026075 Ga0207708_10185426 Ga0207708_101854262 232
116 3300026078 Ga0207702_10004240 Ga0207702_100042406 232
117 3300026088 Ga0207641_10333084 Ga0207641_103330842 232
118 3300026116 Ga0207674_10021307 Ga0207674_100213073 232
119 3300026116 Ga0207674_10031102 Ga0207674_100311023 232
120 3300027471 Ga0209995_1000160 Ga0209995_10001606 232
121 3300027876 Ga0209974_10003807 Ga0209974_100038074 232
122 3300027907 Ga0207428_10152541 Ga0207428_101525412 232
123 3300028786 Ga0307517_10297086 Ga0307517_102970862 232
124 3300031241 Ga0265325_10029087 Ga0265325_100290873 232
125 3300031730 Ga0307516_10021030 Ga0307516_100210306 232
126 3300035118 Ga0373954_0029214 Ga0373954_0029214_1441_2160 232
127 3300037471 Ga0395905_0198583 Ga0395905_0198583_656_1393 232
128 3300044735 Ga0466968_0018776 Ga0466968_0018776_1579_2280 232
129 3300046499 Ga0495594_0304463 Ga0495594_0304463_164_877 232
130 3300046511 Ga0495608_0156099 Ga0495608_0156099_575_1294 232
131 3300046559 Ga0495667_0015443 Ga0495667_0015443_2043_2762 232
132 3300046663 Ga0495635_0136506 Ga0495635_0136506_55_756 232
133 3300047322 Ga0495680_0263007 Ga0495680_0263007_443_1162 232
134 3300047471 Ga0495684_0437164 Ga0495684_0437164_49_768 232
135 3300048905 Ga0496102_0041644 Ga0496102_0041644_2857_3558 232
136 3300048905 Ga0496102_0910253 Ga0496102_0910253_69_782 232
137 3300049592 Ga0501076_0278236 Ga0501076_0278236_480_1181 232
138 3300053117 Ga0500593_000186 Ga0500593_000186_22555_23256 232
139 3300060353 Ga0501082_0469980 Ga0501082_0469980_91_792 232
140 iso_pu_bacteria 2939631187 2939633203 232
141 3300002704 JGI25155J39150_1000035 JGI25155J39150_100003550 233
142 3300002705 JGI25156J39149_1000012 JGI25156J39149_100001235 233
143 3300002738 JGI25154J39366_1000029 JGI25154J39366_1000029136 233
144 3300002741 JGI25157J39369_1000014 JGI25157J39369_100001435 233
145 3300002987 JGI25159J45721_1000334 JGI25159J45721_100033416 233
146 3300002987 JGI25159J45721_1003179 JGI25159J45721_10031792 233
147 3300003187 JGI25151J46595_10008323 JGI25151J46595_100083236 233
148 3300003187 JGI25151J46595_10008820 JGI25151J46595_100088203 233
149 3300003354 JGI25160J50197_1000303 JGI25160J50197_100030315 233
150 3300003354 JGI25160J50197_1044611 JGI25160J50197_10446111 233
151 3300003374 JGI25161J50226_1000094 JGI25161J50226_100009445 233
152 3300003761 Ga0055535_1000346 Ga0055535_100034648 233
153 3300003761 Ga0055535_1000467 Ga0055535_100046727 233
154 3300003763 Ga0055529_1000156 Ga0055529_100015666 233
155 3300003771 Ga0055526_1000854 Ga0055526_10008543 233
156 3300003771 Ga0055526_1004656 Ga0055526_10046563 233
157 3300003773 Ga0055537_1000092 Ga0055537_10000923 233
158 3300003775 Ga0055524_1000306 Ga0055524_100030626 233
159 3300003781 Ga0055536_1020051 Ga0055536_10200512 233
160 3300003784 Ga0055534_1006822 Ga0055534_10068222 233
161 3300003790 Ga0055528_1000480 Ga0055528_100048010 233
162 3300003791 Ga0055530_10000863 Ga0055530_1000086311 233
163 3300003792 Ga0055540_1000449 Ga0055540_100044915 233
164 3300003792 Ga0055540_1006320 Ga0055540_10063203 233
165 3300003794 Ga0055531_10002683 Ga0055531_100026833 233
166 3300003794 Ga0055531_10002832 Ga0055531_100028324 233
167 3300004625 Ga0055543_1000780 Ga0055543_100078010 233
168 3300005262 Ga0065165_1001186 Ga0065165_100118626 233
169 3300005288 Ga0065714_10018971 Ga0065714_100189712 233
170 3300005295 Ga0065707_10176353 Ga0065707_101763531 233
171 3300005327 Ga0070658_10115923 Ga0070658_101159233 233
172 3300005327 Ga0070658_10146194 Ga0070658_101461942 233
173 3300005327 Ga0070658_10589056 Ga0070658_105890561 233
174 3300005328 Ga0070676_10006298 Ga0070676_100062984 233
175 3300005329 Ga0070683_100040327 Ga0070683_1000403272 233
176 3300005329 Ga0070683_100065230 Ga0070683_1000652303 233
177 3300005330 Ga0070690_100062871 Ga0070690_1000628713 233
178 3300005331 Ga0070670_100040562 Ga0070670_1000405624 233
179 3300005331 Ga0070670_100042619 Ga0070670_1000426193 233
180 3300005331 Ga0070670_100512908 Ga0070670_1005129082 233
181 3300005333 Ga0070677_10067027 Ga0070677_100670272 233
182 3300005334 Ga0068869_100108125 Ga0068869_1001081253 233
183 3300005337 Ga0070682_100104091 Ga0070682_1001040913 233
184 3300005338 Ga0068868_100011018 Ga0068868_1000110187 233
185 3300005338 Ga0068868_100015797 Ga0068868_1000157973 233
186 3300005338 Ga0068868_100555220 Ga0068868_1005552201 233
187 3300005339 Ga0070660_100025973 Ga0070660_1000259734 233
188 3300005339 Ga0070660_100061955 Ga0070660_1000619552 233
189 3300005339 Ga0070660_100140920 Ga0070660_1001409201 233
190 3300005340 Ga0070689_100128466 Ga0070689_1001284662 233
191 3300005344 Ga0070661_100112646 Ga0070661_1001126462 233
192 3300005347 Ga0070668_100004185 Ga0070668_10000418512 233
193 3300005353 Ga0070669_100025707 Ga0070669_1000257074 233
194 3300005353 Ga0070669_100455366 Ga0070669_1004553661 233
195 3300005354 Ga0070675_100009133 Ga0070675_1000091334 233
196 3300005354 Ga0070675_100080463 Ga0070675_1000804632 233
197 3300005355 Ga0070671_100113696 Ga0070671_1001136961 233
198 3300005355 Ga0070671_100531978 Ga0070671_1005319782 233
199 3300005356 Ga0070674_100019585 Ga0070674_1000195854 233
200 3300005356 Ga0070674_100321063 Ga0070674_1003210632 233
201 3300005366 Ga0070659_100067511 Ga0070659_1000675112 233
202 3300005366 Ga0070659_100176025 Ga0070659_1001760252 233
203 3300005367 Ga0070667_100260497 Ga0070667_1002604972 233
204 3300005455 Ga0070663_100008867 Ga0070663_1000088677 233
205 3300005457 Ga0070662_100004805 Ga0070662_1000048053 233
206 3300005457 Ga0070662_100094281 Ga0070662_1000942813 233
207 3300005458 Ga0070681_10732200 Ga0070681_107322002 233
208 3300005459 Ga0068867_100058847 Ga0068867_1000588472 233
209 3300005459 Ga0068867_100408129 Ga0068867_1004081291 233
210 3300005467 Ga0070706_100000367 Ga0070706_10000036738 233
211 3300005471 Ga0070698_100139972 Ga0070698_1001399722 233
212 3300005530 Ga0070679_100004721 Ga0070679_1000047217 233
213 3300005530 Ga0070679_100134851 Ga0070679_1001348512 233
214 3300005535 Ga0070684_100131782 Ga0070684_1001317822 233
215 3300005539 Ga0068853_100063215 Ga0068853_1000632153 233
216 3300005539 Ga0068853_100095812 Ga0068853_1000958122 233
217 3300005539 Ga0068853_100315396 Ga0068853_1003153962 233
218 3300005543 Ga0070672_100021949 Ga0070672_1000219494 233
219 3300005543 Ga0070672_100100367 Ga0070672_1001003673 233
220 3300005544 Ga0070686_100334627 Ga0070686_1003346272 233
221 3300005547 Ga0070693_100052404 Ga0070693_1000524042 233
222 3300005547 Ga0070693_100101508 Ga0070693_1001015082 233
223 3300005548 Ga0070665_100501096 Ga0070665_1005010962 233
224 3300005548 Ga0070665_100625402 Ga0070665_1006254022 233
225 3300005563 Ga0068855_100024131 Ga0068855_1000241312 233
226 3300005563 Ga0068855_100189798 Ga0068855_1001897983 233
227 3300005563 Ga0068855_100255777 Ga0068855_1002557772 233
228 3300005564 Ga0070664_100057283 Ga0070664_1000572832 233
229 3300005564 Ga0070664_100263031 Ga0070664_1002630312 233
230 3300005577 Ga0068857_100087284 Ga0068857_1000872843 233
231 3300005577 Ga0068857_100268815 Ga0068857_1002688152 233
232 3300005578 Ga0068854_100206692 Ga0068854_1002066922 233
233 3300005578 Ga0068854_100206956 Ga0068854_1002069562 233
234 3300005614 Ga0068856_100021189 Ga0068856_1000211896 233
235 3300005614 Ga0068856_100083459 Ga0068856_1000834592 233
236 3300005614 Ga0068856_100392910 Ga0068856_1003929102 233
237 3300005614 Ga0068856_100583872 Ga0068856_1005838722 233
238 3300005615 Ga0070702_100184225 Ga0070702_1001842251 233
239 3300005615 Ga0070702_100577765 Ga0070702_1005777651 233
240 3300005616 Ga0068852_100032795 Ga0068852_1000327952 233
241 3300005616 Ga0068852_100324762 Ga0068852_1003247622 233
242 3300005616 Ga0068852_100331606 Ga0068852_1003316062 233
243 3300005616 Ga0068852_100364378 Ga0068852_1003643782 233
244 3300005618 Ga0068864_100009062 Ga0068864_1000090629 233
245 3300005618 Ga0068864_100011997 Ga0068864_1000119973 233
246 3300005618 Ga0068864_100017095 Ga0068864_1000170952 233
247 3300005718 Ga0068866_10073079 Ga0068866_100730792 233
248 3300005719 Ga0068861_100001656 Ga0068861_10000165613 233
249 3300005719 Ga0068861_100019378 Ga0068861_1000193787 233
250 3300005719 Ga0068861_100045356 Ga0068861_1000453562 233
251 3300005834 Ga0068851_10032935 Ga0068851_100329352 233
252 3300005834 Ga0068851_10089997 Ga0068851_100899972 233
253 3300005841 Ga0068863_100463299 Ga0068863_1004632992 233
254 3300005842 Ga0068858_100002470 Ga0068858_1000024703 233
255 3300005842 Ga0068858_100008215 Ga0068858_1000082152 233
256 3300005842 Ga0068858_100259239 Ga0068858_1002592392 233
257 3300005843 Ga0068860_100001365 Ga0068860_10000136518 233
258 3300005843 Ga0068860_100103887 Ga0068860_1001038873 233
259 3300005844 Ga0068862_100538947 Ga0068862_1005389472 233
260 3300005985 Ga0081539_10017388 Ga0081539_100173884 233
261 3300006038 Ga0075365_10013289 Ga0075365_100132893 233
262 3300006038 Ga0075365_10016664 Ga0075365_100166642 233
263 3300006038 Ga0075365_10087742 Ga0075365_100877422 233
264 3300006038 Ga0075365_10096082 Ga0075365_100960822 233
265 3300006042 Ga0075368_10040676 Ga0075368_100406762 233
266 3300006048 Ga0075363_100080638 Ga0075363_1000806382 233
267 3300006048 Ga0075363_100086368 Ga0075363_1000863682 233
268 3300006051 Ga0075364_10022311 Ga0075364_100223113 233
269 3300006051 Ga0075364_10049231 Ga0075364_100492312 233
270 3300006058 Ga0075432_10006527 Ga0075432_100065273 233
271 3300006058 Ga0075432_10016456 Ga0075432_100164562 233
272 3300006173 Ga0070716_100168069 Ga0070716_1001680692 233
273 3300006177 Ga0075362_10032249 Ga0075362_100322493 233
274 3300006177 Ga0075362_10080073 Ga0075362_100800732 233
275 3300006177 Ga0075362_10081004 Ga0075362_100810042 233
276 3300006177 Ga0075362_10160324 Ga0075362_101603242 233
277 3300006178 Ga0075367_10015436 Ga0075367_100154363 233
278 3300006178 Ga0075367_10018865 Ga0075367_100188653 233
279 3300006178 Ga0075367_10043243 Ga0075367_100432432 233
280 3300006178 Ga0075367_10094747 Ga0075367_100947472 233
281 3300006186 Ga0075369_10014645 Ga0075369_100146453 233
282 3300006195 Ga0075366_10007983 Ga0075366_100079832 233
283 3300006195 Ga0075366_10015005 Ga0075366_100150052 233
284 3300006195 Ga0075366_10041892 Ga0075366_100418922 233
285 3300006195 Ga0075366_10043723 Ga0075366_100437233 233
286 3300006195 Ga0075366_10091374 Ga0075366_100913742 233
287 3300006237 Ga0097621_100020754 Ga0097621_1000207545 233
288 3300006237 Ga0097621_100078702 Ga0097621_1000787023 233
289 3300006237 Ga0097621_100842200 Ga0097621_1008422001 233
290 3300006353 Ga0075370_10000151 Ga0075370_100001517 233
291 3300006353 Ga0075370_10002757 Ga0075370_100027579 233
292 3300006353 Ga0075370_10003232 Ga0075370_100032324 233
293 3300006353 Ga0075370_10003626 Ga0075370_100036268 233
294 3300006353 Ga0075370_10346862 Ga0075370_103468622 233
295 3300006358 Ga0068871_100054136 Ga0068871_1000541363 233
296 3300006844 Ga0075428_100406219 Ga0075428_1004062192 233
297 3300006846 Ga0075430_100221789 Ga0075430_1002217892 233
298 3300006847 Ga0075431_100155082 Ga0075431_1001550822 233
299 3300006880 Ga0075429_100008410 Ga0075429_1000084104 233
300 3300009093 Ga0105240_10009978 Ga0105240_1000997815 233
301 3300009093 Ga0105240_10016101 Ga0105240_100161017 233
302 3300009093 Ga0105240_10429932 Ga0105240_104299322 233
303 3300009093 Ga0105240_10682907 Ga0105240_106829072 233
304 3300009094 Ga0111539_10405288 Ga0111539_104052882 233
305 3300009098 Ga0105245_10114171 Ga0105245_101141713 233
306 3300009098 Ga0105245_10189923 Ga0105245_101899232 233
307 3300009098 Ga0105245_11182731 Ga0105245_111827312 233
308 3300009101 Ga0105247_10532069 Ga0105247_105320691 233
309 3300009147 Ga0114129_10058968 Ga0114129_100589685 233
310 3300009148 Ga0105243_10119990 Ga0105243_101199901 233
311 3300009148 Ga0105243_10140765 Ga0105243_101407651 233
312 3300009177 Ga0105248_10034909 Ga0105248_100349096 233
313 3300009177 Ga0105248_10071563 Ga0105248_100715631 233
314 3300009177 Ga0105248_10098068 Ga0105248_100980683 233
315 3300009545 Ga0105237_10008751 Ga0105237_100087511 233
316 3300009545 Ga0105237_10015804 Ga0105237_100158043 233
317 3300009545 Ga0105237_10723080 Ga0105237_107230802 233
318 3300009551 Ga0105238_10016417 Ga0105238_100164173 233
319 3300009551 Ga0105238_10086366 Ga0105238_100863663 233
320 3300009551 Ga0105238_10153244 Ga0105238_101532443 233
321 3300010375 Ga0105239_10001543 Ga0105239_100015435 233
322 3300010375 Ga0105239_10531343 Ga0105239_105313432 233
323 3300010375 Ga0105239_10640138 Ga0105239_106401382 233
324 3300010375 Ga0105239_11085710 Ga0105239_110857102 233
325 3300013100 Ga0157373_10054846 Ga0157373_100548462 233
326 3300013104 Ga0157370_10187911 Ga0157370_101879111 233
327 3300013105 Ga0157369_10092084 Ga0157369_100920843 233
328 3300013105 Ga0157369_10177351 Ga0157369_101773512 233
329 3300013297 Ga0157378_10340944 Ga0157378_103409442 233
330 3300013297 Ga0157378_10653201 Ga0157378_106532011 233
331 3300013306 Ga0163162_10036736 Ga0163162_100367362 233
332 3300013306 Ga0163162_10437512 Ga0163162_104375122 233
333 3300013307 Ga0157372_10206397 Ga0157372_102063973 233
334 3300013307 Ga0157372_10365023 Ga0157372_103650232 233
335 3300013308 Ga0157375_10157383 Ga0157375_101573833 233
336 3300013308 Ga0157375_10402262 Ga0157375_104022622 233
337 3300013308 Ga0157375_10578590 Ga0157375_105785902 233
338 3300014325 Ga0163163_10286818 Ga0163163_102868182 233
339 3300014325 Ga0163163_10327258 Ga0163163_103272582 233
340 3300014326 Ga0157380_10075509 Ga0157380_100755092 233
341 3300014497 Ga0182008_10185237 Ga0182008_101852371 233
342 3300014745 Ga0157377_10001260 Ga0157377_1000126010 233
343 3300014968 Ga0157379_10012658 Ga0157379_100126587 233
344 3300014968 Ga0157379_10196358 Ga0157379_101963582 233
345 3300014969 Ga0157376_10006493 Ga0157376_100064936 233
346 3300014969 Ga0157376_10035440 Ga0157376_100354402 233
347 3300014969 Ga0157376_11129019 Ga0157376_111290191 233
348 3300015262 Ga0182007_10061376 Ga0182007_100613762 233
349 3300015262 Ga0182007_10118646 Ga0182007_101186461 233
350 3300021384 Ga0213876_10043510 Ga0213876_100435102 233
351 3300021388 Ga0213875_10001372 Ga0213875_100013725 233
352 3300025206 Ga0209435_100002 Ga0209435_100002437 233
353 3300025230 Ga0209563_107053 Ga0209563_1070532 233
354 3300025231 Ga0207427_100989 Ga0207427_1009893 233
355 3300025242 Ga0209258_100025 Ga0209258_100025300 233
356 3300025245 Ga0207425_1003954 Ga0207425_10039544 233
357 3300025245 Ga0207425_1017783 Ga0207425_10177831 233
358 3300025246 Ga0209646_1000001 Ga0209646_10000012580 233
359 3300025250 Ga0209026_1000040 Ga0209026_1000040195 233
360 3300025253 Ga0209677_100832 Ga0209677_1008324 233
361 3300025254 Ga0209148_1002620 Ga0209148_10026203 233
362 3300025256 Ga0209759_1000001 Ga0209759_10000012211 233
363 3300025256 Ga0209759_1004903 Ga0209759_10049034 233
364 3300025256 Ga0209759_1007462 Ga0209759_10074622 233
365 3300025258 Ga0209129_1011540 Ga0209129_10115402 233
366 3300025263 Ga0209565_1000026 Ga0209565_1000026224 233
367 3300025263 Ga0209565_1001255 Ga0209565_10012556 233
368 3300025263 Ga0209565_1005280 Ga0209565_10052802 233
369 3300025263 Ga0209565_1014193 Ga0209565_10141932 233
370 3300025271 Ga0207666_1001927 Ga0207666_10019273 233
371 3300025272 Ga0209455_1000089 Ga0209455_1000089203 233
372 3300025273 Ga0209673_1000009 Ga0209673_1000009231 233
373 3300025273 Ga0209673_1000012 Ga0209673_1000012132 233
374 3300025273 Ga0209673_1051404 Ga0209673_10514042 233
375 3300025284 Ga0209130_1000183 Ga0209130_100018313 233
376 3300025284 Ga0209130_1000644 Ga0209130_100064410 233
377 3300025291 Ga0209675_1000308 Ga0209675_100030824 233
378 3300025291 Ga0209675_1006996 Ga0209675_10069963 233
379 3300025291 Ga0209675_1012555 Ga0209675_10125552 233
380 3300025291 Ga0209675_1017411 Ga0209675_10174112 233
381 3300025292 Ga0209676_1000013 Ga0209676_100001310 233
382 3300025292 Ga0209676_1003161 Ga0209676_10031618 233
383 3300025294 Ga0209025_1005365 Ga0209025_10053656 233
384 3300025294 Ga0209025_1006206 Ga0209025_10062067 233
385 3300025294 Ga0209025_1031654 Ga0209025_10316542 233
386 3300025295 Ga0209564_1001304 Ga0209564_100130415 233
387 3300025295 Ga0209564_1004427 Ga0209564_10044273 233
388 3300025295 Ga0209564_1004860 Ga0209564_10048601 233
389 3300025297 Ga0209758_1000304 Ga0209758_100030418 233
390 3300025297 Ga0209758_1007970 Ga0209758_10079706 233
391 3300025298 Ga0209050_1000008 Ga0209050_100000810 233
392 3300025298 Ga0209050_1000266 Ga0209050_100026636 233
393 3300025298 Ga0209050_1001933 Ga0209050_100193314 233
394 3300025298 Ga0209050_1006110 Ga0209050_10061105 233
395 3300025298 Ga0209050_1025810 Ga0209050_10258102 233
396 3300025299 Ga0209256_1000003 Ga0209256_1000003386 233
397 3300025299 Ga0209256_1000049 Ga0209256_1000049207 233
398 3300025299 Ga0209256_1001148 Ga0209256_100114812 233
399 3300025302 Ga0207426_1000062 Ga0207426_1000062121 233
400 3300025302 Ga0207426_1003042 Ga0207426_10030423 233
401 3300025303 Ga0209051_1000005 Ga0209051_100000510 233
402 3300025303 Ga0209051_1000025 Ga0209051_1000025326 233
403 3300025303 Ga0209051_1009298 Ga0209051_10092984 233
404 3300025303 Ga0209051_1042094 Ga0209051_10420942 233
405 3300025304 Ga0209257_1000039 Ga0209257_1000039282 233
406 3300025304 Ga0209257_1000048 Ga0209257_100004810 233
407 3300025304 Ga0209257_1012197 Ga0209257_10121974 233
408 3300025315 Ga0207697_10098276 Ga0207697_100982762 233
409 3300025321 Ga0207656_10017653 Ga0207656_100176533 233
410 3300025321 Ga0207656_10322762 Ga0207656_103227621 233
411 3300025893 Ga0207682_10024170 Ga0207682_100241703 233
412 3300025901 Ga0207688_10086801 Ga0207688_100868012 233
413 3300025901 Ga0207688_10120969 Ga0207688_101209692 233
414 3300025903 Ga0207680_10097179 Ga0207680_100971792 233
415 3300025903 Ga0207680_10100226 Ga0207680_101002262 233
416 3300025903 Ga0207680_10131443 Ga0207680_101314432 233
417 3300025906 Ga0207699_10000129 Ga0207699_1000012917 233
418 3300025907 Ga0207645_10008065 Ga0207645_100080652 233
419 3300025907 Ga0207645_10022328 Ga0207645_100223283 233
420 3300025907 Ga0207645_10023553 Ga0207645_100235532 233
421 3300025907 Ga0207645_10111785 Ga0207645_101117852 233
422 3300025909 Ga0207705_10145984 Ga0207705_101459842 233
423 3300025910 Ga0207684_10005313 Ga0207684_100053137 233
424 3300025911 Ga0207654_10030295 Ga0207654_100302953 233
425 3300025911 Ga0207654_10128404 Ga0207654_101284042 233
426 3300025912 Ga0207707_10178613 Ga0207707_101786133 233
427 3300025912 Ga0207707_10683737 Ga0207707_106837371 233
428 3300025913 Ga0207695_10014227 Ga0207695_1001422710 233
429 3300025913 Ga0207695_10065783 Ga0207695_100657833 233
430 3300025913 Ga0207695_10197632 Ga0207695_101976322 233
431 3300025914 Ga0207671_10010930 Ga0207671_100109306 233
432 3300025914 Ga0207671_10022450 Ga0207671_100224503 233
433 3300025914 Ga0207671_10088141 Ga0207671_100881412 233
434 3300025918 Ga0207662_10021765 Ga0207662_100217652 233
435 3300025919 Ga0207657_10010934 Ga0207657_100109347 233
436 3300025919 Ga0207657_10074502 Ga0207657_100745022 233
437 3300025919 Ga0207657_10112162 Ga0207657_101121622 233
438 3300025919 Ga0207657_10188518 Ga0207657_101885182 233
439 3300025921 Ga0207652_10022385 Ga0207652_100223852 233
440 3300025921 Ga0207652_10049913 Ga0207652_100499132 233
441 3300025923 Ga0207681_10023814 Ga0207681_100238142 233
442 3300025923 Ga0207681_10191883 Ga0207681_101918832 233
443 3300025923 Ga0207681_10564861 Ga0207681_105648612 233
444 3300025924 Ga0207694_10061758 Ga0207694_100617582 233
445 3300025924 Ga0207694_10135696 Ga0207694_101356962 233
446 3300025924 Ga0207694_10183779 Ga0207694_101837792 233
447 3300025924 Ga0207694_10428311 Ga0207694_104283112 233
448 3300025924 Ga0207694_10732629 Ga0207694_107326292 233
449 3300025925 Ga0207650_10023362 Ga0207650_100233622 233
450 3300025925 Ga0207650_10060524 Ga0207650_100605242 233
451 3300025925 Ga0207650_10101250 Ga0207650_101012502 233
452 3300025926 Ga0207659_10022700 Ga0207659_100227002 233
453 3300025927 Ga0207687_10024102 Ga0207687_100241024 233
454 3300025927 Ga0207687_10033528 Ga0207687_100335282 233
455 3300025927 Ga0207687_10358276 Ga0207687_103582762 233
456 3300025927 Ga0207687_10460726 Ga0207687_104607262 233
457 3300025931 Ga0207644_10423898 Ga0207644_104238982 233
458 3300025932 Ga0207690_10126632 Ga0207690_101266322 233
459 3300025932 Ga0207690_10288059 Ga0207690_102880592 233
460 3300025932 Ga0207690_10439131 Ga0207690_104391311 233
461 3300025933 Ga0207706_10001995 Ga0207706_100019957 233
462 3300025933 Ga0207706_10119541 Ga0207706_101195412 233
463 3300025933 Ga0207706_10170119 Ga0207706_101701192 233
464 3300025933 Ga0207706_10509612 Ga0207706_105096121 233
465 3300025935 Ga0207709_10050782 Ga0207709_100507823 233
466 3300025935 Ga0207709_10133921 Ga0207709_101339212 233
467 3300025936 Ga0207670_10145065 Ga0207670_101450652 233
468 3300025937 Ga0207669_10137672 Ga0207669_101376722 233
469 3300025937 Ga0207669_10684543 Ga0207669_106845432 233
470 3300025938 Ga0207704_10111724 Ga0207704_101117242 233
471 3300025940 Ga0207691_10004985 Ga0207691_100049852 233
472 3300025940 Ga0207691_10027031 Ga0207691_100270314 233
473 3300025941 Ga0207711_10009070 Ga0207711_100090708 233
474 3300025941 Ga0207711_10046878 Ga0207711_100468783 233
475 3300025941 Ga0207711_10060141 Ga0207711_100601412 233
476 3300025941 Ga0207711_10463249 Ga0207711_104632492 233
477 3300025942 Ga0207689_10000996 Ga0207689_100009967 233
478 3300025942 Ga0207689_10011569 Ga0207689_100115694 233
479 3300025942 Ga0207689_10198912 Ga0207689_101989122 233
480 3300025944 Ga0207661_10043857 Ga0207661_100438573 233
481 3300025945 Ga0207679_10015982 Ga0207679_100159822 233
482 3300025945 Ga0207679_10122608 Ga0207679_101226082 233
483 3300025949 Ga0207667_10021835 Ga0207667_100218353 233
484 3300025949 Ga0207667_10453804 Ga0207667_104538042 233
485 3300025960 Ga0207651_10030894 Ga0207651_100308945 233
486 3300025960 Ga0207651_10134764 Ga0207651_101347642 233
487 3300025961 Ga0207712_10233178 Ga0207712_102331782 233
488 3300025972 Ga0207668_10090770 Ga0207668_100907703 233
489 3300025981 Ga0207640_10221288 Ga0207640_102212882 233
490 3300025981 Ga0207640_10345284 Ga0207640_103452841 233
491 3300025986 Ga0207658_10012023 Ga0207658_100120232 233
492 3300025986 Ga0207658_10073606 Ga0207658_100736062 233
493 3300026023 Ga0207677_10000853 Ga0207677_100008539 233
494 3300026023 Ga0207677_10057976 Ga0207677_100579763 233
495 3300026035 Ga0207703_10003620 Ga0207703_100036202 233
496 3300026035 Ga0207703_10009640 Ga0207703_100096408 233
497 3300026035 Ga0207703_10044880 Ga0207703_100448804 233
498 3300026041 Ga0207639_10272831 Ga0207639_102728312 233
499 3300026041 Ga0207639_10273608 Ga0207639_102736082 233
500 3300026067 Ga0207678_10062737 Ga0207678_100627373 233
501 3300026067 Ga0207678_10103777 Ga0207678_101037772 233
502 3300026075 Ga0207708_10019046 Ga0207708_100190464 233
503 3300026078 Ga0207702_10014759 Ga0207702_100147592 233
504 3300026078 Ga0207702_10087741 Ga0207702_100877413 233
505 3300026088 Ga0207641_10139494 Ga0207641_101394942 233
506 3300026089 Ga0207648_10129602 Ga0207648_101296022 233
507 3300026089 Ga0207648_10408558 Ga0207648_104085582 233
508 3300026089 Ga0207648_10691485 Ga0207648_106914851 233
509 3300026089 Ga0207648_10949846 Ga0207648_109498461 233
510 3300026095 Ga0207676_10003408 Ga0207676_100034085 233
511 3300026095 Ga0207676_10028197 Ga0207676_100281972 233
512 3300026095 Ga0207676_10029223 Ga0207676_100292232 233
513 3300026116 Ga0207674_10022527 Ga0207674_100225275 233
514 3300026116 Ga0207674_10257168 Ga0207674_102571682 233
515 3300026116 Ga0207674_10643093 Ga0207674_106430931 233
516 3300026118 Ga0207675_100002360 Ga0207675_1000023602 233
517 3300026118 Ga0207675_100090758 Ga0207675_1000907582 233
518 3300026118 Ga0207675_100262784 Ga0207675_1002627842 233
519 3300026121 Ga0207683_10009600 Ga0207683_1000960010 233
520 3300026142 Ga0207698_10020822 Ga0207698_100208223 233
521 3300026142 Ga0207698_10027402 Ga0207698_100274025 233
522 3300026142 Ga0207698_10065102 Ga0207698_100651021 233
523 3300026142 Ga0207698_11071726 Ga0207698_110717262 233
524 3300026142 Ga0207698_11078538 Ga0207698_110785382 233
525 3300027552 Ga0209982_1021798 Ga0209982_10217982 233
526 3300027717 Ga0209998_10015322 Ga0209998_100153222 233
527 3300027866 Ga0209813_10063458 Ga0209813_100634582 233
528 3300028379 Ga0268266_10117960 Ga0268266_101179603 233
529 3300028380 Ga0268265_10792347 Ga0268265_107923472 233
530 3300028380 Ga0268265_10891596 Ga0268265_108915961 233
531 3300028381 Ga0268264_10011726 Ga0268264_100117268 233
532 3300028381 Ga0268264_10068442 Ga0268264_100684421 233
533 3300028666 Ga0265336_10000029 Ga0265336_10000029181 233
534 3300028794 Ga0307515_10000123 Ga0307515_10000123123 233
535 3300028794 Ga0307515_10001456 Ga0307515_100014566 233
536 3300028794 Ga0307515_10002728 Ga0307515_100027289 233
537 3300028794 Ga0307515_10009581 Ga0307515_100095819 233
538 3300028794 Ga0307515_10175757 Ga0307515_101757572 233
539 3300028794 Ga0307515_10424713 Ga0307515_104247132 233
540 3300029957 Ga0265324_10000326 Ga0265324_100003268 233
541 3300030521 Ga0307511_10000092 Ga0307511_1000009269 233
542 3300030521 Ga0307511_10059059 Ga0307511_100590593 233
543 3300030522 Ga0307512_10090121 Ga0307512_100901212 233
544 3300030522 Ga0307512_10114850 Ga0307512_101148502 233
545 3300031235 Ga0265330_10037955 Ga0265330_100379552 233
546 3300031241 Ga0265325_10004429 Ga0265325_100044292 233
547 3300031242 Ga0265329_10060855 Ga0265329_100608552 233
548 3300031251 Ga0265327_10000049 Ga0265327_1000004912 233
549 3300031344 Ga0265316_10038848 Ga0265316_100388484 233
550 3300031344 Ga0265316_10054144 Ga0265316_100541442 233
551 3300031456 Ga0307513_10000057 Ga0307513_1000005789 233
552 3300031456 Ga0307513_10041778 Ga0307513_100417786 233
553 3300031456 Ga0307513_10240657 Ga0307513_102406572 233
554 3300031507 Ga0307509_10069245 Ga0307509_100692454 233
555 3300031548 Ga0307408_100062798 Ga0307408_1000627982 233
556 3300031548 Ga0307408_100148179 Ga0307408_1001481792 233
557 3300031595 Ga0265313_10142367 Ga0265313_101423672 233
558 3300031616 Ga0307508_10008033 Ga0307508_100080334 233
559 3300031616 Ga0307508_10298811 Ga0307508_102988112 233
560 3300031616 Ga0307508_10363596 Ga0307508_103635961 233
561 3300031649 Ga0307514_10008631 Ga0307514_100086313 233
562 3300031711 Ga0265314_10002601 Ga0265314_100026013 233
563 3300031711 Ga0265314_10023252 Ga0265314_100232522 233
564 3300031711 Ga0265314_10313544 Ga0265314_103135442 233
565 3300031730 Ga0307516_10000017 Ga0307516_10000017139 233
566 3300031730 Ga0307516_10016806 Ga0307516_100168065 233
567 3300031730 Ga0307516_10176861 Ga0307516_101768612 233
568 3300031730 Ga0307516_10400243 Ga0307516_104002432 233
569 3300031901 Ga0307406_10537104 Ga0307406_105371041 233
570 3300031911 Ga0307412_10264747 Ga0307412_102647472 233
571 3300031911 Ga0307412_10369013 Ga0307412_103690132 233
572 3300033179 Ga0307507_10040381 Ga0307507_100403814 233
573 3300034820 Ga0373959_0053251 Ga0373959_0053251_130_834 233
574 3300035083 Ga0373926_0030127 Ga0373926_0030127_518_1231 233
575 3300035089 Ga0373944_0007686 Ga0373944_0007686_1529_2242 233
576 3300035092 Ga0373952_0020702 Ga0373952_0020702_417_1121 233
577 3300035111 Ga0373923_0016948 Ga0373923_0016948_1459_2163 233
578 3300035113 Ga0373936_0042331 Ga0373936_0042331_1095_1808 233
579 3300035113 Ga0373936_0189988 Ga0373936_0189988_28_732 233
580 3300035116 Ga0373945_0000417 Ga0373945_0000417_9462_10175 233
581 3300035116 Ga0373945_0062883 Ga0373945_0062883_286_990 233
582 3300035118 Ga0373954_0089060 Ga0373954_0089060_229_933 233
583 3300035170 Ga0373943_0000245 Ga0373943_0000245_4241_4954 233
584 3300035691 Ga0373931_0011040 Ga0373931_0011040_2916_3620 233
585 3300035692 Ga0373935_0001774 Ga0373935_0001774_3794_4507 233
586 3300035695 Ga0373927_0000215 Ga0373927_0000215_19946_20659 233
587 3300035725 Ga0373947_0000242 Ga0373947_0000242_26169_26882 233
588 3300036401 Ga0373937_0196091 Ga0373937_0196091_636_1340 233
589 3300037068 Ga0373925_0000700 Ga0373925_0000700_14479_15192 233
590 3300037068 Ga0373925_0177241 Ga0373925_0177241_664_1368 233
591 3300037312 Ga0395899_0002984 Ga0395899_0002984_140_844 233
592 3300037312 Ga0395899_0004579 Ga0395899_0004579_8450_9157 233
593 3300037418 Ga0395900_0006516 Ga0395900_0006516_6260_6964 233
594 3300037418 Ga0395900_0010859 Ga0395900_0010859_5410_6117 233
595 3300037418 Ga0395900_0020030 Ga0395900_0020030_3780_4487 233
596 3300037418 Ga0395900_0044597 Ga0395900_0044597_3581_4288 233
597 3300037466 Ga0395898_0002933 Ga0395898_0002933_2779_3486 233
598 3300037466 Ga0395898_0010476 Ga0395898_0010476_2728_3432 233
599 3300037466 Ga0395898_0012459 Ga0395898_0012459_2818_3525 233
600 3300037471 Ga0395905_0002575 Ga0395905_0002575_17069_17779 233
601 3300037471 Ga0395905_0004104 Ga0395905_0004104_1182_1886 233
602 3300037471 Ga0395905_0005907 Ga0395905_0005907_8984_9787 233
603 3300037471 Ga0395905_0006007 Ga0395905_0006007_7357_8064 233
604 3300037471 Ga0395905_0007574 Ga0395905_0007574_2484_3191 233
605 3300037471 Ga0395905_0009071 Ga0395905_0009071_2006_2713 233
606 3300037471 Ga0395905_0023096 Ga0395905_0023096_1570_2274 233
607 3300037471 Ga0395905_0104621 Ga0395905_0104621_1158_1865 233
608 3300037471 Ga0395905_0105356 Ga0395905_0105356_1629_2333 233
609 3300037471 Ga0395905_0112958 Ga0395905_0112958_914_1621 233
610 3300037471 Ga0395905_0113088 Ga0395905_0113088_941_1648 233
611 3300037471 Ga0395905_0139673 Ga0395905_0139673_147_854 233
612 3300037471 Ga0395905_0190377 Ga0395905_0190377_680_1387 233
613 3300037853 Ga0436364_0252687 Ga0436364_0252687_77_781 233
614 3300038443 Ga0395901_0003137 Ga0395901_0003137_5864_6568 233
615 3300038443 Ga0395901_0038125 Ga0395901_0038125_3821_4528 233
616 3300038443 Ga0395901_0144544 Ga0395901_0144544_264_971 233
617 3300038443 Ga0395901_0250782 Ga0395901_0250782_952_1659 233
618 3300038443 Ga0395901_0424467 Ga0395901_0424467_312_1016 233
619 3300038443 Ga0395901_0679900 Ga0395901_0679900_86_793 233
620 3300038705 Ga0237819_05419 Ga0237819_05419_785_1519 233
621 3300039437 Ga0436365_1382513 Ga0436365_1382513_1744_2448 233
622 3300039447 Ga0436361_0010685 Ga0436361_0010685_325_1047 233
623 3300039450 Ga0436363_0491254 Ga0436363_0491254_183_887 233
624 3300039450 Ga0436363_1157161 Ga0436363_1157161_4265_4969 233
625 3300041408 Ga0439453_0029934 Ga0439453_0029934_293_1003 233
626 3300041413 Ga0439465_0126018 Ga0439465_0126018_74_778 233
627 3300041443 Ga0451789_0890581 Ga0451789_0890581_337_1041 233
628 3300041458 Ga0451798_0006129 Ga0451798_0006129_123_827 233
629 3300041459 Ga0451800_1231896 Ga0451800_1231896_1224_1928 233
630 3300041997 Ga0439431_0006681 Ga0439431_0006681_239_946 233
631 3300041999 Ga0439433_0009143 Ga0439433_0009143_499_1203 233
632 3300042007 Ga0439449_0012132 Ga0439449_0012132_2058_2765 233
633 3300042008 Ga0439450_016327 Ga0439450_016327_348_1055 233
634 3300042009 Ga0439451_013034 Ga0439451_013034_74_796 233
635 3300042013 Ga0439456_020582 Ga0439456_020582_499_1221 233
636 3300042014 Ga0439457_057648 Ga0439457_057648_128_838 233
637 3300042015 Ga0439462_0009145 Ga0439462_0009145_1113_1820 233
638 3300042134 Ga0450898_009171 Ga0450898_009171_615_1325 233
639 3300042138 Ga0450903_002112 Ga0450903_002112_455_1165 233
640 3300042142 Ga0450905_010419 Ga0450905_010419_447_1157 233
641 3300042156 Ga0439446_0012973 Ga0439446_0012973_1496_2203 233
642 3300042156 Ga0439446_0019921 Ga0439446_0019921_1157_1876 233
643 3300042435 Ga0439434_0047294 Ga0439434_0047294_173_880 233
644 3300042876 Ga0451577_0001028 Ga0451577_0001028_34251_34955 233
645 3300042876 Ga0451577_0027391 Ga0451577_0027391_1562_2266 233
646 3300042876 Ga0451577_0178976 Ga0451577_0178976_1010_1720 233
647 3300044656 Ga0466969_0000009 Ga0466969_0000009_6799_7503 233
648 3300044656 Ga0466969_0013911 Ga0466969_0013911_2213_2917 233
649 3300044656 Ga0466969_0032818 Ga0466969_0032818_1615_2322 233
650 3300044656 Ga0466969_0036236 Ga0466969_0036236_1450_2157 233
651 3300044673 Ga0453683_0012323 Ga0453683_0012323_1271_1978 233
652 3300044673 Ga0453683_0068463 Ga0453683_0068463_1255_1965 233
653 3300044683 Ga0466965_0003719 Ga0466965_0003719_5022_5726 233
654 3300044684 Ga0466966_0000818 Ga0466966_0000818_5540_6244 233
655 3300044684 Ga0466966_0021372 Ga0466966_0021372_2125_2832 233
656 3300044693 Ga0466961_0038195 Ga0466961_0038195_1859_2563 233
657 3300044693 Ga0466961_0111823 Ga0466961_0111823_68_775 233
658 3300044693 Ga0466961_0168319 Ga0466961_0168319_573_1280 233
659 3300044693 Ga0466961_0217074 Ga0466961_0217074_206_910 233
660 3300044694 Ga0466963_0050472 Ga0466963_0050472_1507_2211 233
661 3300044694 Ga0466963_0121342 Ga0466963_0121342_1045_1749 233
662 3300044694 Ga0466963_0410234 Ga0466963_0410234_205_909 233
663 3300044706 Ga0466964_0004255 Ga0466964_0004255_2995_3699 233
664 3300044712 Ga0453684_0000280 Ga0453684_0000280_30767_31477 233
665 3300044712 Ga0453684_0030004 Ga0453684_0030004_2457_3167 233
666 3300044712 Ga0453684_0492545 Ga0453684_0492545_140_844 233
667 3300044712 Ga0453684_0501604 Ga0453684_0501604_16_720 233
668 3300044719 Ga0466971_0009634 Ga0466971_0009634_1768_2472 233
669 3300044735 Ga0466968_0024344 Ga0466968_0024344_1194_1901 233
670 3300044765 Ga0466970_0166066 Ga0466970_0166066_360_1070 233
671 3300044842 Ga0466957_0003611 Ga0466957_0003611_6055_6759 233
672 3300044842 Ga0466957_0076160 Ga0466957_0076160_274_978 233
673 3300044901 Ga0466960_0093818 Ga0466960_0093818_83_790 233
674 3300045049 Ga0466959_0005772 Ga0466959_0005772_1091_1795 233
675 3300045049 Ga0466959_0009501 Ga0466959_0009501_5456_6172 233
676 3300045049 Ga0466959_0023548 Ga0466959_0023548_1507_2211 233
677 3300045049 Ga0466959_0041525 Ga0466959_0041525_1584_2294 233
678 3300045049 Ga0466959_0173392 Ga0466959_0173392_530_1255 233
679 3300045051 Ga0451576_0003797 Ga0451576_0003797_10627_11337 233
680 3300045051 Ga0451576_0004140 Ga0451576_0004140_12575_13282 233
681 3300045051 Ga0451576_0027493 Ga0451576_0027493_4029_4733 233
682 3300045051 Ga0451576_0309203 Ga0451576_0309203_170_880 233
683 3300045051 Ga0451576_0343726 Ga0451576_0343726_636_1340 233
684 3300045051 Ga0451576_0406597 Ga0451576_0406597_109_813 233
685 3300045051 Ga0451576_0543329 Ga0451576_0543329_97_807 233
686 3300045836 Ga0466958_0032521 Ga0466958_0032521_2126_2830 233
687 3300045836 Ga0466958_0098498 Ga0466958_0098498_517_1221 233
688 3300045976 Ga0466967_0021050 Ga0466967_0021050_3791_4495 233
689 3300045976 Ga0466967_0312674 Ga0466967_0312674_34_738 233
690 3300046454 Ga0495592_0350457 Ga0495592_0350457_176_880 233
691 3300046455 Ga0495603_0034923 Ga0495603_0034923_1877_2581 233
692 3300046457 Ga0495590_0000939 Ga0495590_0000939_62_865 233
693 3300046457 Ga0495590_0015656 Ga0495590_0015656_1685_2392 233
694 3300046460 Ga0495638_0000224 Ga0495638_0000224_35294_36028 233
695 3300046460 Ga0495638_0002585 Ga0495638_0002585_11813_12535 233
696 3300046472 Ga0495580_0000118 Ga0495580_0000118_19936_20640 233
697 3300046472 Ga0495580_0003172 Ga0495580_0003172_10577_11281 233
698 3300046472 Ga0495580_0404365 Ga0495580_0404365_204_908 233
699 3300046473 Ga0495582_0226193 Ga0495582_0226193_340_1044 233
700 3300046499 Ga0495594_0026445 Ga0495594_0026445_480_1184 233
701 3300046506 Ga0495583_0000071 Ga0495583_0000071_41190_41894 233
702 3300046506 Ga0495583_0084614 Ga0495583_0084614_552_1259 233
703 3300046507 Ga0495606_0000560 Ga0495606_0000560_31456_32160 233
704 3300046515 Ga0495620_0050297 Ga0495620_0050297_746_1450 233
705 3300046515 Ga0495620_0052557 Ga0495620_0052557_225_929 233
706 3300046517 Ga0495630_0001053 Ga0495630_0001053_5538_6251 233
707 3300046519 Ga0495632_0011670 Ga0495632_0011670_2487_3194 233
708 3300046519 Ga0495632_0035966 Ga0495632_0035966_150_854 233
709 3300046519 Ga0495632_0050326 Ga0495632_0050326_259_981 233
710 3300046519 Ga0495632_0051520 Ga0495632_0051520_274_984 233
711 3300046525 Ga0495663_0014896 Ga0495663_0014896_117_821 233
712 3300046526 Ga0495666_0174275 Ga0495666_0174275_105_818 233
713 3300046528 Ga0495642_0203357 Ga0495642_0203357_66_770 233
714 3300046530 Ga0495654_0090777 Ga0495654_0090777_577_1281 233
715 3300046531 Ga0495665_0007571 Ga0495665_0007571_1418_2122 233
716 3300046531 Ga0495665_0092298 Ga0495665_0092298_287_1000 233
717 3300046533 Ga0495640_0011409 Ga0495640_0011409_5151_5864 233
718 3300046535 Ga0495586_0219923 Ga0495586_0219923_344_1048 233
719 3300046542 Ga0495597_0012332 Ga0495597_0012332_1512_2216 233
720 3300046615 Ga0495656_0021763 Ga0495656_0021763_460_1164 233
721 3300046615 Ga0495656_0022579 Ga0495656_0022579_1355_2059 233
722 3300046642 Ga0495634_0016833 Ga0495634_0016833_3801_4514 233
723 3300046660 Ga0495625_0000990 Ga0495625_0000990_31153_31857 233
724 3300046660 Ga0495625_0013676 Ga0495625_0013676_1980_2684 233
725 3300046663 Ga0495635_0012723 Ga0495635_0012723_3558_4271 233
726 3300046663 Ga0495635_0146342 Ga0495635_0146342_218_922 233
727 3300046664 Ga0495659_0104335 Ga0495659_0104335_154_858 233
728 3300046674 Ga0495588_0084029 Ga0495588_0084029_117_827 233
729 3300046683 Ga0495658_0030201 Ga0495658_0030201_1628_2332 233
730 3300046689 Ga0495613_0029473 Ga0495613_0029473_2119_2832 233
731 3300046690 Ga0495624_0003524 Ga0495624_0003524_1417_2130 233
732 3300046691 Ga0495670_0101905 Ga0495670_0101905_632_1336 233
733 3300046692 Ga0495671_0042279 Ga0495671_0042279_886_1596 233
734 3300046694 Ga0495649_0000144 Ga0495649_0000144_33309_34013 233
735 3300046694 Ga0495649_0001813 Ga0495649_0001813_12878_13585 233
736 3300046794 Ga0495589_0022802 Ga0495589_0022802_1760_2464 233
737 3300046809 Ga0495600_0103555 Ga0495600_0103555_181_885 233
738 3300046810 Ga0495660_0041610 Ga0495660_0041610_356_1063 233
739 3300047315 Ga0495581_0012636 Ga0495581_0012636_658_1371 233
740 3300047317 Ga0495604_0002984 Ga0495604_0002984_1285_1989 233
741 3300047319 Ga0495674_0050007 Ga0495674_0050007_1293_2006 233
742 3300047319 Ga0495674_0463555 Ga0495674_0463555_265_969 233
743 3300047321 Ga0495676_0053068 Ga0495676_0053068_1120_1833 233
744 3300047443 Ga0495687_000454 Ga0495687_000454_45322_46026 233
745 3300047443 Ga0495687_007504 Ga0495687_007504_2539_3246 233
746 3300047447 Ga0495685_019184 Ga0495685_019184_474_1178 233
747 3300047469 Ga0495673_0070024 Ga0495673_0070024_103_825 233
748 3300047469 Ga0495673_0091723 Ga0495673_0091723_204_908 233
749 3300047470 Ga0495681_0164801 Ga0495681_0164801_79_783 233
750 3300047471 Ga0495684_0004024 Ga0495684_0004024_5314_6027 233
751 3300047472 Ga0495686_0001272 Ga0495686_0001272_13816_14520 233
752 3300047673 Ga0495593_0024039 Ga0495593_0024039_135_848 233
753 3300048089 Ga0495614_0160986 Ga0495614_0160986_240_953 233
754 3300048091 Ga0495626_0102388 Ga0495626_0102388_191_895 233
755 3300048904 Ga0496101_0099560 Ga0496101_0099560_663_1367 233
756 3300048905 Ga0496102_0001271 Ga0496102_0001271_17395_18099 233
757 3300048905 Ga0496102_0027990 Ga0496102_0027990_1879_2583 233
758 3300048906 Ga0496103_0095447 Ga0496103_0095447_580_1284 233
759 3300048907 Ga0496104_0037358 Ga0496104_0037358_3319_4023 233
760 3300048908 Ga0496105_0307559 Ga0496105_0307559_239_943 233
761 3300048909 Ga0496106_0308786 Ga0496106_0308786_413_1129 233
762 3300048909 Ga0496106_0411920 Ga0496106_0411920_285_989 233
763 3300048910 Ga0496107_0059744 Ga0496107_0059744_1513_2217 233
764 3300048910 Ga0496107_0468999 Ga0496107_0468999_56_760 233
765 3300048911 Ga0496108_0154503 Ga0496108_0154503_1056_1760 233
766 3300048911 Ga0496108_0456468 Ga0496108_0456468_105_809 233
767 3300048911 Ga0496108_0475369 Ga0496108_0475369_42_746 233
768 3300048912 Ga0496109_0122282 Ga0496109_0122282_1705_2409 233
769 3300048912 Ga0496109_0359833 Ga0496109_0359833_325_1029 233
770 3300048912 Ga0496109_0382153 Ga0496109_0382153_447_1151 233
771 3300048913 Ga0496110_0030521 Ga0496110_0030521_2383_3087 233
772 3300048914 Ga0496111_0544345 Ga0496111_0544345_67_771 233
773 3300048916 Ga0496113_0075019 Ga0496113_0075019_1711_2415 233
774 3300048917 Ga0496114_0019358 Ga0496114_0019358_238_942 233
775 3300048917 Ga0496114_0047036 Ga0496114_0047036_831_1535 233
776 3300048917 Ga0496114_0155840 Ga0496114_0155840_727_1431 233
777 3300048918 Ga0496115_0050330 Ga0496115_0050330_2506_3210 233
778 3300048924 Ga0496121_0002728 Ga0496121_0002728_8828_9562 233
779 3300048925 Ga0496122_0134255 Ga0496122_0134255_693_1427 233
780 3300048926 Ga0496123_0235711 Ga0496123_0235711_94_828 233
781 3300048928 Ga0496125_0297340 Ga0496125_0297340_120_854 233
782 3300048929 Ga0496126_0137269 Ga0496126_0137269_420_1154 233
783 3300048929 Ga0496126_0229384 Ga0496126_0229384_397_1131 233
784 3300049571 Ga0501034_0000106 Ga0501034_0000106_48973_49677 233
785 3300049571 Ga0501034_0035657 Ga0501034_0035657_2909_3613 233
786 3300049574 Ga0501038_0115715 Ga0501038_0115715_721_1425 233
787 3300049579 Ga0501043_0050928 Ga0501043_0050928_1232_1936 233
788 3300049580 Ga0501046_0007148 Ga0501046_0007148_7622_8326 233
789 3300049580 Ga0501046_0374205 Ga0501046_0374205_37_741 233
790 3300049581 Ga0501047_0028441 Ga0501047_0028441_3784_4488 233
791 3300049649 Ga0501198_000023 Ga0501198_000023_45074_45778 233
792 3300049662 Ga0501222_000031 Ga0501222_000031_23339_24043 233
793 3300049742 Ga0501080_0064774 Ga0501080_0064774_1422_2126 233
794 3300049822 Ga0501035_0104532 Ga0501035_0104532_862_1566 233
795 3300049822 Ga0501035_0120588 Ga0501035_0120588_594_1304 233
796 3300049823 Ga0501044_0013961 Ga0501044_0013961_6303_7007 233
797 3300049823 Ga0501044_0148737 Ga0501044_0148737_859_1563 233
798 3300050490 nmdc:mga03n38_33245_c1 nmdc:mga03n38_33245_c1_296_1000 233
799 3300050490 nmdc:mga03n38_348948_c1 nmdc:mga03n38_348948_c1_59_763 233
800 3300050491 nmdc:mga00v17_78683_c1 nmdc:mga00v17_78683_c1_1151_1855 233
801 3300050492 nmdc:mga0yw44_339383_c1 nmdc:mga0yw44_339383_c1_241_945 233
802 3300050492 nmdc:mga0yw44_410945_c1 nmdc:mga0yw44_410945_c1_201_905 233
803 3300050492 nmdc:mga0yw44_96825_c1 nmdc:mga0yw44_96825_c1_83_787 233
804 3300050493 nmdc:mga0k408_10501_c1 nmdc:mga0k408_10501_c1_2684_3388 233
805 3300050493 nmdc:mga0k408_111545_c1 nmdc:mga0k408_111545_c1_818_1531 233
806 3300050493 nmdc:mga0k408_14119_c2 nmdc:mga0k408_14119_c2_1440_2162 233
807 3300050493 nmdc:mga0k408_14745_c1 nmdc:mga0k408_14745_c1_677_1381 233
808 3300050493 nmdc:mga0k408_201630_c1 nmdc:mga0k408_201630_c1_389_1093 233
809 3300050493 nmdc:mga0k408_323732_c1 nmdc:mga0k408_323732_c1_173_877 233
810 3300050493 nmdc:mga0k408_35013_c1 nmdc:mga0k408_35013_c1_1730_2434 233
811 3300050493 nmdc:mga0k408_40610_c1 nmdc:mga0k408_40610_c1_1752_2468 233
812 3300050493 nmdc:mga0k408_4653_c1 nmdc:mga0k408_4653_c1_1139_1843 233
813 3300050494 nmdc:mga06z11_61813_c1 nmdc:mga06z11_61813_c1_533_1237 233
814 3300050496 nmdc:mga07m45_179357_c1 nmdc:mga07m45_179357_c1_209_913 233
815 3300050496 nmdc:mga07m45_18581_c1 nmdc:mga07m45_18581_c1_1408_2124 233
816 3300050496 nmdc:mga07m45_26255_c1 nmdc:mga07m45_26255_c1_1260_1964 233
817 3300050496 nmdc:mga07m45_3277_c1 nmdc:mga07m45_3277_c1_6858_7571 233
818 3300050496 nmdc:mga07m45_3995_c1 nmdc:mga07m45_3995_c1_5587_6291 233
819 3300050496 nmdc:mga07m45_4628_c1 nmdc:mga07m45_4628_c1_2113_2817 233
820 3300050496 nmdc:mga07m45_468_c1 nmdc:mga07m45_468_c1_11314_12021 233
821 3300050496 nmdc:mga07m45_49006_c1 nmdc:mga07m45_49006_c1_227_931 233
822 3300050496 nmdc:mga07m45_494_c1 nmdc:mga07m45_494_c1_681_1385 233
823 3300050507 nmdc:mga05p37_28163_c1 nmdc:mga05p37_28163_c1_3014_3718 233
824 3300050508 nmdc:mga09592_1109_c1 nmdc:mga09592_1109_c1_11673_12389 233
825 3300050509 nmdc:mga0qj67_194221_c1 nmdc:mga0qj67_194221_c1_509_1216 233
826 3300050512 nmdc:mga0n895_93044_c1 nmdc:mga0n895_93044_c1_718_1422 233
827 3300050516 nmdc:mga0sz30_115229_c1 nmdc:mga0sz30_115229_c1_269_973 233
828 3300050516 nmdc:mga0sz30_17015_c1 nmdc:mga0sz30_17015_c1_668_1372 233
829 3300050516 nmdc:mga0sz30_4255_c1 nmdc:mga0sz30_4255_c1_1916_2620 233
830 3300053077 Ga0495601_0325694 Ga0495601_0325694_204_908 233
831 3300053078 Ga0495612_0129886 Ga0495612_0129886_289_993 233
832 3300053085 Ga0495619_0041407 Ga0495619_0041407_18_722 233
833 3300053085 Ga0495619_0067162 Ga0495619_0067162_979_1683 233
834 3300053086 Ga0500578_0000057 Ga0500578_0000057_74650_75354 233
835 3300053090 Ga0500646_0001133 Ga0500646_0001133_1359_2063 233
836 3300053090 Ga0500646_0017240 Ga0500646_0017240_202_906 233
837 3300053092 Ga0500583_0039612 Ga0500583_0039612_1049_1753 233
838 3300053093 Ga0500651_0035425 Ga0500651_0035425_336_1040 233
839 3300053108 Ga0500562_049598 Ga0500562_049598_263_967 233
840 3300053109 Ga0500569_061511 Ga0500569_061511_298_1002 233
841 3300053117 Ga0500593_000199 Ga0500593_000199_21560_22264 233
842 3300053131 Ga0500652_002632 Ga0500652_002632_1829_2533 233
843 3300053133 Ga0500655_035354 Ga0500655_035354_102_806 233
844 3300053134 Ga0500658_0001951 Ga0500658_0001951_6072_6779 233
845 3300053134 Ga0500658_0062796 Ga0500658_0062796_217_948 233
846 3300053151 Ga0500604_0028653 Ga0500604_0028653_601_1305 233
847 3300053156 Ga0500622_0000530 Ga0500622_0000530_20972_21676 233
848 3300053730 Ga0500645_000978 Ga0500645_000978_1142_1846 233
849 3300053730 Ga0500645_008154 Ga0500645_008154_298_1002 233
850 3300055283 Ga0500661_010782 Ga0500661_010782_763_1467 233
851 3300061719 Ga0466962_0012685 Ga0466962_0012685_645_1349 233
852 iso_pu_bacteria 2900634093 2900643337 233
853 3300033179 Ga0307507_10040352 Ga0307507_100403524 234
854 3300037418 Ga0395900_0000387 Ga0395900_0000387_62032_62745 234
855 3300037418 Ga0395900_0267418 Ga0395900_0267418_125_835 234
856 3300037466 Ga0395898_0000958 Ga0395898_0000958_44270_44983 234
857 3300037466 Ga0395898_0028246 Ga0395898_0028246_897_1607 234
858 3300044684 Ga0466966_0228245 Ga0466966_0228245_30_740 234
859 3300044842 Ga0466957_0044811 Ga0466957_0044811_433_1143 234
860 3300045049 Ga0466959_0064165 Ga0466959_0064165_1520_2230 234
861 3300045836 Ga0466958_0037418 Ga0466958_0037418_1261_1971 234
862 3300045976 Ga0466967_0016859 Ga0466967_0016859_3556_4266 234
863 3300000546 LJNas_1012990 LJNas_10129902 235
864 3300030763 Ga0265763_1001692 Ga0265763_10016922 235
865 3300035695 Ga0373927_0356018 Ga0373927_0356018_157_864 235
866 3300036401 Ga0373937_0233384 Ga0373937_0233384_89_796 235
867 3300046529 Ga0495652_0227862 Ga0495652_0227862_614_1321 235
868 3300049822 Ga0501035_0018506 Ga0501035_0018506_4906_5643 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

48

190

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.8983 1 235
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.8946 1 235
3rlf-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.8916 6 222
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.8901 4 225
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.8885 4 225
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9134 1 235 3.40.50.300
af_O86311_2_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9133 3 224 3.40.50.300
af_O53149_2_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9128 1 227 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9096 1 235 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9008 5 234 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A127JQP1-F1-model_v4 Histidinol dehydrogenase 0.9951 2 235 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A4Y7B3T8-F1-model_v4 deleted 0.994 5 235
AF-A0A7H0GJX1-F1-model_v4 ABC transporter ATP-binding protein 0.9932 1 235 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-M1SDV6-F1-model_v4 ABC transporter related protein 0.9926 5 235 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A0Q6TCL7-F1-model_v4 ABC transporter ATP-binding protein 0.9925 3 235 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887

Feature Viewer

pLDDT pTM Quality
93.49 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map