F483375

General Info

Members Datasets Scaffolds Average Seq Length
848 513 739 262

Family's Representative Sequence

Representative Sequence 3300046535|Ga0495586_0154630|Ga0495586_0154630_64_999
Length 311
Sequence VSLPPEGAAGRLGAARRRPEFRFFTGRAAACRGGRAVPTTFAAMFTDSHCHLTFPEFADQMPQIRAAMAAAQVDRALCICTTLEEFPAVQALAERHDNFWASVGVHPDNEDILEPTVEGLVQRAALPKVIAIGETGLDYYQMEERKGGRSIADMEWQRERFRVHIRAAQQTRKPLVIHTREASADTLAILREEGETGSGQAAGGVFHCFTETAEVARAALDLGFYISFSGILTFKKAQDLRDVAAFVPLDRMLIETDSPYLAPVPYRGKTNNPSYVPFVAQQIAQLRQLPVEAIAKATSDNFETLFSGVKT

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
3 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
4 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
5 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
6 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
7 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
8 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
9 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
10 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
11 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
12 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
13 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
14 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
15 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
16 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
17 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
18 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
19 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
20 2643221658 Variovorax sp. Root411 Isolate Unclassified
21 2643221660 Methylibium sp. Root1272 Isolate Unclassified
22 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
23 2643221672 Variovorax sp. Root434 Isolate Unclassified
24 2643221683 Variovorax sp. Root473 Isolate Unclassified
25 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
26 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
27 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
28 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
29 2738541277 Variovorax sp. GV051 Isolate Unclassified
30 2738541307 Variovorax sp. GV008 Isolate Unclassified
31 2738543013 Variovorax sp. BT01 Isolate Unclassified
32 2738543019 Variovorax sp. GV040 Isolate Unclassified
33 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
34 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
35 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
36 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
37 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
38 2818991446 Variovorax sp. 1180 Isolate Unclassified
39 2818991459 Paenibacillus sp. 597 Isolate Unclassified
40 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
41 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
42 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
43 2842677519 Variovorax sp. R-72495 Isolate Unclassified
44 2842733646 Variovorax sp. R-72446 Isolate Unclassified
45 2842747753 Variovorax sp. R-72060 Isolate Unclassified
46 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
47 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
48 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
49 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
50 2885198086 Variovorax sp. 679 Isolate Unclassified
51 2885211737 Variovorax sp. 553 Isolate Unclassified
52 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
53 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
54 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
55 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
56 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
57 2899924645 Variovorax sp. 369 Isolate Unclassified
58 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
59 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
60 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
61 2904456579 Variovorax sp. 2002 Isolate Unclassified
62 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
63 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
64 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
65 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
66 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
67 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
68 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
69 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
70 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
71 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
72 2928044640 Variovorax sp. 1128 Isolate Unclassified
73 2928051484 Variovorax sp. 1133 Isolate Unclassified
74 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
75 2928070936 Variovorax gossypii 1167 Isolate Unclassified
76 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
77 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
78 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
79 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
80 2929520902 Variovorax beijingensis 502 Isolate Unclassified
81 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
82 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
83 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
84 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
85 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
86 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
87 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
88 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
89 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
90 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
91 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
92 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
93 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
94 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
95 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
96 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
97 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
98 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
99 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
100 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
101 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
102 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
103 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
104 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
105 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
106 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
107 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
108 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
109 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
110 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
111 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
112 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
113 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
114 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
115 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
116 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
117 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
118 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
119 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
120 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
121 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
122 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
123 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
124 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
125 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
126 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
127 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
128 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
129 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
130 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
131 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
132 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
133 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
134 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
135 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
136 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
137 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
138 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
139 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
140 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
141 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
142 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
143 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
144 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
145 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
146 3300005473 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v2 (version 2) Metagenome Rhizosphere
147 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
148 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
149 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
150 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
151 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
152 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
153 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
154 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
155 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
156 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
157 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
158 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
159 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
160 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
161 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
162 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
163 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
164 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
165 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
166 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
167 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
168 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
169 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
170 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
171 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
172 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
173 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
174 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
175 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
176 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
177 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
178 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
179 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
180 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
181 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
182 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
183 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
184 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
185 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
186 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
187 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
188 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
189 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
190 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
191 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
192 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
193 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
194 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
195 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
196 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
197 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
198 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
199 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
200 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
201 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
202 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
203 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
204 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
205 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
206 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
207 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
208 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
209 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
210 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
215 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
217 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
219 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
220 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
222 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
223 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
224 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
226 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
227 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
228 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
230 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
231 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
270 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
274 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
278 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
279 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
280 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
281 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
282 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
283 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
284 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
285 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
286 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
287 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
288 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
289 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
290 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
291 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
292 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
293 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
294 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
295 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
296 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
297 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
298 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
299 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
300 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
301 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
302 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
303 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
304 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
305 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
306 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
307 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
308 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
309 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
310 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
311 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
312 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
313 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
314 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
315 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
316 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
317 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
319 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
322 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
323 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
324 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
325 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
326 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
327 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
328 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
329 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
330 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
331 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
332 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
333 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
334 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
335 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
336 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
337 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
338 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
339 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
340 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
341 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
342 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
343 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
344 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
345 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
346 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
347 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
348 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
349 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
350 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
351 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
352 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
353 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
354 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
355 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
356 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
357 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
358 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
359 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
360 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
361 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
362 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
363 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
364 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
365 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
366 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
367 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
368 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
369 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
370 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
371 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
372 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
373 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
374 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
375 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
376 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
377 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
378 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
379 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
380 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
381 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
382 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
383 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
384 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
385 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
386 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
387 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
388 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
389 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
390 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
391 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
392 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
393 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
394 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
395 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
396 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
397 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
398 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
399 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
400 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
401 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
402 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
403 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
404 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
405 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
406 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
407 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
408 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
409 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
410 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
411 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
412 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
413 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
414 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
415 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
416 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
417 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
418 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
419 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
420 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
421 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
422 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
423 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
424 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
425 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
426 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
427 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
428 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
429 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
442 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
443 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
444 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
445 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
446 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
447 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
448 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
449 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
450 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
451 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
452 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
455 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
456 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
457 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
458 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
459 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
460 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
461 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
462 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
463 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
464 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
465 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
466 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
467 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
468 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
469 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
470 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
471 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
472 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
473 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
474 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
475 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
476 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
477 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
478 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
479 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
480 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
481 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
482 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
483 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
484 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
485 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
486 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
487 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
488 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
489 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
490 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
491 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
492 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
493 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
494 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
495 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
496 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
497 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
498 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
499 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
500 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
501 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
502 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
503 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
504 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
505 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
506 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
507 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
508 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
509 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
510 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
511 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
512 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
513 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.32
Metatranscriptomes 0.83
Isolates 12.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.35
Bulb 0
Endosphere 19.93
Nodule 0.59
Rhizoplane 2.36
Rhizosphere 63.44
Stem 0
Stem Tuber 0
Unclassified 13.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1005379 3300002739 Bacteria 1880
2 JGI25150J39212_1000384 3300002774 Bacteria 21069
3 JGI25159J45721_1000103 3300002987 Bacteria 40372
4 JGI25159J45721_1004784 3300002987 Bacteria 4379
5 JGI25151J46595_10001581 3300003187 Bacteria 15162
6 JGI25151J46595_10053790 3300003187 Bacteria 1341
7 JGI25406J46586_10004609 3300003203 Bacteria 6418
8 JGI25160J50197_1000255 3300003354 Bacteria 40372
9 JGI25160J50197_1006714 3300003354 Bacteria 4620
10 JGI25161J50226_1000393 3300003374 Bacteria 21899
11 JGI25161J50226_1006326 3300003374 Bacteria 2159
12 Ga0006562J51391_1014207 3300003578 Bacteria 1722
13 Ga0006562J51391_1023071 3300003578 Bacteria 2674
14 Ga0006562J51391_1076832 3300003578 Bacteria 2326
15 Ga0055538_1000176 3300003751 Bacteria 41284
16 Ga0055535_1000305 3300003761 Bacteria 49948
17 Ga0055535_1012267 3300003761 Bacteria 1315
18 Ga0055542_1000021 3300003762 Bacteria 331499
19 Ga0055529_1003355 3300003763 Bacteria 2683
20 Ga0055537_1000036 3300003773 Bacteria 96045
21 Ga0055536_1000396 3300003781 Bacteria 31602
22 Ga0055536_1002959 3300003781 Bacteria 9315
23 Ga0055536_1005104 3300003781 Bacteria 6505
24 Ga0055534_1000018 3300003784 Bacteria 138136
25 Ga0055534_1003667 3300003784 Bacteria 4756
26 Ga0055534_1013198 3300003784 Bacteria 1595
27 Ga0055528_1004492 3300003790 Bacteria 6716
28 Ga0055530_10000086 3300003791 Bacteria 80109
29 Ga0055530_10000991 3300003791 Bacteria 22764
30 Ga0055540_1000405 3300003792 Bacteria 34908
31 Ga0055540_1001568 3300003792 Bacteria 13345
32 Ga0055540_1008793 3300003792 Bacteria 3583
33 Ga0055531_10000515 3300003794 Bacteria 34908
34 Ga0055531_10000762 3300003794 Bacteria 26870
35 Ga0055541_1000158 3300003841 Bacteria 33250
36 Ga0058692_1000003 3300003856 Bacteria 435295
37 Ga0055543_1000262 3300004625 Bacteria 39412
38 Ga0065165_1000494 3300005262 Bacteria 60929
39 Ga0065703_1000145 3300005272 Bacteria 90784
40 Ga0065714_10074806 3300005288 Bacteria 2988
41 Ga0070658_10020838 3300005327 Bacteria 5253
42 Ga0070683_100312193 3300005329 Bacteria 1496
43 Ga0070670_100043728 3300005331 Bacteria 3850
44 Ga0070670_100126513 3300005331 Bacteria 2206
45 Ga0070677_10009459 3300005333 Bacteria 3304
46 Ga0068869_100016290 3300005334 Bacteria 5007
47 Ga0068868_100137282 3300005338 Bacteria 2005
48 Ga0070660_100045205 3300005339 Bacteria 3370
49 Ga0070661_100001215 3300005344 Bacteria 18159
50 Ga0070661_100009411 3300005344 Bacteria 6761
51 Ga0070668_100030703 3300005347 Bacteria 4087
52 Ga0070669_100120891 3300005353 Bacteria 1998
53 Ga0070669_100241543 3300005353 Bacteria 1435
54 Ga0070675_100171940 3300005354 Bacteria 1869
55 Ga0070673_100175986 3300005364 Bacteria 1829
56 Ga0070673_100258958 3300005364 Bacteria 1519
57 Ga0070659_100000723 3300005366 Bacteria 23971
58 Ga0070667_100000558 3300005367 Bacteria 36933
59 Ga0070667_100069059 3300005367 Bacteria 3007
60 Ga0070667_100200892 3300005367 Bacteria 1769
61 Ga0070667_100393519 3300005367 Bacteria 1260
62 Ga0070708_100181819 3300005445 Bacteria 1966
63 Ga0070663_100281408 3300005455 Bacteria 1326
64 Ga0070678_100015055 3300005456 Bacteria 4902
65 Ga0070662_100024236 3300005457 Bacteria 4178
66 Ga0070662_100453955 3300005457 Bacteria 1064
67 Ga0070707_100520909 3300005468 Bacteria 1151
68 Ga0074250_12230 3300005473 Bacteria 1671
69 Ga0068853_100018345 3300005539 Bacteria 5790
70 Ga0070672_100151508 3300005543 Bacteria 1918
71 Ga0070696_100009243 3300005546 Bacteria 6599
72 Ga0070665_100088422 3300005548 Bacteria 3104
73 Ga0070665_100248677 3300005548 Bacteria 1779
74 Ga0070665_100839453 3300005548 Bacteria 932
75 Ga0068855_100107378 3300005563 Bacteria 3207
76 Ga0070664_100001692 3300005564 Bacteria 17677
77 Ga0070664_100009223 3300005564 Bacteria 8011
78 Ga0070664_100116433 3300005564 Bacteria 2337
79 Ga0068854_100024384 3300005578 Bacteria 4141
80 Ga0068852_100033408 3300005616 Bacteria 4270
81 Ga0068866_10069945 3300005718 Bacteria 1851
82 Ga0068851_10010148 3300005834 Bacteria 4390
83 Ga0068863_100009589 3300005841 Bacteria 9446
84 Ga0068863_100729575 3300005841 Bacteria 986
85 Ga0068858_100038966 3300005842 Bacteria 4408
86 Ga0068860_100104582 3300005843 Bacteria 2703
87 Ga0068860_100622858 3300005843 Bacteria 1086
88 Ga0081538_10004879 3300005981 Bacteria 12211
89 Ga0075365_10000499 3300006038 Bacteria 14928
90 Ga0075368_10058445 3300006042 Bacteria 1541
91 Ga0075363_100006375 3300006048 Bacteria 5348
92 Ga0075363_100117241 3300006048 Bacteria 1484
93 Ga0075363_100120608 3300006048 Bacteria 1464
94 Ga0075363_100156550 3300006048 Bacteria 1288
95 Ga0075363_100204754 3300006048 Bacteria 1128
96 Ga0075364_10004388 3300006051 Bacteria 8107
97 Ga0075364_10029011 3300006051 Bacteria 3546
98 Ga0075364_10031420 3300006051 Bacteria 3412
99 Ga0075364_10149558 3300006051 Bacteria 1573
100 Ga0070712_100291695 3300006175 Bacteria 1317
101 Ga0075362_10017200 3300006177 Bacteria 2976
102 Ga0075362_10151461 3300006177 Bacteria 1113
103 Ga0075367_10177486 3300006178 Bacteria 1328
104 Ga0075367_10211326 3300006178 Bacteria 1213
105 Ga0075366_10017858 3300006195 Bacteria 4091
106 Ga0075366_10069323 3300006195 Bacteria 2099
107 Ga0075366_10167057 3300006195 Bacteria 1334
108 Ga0097621_100183013 3300006237 Bacteria 1811
109 Ga0097621_100203292 3300006237 Bacteria 1720
110 Ga0075370_10006928 3300006353 Bacteria 5741
111 Ga0075370_10014387 3300006353 Bacteria 4220
112 Ga0075370_10020408 3300006353 Bacteria 3621
113 Ga0075370_10023929 3300006353 Bacteria 3369
114 Ga0075370_10026852 3300006353 Bacteria 3192
115 Ga0068871_100064748 3300006358 Bacteria 2993
116 Ga0075430_100015143 3300006846 Bacteria 6565
117 Ga0075430_100091033 3300006846 Bacteria 2551
118 Ga0075430_100234007 3300006846 Bacteria 1523
119 Ga0075431_100018061 3300006847 Bacteria 7174
120 Ga0075431_100026019 3300006847 Bacteria 5999
121 Ga0075431_100054811 3300006847 Bacteria 4112
122 Ga0075433_10002638 3300006852 Bacteria 13692
123 Ga0075433_10090205 3300006852 Bacteria 2709
124 Ga0075434_100005021 3300006871 Bacteria 12009
125 Ga0075434_100025406 3300006871 Bacteria 5795
126 Ga0075429_100025948 3300006880 Bacteria 5087
127 Ga0075429_100049096 3300006880 Bacteria 3670
128 Ga0099826_10003330 3300006948 Bacteria 10855
129 Ga0099826_10145492 3300006948 Bacteria 1363
130 Ga0075435_100006375 3300007076 Bacteria 8339
131 Ga0105251_10088378 3300009011 Bacteria 1426
132 Ga0105244_10006079 3300009036 Bacteria 7894
133 Ga0105244_10012501 3300009036 Bacteria 5012
134 Ga0105244_10027847 3300009036 Bacteria 3040
135 Ga0105244_10042638 3300009036 Bacteria 2345
136 Ga0105244_10062105 3300009036 Bacteria 1879
137 Ga0105244_10221842 3300009036 Bacteria 886
138 Ga0105244_10232879 3300009036 Bacteria 862
139 Ga0105250_10028905 3300009092 Bacteria 2231
140 Ga0105240_10014478 3300009093 Bacteria 10769
141 Ga0105240_10096400 3300009093 Bacteria 3604
142 Ga0105240_10124319 3300009093 Bacteria 3103
143 Ga0105245_10066112 3300009098 Bacteria 3272
144 Ga0105247_10010556 3300009101 Bacteria 5580
145 Ga0114129_10964067 3300009147 Bacteria 1076
146 Ga0105243_10000005 3300009148 Bacteria 576265
147 Ga0105243_10000481 3300009148 Bacteria 40913
148 Ga0105243_10005911 3300009148 Bacteria 9478
149 Ga0105243_10069193 3300009148 Bacteria 2847
150 Ga0105242_10221796 3300009176 Bacteria 1690
151 Ga0105242_10279982 3300009176 Bacteria 1515
152 Ga0105242_10462811 3300009176 Bacteria 1198
153 Ga0105242_10599796 3300009176 Bacteria 1063
154 Ga0105248_10468699 3300009177 Bacteria 1420
155 Ga0105248_10690665 3300009177 Bacteria 1151
156 Ga0105237_10000296 3300009545 Bacteria 68633
157 Ga0105238_10034295 3300009551 Bacteria 5164
158 Ga0105238_10090160 3300009551 Bacteria 3053
159 Ga0105239_10000250 3300010375 Bacteria 80439
160 Ga0105239_10076230 3300010375 Bacteria 3688
161 Ga0105239_10622341 3300010375 Bacteria 1232
162 Ga0105246_10002991 3300011119 Bacteria 10245
163 Ga0105246_10023702 3300011119 Bacteria 3975
164 Ga0105246_10075113 3300011119 Bacteria 2392
165 Ga0105246_10721820 3300011119 Bacteria 876
166 Ga0157371_10011368 3300013102 Bacteria 6866
167 Ga0157371_10049688 3300013102 Bacteria 2979
168 Ga0157371_10142439 3300013102 Bacteria 1707
169 Ga0157370_10007628 3300013104 Bacteria 11748
170 Ga0157370_10436765 3300013104 Bacteria 1204
171 Ga0157369_10030735 3300013105 Bacteria 5921
172 Ga0157374_10233809 3300013296 Bacteria 1806
173 Ga0157378_10136035 3300013297 Bacteria 2279
174 Ga0163162_10011471 3300013306 Bacteria 8643
175 Ga0157372_10083033 3300013307 Bacteria 3629
176 Ga0157375_10024840 3300013308 Bacteria 5553
177 Ga0182008_10000248 3300014497 Bacteria 41927
178 Ga0182008_10027578 3300014497 Bacteria 2875
179 Ga0182008_10037366 3300014497 Bacteria 2429
180 Ga0182008_10051748 3300014497 Bacteria 2037
181 Ga0157379_10543019 3300014968 Bacteria 1081
182 Ga0157376_10114435 3300014969 Bacteria 2380
183 Ga0182006_1002817 3300015261 Bacteria 9274
184 Ga0182006_1029757 3300015261 Bacteria 2211
185 Ga0182007_10001320 3300015262 Bacteria 13385
186 Ga0182007_10003094 3300015262 Bacteria 8010
187 Ga0182007_10039823 3300015262 Bacteria 1571
188 Ga0183362_10001 3300015683 Bacteria 2046624
189 Ga0163161_10000578 3300017792 Bacteria 29487
190 Ga0163161_10010469 3300017792 Bacteria 6420
191 Ga0163161_10023675 3300017792 Bacteria 4334
192 Ga0163161_10077465 3300017792 Bacteria 2442
193 Ga0163161_10483552 3300017792 Bacteria 1006
194 Ga0213872_10001126 3300021361 Bacteria 18260
195 Ga0213872_10057105 3300021361 Bacteria 1768
196 Ga0213874_10007518 3300021377 Bacteria 2618
197 Ga0209784_100151 3300025224 Bacteria 63336
198 Ga0209566_100196 3300025225 Bacteria 62620
199 Ga0209566_106134 3300025225 Bacteria 1442
200 Ga0209672_102245 3300025228 Bacteria 4977
201 Ga0209147_104170 3300025229 Bacteria 2489
202 Ga0209437_100524 3300025233 Bacteria 26708
203 Ga0209258_100058 3300025242 Bacteria 331567
204 Ga0207425_1000087 3300025245 Bacteria 93219
205 Ga0207425_1000921 3300025245 Bacteria 14021
206 Ga0209148_1000071 3300025254 Bacteria 331551
207 Ga0209129_1000007 3300025258 Bacteria 771325
208 Ga0209129_1016558 3300025258 Bacteria 1476
209 Ga0209129_1019157 3300025258 Bacteria 1299
210 Ga0209565_1000075 3300025263 Bacteria 162259
211 Ga0209565_1001142 3300025263 Bacteria 12781
212 Ga0209455_1000359 3300025272 Bacteria 42537
213 Ga0209673_1000066 3300025273 Bacteria 250037
214 Ga0209673_1000080 3300025273 Bacteria 223503
215 Ga0209673_1002015 3300025273 Bacteria 15619
216 Ga0209130_1000131 3300025284 Bacteria 119977
217 Ga0209130_1000137 3300025284 Bacteria 116784
218 Ga0209675_1000074 3300025291 Bacteria 162260
219 Ga0209675_1000102 3300025291 Bacteria 123742
220 Ga0209675_1001838 3300025291 Bacteria 11553
221 Ga0209675_1001972 3300025291 Bacteria 11021
222 Ga0209675_1014865 3300025291 Bacteria 2344
223 Ga0209676_1000005 3300025292 Bacteria 1076001
224 Ga0209676_1000139 3300025292 Bacteria 177886
225 Ga0209676_1000186 3300025292 Bacteria 142440
226 Ga0209676_1000703 3300025292 Bacteria 46688
227 Ga0209676_1001078 3300025292 Bacteria 30809
228 Ga0209676_1041679 3300025292 Bacteria 1281
229 Ga0209025_1000056 3300025294 Bacteria 316188
230 Ga0209025_1000088 3300025294 Bacteria 255087
231 Ga0209025_1000104 3300025294 Bacteria 226895
232 Ga0209025_1008022 3300025294 Bacteria 7690
233 Ga0209025_1008927 3300025294 Bacteria 7095
234 Ga0209025_1010001 3300025294 Bacteria 6499
235 Ga0209564_1000073 3300025295 Bacteria 288080
236 Ga0209564_1000090 3300025295 Bacteria 249298
237 Ga0209758_1000044 3300025297 Bacteria 398448
238 Ga0209758_1002538 3300025297 Bacteria 18399
239 Ga0209758_1030843 3300025297 Bacteria 2211
240 Ga0209050_1000007 3300025298 Bacteria 1187891
241 Ga0209050_1000250 3300025298 Bacteria 115980
242 Ga0209050_1005618 3300025298 Bacteria 7780
243 Ga0209256_1000020 3300025299 Bacteria 542402
244 Ga0209256_1000022 3300025299 Bacteria 481843
245 Ga0209256_1033560 3300025299 Bacteria 1379
246 Ga0207426_1000001 3300025302 Bacteria 1341301
247 Ga0207426_1000031 3300025302 Bacteria 460699
248 Ga0209051_1000036 3300025303 Bacteria 339863
249 Ga0209051_1000078 3300025303 Bacteria 201965
250 Ga0209051_1000160 3300025303 Bacteria 126473
251 Ga0209051_1000213 3300025303 Bacteria 98755
252 Ga0209051_1000257 3300025303 Bacteria 88842
253 Ga0209051_1011578 3300025303 Bacteria 4342
254 Ga0209051_1028273 3300025303 Bacteria 2217
255 Ga0209257_1000011 3300025304 Bacteria 1112630
256 Ga0209257_1000012 3300025304 Bacteria 1111138
257 Ga0209257_1000116 3300025304 Bacteria 228733
258 Ga0209257_1000222 3300025304 Bacteria 134717
259 Ga0209257_1003620 3300025304 Bacteria 13011
260 Ga0209257_1010150 3300025304 Bacteria 4845
261 Ga0207696_1001081 3300025711 Bacteria 16071
262 Ga0207655_1002033 3300025728 Bacteria 17090
263 Ga0207655_1002576 3300025728 Bacteria 14467
264 Ga0207655_1002672 3300025728 Bacteria 14020
265 Ga0207655_1002703 3300025728 Bacteria 13907
266 Ga0207655_1005759 3300025728 Bacteria 8346
267 Ga0207655_1006420 3300025728 Bacteria 7796
268 Ga0207713_1010478 3300025735 Bacteria 5125
269 Ga0207710_10000172 3300025900 Bacteria 66486
270 Ga0207688_10052548 3300025901 Bacteria 2284
271 Ga0207705_10088474 3300025909 Bacteria 2266
272 Ga0207695_10023858 3300025913 Bacteria 6903
273 Ga0207695_10290833 3300025913 Bacteria 1526
274 Ga0207671_10011355 3300025914 Bacteria 7256
275 Ga0207671_10104987 3300025914 Bacteria 2143
276 Ga0207657_10057735 3300025919 Bacteria 3343
277 Ga0207649_10010047 3300025920 Bacteria 5193
278 Ga0207681_10082402 3300025923 Bacteria 2274
279 Ga0207681_10205550 3300025923 Bacteria 1514
280 Ga0207650_10050473 3300025925 Bacteria 3077
281 Ga0207687_10033564 3300025927 Bacteria 3482
282 Ga0207690_10001849 3300025932 Bacteria 13005
283 Ga0207706_10146369 3300025933 Bacteria 2078
284 Ga0207706_10504022 3300025933 Bacteria 1045
285 Ga0207709_10000001 3300025935 Bacteria 2228154
286 Ga0207709_10000292 3300025935 Bacteria 56565
287 Ga0207709_10002968 3300025935 Bacteria 10339
288 Ga0207709_10034195 3300025935 Bacteria 2993
289 Ga0207691_10128560 3300025940 Bacteria 2239
290 Ga0207691_10162804 3300025940 Bacteria 1956
291 Ga0207691_10224580 3300025940 Bacteria 1628
292 Ga0207711_10049953 3300025941 Bacteria 3581
293 Ga0207711_10297692 3300025941 Bacteria 1488
294 Ga0207689_10015046 3300025942 Bacteria 6560
295 Ga0207661_10064344 3300025944 Bacteria 2973
296 Ga0207679_10000245 3300025945 Bacteria 41439
297 Ga0207651_10160534 3300025960 Bacteria 1762
298 Ga0207640_10038670 3300025981 Bacteria 3013
299 Ga0207658_10000412 3300025986 Bacteria 40643
300 Ga0207658_10050675 3300025986 Bacteria 3056
301 Ga0207703_10006312 3300026035 Bacteria 9473
302 Ga0207639_10102875 3300026041 Bacteria 2313
303 Ga0207639_10255966 3300026041 Bacteria 1529
304 Ga0207702_10160146 3300026078 Bacteria 2055
305 Ga0207641_10009620 3300026088 Bacteria 7967
306 Ga0207641_10204084 3300026088 Bacteria 1824
307 Ga0207676_10325469 3300026095 Bacteria 1413
308 Ga0207674_10297723 3300026116 Bacteria 1562
309 Ga0207683_10005862 3300026121 Bacteria 10536
310 Ga0207683_10018267 3300026121 Bacteria 5982
311 Ga0207683_10034463 3300026121 Bacteria 4399
312 Ga0207683_10128229 3300026121 Bacteria 2281
313 Ga0207698_10069424 3300026142 Bacteria 2786
314 Ga0207698_10121415 3300026142 Bacteria 2212
315 Ga0209371_1000006 3300027312 Bacteria 1055642
316 Ga0209969_1003204 3300027360 Bacteria 2261
317 Ga0209981_1018448 3300027378 Bacteria 988
318 Ga0209995_1004345 3300027471 Bacteria 2266
319 Ga0209282_1000221 3300027666 Bacteria 29591
320 Ga0209282_1120448 3300027666 Bacteria 1313
321 Ga0209971_1006633 3300027682 Bacteria 2740
322 Ga0209966_1023477 3300027695 Bacteria 1212
323 Ga0209974_10006449 3300027876 Bacteria 4096
324 Ga0207428_10025463 3300027907 Bacteria 4952
325 Ga0207428_10025611 3300027907 Bacteria 4936
326 Ga0268266_10023253 3300028379 Bacteria 5277
327 Ga0268266_10564629 3300028379 Bacteria 1091
328 Ga0268265_10055662 3300028380 Bacteria 3006
329 Ga0268264_10111176 3300028381 Bacteria 2400
330 Ga0265337_1053412 3300028556 Bacteria 1132
331 Ga0265334_10000827 3300028573 Bacteria 15475
332 Ga0307517_10004912 3300028786 Bacteria 20370
333 Ga0307515_10000006 3300028794 Bacteria 725810
334 Ga0307515_10000306 3300028794 Bacteria 121448
335 Ga0307515_10057287 3300028794 Bacteria 5642
336 Ga0307515_10292199 3300028794 Bacteria 1324
337 Ga0307515_10294898 3300028794 Bacteria 1313
338 Ga0265338_10010944 3300028800 Bacteria 10545
339 Ga0265338_10011529 3300028800 Bacteria 10196
340 Ga0265338_10042697 3300028800 Bacteria 4218
341 Ga0265324_10024436 3300029957 Bacteria 2146
342 Ga0268256_1000007 3300030500 Bacteria 1055326
343 Ga0307512_10005276 3300030522 Bacteria 13567
344 Ga0316177_1105017 3300030731 Bacteria 5728
345 Ga0314311_1155152 3300030733 Bacteria 3630
346 Ga0316178_1068791 3300030735 Bacteria 3547
347 Ga0316180_1050822 3300030736 Bacteria 2603
348 Ga0316183_1039891 3300030742 Bacteria 7261
349 Ga0316181_1078789 3300030744 Bacteria 1612
350 Ga0316182_1190822 3300030745 Bacteria 3334
351 Ga0265330_10066331 3300031235 Bacteria 1566
352 Ga0265332_10000094 3300031238 Bacteria 77636
353 Ga0265332_10064125 3300031238 Bacteria 1569
354 Ga0265328_10003603 3300031239 Bacteria 6831
355 Ga0265328_10019905 3300031239 Bacteria 2573
356 Ga0265320_10048560 3300031240 Bacteria 2070
357 Ga0265320_10136512 3300031240 Bacteria 1112
358 Ga0265331_10005085 3300031250 Bacteria 8031
359 Ga0265331_10034829 3300031250 Bacteria 2481
360 Ga0265331_10043885 3300031250 Bacteria 2163
361 Ga0265331_10102982 3300031250 Bacteria 1312
362 Ga0265327_10006203 3300031251 Bacteria 9642
363 Ga0265327_10019851 3300031251 Bacteria 4115
364 Ga0265327_10027976 3300031251 Bacteria 3235
365 Ga0265316_10008373 3300031344 Bacteria 9604
366 Ga0265316_10012742 3300031344 Bacteria 7515
367 Ga0265316_10085054 3300031344 Bacteria 2421
368 Ga0265316_10124170 3300031344 Bacteria 1948
369 Ga0307513_10051472 3300031456 Bacteria 4443
370 Ga0307513_10220338 3300031456 Bacteria 1719
371 Ga0307513_10332493 3300031456 Bacteria 1273
372 Ga0307408_100110771 3300031548 Bacteria 2108
373 Ga0307408_100159897 3300031548 Bacteria 1788
374 Ga0307508_10011794 3300031616 Bacteria 7987
375 Ga0316575_10001169 3300031665 Bacteria 8257
376 Ga0265314_10011481 3300031711 Bacteria 7307
377 Ga0265314_10012964 3300031711 Bacteria 6768
378 Ga0265314_10025842 3300031711 Bacteria 4421
379 Ga0265314_10128646 3300031711 Bacteria 1583
380 Ga0265314_10151812 3300031711 Bacteria 1419
381 Ga0265342_10045457 3300031712 Bacteria 2643
382 Ga0316576_10031177 3300031727 Bacteria 3781
383 Ga0316576_10083412 3300031727 Bacteria 2374
384 Ga0316576_10091160 3300031727 Bacteria 2271
385 Ga0316576_10146743 3300031727 Bacteria 1777
386 Ga0316578_10010891 3300031728 Bacteria 4738
387 Ga0307516_10217266 3300031730 Bacteria 1623
388 Ga0307405_10001524 3300031731 Bacteria 9813
389 Ga0316577_10006651 3300031733 Bacteria 6123
390 Ga0316577_10063816 3300031733 Bacteria 2056
391 Ga0316577_10177270 3300031733 Bacteria 1203
392 Ga0307406_10017753 3300031901 Bacteria 4148
393 Ga0307406_10380051 3300031901 Bacteria 1113
394 Ga0307412_10010332 3300031911 Bacteria 5376
395 Ga0307416_100043673 3300032002 Bacteria 3512
396 Ga0307416_100126598 3300032002 Bacteria 2289
397 Ga0307411_10037176 3300032005 Bacteria 3058
398 Ga0307411_10199074 3300032005 Bacteria 1537
399 Ga0307411_10217608 3300032005 Bacteria 1479
400 Ga0307411_10282556 3300032005 Bacteria 1322
401 Ga0307411_10310685 3300032005 Bacteria 1268
402 Ga0307415_100121710 3300032126 Bacteria 1958
403 Ga0316585_10080829 3300032137 Bacteria 1058
404 Ga0316580_10015636 3300032139 Bacteria 2323
405 Ga0316593_10001705 3300032168 Bacteria 4961
406 Ga0316593_10014207 3300032168 Bacteria 2370
407 Ga0307510_10041814 3300033180 Bacteria 5004
408 Ga0307510_10177388 3300033180 Bacteria 1699
409 Ga0316587_1011069 3300033529 Bacteria 1452
410 Ga0316596_1018021 3300033541 Bacteria 1781
411 Ga0373943_0081189 3300035170 Bacteria 1663
412 Ga0373955_0073008 3300035172 Bacteria 1923
413 Ga0316574_0206237 3300035398 Bacteria 1262
414 Ga0316582_0045365 3300036647 Bacteria 2767
415 Ga0316582_0176261 3300036647 Bacteria 1453
416 Ga0316584_0005970 3300036712 Bacteria 8225
417 Ga0316584_0021546 3300036712 Bacteria 4685
418 Ga0316584_0086613 3300036712 Bacteria 2344
419 Ga0373925_0162515 3300037068 Bacteria 1760
420 Ga0395899_0023506 3300037312 Bacteria 4667
421 Ga0395899_0027560 3300037312 Bacteria 4282
422 Ga0395899_0098060 3300037312 Bacteria 2118
423 Ga0395900_0000063 3300037418 Bacteria 201374
424 Ga0395900_0061938 3300037418 Bacteria 3846
425 Ga0395900_0108516 3300037418 Bacteria 2851
426 Ga0395900_0157926 3300037418 Bacteria 2315
427 Ga0395898_0006380 3300037466 Bacteria 12600
428 Ga0395898_0010832 3300037466 Bacteria 9525
429 Ga0395905_0000443 3300037471 Bacteria 58027
430 Ga0395905_0055765 3300037471 Bacteria 3698
431 Ga0395905_0091368 3300037471 Bacteria 2854
432 Ga0395905_0117574 3300037471 Bacteria 2498
433 Ga0395905_0319772 3300037471 Bacteria 1441
434 Ga0395901_0087577 3300038443 Bacteria 3256
435 Ga0395901_0316787 3300038443 Bacteria 1614
436 Ga0395901_0587435 3300038443 Bacteria 1124
437 Ga0400485_05586 3300038735 Bacteria 2194
438 Ga0400488_16420 3300038741 Bacteria 2489
439 Ga0400486_12391 3300038742 Bacteria 3393
440 Ga0436365_0488796 3300039437 Bacteria 2854
441 Ga0436360_0438486 3300039438 Bacteria 9423
442 Ga0436361_0109034 3300039447 Bacteria 1286
443 Ga0436361_0168382 3300039447 Bacteria 1579
444 Ga0436361_0653184 3300039447 Bacteria 36949
445 Ga0436363_1281725 3300039450 Bacteria 8177
446 Ga0439436_0000212 3300041404 Bacteria 14029
447 Ga0439436_0018026 3300041404 Bacteria 2112
448 Ga0439447_013933 3300041407 Bacteria 2269
449 Ga0439465_0001922 3300041413 Bacteria 6811
450 Ga0439465_0132803 3300041413 Bacteria 880
451 Ga0451849_1462899 3300041505 Bacteria 1612
452 Ga0439431_0054515 3300041997 Bacteria 1043
453 Ga0439433_0000802 3300041999 Bacteria 6213
454 Ga0439442_006094 3300042002 Bacteria 2417
455 Ga0439445_0009924 3300042004 Bacteria 2247
456 Ga0439445_0045973 3300042004 Bacteria 1169
457 Ga0439449_0000162 3300042007 Bacteria 22807
458 Ga0439449_0003523 3300042007 Bacteria 6078
459 Ga0439449_0009856 3300042007 Bacteria 3615
460 Ga0439452_000749 3300042010 Bacteria 15562
461 Ga0439455_0027801 3300042012 Bacteria 1388
462 Ga0439462_0026231 3300042015 Bacteria 1535
463 Ga0439463_010290 3300042016 Bacteria 2299
464 Ga0450920_020777 3300042122 Bacteria 1266
465 Ga0450890_011543 3300042127 Bacteria 1142
466 Ga0450907_004002 3300042146 Bacteria 2563
467 Ga0439446_0013796 3300042156 Bacteria 2223
468 Ga0439458_0003995 3300042157 Bacteria 3408
469 Ga0439458_0019659 3300042157 Bacteria 1555
470 Ga0450908_014546 3300042184 Bacteria 1413
471 Ga0439434_0004673 3300042435 Bacteria 4012
472 Ga0439434_0019589 3300042435 Bacteria 2029
473 Ga0439460_0071563 3300042461 Bacteria 1075
474 Ga0450916_005301 3300042530 Bacteria 1487
475 Ga0450918_001383 3300042531 Bacteria 4855
476 Ga0450893_0000684 3300042532 Bacteria 4895
477 Ga0450893_0012365 3300042532 Bacteria 1417
478 Ga0451577_0023778 3300042876 Bacteria 5582
479 Ga0451577_0094965 3300042876 Bacteria 2662
480 Ga0451577_0523177 3300042876 Bacteria 1077
481 Ga0439440_0026087 3300042993 Bacteria 1350
482 Ga0466969_0042909 3300044656 Bacteria 2255
483 Ga0466969_0043578 3300044656 Bacteria 2235
484 Ga0453683_0002359 3300044673 Bacteria 14773
485 Ga0466965_0038070 3300044683 Bacteria 2362
486 Ga0466965_0207724 3300044683 Bacteria 1040
487 Ga0466966_0014971 3300044684 Bacteria 5131
488 Ga0466966_0197596 3300044684 Bacteria 1217
489 Ga0466961_0011090 3300044693 Bacteria 5761
490 Ga0466961_0073364 3300044693 Bacteria 2170
491 Ga0453684_0041347 3300044712 Bacteria 6237
492 Ga0453684_0044822 3300044712 Bacteria 5911
493 Ga0453684_0904711 3300044712 Bacteria 945
494 Ga0466957_0101181 3300044842 Bacteria 1817
495 Ga0466959_0032340 3300045049 Bacteria 3872
496 Ga0451576_0001973 3300045051 Bacteria 32632
497 Ga0451576_0005477 3300045051 Bacteria 15899
498 Ga0451576_0007413 3300045051 Bacteria 13122
499 Ga0451576_0062335 3300045051 Bacteria 3887
500 Ga0451576_0461438 3300045051 Bacteria 1334
501 Ga0451576_0888064 3300045051 Bacteria 935
502 Ga0466967_0984494 3300045976 Bacteria 840
503 Ga0495627_004409 3300046453 Bacteria 5896
504 Ga0495627_028567 3300046453 Bacteria 1781
505 Ga0495592_0000478 3300046454 Bacteria 29353
506 Ga0495592_0155355 3300046454 Bacteria 1579
507 Ga0495590_0005550 3300046457 Bacteria 4992
508 Ga0495591_039412 3300046458 Bacteria 1354
509 Ga0495638_0099749 3300046460 Bacteria 1737
510 Ga0495653_0065406 3300046463 Bacteria 2737
511 Ga0495639_0071286 3300046475 Bacteria 1605
512 Ga0495608_0052256 3300046511 Unclassified 2705
513 Ga0495616_0001622 3300046513 Bacteria 15416
514 Ga0495620_0106301 3300046515 Bacteria 1115
515 Ga0495631_0003611 3300046518 Bacteria 8442
516 Ga0495663_0085826 3300046525 Bacteria 1020
517 Ga0495642_0025051 3300046528 Bacteria 2363
518 Ga0495652_0474842 3300046529 Bacteria 871
519 Ga0495640_0192496 3300046533 Bacteria 1296
520 Ga0495586_0154630 3300046535 Bacteria 1292
521 Ga0495621_0108121 3300046539 Bacteria 1064
522 Ga0495622_0043947 3300046557 Bacteria 2077
523 Ga0495667_0148430 3300046559 Unclassified 1510
524 Ga0495656_0000193 3300046615 Bacteria 21880
525 Ga0495625_0000057 3300046660 Bacteria 181623
526 Ga0495588_0067289 3300046674 Bacteria 1859
527 Ga0495588_0073967 3300046674 Bacteria 1774
528 Ga0495657_0322063 3300046675 Bacteria 918
529 Ga0495658_0006263 3300046683 Bacteria 5849
530 Ga0495670_0272336 3300046691 Bacteria 905
531 Ga0495660_0004595 3300046810 Bacteria 8328
532 Ga0495581_0137626 3300047315 Bacteria 1424
533 Ga0495604_0061684 3300047317 Bacteria 2867
534 Ga0495676_0233490 3300047321 Bacteria 1262
535 Ga0495614_0064795 3300048089 Bacteria 1571
536 Ga0496100_0599137 3300048903 Bacteria 855
537 Ga0496101_0003661 3300048904 Bacteria 9588
538 Ga0496102_0020130 3300048905 Bacteria 5891
539 Ga0496103_0028975 3300048906 Bacteria 3363
540 Ga0496104_0001081 3300048907 Bacteria 23265
541 Ga0496105_0025976 3300048908 Bacteria 4772
542 Ga0496106_0123914 3300048909 Bacteria 2022
543 Ga0496107_0423469 3300048910 Bacteria 990
544 Ga0496108_0412522 3300048911 Bacteria 1180
545 Ga0496110_0067898 3300048913 Bacteria 3155
546 Ga0496110_0072369 3300048913 Bacteria 3058
547 Ga0496110_0287222 3300048913 Bacteria 1498
548 Ga0496111_0137037 3300048914 Bacteria 1813
549 Ga0496111_0172463 3300048914 Bacteria 1607
550 Ga0496114_0072792 3300048917 Bacteria 2891
551 Ga0496115_0004095 3300048918 Bacteria 10527
552 Ga0496116_0000596 3300048919 Bacteria 48028
553 Ga0496116_0010830 3300048919 Bacteria 7606
554 Ga0496116_0030387 3300048919 Bacteria 3881
555 Ga0496116_0108081 3300048919 Bacteria 1643
556 Ga0496116_0135126 3300048919 Bacteria 1398
557 Ga0496117_0028533 3300048920 Bacteria 4320
558 Ga0496117_0223145 3300048920 Bacteria 1047
559 Ga0496118_0004128 3300048921 Bacteria 17573
560 Ga0496118_0016121 3300048921 Bacteria 6872
561 Ga0496118_0047711 3300048921 Bacteria 3316
562 Ga0496119_0000682 3300048922 Bacteria 45362
563 Ga0496119_0006105 3300048922 Bacteria 11283
564 Ga0496119_0092451 3300048922 Bacteria 1716
565 Ga0496120_0000678 3300048923 Bacteria 49988
566 Ga0496120_0010297 3300048923 Bacteria 6538
567 Ga0496120_0084670 3300048923 Bacteria 1708
568 Ga0496121_0269419 3300048924 Bacteria 1171
569 Ga0496121_0270710 3300048924 Bacteria 1167
570 Ga0496121_0322973 3300048924 Bacteria 1038
571 Ga0496122_0017422 3300048925 Bacteria 6718
572 Ga0496122_0044689 3300048925 Bacteria 3453
573 Ga0496122_0053526 3300048925 Bacteria 3042
574 Ga0496122_0077691 3300048925 Bacteria 2329
575 Ga0496122_0138161 3300048925 Bacteria 1531
576 Ga0496122_0223970 3300048925 Bacteria 1076
577 Ga0496123_0000108 3300048926 Bacteria 166102
578 Ga0496123_0082204 3300048926 Bacteria 1954
579 Ga0496124_0000542 3300048927 Bacteria 64211
580 Ga0496124_0008708 3300048927 Bacteria 10546
581 Ga0496124_0048959 3300048927 Bacteria 3607
582 Ga0496124_0198462 3300048927 Bacteria 1528
583 Ga0496124_0222762 3300048927 Bacteria 1417
584 Ga0496124_0344690 3300048927 Bacteria 1056
585 Ga0496125_0000920 3300048928 Bacteria 46265
586 Ga0496125_0008866 3300048928 Bacteria 10448
587 Ga0496125_0059271 3300048928 Bacteria 3086
588 Ga0496125_0117968 3300048928 Bacteria 1902
589 Ga0496125_0187609 3300048928 Bacteria 1369
590 Ga0496125_0225309 3300048928 Bacteria 1204
591 Ga0496126_0005347 3300048929 Bacteria 14684
592 Ga0496126_0012013 3300048929 Bacteria 8899
593 Ga0501032_0007886 3300049569 Bacteria 7756
594 Ga0501033_0053132 3300049570 Bacteria 3001
595 Ga0501034_0046544 3300049571 Bacteria 4382
596 Ga0501034_0131514 3300049571 Bacteria 2485
597 Ga0501034_0180621 3300049571 Unclassified 2075
598 Ga0501036_0002624 3300049572 Bacteria 14176
599 Ga0501036_0103759 3300049572 Bacteria 2404
600 Ga0501036_0114526 3300049572 Bacteria 2279
601 Ga0501036_0264858 3300049572 Bacteria 1439
602 Ga0501036_0422520 3300049572 Bacteria 1111
603 Ga0501037_0066636 3300049573 Bacteria 2622
604 Ga0501037_0263019 3300049573 Bacteria 1205
605 Ga0501037_0294303 3300049573 Bacteria 1128
606 Ga0501038_0006635 3300049574 Bacteria 10705
607 Ga0501038_0092190 3300049574 Bacteria 2537
608 Ga0501038_0560320 3300049574 Bacteria 868
609 Ga0501039_0012059 3300049575 Bacteria 6589
610 Ga0501039_0208127 3300049575 Bacteria 1538
611 Ga0501039_0331964 3300049575 Bacteria 1195
612 Ga0501039_0589796 3300049575 Bacteria 871
613 Ga0501039_0753478 3300049575 Bacteria 760
614 Ga0501042_0008784 3300049578 Bacteria 6699
615 Ga0501042_0199012 3300049578 Bacteria 1445
616 Ga0501043_0007806 3300049579 Bacteria 8458
617 Ga0501043_0399674 3300049579 Bacteria 1038
618 Ga0501046_0005506 3300049580 Bacteria 11310
619 Ga0501046_0034919 3300049580 Bacteria 4055
620 Ga0501047_0000522 3300049581 Bacteria 41607
621 Ga0501047_0005585 3300049581 Bacteria 11841
622 Ga0501047_0064631 3300049581 Bacteria 3529
623 Ga0501047_0398911 3300049581 Bacteria 1208
624 Ga0501047_0644984 3300049581 Bacteria 878
625 Ga0501048_0078533 3300049582 Bacteria 2329
626 Ga0501048_0325780 3300049582 Bacteria 1094
627 Ga0501048_0381736 3300049582 Bacteria 1006
628 Ga0501048_0386765 3300049582 Bacteria 999
629 Ga0501067_0016902 3300049583 Bacteria 4030
630 Ga0501067_0091580 3300049583 Bacteria 1688
631 Ga0501067_0195615 3300049583 Bacteria 1126
632 Ga0501067_0249256 3300049583 Bacteria 988
633 Ga0501069_0081821 3300049585 Bacteria 1819
634 Ga0501069_0105371 3300049585 Bacteria 1602
635 Ga0501071_0044932 3300049587 Bacteria 3170
636 Ga0501071_0120585 3300049587 Bacteria 1944
637 Ga0501072_0089875 3300049588 Bacteria 2438
638 Ga0501072_0153936 3300049588 Bacteria 1833
639 Ga0501072_0429803 3300049588 Bacteria 1046
640 Ga0501073_0015241 3300049589 Bacteria 5576
641 Ga0501073_0028689 3300049589 Bacteria 3976
642 Ga0501073_0049769 3300049589 Bacteria 2937
643 Ga0501073_0097478 3300049589 Bacteria 2042
644 Ga0501073_0114704 3300049589 Bacteria 1868
645 Ga0501073_0339735 3300049589 Bacteria 1036
646 Ga0501075_0155825 3300049591 Bacteria 1741
647 Ga0501076_0011770 3300049592 Bacteria 6532
648 Ga0501225_0007216 3300049705 Bacteria 3225
649 Ga0501080_0192021 3300049742 Bacteria 1876
650 Ga0501080_0313276 3300049742 Bacteria 1422
651 Ga0501080_0672822 3300049742 Bacteria 914
652 Ga0501083_0006222 3300049744 Bacteria 8467
653 Ga0501083_0081008 3300049744 Bacteria 2152
654 Ga0501083_0187637 3300049744 Bacteria 1349
655 Ga0501262_000418 3300049759 Bacteria 5128
656 Ga0501035_0116026 3300049822 Bacteria 2343
657 Ga0501044_0000183 3300049823 Bacteria 77954
658 Ga0501044_0007969 3300049823 Bacteria 11637
659 Ga0501044_0218839 3300049823 Bacteria 1855
660 Ga0501045_0085194 3300049824 Bacteria 2332
661 nmdc:mga03683_1803_c1 3300050489 Bacteria 6494
662 nmdc:mga03n38_252897_c1 3300050490 Bacteria 931
663 nmdc:mga03n38_87449_c1 3300050490 Bacteria 1477
664 nmdc:mga00v17_117111_c1 3300050491 Bacteria 1694
665 nmdc:mga00v17_30760_c1 3300050491 Bacteria 3160
666 nmdc:mga0k408_41463_c1 3300050493 Bacteria 2650
667 nmdc:mga0k408_44683_c1 3300050493 Bacteria 2555
668 nmdc:mga06z11_114667_c1 3300050494 Bacteria 1496
669 nmdc:mga06z11_123977_c1 3300050494 Bacteria 1444
670 nmdc:mga07m45_22269_c1 3300050496 Bacteria 3458
671 nmdc:mga07m45_3731_c1 3300050496 Bacteria 7374
672 nmdc:mga07m45_69128_c1 3300050496 Bacteria 2008
673 nmdc:mga07m45_72022_c1 3300050496 Bacteria 1967
674 nmdc:mga05p37_777838_c1 3300050507 Bacteria 1051
675 nmdc:mga09592_7151_c1 3300050508 Bacteria 9071
676 nmdc:mga0qj67_22757_c1 3300050509 Bacteria 4814
677 nmdc:mga0qj67_317379_c1 3300050509 Bacteria 1261
678 nmdc:mga0qj67_37458_c1 3300050509 Bacteria 3799
679 nmdc:mga06r32_487803_c1 3300050510 Bacteria 1210
680 nmdc:mga06r32_83805_c1 3300050510 Bacteria 3107
681 nmdc:mga08y16_1000_c1 3300050511 Bacteria 27606
682 nmdc:mga08y16_346177_c1 3300050511 Bacteria 1527
683 nmdc:mga0n895_29647_c1 3300050512 Bacteria 5222
684 nmdc:mga0n895_4457_c1 3300050512 Bacteria 11505
685 nmdc:mga0rr50_4295_c1 3300050513 Bacteria 8344
686 nmdc:mga0a205_21378_c1 3300050515 Bacteria 6122
687 nmdc:mga0a205_725_c1 3300050515 Bacteria 26539
688 Ga0495601_0010487 3300053077 Bacteria 5517
689 Ga0500610_0037924 3300053079 Bacteria 2482
690 Ga0500610_0040179 3300053079 Bacteria 2416
691 Ga0495655_0091867 3300053083 Bacteria 885
692 Ga0495619_0040142 3300053085 Bacteria 3059
693 Ga0500643_003606 3300053087 Bacteria 7353
694 Ga0500646_0134545 3300053090 Bacteria 806
695 Ga0500651_0000090 3300053093 Bacteria 58811
696 Ga0500566_0031058 3300053094 Bacteria 3115
697 Ga0500641_0035978 3300053096 Bacteria 1979
698 Ga0500571_000014 3300053110 Bacteria 67097
699 Ga0500572_006241 3300053111 Bacteria 2726
700 Ga0500593_001335 3300053117 Bacteria 8884
701 Ga0500594_0000375 3300053118 Bacteria 9973
702 Ga0500594_0001172 3300053118 Bacteria 5659
703 Ga0500607_000328 3300053121 Bacteria 44883
704 Ga0500608_003138 3300053122 Bacteria 6133
705 Ga0500608_055924 3300053122 Bacteria 1891
706 Ga0500618_013715 3300053125 Bacteria 2088
707 Ga0500655_000075 3300053133 Bacteria 26773
708 Ga0500658_0000018 3300053134 Bacteria 141217
709 Ga0500658_0000322 3300053134 Bacteria 21148
710 Ga0500559_0000011 3300053136 Bacteria 164751
711 Ga0500559_0009178 3300053136 Bacteria 4294
712 Ga0500559_0010108 3300053136 Bacteria 4061
713 Ga0500559_0011930 3300053136 Bacteria 3703
714 Ga0500568_0049088 3300053139 Bacteria 1666
715 Ga0500573_0013759 3300053140 Bacteria 4567
716 Ga0500574_016421 3300053141 Bacteria 1788
717 Ga0500604_0068011 3300053151 Bacteria 1131
718 Ga0500616_0122204 3300053153 Bacteria 1242
719 Ga0500622_0002568 3300053156 Bacteria 13011
720 Ga0500622_0027911 3300053156 Bacteria 2974
721 Ga0500627_0001126 3300053158 Bacteria 7324
722 Ga0500634_0043273 3300053161 Bacteria 2441
723 Ga0500638_007322 3300053162 Bacteria 4606
724 Ga0500565_001028 3300053734 Bacteria 1747
725 Ga0500587_000071 3300053739 Bacteria 8323
726 Ga0501084_0011445 3300054114 Bacteria 7346
727 Ga0501084_0050809 3300054114 Bacteria 3469
728 Ga0501084_0107602 3300054114 Bacteria 2342
729 Ga0501084_0150072 3300054114 Bacteria 1964
730 Ga0590071_000671 3300059421 Bacteria 9700
731 Ga0590074_001247 3300059423 Bacteria 4036
732 Ga0590075_000135 3300059424 Bacteria 19348
733 Ga0590077_000917 3300059426 Bacteria 7505
734 Ga0501082_0007506 3300060353 Bacteria 9412
735 Ga0501082_0009486 3300060353 Bacteria 8379
736 Ga0501082_0093551 3300060353 Bacteria 2597
737 Ga0501082_0190467 3300060353 Bacteria 1784
738 Ga0501082_0327616 3300060353 Bacteria 1334
739 Ga0466962_0035738 3300061719 Bacteria 2377

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053083 Ga0495655_0091867 Ga0495655_0091867_183_848 212
2 3300049575 Ga0501039_0753478 Ga0501039_0753478_51_749 214
3 iso_pu_bacteria 2563366752 2563930593 218
4 3300031665 Ga0316575_10001169 Ga0316575_100011695 230
5 3300046529 Ga0495652_0474842 Ga0495652_0474842_11_772 230
6 3300003203 JGI25406J46586_10004609 JGI25406J46586_100046096 238
7 3300005473 Ga0074250_12230 Ga0074250_122301 238
8 3300006846 Ga0075430_100234007 Ga0075430_1002340072 238
9 3300006880 Ga0075429_100025948 Ga0075429_1000259484 238
10 3300009011 Ga0105251_10088378 Ga0105251_100883783 238
11 3300009036 Ga0105244_10012501 Ga0105244_100125013 238
12 3300009036 Ga0105244_10062105 Ga0105244_100621051 238
13 3300009036 Ga0105244_10221842 Ga0105244_102218421 238
14 3300009036 Ga0105244_10232879 Ga0105244_102328791 238
15 3300009092 Ga0105250_10028905 Ga0105250_100289053 238
16 3300009093 Ga0105240_10096400 Ga0105240_100964005 238
17 3300009101 Ga0105247_10010556 Ga0105247_100105568 238
18 3300009147 Ga0114129_10964067 Ga0114129_109640672 238
19 3300009148 Ga0105243_10000005 Ga0105243_10000005188 238
20 3300011119 Ga0105246_10721820 Ga0105246_107218201 238
21 3300013102 Ga0157371_10011368 Ga0157371_100113683 238
22 3300025711 Ga0207696_1001081 Ga0207696_10010815 238
23 3300025735 Ga0207713_1010478 Ga0207713_10104785 238
24 3300027907 Ga0207428_10025611 Ga0207428_100256112 238
25 3300037068 Ga0373925_0162515 Ga0373925_0162515_95_847 238
26 3300042016 Ga0439463_010290 Ga0439463_010290_285_1034 238
27 3300042157 Ga0439458_0003995 Ga0439458_0003995_1675_2424 238
28 3300042461 Ga0439460_0071563 Ga0439460_0071563_158_907 238
29 3300042530 Ga0450916_005301 Ga0450916_005301_654_1403 238
30 3300042993 Ga0439440_0026087 Ga0439440_0026087_40_789 238
31 3300044684 Ga0466966_0197596 Ga0466966_0197596_54_806 238
32 3300045976 Ga0466967_0984494 Ga0466967_0984494_31_780 238
33 3300048913 Ga0496110_0287222 Ga0496110_0287222_621_1370 238
34 3300048919 Ga0496116_0030387 Ga0496116_0030387_1255_1998 238
35 3300048923 Ga0496120_0010297 Ga0496120_0010297_5694_6437 238
36 3300048923 Ga0496120_0084670 Ga0496120_0084670_602_1345 238
37 3300048924 Ga0496121_0270710 Ga0496121_0270710_160_903 238
38 3300048924 Ga0496121_0322973 Ga0496121_0322973_265_1008 238
39 3300048927 Ga0496124_0344690 Ga0496124_0344690_40_783 238
40 3300048928 Ga0496125_0000920 Ga0496125_0000920_44944_45687 238
41 3300050507 nmdc:mga05p37_777838_c1 nmdc:mga05p37_777838_c1_107_895 238
42 3300050508 nmdc:mga09592_7151_c1 nmdc:mga09592_7151_c1_4725_5513 238
43 3300050509 nmdc:mga0qj67_317379_c1 nmdc:mga0qj67_317379_c1_268_1056 238
44 3300050511 nmdc:mga08y16_1000_c1 nmdc:mga08y16_1000_c1_648_1436 238
45 3300006846 Ga0075430_100091033 Ga0075430_1000910332 239
46 3300006847 Ga0075431_100018061 Ga0075431_1000180612 239
47 3300050509 nmdc:mga0qj67_37458_c1 nmdc:mga0qj67_37458_c1_1679_2458 239
48 3300005455 Ga0070663_100281408 Ga0070663_1002814082 240
49 iso_pu_bacteria 2888578766 2888578955 241
50 3300031727 Ga0316576_10083412 Ga0316576_100834123 242
51 iso_pu_bacteria 2818991459 2819676046 242
52 iso_pu_bacteria 2864733723 2864738816 242
53 iso_pu_bacteria 2881636855 2881639589 242
54 iso_pu_bacteria 2889049205 2889052511 242
55 iso_pu_bacteria 2904755435 2904758162 242
56 iso_pu_bacteria 2929206907 2929207110 242
57 iso_pu_bacteria 2939679117 2939685029 242
58 iso_pu_bacteria 2984527788 2984531980 242
59 iso_pu_bacteria 2984532647 2984533234 242
60 iso_pu_bacteria 8057733483 8057735771 242
61 iso_pu_bacteria 8057977335 8057979760 242
62 3300005329 Ga0070683_100312193 Ga0070683_1003121932 243
63 3300009176 Ga0105242_10279982 Ga0105242_102799822 243
64 3300046454 Ga0495592_0155355 Ga0495592_0155355_463_1230 243
65 3300046511 Ga0495608_0052256 Ga0495608_0052256_76_843 243
66 3300046559 Ga0495667_0148430 Ga0495667_0148430_82_849 243
67 3300047317 Ga0495604_0061684 Ga0495604_0061684_1942_2709 243
68 3300049571 Ga0501034_0180621 Ga0501034_0180621_1252_2016 243
69 3300049574 Ga0501038_0092190 Ga0501038_0092190_934_1722 243
70 3300053085 Ga0495619_0040142 Ga0495619_0040142_185_952 243
71 iso_pu_bacteria 2548877040 2550903433 243
72 iso_pu_bacteria 2571042143 2571530876 243
73 iso_pu_bacteria 2571042588 2573041707 243
74 iso_pu_bacteria 2576861424 2578334537 243
75 iso_pu_bacteria 2579778775 2580930452 243
76 iso_pu_bacteria 2600255286 2601636910 243
77 iso_pu_bacteria 2619619294 2621272563 243
78 iso_pu_bacteria 2643221543 2643738691 243
79 iso_pu_bacteria 2721755693 2723601374 243
80 iso_pu_bacteria 2728368933 2728529743 243
81 iso_pu_bacteria 2728369359 2730137497 243
82 iso_pu_bacteria 2751185905 2753812984 243
83 iso_pu_bacteria 2802428803 2802440567 243
84 iso_pu_bacteria 2821111986 2821118263 243
85 iso_pu_bacteria 2885526491 2885529778 243
86 iso_pu_bacteria 2889276214 2889277467 243
87 iso_pu_bacteria 2904162308 2904167383 243
88 iso_pu_bacteria 2904490793 2904496856 243
89 iso_pu_bacteria 2904595352 2904601013 243
90 iso_pu_bacteria 2907202186 2907205061 243
91 iso_pu_bacteria 2931384279 2931385900 243
92 iso_pu_bacteria 2938649242 2938653451 243
93 iso_pu_bacteria 2939702853 2939706830 243
94 iso_pu_bacteria 2946053406 2946058204 243
95 iso_pu_bacteria 2968558590 2968562218 243
96 iso_pu_bacteria 2971403814 2971406907 243
97 iso_pu_bacteria 2988225383 2988230062 243
98 iso_pu_bacteria 2996632988 2996637389 243
99 iso_pu_bacteria 2996706504 2996711041 243
100 iso_pu_bacteria 648028048 648167958 243
101 iso_pu_bacteria 8054465665 8054468521 243
102 3300005841 Ga0068863_100009589 Ga0068863_1000095896 244
103 3300009177 Ga0105248_10468699 Ga0105248_104686992 244
104 3300025941 Ga0207711_10297692 Ga0207711_102976922 244
105 3300026088 Ga0207641_10009620 Ga0207641_100096206 244
106 3300028800 Ga0265338_10010944 Ga0265338_100109443 244
107 3300029957 Ga0265324_10024436 Ga0265324_100244362 244
108 3300031240 Ga0265320_10048560 Ga0265320_100485602 244
109 3300031240 Ga0265320_10136512 Ga0265320_101365121 244
110 3300031250 Ga0265331_10034829 Ga0265331_100348292 244
111 3300031250 Ga0265331_10043885 Ga0265331_100438852 244
112 3300031344 Ga0265316_10008373 Ga0265316_100083733 244
113 3300031344 Ga0265316_10012742 Ga0265316_100127424 244
114 3300031344 Ga0265316_10124170 Ga0265316_101241702 244
115 3300031712 Ga0265342_10045457 Ga0265342_100454572 244
116 3300042004 Ga0439445_0009924 Ga0439445_0009924_1471_2226 244
117 3300042122 Ga0450920_020777 Ga0450920_020777_23_781 244
118 3300042184 Ga0450908_014546 Ga0450908_014546_47_805 244
119 3300045051 Ga0451576_0888064 Ga0451576_0888064_18_785 244
120 3300046674 Ga0495588_0067289 Ga0495588_0067289_992_1747 244
121 3300048911 Ga0496108_0412522 Ga0496108_0412522_408_1163 244
122 3300053111 Ga0500572_006241 Ga0500572_006241_182_937 244
123 3300053118 Ga0500594_0001172 Ga0500594_0001172_3278_4033 244
124 3300053136 Ga0500559_0010108 Ga0500559_0010108_993_1748 244
125 iso_pu_bacteria 2551306352 2552749147 244
126 iso_pu_bacteria 2554235469 2556066060 244
127 iso_pu_bacteria 2639762793 2640734095 244
128 iso_pu_bacteria 2643221665 2644361228 244
129 iso_pu_bacteria 2675903507 2678231069 244
130 iso_pu_bacteria 2744054655 2745160193 244
131 iso_pu_bacteria 2773857761 2774388382 244
132 iso_pu_bacteria 2773857770 2774437584 244
133 iso_pu_bacteria 2904113452 2904119525 244
134 iso_pu_bacteria 2916699645 2916702080 244
135 iso_pu_bacteria 2919182534 2919183981 244
136 iso_pu_bacteria 2919506607 2919507812 244
137 iso_pu_bacteria 2928515477 2928518123 244
138 iso_pu_bacteria 2984568884 2984570157 244
139 iso_pu_bacteria 8033232454 8033232739 244
140 3300003751 Ga0055538_1000176 Ga0055538_100017641 245
141 3300005546 Ga0070696_100009243 Ga0070696_1000092434 245
142 3300025224 Ga0209784_100151 Ga0209784_10015149 245
143 3300048919 Ga0496116_0010830 Ga0496116_0010830_3198_3962 245
144 3300048922 Ga0496119_0000682 Ga0496119_0000682_31623_32387 245
145 3300048923 Ga0496120_0000678 Ga0496120_0000678_12977_13741 245
146 3300048925 Ga0496122_0077691 Ga0496122_0077691_1509_2273 245
147 3300048926 Ga0496123_0082204 Ga0496123_0082204_765_1529 245
148 3300048927 Ga0496124_0000542 Ga0496124_0000542_50472_51236 245
149 3300048928 Ga0496125_0117968 Ga0496125_0117968_50_814 245
150 3300048929 Ga0496126_0005347 Ga0496126_0005347_13513_14277 245
151 3300049571 Ga0501034_0046544 Ga0501034_0046544_1808_2590 245
152 3300049571 Ga0501034_0131514 Ga0501034_0131514_883_1671 245
153 3300049572 Ga0501036_0002624 Ga0501036_0002624_8116_8898 245
154 3300049572 Ga0501036_0422520 Ga0501036_0422520_215_1003 245
155 3300049573 Ga0501037_0294303 Ga0501037_0294303_98_886 245
156 3300049574 Ga0501038_0006635 Ga0501038_0006635_4610_5392 245
157 3300049578 Ga0501042_0199012 Ga0501042_0199012_545_1327 245
158 3300049579 Ga0501043_0007806 Ga0501043_0007806_6385_7173 245
159 3300049580 Ga0501046_0005506 Ga0501046_0005506_5356_6138 245
160 3300049581 Ga0501047_0000522 Ga0501047_0000522_696_1484 245
161 3300049581 Ga0501047_0005585 Ga0501047_0005585_4157_4939 245
162 3300049582 Ga0501048_0078533 Ga0501048_0078533_106_894 245
163 3300049582 Ga0501048_0386765 Ga0501048_0386765_96_878 245
164 3300049583 Ga0501067_0249256 Ga0501067_0249256_130_918 245
165 3300049585 Ga0501069_0105371 Ga0501069_0105371_684_1466 245
166 3300049589 Ga0501073_0015241 Ga0501073_0015241_598_1380 245
167 3300049589 Ga0501073_0097478 Ga0501073_0097478_1183_1971 245
168 3300049744 Ga0501083_0187637 Ga0501083_0187637_23_811 245
169 3300049823 Ga0501044_0007969 Ga0501044_0007969_6572_7354 245
170 3300054114 Ga0501084_0011445 Ga0501084_0011445_2559_3347 245
171 3300054114 Ga0501084_0150072 Ga0501084_0150072_25_807 245
172 3300060353 Ga0501082_0009486 Ga0501082_0009486_4393_5175 245
173 3300060353 Ga0501082_0327616 Ga0501082_0327616_183_971 245
174 iso_pu_bacteria 2971511577 2971513844 245
175 iso_pu_bacteria 2980176882 2980179565 245
176 3300003578 Ga0006562J51391_1023071 Ga0006562J51391_10230712 246
177 3300003761 Ga0055535_1012267 Ga0055535_10122671 246
178 3300003841 Ga0055541_1000158 Ga0055541_100015824 246
179 3300005353 Ga0070669_100241543 Ga0070669_1002415432 246
180 3300005981 Ga0081538_10004879 Ga0081538_1000487917 246
181 3300009036 Ga0105244_10027847 Ga0105244_100278473 246
182 3300009036 Ga0105244_10042638 Ga0105244_100426382 246
183 3300011119 Ga0105246_10002991 Ga0105246_100029914 246
184 3300013102 Ga0157371_10049688 Ga0157371_100496882 246
185 3300025225 Ga0209566_100196 Ga0209566_10019614 246
186 3300025225 Ga0209566_106134 Ga0209566_1061341 246
187 3300025233 Ga0209437_100524 Ga0209437_10052414 246
188 3300025294 Ga0209025_1010001 Ga0209025_10100015 246
189 3300025728 Ga0207655_1006420 Ga0207655_10064203 246
190 3300025923 Ga0207681_10082402 Ga0207681_100824023 246
191 3300036712 Ga0316584_0005970 Ga0316584_0005970_7354_8124 246
192 3300038735 Ga0400485_05586 Ga0400485_05586_1169_1969 246
193 3300038741 Ga0400488_16420 Ga0400488_16420_857_1657 246
194 3300038742 Ga0400486_12391 Ga0400486_12391_1544_2344 246
195 3300046457 Ga0495590_0005550 Ga0495590_0005550_4109_4879 246
196 3300046458 Ga0495591_039412 Ga0495591_039412_241_1011 246
197 3300046810 Ga0495660_0004595 Ga0495660_0004595_4574_5344 246
198 3300048919 Ga0496116_0000596 Ga0496116_0000596_34308_35096 246
199 3300048919 Ga0496116_0108081 Ga0496116_0108081_171_938 246
200 3300048921 Ga0496118_0047711 Ga0496118_0047711_269_1039 246
201 3300048922 Ga0496119_0006105 Ga0496119_0006105_4138_4908 246
202 3300048924 Ga0496121_0269419 Ga0496121_0269419_210_989 246
203 3300048925 Ga0496122_0044689 Ga0496122_0044689_1632_2402 246
204 3300048925 Ga0496122_0053526 Ga0496122_0053526_393_1181 246
205 3300048927 Ga0496124_0198462 Ga0496124_0198462_728_1516 246
206 3300048928 Ga0496125_0187609 Ga0496125_0187609_586_1353 246
207 3300048929 Ga0496126_0012013 Ga0496126_0012013_3947_4717 246
208 3300049569 Ga0501032_0007886 Ga0501032_0007886_6919_7719 246
209 3300049572 Ga0501036_0103759 Ga0501036_0103759_243_1037 246
210 3300049572 Ga0501036_0264858 Ga0501036_0264858_37_831 246
211 3300049573 Ga0501037_0066636 Ga0501037_0066636_882_1676 246
212 3300049573 Ga0501037_0263019 Ga0501037_0263019_271_1071 246
213 3300049575 Ga0501039_0331964 Ga0501039_0331964_197_991 246
214 3300049579 Ga0501043_0399674 Ga0501043_0399674_104_904 246
215 3300049581 Ga0501047_0398911 Ga0501047_0398911_47_841 246
216 3300049581 Ga0501047_0644984 Ga0501047_0644984_39_833 246
217 3300049582 Ga0501048_0325780 Ga0501048_0325780_35_829 246
218 3300049582 Ga0501048_0381736 Ga0501048_0381736_160_960 246
219 3300049583 Ga0501067_0016902 Ga0501067_0016902_315_1109 246
220 3300049583 Ga0501067_0195615 Ga0501067_0195615_219_1019 246
221 3300049585 Ga0501069_0081821 Ga0501069_0081821_853_1653 246
222 3300049588 Ga0501072_0153936 Ga0501072_0153936_346_1140 246
223 3300049589 Ga0501073_0028689 Ga0501073_0028689_849_1649 246
224 3300049589 Ga0501073_0049769 Ga0501073_0049769_472_1266 246
225 3300049589 Ga0501073_0339735 Ga0501073_0339735_212_1006 246
226 3300049742 Ga0501080_0192021 Ga0501080_0192021_681_1475 246
227 3300049742 Ga0501080_0672822 Ga0501080_0672822_65_865 246
228 3300049744 Ga0501083_0006222 Ga0501083_0006222_7192_7986 246
229 3300049744 Ga0501083_0081008 Ga0501083_0081008_1136_1936 246
230 3300049823 Ga0501044_0218839 Ga0501044_0218839_53_847 246
231 3300054114 Ga0501084_0107602 Ga0501084_0107602_1458_2252 246
232 3300060353 Ga0501082_0093551 Ga0501082_0093551_552_1352 246
233 3300060353 Ga0501082_0190467 Ga0501082_0190467_345_1139 246
234 iso_pu_bacteria 2889042446 2889042475 246
235 iso_pu_bacteria 2945991243 2945995497 246
236 3300005333 Ga0070677_10009459 Ga0070677_100094592 247
237 3300005367 Ga0070667_100393519 Ga0070667_1003935192 247
238 3300006846 Ga0075430_100015143 Ga0075430_1000151433 247
239 3300006847 Ga0075431_100026019 Ga0075431_1000260192 247
240 3300009176 Ga0105242_10599796 Ga0105242_105997962 247
241 3300031235 Ga0265330_10066331 Ga0265330_100663312 247
242 3300031711 Ga0265314_10011481 Ga0265314_100114818 247
243 3300048925 Ga0496122_0138161 Ga0496122_0138161_43_807 247
244 3300049572 Ga0501036_0114526 Ga0501036_0114526_180_959 247
245 3300049575 Ga0501039_0012059 Ga0501039_0012059_5182_5961 247
246 3300049578 Ga0501042_0008784 Ga0501042_0008784_51_830 247
247 3300049580 Ga0501046_0034919 Ga0501046_0034919_2136_2915 247
248 3300049587 Ga0501071_0044932 Ga0501071_0044932_917_1696 247
249 3300049589 Ga0501073_0114704 Ga0501073_0114704_236_1015 247
250 3300049591 Ga0501075_0155825 Ga0501075_0155825_952_1731 247
251 3300049592 Ga0501076_0011770 Ga0501076_0011770_1041_1820 247
252 3300050509 nmdc:mga0qj67_22757_c1 nmdc:mga0qj67_22757_c1_1805_2584 247
253 3300050510 nmdc:mga06r32_487803_c1 nmdc:mga06r32_487803_c1_201_980 247
254 3300050510 nmdc:mga06r32_83805_c1 nmdc:mga06r32_83805_c1_557_1336 247
255 3300054114 Ga0501084_0050809 Ga0501084_0050809_1481_2260 247
256 3300059421 Ga0590071_000671 Ga0590071_000671_2177_2950 247
257 3300059423 Ga0590074_001247 Ga0590074_001247_2154_2927 247
258 3300059424 Ga0590075_000135 Ga0590075_000135_1507_2280 247
259 3300059426 Ga0590077_000917 Ga0590077_000917_724_1497 247
260 3300060353 Ga0501082_0007506 Ga0501082_0007506_1098_1877 247
261 iso_pu_bacteria 8002392321 8002394423 247
262 iso_pu_bacteria 8048746797 8048749310 247
263 iso_pu_bacteria 8055225921 8055228117 247
264 3300003578 Ga0006562J51391_1014207 Ga0006562J51391_10142073 248
265 3300003856 Ga0058692_1000003 Ga0058692_1000003113 248
266 3300005272 Ga0065703_1000145 Ga0065703_100014559 248
267 3300005334 Ga0068869_100016290 Ga0068869_1000162902 248
268 3300005338 Ga0068868_100137282 Ga0068868_1001372823 248
269 3300005353 Ga0070669_100120891 Ga0070669_1001208912 248
270 3300005364 Ga0070673_100175986 Ga0070673_1001759861 248
271 3300005718 Ga0068866_10069945 Ga0068866_100699452 248
272 3300005841 Ga0068863_100729575 Ga0068863_1007295752 248
273 3300005842 Ga0068858_100038966 Ga0068858_1000389666 248
274 3300006237 Ga0097621_100203292 Ga0097621_1002032922 248
275 3300009176 Ga0105242_10221796 Ga0105242_102217961 248
276 3300010375 Ga0105239_10622341 Ga0105239_106223411 248
277 3300011119 Ga0105246_10075113 Ga0105246_100751132 248
278 3300013297 Ga0157378_10136035 Ga0157378_101360353 248
279 3300014968 Ga0157379_10543019 Ga0157379_105430191 248
280 3300014969 Ga0157376_10114435 Ga0157376_101144353 248
281 3300017792 Ga0163161_10483552 Ga0163161_104835522 248
282 3300025728 Ga0207655_1002033 Ga0207655_100203313 248
283 3300025728 Ga0207655_1002576 Ga0207655_100257613 248
284 3300025728 Ga0207655_1002672 Ga0207655_10026729 248
285 3300025728 Ga0207655_1002703 Ga0207655_10027039 248
286 3300025900 Ga0207710_10000172 Ga0207710_1000017221 248
287 3300025923 Ga0207681_10205550 Ga0207681_102055502 248
288 3300025935 Ga0207709_10000001 Ga0207709_100000011239 248
289 3300025941 Ga0207711_10049953 Ga0207711_100499534 248
290 3300025942 Ga0207689_10015046 Ga0207689_100150462 248
291 3300026035 Ga0207703_10006312 Ga0207703_100063123 248
292 3300027312 Ga0209371_1000006 Ga0209371_1000006391 248
293 3300027907 Ga0207428_10025463 Ga0207428_100254634 248
294 3300030500 Ga0268256_1000007 Ga0268256_1000007391 248
295 3300031548 Ga0307408_100159897 Ga0307408_1001598972 248
296 3300032002 Ga0307416_100126598 Ga0307416_1001265982 248
297 3300032126 Ga0307415_100121710 Ga0307415_1001217102 248
298 3300042876 Ga0451577_0523177 Ga0451577_0523177_231_992 248
299 3300048918 Ga0496115_0004095 Ga0496115_0004095_5062_5847 248
300 3300049575 Ga0501039_0589796 Ga0501039_0589796_28_807 248
301 3300049587 Ga0501071_0120585 Ga0501071_0120585_1121_1900 248
302 3300049588 Ga0501072_0429803 Ga0501072_0429803_136_915 248
303 3300049742 Ga0501080_0313276 Ga0501080_0313276_245_1024 248
304 3300053077 Ga0495601_0010487 Ga0495601_0010487_2565_3359 248
305 3300005445 Ga0070708_100181819 Ga0070708_1001818192 249
306 3300005468 Ga0070707_100520909 Ga0070707_1005209092 249
307 3300006175 Ga0070712_100291695 Ga0070712_1002916952 249
308 3300006237 Ga0097621_100183013 Ga0097621_1001830131 249
309 3300006847 Ga0075431_100054811 Ga0075431_1000548113 249
310 3300006852 Ga0075433_10002638 Ga0075433_100026384 249
311 3300006852 Ga0075433_10090205 Ga0075433_100902052 249
312 3300006871 Ga0075434_100005021 Ga0075434_1000050217 249
313 3300006871 Ga0075434_100025406 Ga0075434_1000254062 249
314 3300007076 Ga0075435_100006375 Ga0075435_1000063754 249
315 3300013307 Ga0157372_10083033 Ga0157372_100830332 249
316 3300021361 Ga0213872_10001126 Ga0213872_1000112615 249
317 3300021377 Ga0213874_10007518 Ga0213874_100075182 249
318 3300028556 Ga0265337_1053412 Ga0265337_10534122 249
319 3300028573 Ga0265334_10000827 Ga0265334_1000082710 249
320 3300028800 Ga0265338_10011529 Ga0265338_1001152913 249
321 3300028800 Ga0265338_10042697 Ga0265338_100426972 249
322 3300031238 Ga0265332_10064125 Ga0265332_100641252 249
323 3300031239 Ga0265328_10019905 Ga0265328_100199053 249
324 3300031344 Ga0265316_10085054 Ga0265316_100850543 249
325 3300031711 Ga0265314_10012964 Ga0265314_100129645 249
326 3300031711 Ga0265314_10128646 Ga0265314_101286462 249
327 3300031711 Ga0265314_10151812 Ga0265314_101518121 249
328 3300031901 Ga0307406_10380051 Ga0307406_103800512 249
329 3300035170 Ga0373943_0081189 Ga0373943_0081189_256_1110 249
330 3300035172 Ga0373955_0073008 Ga0373955_0073008_542_1324 249
331 3300039447 Ga0436361_0109034 Ga0436361_0109034_342_1133 249
332 3300039447 Ga0436361_0168382 Ga0436361_0168382_33_812 249
333 3300039447 Ga0436361_0653184 Ga0436361_0653184_34563_35339 249
334 3300039450 Ga0436363_1281725 Ga0436363_1281725_2070_2849 249
335 3300041413 Ga0439465_0132803 Ga0439465_0132803_51_845 249
336 3300045051 Ga0451576_0062335 Ga0451576_0062335_3001_3780 249
337 3300046533 Ga0495640_0192496 Ga0495640_0192496_43_834 249
338 3300048914 Ga0496111_0172463 Ga0496111_0172463_80_901 249
339 3300049570 Ga0501033_0053132 Ga0501033_0053132_1270_2064 249
340 3300049575 Ga0501039_0208127 Ga0501039_0208127_652_1437 249
341 3300049581 Ga0501047_0064631 Ga0501047_0064631_2221_3003 249
342 3300049588 Ga0501072_0089875 Ga0501072_0089875_1066_1851 249
343 3300049824 Ga0501045_0085194 Ga0501045_0085194_490_1275 249
344 3300050494 nmdc:mga06z11_123977_c1 nmdc:mga06z11_123977_c1_536_1369 249
345 3300050512 nmdc:mga0n895_29647_c1 nmdc:mga0n895_29647_c1_1805_2608 249
346 3300050512 nmdc:mga0n895_4457_c1 nmdc:mga0n895_4457_c1_9021_9824 249
347 3300050513 nmdc:mga0rr50_4295_c1 nmdc:mga0rr50_4295_c1_3804_4607 249
348 3300050515 nmdc:mga0a205_21378_c1 nmdc:mga0a205_21378_c1_2877_3680 249
349 3300050515 nmdc:mga0a205_725_c1 nmdc:mga0a205_725_c1_10486_11289 249
350 3300006358 Ga0068871_100064748 Ga0068871_1000647482 250
351 3300037471 Ga0395905_0000443 Ga0395905_0000443_26932_27729 250
352 3300046463 Ga0495653_0065406 Ga0495653_0065406_651_1472 250
353 3300003763 Ga0055529_1003355 Ga0055529_10033553 251
354 3300005331 Ga0070670_100126513 Ga0070670_1001265132 251
355 3300005344 Ga0070661_100009411 Ga0070661_1000094118 251
356 3300005347 Ga0070668_100030703 Ga0070668_1000307035 251
357 3300005354 Ga0070675_100171940 Ga0070675_1001719403 251
358 3300005367 Ga0070667_100200892 Ga0070667_1002008921 251
359 3300005543 Ga0070672_100151508 Ga0070672_1001515083 251
360 3300005548 Ga0070665_100088422 Ga0070665_1000884225 251
361 3300005548 Ga0070665_100839453 Ga0070665_1008394531 251
362 3300005563 Ga0068855_100107378 Ga0068855_1001073782 251
363 3300005564 Ga0070664_100009223 Ga0070664_1000092239 251
364 3300005578 Ga0068854_100024384 Ga0068854_1000243845 251
365 3300005616 Ga0068852_100033408 Ga0068852_1000334082 251
366 3300005834 Ga0068851_10010148 Ga0068851_100101485 251
367 3300005843 Ga0068860_100622858 Ga0068860_1006228582 251
368 3300006051 Ga0075364_10004388 Ga0075364_100043885 251
369 3300006051 Ga0075364_10029011 Ga0075364_100290113 251
370 3300006051 Ga0075364_10031420 Ga0075364_100314203 251
371 3300013296 Ga0157374_10233809 Ga0157374_102338092 251
372 3300025228 Ga0209672_102245 Ga0209672_1022455 251
373 3300025272 Ga0209455_1000359 Ga0209455_100035915 251
374 3300025901 Ga0207688_10052548 Ga0207688_100525481 251
375 3300025925 Ga0207650_10050473 Ga0207650_100504734 251
376 3300025940 Ga0207691_10224580 Ga0207691_102245801 251
377 3300025944 Ga0207661_10064344 Ga0207661_100643443 251
378 3300025981 Ga0207640_10038670 Ga0207640_100386702 251
379 3300026095 Ga0207676_10325469 Ga0207676_103254692 251
380 3300026121 Ga0207683_10128229 Ga0207683_101282293 251
381 3300027360 Ga0209969_1003204 Ga0209969_10032042 251
382 3300027378 Ga0209981_1018448 Ga0209981_10184481 251
383 3300027471 Ga0209995_1004345 Ga0209995_10043453 251
384 3300027695 Ga0209966_1023477 Ga0209966_10234772 251
385 3300027876 Ga0209974_10006449 Ga0209974_100064493 251
386 3300028379 Ga0268266_10023253 Ga0268266_100232538 251
387 3300028379 Ga0268266_10564629 Ga0268266_105646292 251
388 3300031239 Ga0265328_10003603 Ga0265328_100036032 251
389 3300031250 Ga0265331_10005085 Ga0265331_100050856 251
390 3300031250 Ga0265331_10102982 Ga0265331_101029822 251
391 3300031251 Ga0265327_10019851 Ga0265327_100198515 251
392 3300031251 Ga0265327_10027976 Ga0265327_100279763 251
393 3300031727 Ga0316576_10031177 Ga0316576_100311775 251
394 3300031727 Ga0316576_10091160 Ga0316576_100911603 251
395 3300031727 Ga0316576_10146743 Ga0316576_101467433 251
396 3300031728 Ga0316578_10010891 Ga0316578_100108913 251
397 3300031733 Ga0316577_10006651 Ga0316577_100066516 251
398 3300031733 Ga0316577_10063816 Ga0316577_100638162 251
399 3300031733 Ga0316577_10177270 Ga0316577_101772702 251
400 3300032137 Ga0316585_10080829 Ga0316585_100808292 251
401 3300032139 Ga0316580_10015636 Ga0316580_100156363 251
402 3300032168 Ga0316593_10001705 Ga0316593_100017052 251
403 3300032168 Ga0316593_10014207 Ga0316593_100142073 251
404 3300033529 Ga0316587_1011069 Ga0316587_10110693 251
405 3300033541 Ga0316596_1018021 Ga0316596_10180212 251
406 3300035398 Ga0316574_0206237 Ga0316574_0206237_385_1197 251
407 3300036647 Ga0316582_0045365 Ga0316582_0045365_279_1064 251
408 3300036647 Ga0316582_0176261 Ga0316582_0176261_70_870 251
409 3300036712 Ga0316584_0021546 Ga0316584_0021546_3514_4362 251
410 3300036712 Ga0316584_0086613 Ga0316584_0086613_528_1313 251
411 3300037312 Ga0395899_0098060 Ga0395899_0098060_711_1487 251
412 3300037418 Ga0395900_0061938 Ga0395900_0061938_100_870 251
413 3300038443 Ga0395901_0087577 Ga0395901_0087577_1013_1789 251
414 3300039437 Ga0436365_0488796 Ga0436365_0488796_1822_2598 251
415 3300042876 Ga0451577_0023778 Ga0451577_0023778_17_802 251
416 3300045051 Ga0451576_0001973 Ga0451576_0001973_20271_21056 251
417 3300045051 Ga0451576_0461438 Ga0451576_0461438_136_918 251
418 3300049574 Ga0501038_0560320 Ga0501038_0560320_37_819 251
419 3300049822 Ga0501035_0116026 Ga0501035_0116026_221_991 251
420 3300049823 Ga0501044_0000183 Ga0501044_0000183_18096_18866 251
421 3300050491 nmdc:mga00v17_117111_c1 nmdc:mga00v17_117111_c1_517_1296 251
422 3300050491 nmdc:mga00v17_30760_c1 nmdc:mga00v17_30760_c1_1938_2726 251
423 3300050511 nmdc:mga08y16_346177_c1 nmdc:mga08y16_346177_c1_330_1103 251
424 iso_pu_bacteria 2643221654 2644304722 251
425 3300005457 Ga0070662_100453955 Ga0070662_1004539551 252
426 3300006353 Ga0075370_10023929 Ga0075370_100239293 252
427 3300025933 Ga0207706_10504022 Ga0207706_105040222 252
428 3300032005 Ga0307411_10199074 Ga0307411_101990742 252
429 3300039438 Ga0436360_0438486 Ga0436360_0438486_8001_8843 252
430 3300041407 Ga0439447_013933 Ga0439447_013933_1056_1877 252
431 3300050496 nmdc:mga07m45_22269_c1 nmdc:mga07m45_22269_c1_1290_2096 252
432 3300003187 JGI25151J46595_10053790 JGI25151J46595_100537902 253
433 3300005331 Ga0070670_100043728 Ga0070670_1000437283 253
434 3300013104 Ga0157370_10007628 Ga0157370_1000762817 253
435 3300021361 Ga0213872_10057105 Ga0213872_100571052 253
436 3300025258 Ga0209129_1016558 Ga0209129_10165582 253
437 3300025294 Ga0209025_1000088 Ga0209025_1000088142 253
438 3300026088 Ga0207641_10204084 Ga0207641_102040842 253
439 3300028794 Ga0307515_10292199 Ga0307515_102921992 253
440 3300028794 Ga0307515_10294898 Ga0307515_102948982 253
441 3300042532 Ga0450893_0000684 Ga0450893_0000684_821_1627 253
442 3300032005 Ga0307411_10282556 Ga0307411_102825562 254
443 3300005339 Ga0070660_100045205 Ga0070660_1000452053 255
444 3300005344 Ga0070661_100001215 Ga0070661_10000121510 255
445 3300005366 Ga0070659_100000723 Ga0070659_10000072322 255
446 3300005564 Ga0070664_100001692 Ga0070664_1000016926 255
447 3300006195 Ga0075366_10069323 Ga0075366_100693232 255
448 3300025919 Ga0207657_10057735 Ga0207657_100577353 255
449 3300025920 Ga0207649_10010047 Ga0207649_100100478 255
450 3300025932 Ga0207690_10001849 Ga0207690_1000184912 255
451 3300025945 Ga0207679_10000245 Ga0207679_100002457 255
452 3300028786 Ga0307517_10004912 Ga0307517_1000491211 255
453 3300028794 Ga0307515_10000006 Ga0307515_10000006232 255
454 3300028794 Ga0307515_10057287 Ga0307515_100572874 255
455 3300030522 Ga0307512_10005276 Ga0307512_1000527614 255
456 3300031456 Ga0307513_10051472 Ga0307513_100514725 255
457 3300031456 Ga0307513_10332493 Ga0307513_103324931 255
458 3300031616 Ga0307508_10011794 Ga0307508_100117946 255
459 3300031730 Ga0307516_10217266 Ga0307516_102172662 255
460 3300033180 Ga0307510_10041814 Ga0307510_100418146 255
461 3300033180 Ga0307510_10177388 Ga0307510_101773882 255
462 3300044712 Ga0453684_0044822 Ga0453684_0044822_2373_3176 255
463 3300044712 Ga0453684_0904711 Ga0453684_0904711_35_853 255
464 3300045051 Ga0451576_0005477 Ga0451576_0005477_10472_11266 255
465 3300046454 Ga0495592_0000478 Ga0495592_0000478_3522_4307 255
466 3300046460 Ga0495638_0099749 Ga0495638_0099749_168_953 255
467 3300046515 Ga0495620_0106301 Ga0495620_0106301_218_1003 255
468 3300050493 nmdc:mga0k408_41463_c1 nmdc:mga0k408_41463_c1_893_1687 255
469 3300053090 Ga0500646_0134545 Ga0500646_0134545_10_795 255
470 3300053118 Ga0500594_0000375 Ga0500594_0000375_7346_8131 255
471 3300053136 Ga0500559_0000011 Ga0500559_0000011_89520_90305 255
472 3300053151 Ga0500604_0068011 Ga0500604_0068011_296_1081 255
473 3300053153 Ga0500616_0122204 Ga0500616_0122204_143_928 255
474 3300053156 Ga0500622_0002568 Ga0500622_0002568_3023_3808 255
475 3300053739 Ga0500587_000071 Ga0500587_000071_790_1575 255
476 iso_pu_bacteria 2881101125 2881101980 255
477 3300037471 Ga0395905_0091368 Ga0395905_0091368_502_1281 256
478 3300037471 Ga0395905_0117574 Ga0395905_0117574_479_1258 256
479 iso_pu_bacteria 2738541307 2738879579 256
480 3300005367 Ga0070667_100000558 Ga0070667_10000055827 257
481 3300005548 Ga0070665_100248677 Ga0070665_1002486773 257
482 3300005843 Ga0068860_100104582 Ga0068860_1001045823 257
483 3300009093 Ga0105240_10014478 Ga0105240_100144789 257
484 3300009545 Ga0105237_10000296 Ga0105237_1000029648 257
485 3300009551 Ga0105238_10034295 Ga0105238_100342953 257
486 3300010375 Ga0105239_10000250 Ga0105239_1000025059 257
487 3300013308 Ga0157375_10024840 Ga0157375_100248403 257
488 3300025299 Ga0209256_1033560 Ga0209256_10335602 257
489 3300025913 Ga0207695_10023858 Ga0207695_100238584 257
490 3300025914 Ga0207671_10011355 Ga0207671_100113554 257
491 3300025986 Ga0207658_10000412 Ga0207658_1000041227 257
492 3300026041 Ga0207639_10102875 Ga0207639_101028753 257
493 3300026121 Ga0207683_10034463 Ga0207683_100344634 257
494 3300028381 Ga0268264_10111176 Ga0268264_101111762 257
495 3300031238 Ga0265332_10000094 Ga0265332_1000009421 257
496 3300037418 Ga0395900_0000063 Ga0395900_0000063_121650_122456 257
497 3300041505 Ga0451849_1462899 Ga0451849_1462899_683_1480 257
498 3300042012 Ga0439455_0027801 Ga0439455_0027801_129_935 257
499 3300042876 Ga0451577_0094965 Ga0451577_0094965_1591_2385 257
500 3300044656 Ga0466969_0042909 Ga0466969_0042909_162_950 257
501 3300044683 Ga0466965_0207724 Ga0466965_0207724_23_811 257
502 3300044693 Ga0466961_0073364 Ga0466961_0073364_987_1775 257
503 3300044712 Ga0453684_0041347 Ga0453684_0041347_2942_3736 257
504 3300044842 Ga0466957_0101181 Ga0466957_0101181_951_1739 257
505 3300045049 Ga0466959_0032340 Ga0466959_0032340_2823_3611 257
506 3300045051 Ga0451576_0007413 Ga0451576_0007413_5930_6724 257
507 3300049583 Ga0501067_0091580 Ga0501067_0091580_10_804 257
508 3300053096 Ga0500641_0035978 Ga0500641_0035978_989_1798 257
509 3300061719 Ga0466962_0035738 Ga0466962_0035738_751_1539 257
510 iso_pu_bacteria 2513020051 2513226423 257
511 iso_pu_bacteria 2599185214 2599626497 257
512 iso_pu_bacteria 2599185226 2599675561 257
513 iso_pu_bacteria 2599185227 2599684034 257
514 iso_pu_bacteria 2599185229 2599696048 257
515 iso_pu_bacteria 2643221628 2644163328 257
516 iso_pu_bacteria 2643221658 2644327811 257
517 iso_pu_bacteria 2643221660 2644337860 257
518 iso_pu_bacteria 2643221672 2644400506 257
519 iso_pu_bacteria 2643221683 2644468394 257
520 iso_pu_bacteria 2738541277 2738717922 257
521 iso_pu_bacteria 2738543013 2739250274 257
522 iso_pu_bacteria 2738543019 2739278608 257
523 iso_pu_bacteria 2818991446 2819597451 257
524 iso_pu_bacteria 2831265667 2831266629 257
525 iso_pu_bacteria 2838054893 2838057292 257
526 iso_pu_bacteria 2842677519 2842679567 257
527 iso_pu_bacteria 2842733646 2842734864 257
528 iso_pu_bacteria 2842747753 2842751528 257
529 iso_pu_bacteria 2885192300 2885192573 257
530 iso_pu_bacteria 2885198086 2885201348 257
531 iso_pu_bacteria 2885211737 2885214970 257
532 iso_pu_bacteria 2899924645 2899924961 257
533 iso_pu_bacteria 2904449895 2904455666 257
534 iso_pu_bacteria 2904456579 2904462824 257
535 iso_pu_bacteria 2904479285 2904482562 257
536 iso_pu_bacteria 2904541872 2904544913 257
537 iso_pu_bacteria 2919462493 2919467337 257
538 iso_pu_bacteria 2928044640 2928045480 257
539 iso_pu_bacteria 2928051484 2928058377 257
540 iso_pu_bacteria 2928064002 2928064042 257
541 iso_pu_bacteria 2928070936 2928071415 257
542 iso_pu_bacteria 2928084124 2928084644 257
543 iso_pu_bacteria 2929160207 2929163417 257
544 iso_pu_bacteria 2929520902 2929522654 257
545 iso_pu_bacteria 2939631187 2939631833 257
546 iso_pu_bacteria 2945909444 2945912118 257
547 iso_pu_bacteria 2945945610 2945947821 257
548 iso_pu_bacteria 2945972063 2945977334 257
549 iso_pu_bacteria 2945984333 2945985597 257
550 3300025297 Ga0209758_1030843 Ga0209758_10308433 258
551 3300031251 Ga0265327_10006203 Ga0265327_100062038 258
552 3300037312 Ga0395899_0027560 Ga0395899_0027560_3179_3976 258
553 3300037418 Ga0395900_0157926 Ga0395900_0157926_179_976 258
554 3300037466 Ga0395898_0006380 Ga0395898_0006380_7049_7846 258
555 3300037471 Ga0395905_0055765 Ga0395905_0055765_562_1359 258
556 3300038443 Ga0395901_0316787 Ga0395901_0316787_606_1403 258
557 3300044673 Ga0453683_0002359 Ga0453683_0002359_12689_13498 258
558 3300046453 Ga0495627_028567 Ga0495627_028567_127_933 258
559 3300046674 Ga0495588_0073967 Ga0495588_0073967_16_822 258
560 3300053079 Ga0500610_0037924 Ga0500610_0037924_1048_1854 258
561 3300053079 Ga0500610_0040179 Ga0500610_0040179_1048_1854 258
562 3300053117 Ga0500593_001335 Ga0500593_001335_1057_1863 258
563 3300053158 Ga0500627_0001126 Ga0500627_0001126_4372_5178 258
564 3300003354 JGI25160J50197_1006714 JGI25160J50197_10067145 259
565 3300014497 Ga0182008_10037366 Ga0182008_100373662 259
566 3300005364 Ga0070673_100258958 Ga0070673_1002589582 260
567 3300005456 Ga0070678_100015055 Ga0070678_1000150555 260
568 3300025960 Ga0207651_10160534 Ga0207651_101605342 260
569 3300026121 Ga0207683_10018267 Ga0207683_100182673 260
570 3300046453 Ga0495627_004409 Ga0495627_004409_4403_5206 260
571 3300046513 Ga0495616_0001622 Ga0495616_0001622_13921_14748 260
572 3300048925 Ga0496122_0017422 Ga0496122_0017422_1801_2604 260
573 3300048927 Ga0496124_0222762 Ga0496124_0222762_251_1054 260
574 3300048928 Ga0496125_0225309 Ga0496125_0225309_237_1040 260
575 3300002739 JGI25158J39367_1005379 JGI25158J39367_10053791 261
576 3300002774 JGI25150J39212_1000384 JGI25150J39212_10003845 261
577 3300002987 JGI25159J45721_1000103 JGI25159J45721_100010337 261
578 3300002987 JGI25159J45721_1004784 JGI25159J45721_10047842 261
579 3300003187 JGI25151J46595_10001581 JGI25151J46595_100015817 261
580 3300003354 JGI25160J50197_1000255 JGI25160J50197_10002555 261
581 3300003374 JGI25161J50226_1000393 JGI25161J50226_10003935 261
582 3300003374 JGI25161J50226_1006326 JGI25161J50226_10063262 261
583 3300003578 Ga0006562J51391_1076832 Ga0006562J51391_10768323 261
584 3300003761 Ga0055535_1000305 Ga0055535_100030541 261
585 3300003762 Ga0055542_1000021 Ga0055542_1000021110 261
586 3300003773 Ga0055537_1000036 Ga0055537_100003676 261
587 3300003781 Ga0055536_1000396 Ga0055536_100039633 261
588 3300003781 Ga0055536_1002959 Ga0055536_10029594 261
589 3300003781 Ga0055536_1005104 Ga0055536_10051046 261
590 3300003784 Ga0055534_1000018 Ga0055534_10000188 261
591 3300003784 Ga0055534_1003667 Ga0055534_10036673 261
592 3300003784 Ga0055534_1013198 Ga0055534_10131981 261
593 3300003790 Ga0055528_1004492 Ga0055528_10044922 261
594 3300003791 Ga0055530_10000086 Ga0055530_1000008634 261
595 3300003791 Ga0055530_10000991 Ga0055530_1000099110 261
596 3300003792 Ga0055540_1000405 Ga0055540_100040513 261
597 3300003792 Ga0055540_1001568 Ga0055540_10015687 261
598 3300003792 Ga0055540_1008793 Ga0055540_10087932 261
599 3300003794 Ga0055531_10000515 Ga0055531_1000051513 261
600 3300003794 Ga0055531_10000762 Ga0055531_1000076220 261
601 3300004625 Ga0055543_1000262 Ga0055543_10002625 261
602 3300005262 Ga0065165_1000494 Ga0065165_10004945 261
603 3300005288 Ga0065714_10074806 Ga0065714_100748065 261
604 3300005327 Ga0070658_10020838 Ga0070658_100208382 261
605 3300005367 Ga0070667_100069059 Ga0070667_1000690592 261
606 3300005457 Ga0070662_100024236 Ga0070662_1000242362 261
607 3300005539 Ga0068853_100018345 Ga0068853_1000183456 261
608 3300005564 Ga0070664_100116433 Ga0070664_1001164333 261
609 3300006038 Ga0075365_10000499 Ga0075365_1000049916 261
610 3300006042 Ga0075368_10058445 Ga0075368_100584452 261
611 3300006048 Ga0075363_100006375 Ga0075363_1000063752 261
612 3300006048 Ga0075363_100117241 Ga0075363_1001172412 261
613 3300006048 Ga0075363_100120608 Ga0075363_1001206082 261
614 3300006048 Ga0075363_100156550 Ga0075363_1001565502 261
615 3300006048 Ga0075363_100204754 Ga0075363_1002047542 261
616 3300006051 Ga0075364_10149558 Ga0075364_101495582 261
617 3300006177 Ga0075362_10017200 Ga0075362_100172003 261
618 3300006177 Ga0075362_10151461 Ga0075362_101514612 261
619 3300006178 Ga0075367_10177486 Ga0075367_101774862 261
620 3300006178 Ga0075367_10211326 Ga0075367_102113262 261
621 3300006195 Ga0075366_10017858 Ga0075366_100178587 261
622 3300006195 Ga0075366_10167057 Ga0075366_101670572 261
623 3300006353 Ga0075370_10006928 Ga0075370_100069284 261
624 3300006353 Ga0075370_10014387 Ga0075370_100143872 261
625 3300006353 Ga0075370_10020408 Ga0075370_100204086 261
626 3300006353 Ga0075370_10026852 Ga0075370_100268524 261
627 3300006880 Ga0075429_100049096 Ga0075429_1000490964 261
628 3300006948 Ga0099826_10003330 Ga0099826_100033304 261
629 3300006948 Ga0099826_10145492 Ga0099826_101454922 261
630 3300009036 Ga0105244_10006079 Ga0105244_100060793 261
631 3300009093 Ga0105240_10124319 Ga0105240_101243193 261
632 3300009098 Ga0105245_10066112 Ga0105245_100661122 261
633 3300009148 Ga0105243_10000481 Ga0105243_1000048120 261
634 3300009148 Ga0105243_10005911 Ga0105243_100059113 261
635 3300009148 Ga0105243_10069193 Ga0105243_100691932 261
636 3300009176 Ga0105242_10462811 Ga0105242_104628112 261
637 3300009177 Ga0105248_10690665 Ga0105248_106906651 261
638 3300009551 Ga0105238_10090160 Ga0105238_100901605 261
639 3300010375 Ga0105239_10076230 Ga0105239_100762303 261
640 3300011119 Ga0105246_10023702 Ga0105246_100237023 261
641 3300013102 Ga0157371_10142439 Ga0157371_101424392 261
642 3300013104 Ga0157370_10436765 Ga0157370_104367651 261
643 3300013105 Ga0157369_10030735 Ga0157369_100307356 261
644 3300013306 Ga0163162_10011471 Ga0163162_100114716 261
645 3300014497 Ga0182008_10000248 Ga0182008_1000024862 261
646 3300014497 Ga0182008_10027578 Ga0182008_100275783 261
647 3300014497 Ga0182008_10051748 Ga0182008_100517483 261
648 3300015261 Ga0182006_1002817 Ga0182006_10028172 261
649 3300015261 Ga0182006_1029757 Ga0182006_10297572 261
650 3300015262 Ga0182007_10001320 Ga0182007_100013207 261
651 3300015262 Ga0182007_10003094 Ga0182007_100030943 261
652 3300015262 Ga0182007_10039823 Ga0182007_100398231 261
653 3300015683 Ga0183362_10001 Ga0183362_100011228 261
654 3300017792 Ga0163161_10000578 Ga0163161_1000057821 261
655 3300017792 Ga0163161_10010469 Ga0163161_100104693 261
656 3300017792 Ga0163161_10023675 Ga0163161_100236755 261
657 3300017792 Ga0163161_10077465 Ga0163161_100774651 261
658 3300025229 Ga0209147_104170 Ga0209147_1041703 261
659 3300025242 Ga0209258_100058 Ga0209258_100058110 261
660 3300025245 Ga0207425_1000087 Ga0207425_100008757 261
661 3300025245 Ga0207425_1000921 Ga0207425_10009211 261
662 3300025254 Ga0209148_1000071 Ga0209148_1000071110 261
663 3300025258 Ga0209129_1000007 Ga0209129_1000007697 261
664 3300025258 Ga0209129_1019157 Ga0209129_10191572 261
665 3300025263 Ga0209565_1000075 Ga0209565_1000075149 261
666 3300025263 Ga0209565_1001142 Ga0209565_10011422 261
667 3300025273 Ga0209673_1000066 Ga0209673_100006651 261
668 3300025273 Ga0209673_1000080 Ga0209673_1000080159 261
669 3300025273 Ga0209673_1002015 Ga0209673_100201511 261
670 3300025284 Ga0209130_1000131 Ga0209130_100013193 261
671 3300025284 Ga0209130_1000137 Ga0209130_100013758 261
672 3300025291 Ga0209675_1000074 Ga0209675_1000074149 261
673 3300025291 Ga0209675_1000102 Ga0209675_100010244 261
674 3300025291 Ga0209675_1001838 Ga0209675_10018384 261
675 3300025291 Ga0209675_1001972 Ga0209675_10019728 261
676 3300025291 Ga0209675_1014865 Ga0209675_10148653 261
677 3300025292 Ga0209676_1000005 Ga0209676_1000005918 261
678 3300025292 Ga0209676_1000139 Ga0209676_100013954 261
679 3300025292 Ga0209676_1000186 Ga0209676_1000186104 261
680 3300025292 Ga0209676_1000703 Ga0209676_100070337 261
681 3300025292 Ga0209676_1001078 Ga0209676_100107817 261
682 3300025292 Ga0209676_1041679 Ga0209676_10416792 261
683 3300025294 Ga0209025_1000056 Ga0209025_1000056183 261
684 3300025294 Ga0209025_1000104 Ga0209025_100010422 261
685 3300025294 Ga0209025_1008022 Ga0209025_10080228 261
686 3300025294 Ga0209025_1008927 Ga0209025_10089276 261
687 3300025295 Ga0209564_1000073 Ga0209564_1000073219 261
688 3300025295 Ga0209564_1000090 Ga0209564_100009034 261
689 3300025297 Ga0209758_1000044 Ga0209758_1000044170 261
690 3300025297 Ga0209758_1002538 Ga0209758_10025384 261
691 3300025298 Ga0209050_1000007 Ga0209050_1000007179 261
692 3300025298 Ga0209050_1000250 Ga0209050_100025060 261
693 3300025298 Ga0209050_1005618 Ga0209050_10056186 261
694 3300025299 Ga0209256_1000020 Ga0209256_1000020173 261
695 3300025299 Ga0209256_1000022 Ga0209256_1000022258 261
696 3300025302 Ga0207426_1000001 Ga0207426_1000001808 261
697 3300025302 Ga0207426_1000031 Ga0207426_1000031415 261
698 3300025303 Ga0209051_1000036 Ga0209051_1000036269 261
699 3300025303 Ga0209051_1000078 Ga0209051_100007851 261
700 3300025303 Ga0209051_1000160 Ga0209051_100016068 261
701 3300025303 Ga0209051_1000213 Ga0209051_10002137 261
702 3300025303 Ga0209051_1000257 Ga0209051_100025777 261
703 3300025303 Ga0209051_1011578 Ga0209051_10115782 261
704 3300025303 Ga0209051_1028273 Ga0209051_10282733 261
705 3300025304 Ga0209257_1000011 Ga0209257_1000011892 261
706 3300025304 Ga0209257_1000012 Ga0209257_1000012310 261
707 3300025304 Ga0209257_1000116 Ga0209257_100011655 261
708 3300025304 Ga0209257_1000222 Ga0209257_1000222109 261
709 3300025304 Ga0209257_1003620 Ga0209257_10036205 261
710 3300025304 Ga0209257_1010150 Ga0209257_10101505 261
711 3300025728 Ga0207655_1005759 Ga0207655_10057596 261
712 3300025909 Ga0207705_10088474 Ga0207705_100884743 261
713 3300025913 Ga0207695_10290833 Ga0207695_102908333 261
714 3300025914 Ga0207671_10104987 Ga0207671_101049873 261
715 3300025927 Ga0207687_10033564 Ga0207687_100335645 261
716 3300025933 Ga0207706_10146369 Ga0207706_101463692 261
717 3300025935 Ga0207709_10000292 Ga0207709_100002926 261
718 3300025935 Ga0207709_10002968 Ga0207709_1000296811 261
719 3300025935 Ga0207709_10034195 Ga0207709_100341955 261
720 3300025940 Ga0207691_10128560 Ga0207691_101285603 261
721 3300025940 Ga0207691_10162804 Ga0207691_101628042 261
722 3300025986 Ga0207658_10050675 Ga0207658_100506754 261
723 3300026041 Ga0207639_10255966 Ga0207639_102559662 261
724 3300026078 Ga0207702_10160146 Ga0207702_101601462 261
725 3300026116 Ga0207674_10297723 Ga0207674_102977232 261
726 3300026121 Ga0207683_10005862 Ga0207683_1000586212 261
727 3300026142 Ga0207698_10069424 Ga0207698_100694243 261
728 3300026142 Ga0207698_10121415 Ga0207698_101214152 261
729 3300027666 Ga0209282_1000221 Ga0209282_100022126 261
730 3300027666 Ga0209282_1120448 Ga0209282_11204482 261
731 3300027682 Ga0209971_1006633 Ga0209971_10066334 261
732 3300028380 Ga0268265_10055662 Ga0268265_100556624 261
733 3300028794 Ga0307515_10000306 Ga0307515_10000306108 261
734 3300030731 Ga0316177_1105017 Ga0316177_11050173 261
735 3300030733 Ga0314311_1155152 Ga0314311_11551522 261
736 3300030735 Ga0316178_1068791 Ga0316178_10687913 261
737 3300030736 Ga0316180_1050822 Ga0316180_10508221 261
738 3300030742 Ga0316183_1039891 Ga0316183_10398913 261
739 3300030744 Ga0316181_1078789 Ga0316181_10787892 261
740 3300030745 Ga0316182_1190822 Ga0316182_11908225 261
741 3300031456 Ga0307513_10220338 Ga0307513_102203382 261
742 3300031548 Ga0307408_100110771 Ga0307408_1001107712 261
743 3300031711 Ga0265314_10025842 Ga0265314_100258425 261
744 3300031731 Ga0307405_10001524 Ga0307405_1000152410 261
745 3300031901 Ga0307406_10017753 Ga0307406_100177532 261
746 3300031911 Ga0307412_10010332 Ga0307412_100103325 261
747 3300032002 Ga0307416_100043673 Ga0307416_1000436734 261
748 3300032005 Ga0307411_10037176 Ga0307411_100371763 261
749 3300032005 Ga0307411_10217608 Ga0307411_102176083 261
750 3300032005 Ga0307411_10310685 Ga0307411_103106852 261
751 3300037312 Ga0395899_0023506 Ga0395899_0023506_35_841 261
752 3300037418 Ga0395900_0108516 Ga0395900_0108516_1937_2743 261
753 3300037466 Ga0395898_0010832 Ga0395898_0010832_6340_7146 261
754 3300037471 Ga0395905_0319772 Ga0395905_0319772_225_1031 261
755 3300038443 Ga0395901_0587435 Ga0395901_0587435_262_1068 261
756 3300041404 Ga0439436_0000212 Ga0439436_0000212_8296_9102 261
757 3300041404 Ga0439436_0018026 Ga0439436_0018026_270_1079 261
758 3300041413 Ga0439465_0001922 Ga0439465_0001922_345_1151 261
759 3300041997 Ga0439431_0054515 Ga0439431_0054515_98_907 261
760 3300041999 Ga0439433_0000802 Ga0439433_0000802_3375_4181 261
761 3300042002 Ga0439442_006094 Ga0439442_006094_971_1780 261
762 3300042004 Ga0439445_0045973 Ga0439445_0045973_275_1084 261
763 3300042007 Ga0439449_0000162 Ga0439449_0000162_3905_4711 261
764 3300042007 Ga0439449_0003523 Ga0439449_0003523_436_1242 261
765 3300042007 Ga0439449_0009856 Ga0439449_0009856_2284_3093 261
766 3300042010 Ga0439452_000749 Ga0439452_000749_4868_5674 261
767 3300042015 Ga0439462_0026231 Ga0439462_0026231_120_926 261
768 3300042127 Ga0450890_011543 Ga0450890_011543_118_924 261
769 3300042146 Ga0450907_004002 Ga0450907_004002_750_1559 261
770 3300042156 Ga0439446_0013796 Ga0439446_0013796_1384_2193 261
771 3300042157 Ga0439458_0019659 Ga0439458_0019659_249_1055 261
772 3300042435 Ga0439434_0004673 Ga0439434_0004673_3106_3912 261
773 3300042435 Ga0439434_0019589 Ga0439434_0019589_1075_1884 261
774 3300042531 Ga0450918_001383 Ga0450918_001383_2753_3562 261
775 3300042532 Ga0450893_0012365 Ga0450893_0012365_115_924 261
776 3300044656 Ga0466969_0043578 Ga0466969_0043578_699_1505 261
777 3300044683 Ga0466965_0038070 Ga0466965_0038070_664_1470 261
778 3300044684 Ga0466966_0014971 Ga0466966_0014971_3507_4313 261
779 3300044693 Ga0466961_0011090 Ga0466961_0011090_4401_5207 261
780 3300046475 Ga0495639_0071286 Ga0495639_0071286_173_979 261
781 3300046518 Ga0495631_0003611 Ga0495631_0003611_3285_4112 261
782 3300046525 Ga0495663_0085826 Ga0495663_0085826_88_915 261
783 3300046528 Ga0495642_0025051 Ga0495642_0025051_1302_2108 261
784 3300046535 Ga0495586_0154630 Ga0495586_0154630_64_999 261
785 3300046539 Ga0495621_0108121 Ga0495621_0108121_60_887 261
786 3300046557 Ga0495622_0043947 Ga0495622_0043947_411_1238 261
787 3300046615 Ga0495656_0000193 Ga0495656_0000193_14831_15637 261
788 3300046660 Ga0495625_0000057 Ga0495625_0000057_161220_162029 261
789 3300046675 Ga0495657_0322063 Ga0495657_0322063_93_899 261
790 3300046683 Ga0495658_0006263 Ga0495658_0006263_1707_2513 261
791 3300046691 Ga0495670_0272336 Ga0495670_0272336_17_844 261
792 3300047315 Ga0495581_0137626 Ga0495581_0137626_57_863 261
793 3300047321 Ga0495676_0233490 Ga0495676_0233490_141_947 261
794 3300048089 Ga0495614_0064795 Ga0495614_0064795_704_1510 261
795 3300048903 Ga0496100_0599137 Ga0496100_0599137_11_817 261
796 3300048904 Ga0496101_0003661 Ga0496101_0003661_4892_5698 261
797 3300048905 Ga0496102_0020130 Ga0496102_0020130_4637_5443 261
798 3300048906 Ga0496103_0028975 Ga0496103_0028975_56_862 261
799 3300048907 Ga0496104_0001081 Ga0496104_0001081_5323_6129 261
800 3300048908 Ga0496105_0025976 Ga0496105_0025976_1593_2399 261
801 3300048909 Ga0496106_0123914 Ga0496106_0123914_180_986 261
802 3300048910 Ga0496107_0423469 Ga0496107_0423469_128_934 261
803 3300048913 Ga0496110_0067898 Ga0496110_0067898_1370_2176 261
804 3300048913 Ga0496110_0072369 Ga0496110_0072369_1160_1966 261
805 3300048914 Ga0496111_0137037 Ga0496111_0137037_63_869 261
806 3300048917 Ga0496114_0072792 Ga0496114_0072792_1368_2174 261
807 3300048919 Ga0496116_0135126 Ga0496116_0135126_110_916 261
808 3300048920 Ga0496117_0028533 Ga0496117_0028533_2684_3490 261
809 3300048920 Ga0496117_0223145 Ga0496117_0223145_142_948 261
810 3300048921 Ga0496118_0004128 Ga0496118_0004128_15757_16563 261
811 3300048921 Ga0496118_0016121 Ga0496118_0016121_807_1613 261
812 3300048922 Ga0496119_0092451 Ga0496119_0092451_158_985 261
813 3300048925 Ga0496122_0223970 Ga0496122_0223970_95_901 261
814 3300048926 Ga0496123_0000108 Ga0496123_0000108_13248_14057 261
815 3300048927 Ga0496124_0008708 Ga0496124_0008708_5086_5892 261
816 3300048927 Ga0496124_0048959 Ga0496124_0048959_372_1178 261
817 3300048928 Ga0496125_0008866 Ga0496125_0008866_4408_5214 261
818 3300048928 Ga0496125_0059271 Ga0496125_0059271_518_1324 261
819 3300049705 Ga0501225_0007216 Ga0501225_0007216_2301_3110 261
820 3300049759 Ga0501262_000418 Ga0501262_000418_4033_4842 261
821 3300050489 nmdc:mga03683_1803_c1 nmdc:mga03683_1803_c1_4706_5515 261
822 3300050490 nmdc:mga03n38_252897_c1 nmdc:mga03n38_252897_c1_65_871 261
823 3300050490 nmdc:mga03n38_87449_c1 nmdc:mga03n38_87449_c1_251_1057 261
824 3300050493 nmdc:mga0k408_44683_c1 nmdc:mga0k408_44683_c1_451_1257 261
825 3300050494 nmdc:mga06z11_114667_c1 nmdc:mga06z11_114667_c1_583_1389 261
826 3300050496 nmdc:mga07m45_3731_c1 nmdc:mga07m45_3731_c1_688_1497 261
827 3300050496 nmdc:mga07m45_69128_c1 nmdc:mga07m45_69128_c1_796_1602 261
828 3300050496 nmdc:mga07m45_72022_c1 nmdc:mga07m45_72022_c1_935_1741 261
829 3300053087 Ga0500643_003606 Ga0500643_003606_5347_6153 261
830 3300053093 Ga0500651_0000090 Ga0500651_0000090_42550_43356 261
831 3300053094 Ga0500566_0031058 Ga0500566_0031058_2269_3075 261
832 3300053110 Ga0500571_000014 Ga0500571_000014_12189_12995 261
833 3300053121 Ga0500607_000328 Ga0500607_000328_15773_16579 261
834 3300053122 Ga0500608_003138 Ga0500608_003138_4036_4845 261
835 3300053122 Ga0500608_055924 Ga0500608_055924_552_1358 261
836 3300053125 Ga0500618_013715 Ga0500618_013715_553_1362 261
837 3300053133 Ga0500655_000075 Ga0500655_000075_25280_26086 261
838 3300053134 Ga0500658_0000018 Ga0500658_0000018_68562_69389 261
839 3300053134 Ga0500658_0000322 Ga0500658_0000322_10917_11723 261
840 3300053136 Ga0500559_0009178 Ga0500559_0009178_115_924 261
841 3300053136 Ga0500559_0011930 Ga0500559_0011930_953_1762 261
842 3300053139 Ga0500568_0049088 Ga0500568_0049088_559_1386 261
843 3300053140 Ga0500573_0013759 Ga0500573_0013759_246_1055 261
844 3300053141 Ga0500574_016421 Ga0500574_016421_411_1217 261
845 3300053156 Ga0500622_0027911 Ga0500622_0027911_781_1590 261
846 3300053161 Ga0500634_0043273 Ga0500634_0043273_1367_2173 261
847 3300053162 Ga0500638_007322 Ga0500638_007322_2444_3250 261
848 3300053734 Ga0500565_001028 Ga0500565_001028_126_932 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01026

TatD_DNase

TatD related DNase

46

307

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yix-assembly2.cif.gz_B crystal structure of ycfh, tatd homolog from escherichia coli k12, at 1.9 a resolution 0.9301 1 253
1yix-assembly2.cif.gz_B crystal structure of ycfh, tatd homolog from escherichia coli k12, at 1.9 a resolution 0.9125 1 253
2gzx-assembly2.cif.gz_B crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. 0.9044 3 252
1xwy-assembly1.cif.gz_A crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution 0.9038 3 253
1zzm-assembly1.cif.gz_A crystal structure of yjjv, tatd homolog from escherichia coli k12, at 1.8 a resolution 0.9013 2 253
ID Description Score Start End Superfamily
af_P0AFQ7_2_265_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9256 1 253 3.20.20.140
af_P0AFQ7_2_265_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.908 1 253 3.20.20.140
af_P39408_1_259_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.907 2 253 3.20.20.140
1xwyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9038 3 253 3.20.20.140
af_P90989_1_259_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9036 3 253 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A257P9D9-F1-model_v4 DNAase 0.9945 107 252 GO:0005829
GO:0016788
AF-A0A7V8K041-F1-model_v4 Putative metal-dependent hydrolase YcfH 0.9939 1 254 GO:0004536
GO:0005829
AF-A0A519IQI9-F1-model_v4 TatD family deoxyribonuclease 0.9891 1 257 GO:0004536
GO:0005829
GO:0046872
AF-A0A2N3AUL3-F1-model_v4 LuxR family transcriptional regulator 0.9865 129 254 GO:0005829
GO:0016788
AF-A0A520JB74-F1-model_v4 TatD family deoxyribonuclease 0.9864 109 254 GO:0005829
GO:0016788

Feature Viewer

pLDDT pTM Quality
95.61 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map