F479812
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 765 | 373 | 1529 | 470 |
Family's Representative Sequence
| Representative Sequence | 3300059493|Ga0587077_003077|Ga0587077_003077_398_1924 |
| Length | 508 |
| Sequence | MSGSLWVLFYNPLKKHLLQLQVTDLAVKMVKICCIGAGYVGGPTMAVIALKCPDIEVVVVDISKPRIEAWNSDTLPIYEPGLDDVVKQCRGKNLFFSTDVEKHVAEADIIFVSVNTPTKTRGLGAGKAADLTYWESAARMIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGINYQILSNPEFLAEGTAIEDLFKPDRVLIGGRETPEGRKAVQALKDVYAHWVPEDRILTTNLWSAELSKLAANAFLAQRISSVNAISALCEATGANVSEVAYAVGKDTRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVIKINDYQKSRFVNRVVSSMFNTVAGKKIAVLGFAFKKDTGDTRETPAIDVCKGLLGDKAQISIYDPQVTEDQIQRDLAMNKFDWDHPMHLQPTSPTAVKQVSCVWDAYEATKGAHGLCILTEWDEFKTLDYQKIFDNMQKPAFVFDGRNIVDPEKLREIGFIVYSIGKPLDAWLKDMPAVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 4 | 3300003158 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003556 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_09_fullP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003558 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003560 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_13_lowP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003561 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_01_fullP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003564 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_05_lowP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003565 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 23 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 25 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 26 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 50 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 51 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 52 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 53 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 58 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 59 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 60 | 3300009829 | Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D | Metatranscriptome | Rhizosphere |
| 61 | 3300009850 | Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C | Metatranscriptome | Rhizosphere |
| 62 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014486 | Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG | Metagenome | Unclassified |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 72 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 73 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 74 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 75 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 77 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 78 | 3300023304 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctno.R1 | Metatranscriptome | Rhizosphere |
| 79 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 80 | 3300023436 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 | Metatranscriptome | Rhizosphere |
| 81 | 3300023438 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc | Metatranscriptome | Rhizosphere |
| 82 | 3300023553 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 83 | 3300023556 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 84 | 3300023557 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 85 | 3300023558 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 86 | 3300023559 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 87 | 3300023560 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 88 | 3300023561 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 89 | 3300023562 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 90 | 3300023563 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 91 | 3300023564 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 92 | 3300023664 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 93 | 3300023666 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 94 | 3300023668 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 95 | 3300023680 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 96 | 3300023682 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 97 | 3300023684 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 98 | 3300023686 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 99 | 3300023688 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 100 | 3300023689 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 101 | 3300023690 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 115 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 116 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 117 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 118 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 119 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 120 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 121 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 122 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 123 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 124 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 125 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 126 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 127 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 128 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300029272 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 | Metatranscriptome | Rhizosphere |
| 130 | 3300029273 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stno.R1 | Metatranscriptome | Rhizosphere |
| 131 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 132 | 3300029280 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stcc.R1 | Metatranscriptome | Rhizosphere |
| 133 | 3300029282 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 | Metatranscriptome | Rhizosphere |
| 134 | 3300029283 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 | Metatranscriptome | Rhizosphere |
| 135 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 136 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 138 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 139 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 140 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 141 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 142 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 143 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 144 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 145 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 146 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 147 | 3300031591 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 148 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 149 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 150 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 151 | 3300031615 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 152 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 153 | 3300031633 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 154 | 3300031634 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 155 | 3300031635 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 156 | 3300031636 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 157 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 158 | 3300031664 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 159 | 3300031666 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 160 | 3300031667 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 161 | 3300031678 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 162 | 3300031686 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 163 | 3300031690 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 164 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 167 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031810 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 169 | 3300031815 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 170 | 3300031816 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 171 | 3300031828 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 172 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 173 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 174 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 175 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 178 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 180 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 181 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 182 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 183 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 186 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 187 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 188 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 189 | 3300036535 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 190 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 194 | 3300041450 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaT | Metatranscriptome | Rhizoplane |
| 195 | 3300041454 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT | Metatranscriptome | Rhizoplane |
| 196 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 197 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 199 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 200 | 3300041495 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaT | Metatranscriptome | Unclassified |
| 201 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 202 | 3300041497 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT | Metatranscriptome | Unclassified |
| 203 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 204 | 3300041499 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaT | Metatranscriptome | Unclassified |
| 205 | 3300041500 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaT | Metatranscriptome | Unclassified |
| 206 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 207 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 208 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 209 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 210 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 211 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 212 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 213 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 214 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 215 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 216 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 217 | 3300044536 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E | Metagenome | Unclassified |
| 218 | 3300044649 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4E | Metagenome | Unclassified |
| 219 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 220 | 3300044651 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC4E | Metagenome | Unclassified |
| 221 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 222 | 3300044660 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E1 | Metagenome | Unclassified |
| 223 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 224 | 3300044662 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA4E | Metagenome | Unclassified |
| 225 | 3300044663 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR | Metagenome | Unclassified |
| 226 | 3300044665 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC1E | Metagenome | Unclassified |
| 227 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 228 | 3300044668 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 | Metagenome | Unclassified |
| 229 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 230 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 231 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 232 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 233 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 234 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 235 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 238 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048619 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC3E | Metagenome | Unclassified |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 247 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 248 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 249 | 3300048986 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E | Metagenome | Unclassified |
| 250 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 276 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 280 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 281 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 282 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 283 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 284 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 285 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 286 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 287 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 288 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 289 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 290 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 291 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 292 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 293 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 294 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 295 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 296 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 297 | 3300053112 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 endosphere | Metagenome | Endosphere |
| 298 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 299 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 300 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 301 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 302 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 303 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 304 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 305 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 306 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 307 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 308 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 309 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 310 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 311 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 312 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 313 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 314 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 315 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 316 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 317 | 3300053152 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere | Metagenome | Endosphere |
| 318 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 319 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 320 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 321 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 322 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 323 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 324 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 326 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 328 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 329 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 330 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 331 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 332 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059602 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 15R_AD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300060243 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 365 | 2687453341 | Pirellula sp. SH-Sr6A | Isolate | Unclassified |
| 366 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 367 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 368 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 369 | 2786546548 | Spartobacteria bacterium LR76 | Isolate | Unclassified |
| 370 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 371 | 2919509842 | Flavobacterium arsenatis 3773 | Isolate | Unclassified |
| 372 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 373 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71.37 |
| Metatranscriptomes | 27.45 |
| Isolates | 1.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.12 |
| Nodule | 11.76 |
| Rhizoplane | 1.31 |
| Rhizosphere | 38.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0587077_003077 | 3300059493 | Eukaryota | 2064 |
| 2 | JGI24743J22301_10000033 | 3300001991 | Bacteria | 12324 |
| 3 | JGI24033J26618_1000091 | 3300002155 | Bacteria | 12794 |
| 4 | Ga0006760J45825_100944 | 3300003158 | Eukaryota | 1847 |
| 5 | Ga0006770J48903_1039640 | 3300003305 | Eukaryota | 1852 |
| 6 | rootH1_10017807 | 3300003316 | Eukaryota | 2608 |
| 7 | rootH2_10002506 | 3300003320 | Bacteria | 47487 |
| 8 | rootH2_10056337 | 3300003320 | Bacteria | 11946 |
| 9 | rootH2_10079256 | 3300003320 | Bacteria | 6983 |
| 10 | rootL2_10067010 | 3300003322 | Unclassified | 4822 |
| 11 | rootL2_10169922 | 3300003322 | Eukaryota | 2242 |
| 12 | rootH1_10015810 | 3300003316 | Bacteria | 1931 |
| 13 | rootH1_10015810 | 3300003323 | Bacteria | 19240 |
| 14 | rootH1_10029938 | 3300003323 | Bacteria | 3142 |
| 15 | rootH1_10059113 | 3300003323 | Bacteria | 15831 |
| 16 | rootH1_10290663 | 3300003323 | Bacteria | 3613 |
| 17 | Ga0006556J51387_1001852 | 3300003479 | Eukaryota | 2142 |
| 18 | Ga0006556J51387_1003319 | 3300003479 | Eukaryota | 1831 |
| 19 | Ga0006556J51387_1006011 | 3300003479 | Eukaryota | 1759 |
| 20 | Ga0006556J51387_1006012 | 3300003479 | Eukaryota | 2162 |
| 21 | Ga0007417J51691_1005279 | 3300003544 | Eukaryota | 1886 |
| 22 | Ga0006557J51388_1003258 | 3300003556 | Eukaryota | 2030 |
| 23 | Ga0006557J51388_1007654 | 3300003556 | Eukaryota | 1854 |
| 24 | Ga0006557J51388_1011294 | 3300003556 | Eukaryota | 1738 |
| 25 | Ga0006558J51389_1007620 | 3300003558 | Eukaryota | 1797 |
| 26 | Ga0006558J51389_1012456 | 3300003558 | Eukaryota | 1734 |
| 27 | Ga0006559J51393_1002030 | 3300003560 | Eukaryota | 2142 |
| 28 | Ga0006559J51393_1004417 | 3300003560 | Eukaryota | 1766 |
| 29 | Ga0006559J51393_1005472 | 3300003560 | Eukaryota | 1772 |
| 30 | Ga0006553J51392_1002676 | 3300003561 | Eukaryota | 1810 |
| 31 | Ga0006553J51392_1002677 | 3300003561 | Eukaryota | 2123 |
| 32 | Ga0006553J51392_1006354 | 3300003561 | Eukaryota | 1770 |
| 33 | Ga0006553J51392_1009232 | 3300003561 | Eukaryota | 1766 |
| 34 | Ga0006553J51392_1009233 | 3300003561 | Eukaryota | 2052 |
| 35 | Ga0006555J51386_1002101 | 3300003564 | Eukaryota | 2143 |
| 36 | Ga0006555J51386_1003454 | 3300003564 | Eukaryota | 1754 |
| 37 | Ga0006555J51386_1004584 | 3300003564 | Eukaryota | 1773 |
| 38 | Ga0006560J51390_1002148 | 3300003565 | Eukaryota | 1941 |
| 39 | Ga0006560J51390_1002468 | 3300003565 | Eukaryota | 1929 |
| 40 | Ga0006560J51390_1003168 | 3300003565 | Eukaryota | 1774 |
| 41 | Ga0006554J51385_1005673 | 3300003567 | Eukaryota | 1804 |
| 42 | Ga0006554J51385_1009750 | 3300003567 | Eukaryota | 1770 |
| 43 | Ga0007410J51695_1015327 | 3300003574 | Eukaryota | 1881 |
| 44 | Ga0007409J51694_1002305 | 3300003575 | Eukaryota | 1866 |
| 45 | Ga0007409J51694_1004040 | 3300003575 | Eukaryota | 1874 |
| 46 | Ga0007409J51694_1005953 | 3300003575 | Eukaryota | 1849 |
| 47 | Ga0007416J51690_1002064 | 3300003577 | Eukaryota | 1865 |
| 48 | Ga0006562J51391_1009759 | 3300003578 | Bacteria | 4485 |
| 49 | Ga0058863_10104301 | 3300004799 | Eukaryota | 1956 |
| 50 | Ga0058860_10118984 | 3300004801 | Eukaryota | 1884 |
| 51 | Ga0058862_10072939 | 3300004803 | Eukaryota | 1940 |
| 52 | Ga0065714_10008350 | 3300005288 | Bacteria | 8477 |
| 53 | Ga0065714_10074752 | 3300005288 | Bacteria | 2988 |
| 54 | Ga0065704_10071143 | 3300005289 | Bacteria | 12868 |
| 55 | Ga0065704_10072412 | 3300005289 | Bacteria | 8573 |
| 56 | Ga0065715_10089560 | 3300005293 | Bacteria | 9483 |
| 57 | Ga0070658_10000334 | 3300005327 | Bacteria | 40558 |
| 58 | Ga0070683_100032301 | 3300005329 | Bacteria | 4767 |
| 59 | Ga0070683_100192796 | 3300005329 | Bacteria | 1935 |
| 60 | Ga0070690_100091704 | 3300005330 | Bacteria | 2002 |
| 61 | Ga0070670_100026965 | 3300005331 | Bacteria | 4942 |
| 62 | Ga0068869_100000177 | 3300005334 | Bacteria | 32439 |
| 63 | Ga0068868_100004199 | 3300005338 | Bacteria | 10072 |
| 64 | Ga0070668_100014552 | 3300005347 | Bacteria | 5879 |
| 65 | Ga0070688_100072861 | 3300005365 | Bacteria | 2202 |
| 66 | Ga0070667_100114532 | 3300005367 | Bacteria | 2341 |
| 67 | Ga0070663_100092801 | 3300005455 | Bacteria | 2239 |
| 68 | Ga0070678_100012449 | 3300005456 | Bacteria | 5289 |
| 69 | Ga0068867_100009825 | 3300005459 | Bacteria | 6743 |
| 70 | Ga0070684_100005152 | 3300005535 | Bacteria | 9993 |
| 71 | Ga0070704_100040712 | 3300005549 | Eukaryota | 3201 |
| 72 | Ga0070664_100008522 | 3300005564 | Bacteria | 8291 |
| 73 | Ga0068856_100001795 | 3300005614 | Bacteria | 22416 |
| 74 | Ga0068856_100002539 | 3300005614 | Bacteria | 18824 |
| 75 | Ga0068866_10010773 | 3300005718 | Bacteria | 3931 |
| 76 | Ga0070717_10000060 | 3300006028 | Bacteria | 92521 |
| 77 | Ga0070712_100005031 | 3300006175 | Bacteria | 8187 |
| 78 | Ga0068871_100055115 | 3300006358 | Bacteria | 3227 |
| 79 | Ga0075428_100013048 | 3300006844 | Bacteria | 9235 |
| 80 | Ga0099825_1000968 | 3300006941 | Eukaryota | 34607 |
| 81 | Ga0099825_1006620 | 3300006941 | Eukaryota | 14401 |
| 82 | Ga0099825_1008186 | 3300006941 | Eukaryota | 12475 |
| 83 | Ga0099825_1012731 | 3300006941 | Eukaryota | 8427 |
| 84 | Ga0099825_1015924 | 3300006941 | Eukaryota | 6603 |
| 85 | Ga0099824_1000152 | 3300006942 | Eukaryota | 61859 |
| 86 | Ga0099824_1001369 | 3300006942 | Eukaryota | 34001 |
| 87 | Ga0099824_1002882 | 3300006942 | Eukaryota | 25168 |
| 88 | Ga0099824_1011337 | 3300006942 | Eukaryota | 10125 |
| 89 | Ga0099824_1016693 | 3300006942 | Eukaryota | 6586 |
| 90 | Ga0099822_1001507 | 3300006943 | Eukaryota | 27291 |
| 91 | Ga0099822_1014542 | 3300006943 | Eukaryota | 9015 |
| 92 | Ga0099822_1016133 | 3300006943 | Eukaryota | 8259 |
| 93 | Ga0099822_1016811 | 3300006943 | Eukaryota | 7961 |
| 94 | Ga0099822_1029439 | 3300006943 | Eukaryota | 4268 |
| 95 | Ga0099823_1012196 | 3300006944 | Eukaryota | 8703 |
| 96 | Ga0099823_1014063 | 3300006944 | Eukaryota | 8013 |
| 97 | Ga0099823_1014698 | 3300006944 | Eukaryota | 7814 |
| 98 | Ga0099823_1032315 | 3300006944 | Eukaryota | 4268 |
| 99 | Ga0099823_1042911 | 3300006944 | Eukaryota | 3144 |
| 100 | Ga0111539_10076711 | 3300009094 | Bacteria | 3935 |
| 101 | Ga0105248_10024605 | 3300009177 | Bacteria | 6695 |
| 102 | Ga0105237_10001258 | 3300009545 | Bacteria | 33852 |
| 103 | Ga0123340_1012829 | 3300009763 | Eukaryota | 7519 |
| 104 | Ga0123340_1014312 | 3300009763 | Eukaryota | 6974 |
| 105 | Ga0123340_1019357 | 3300009763 | Eukaryota | 5442 |
| 106 | Ga0123340_1020935 | 3300009763 | Eukaryota | 5042 |
| 107 | Ga0123340_1024538 | 3300009763 | Eukaryota | 4298 |
| 108 | Ga0123341_1020325 | 3300009765 | Eukaryota | 5659 |
| 109 | Ga0123341_1021674 | 3300009765 | Eukaryota | 5387 |
| 110 | Ga0123341_1030624 | 3300009765 | Eukaryota | 4047 |
| 111 | Ga0123341_1031846 | 3300009765 | Eukaryota | 3897 |
| 112 | Ga0123341_1049410 | 3300009765 | Eukaryota | 2420 |
| 113 | Ga0123342_1000675 | 3300009766 | Eukaryota | 55083 |
| 114 | Ga0123342_1000777 | 3300009766 | Eukaryota | 51976 |
| 115 | Ga0123342_1001375 | 3300009766 | Eukaryota | 40897 |
| 116 | Ga0123342_1015060 | 3300009766 | Eukaryota | 7180 |
| 117 | Ga0123342_1036996 | 3300009766 | Eukaryota | 1983 |
| 118 | Ga0130086_1051381 | 3300009829 | Eukaryota | 2063 |
| 119 | Ga0130085_1009033 | 3300009850 | Eukaryota | 2063 |
| 120 | Ga0157373_10000100 | 3300013100 | Bacteria | 70609 |
| 121 | Ga0157370_10000156 | 3300013104 | Bacteria | 84357 |
| 122 | Ga0157370_10022212 | 3300013104 | Bacteria | 6313 |
| 123 | Ga0157369_10180539 | 3300013105 | Bacteria | 2221 |
| 124 | Ga0157378_10001118 | 3300013297 | Bacteria | 24448 |
| 125 | Ga0163163_10021623 | 3300014325 | Bacteria | 6074 |
| 126 | Ga0163163_10105615 | 3300014325 | Bacteria | 2842 |
| 127 | Ga0182004_10001901 | 3300014486 | Eukaryota | 15861 |
| 128 | Ga0182004_10006101 | 3300014486 | Eukaryota | 9837 |
| 129 | Ga0182004_10020967 | 3300014486 | Eukaryota | 4900 |
| 130 | Ga0163161_10000039 | 3300017792 | Bacteria | 148130 |
| 131 | Ga0163161_10017299 | 3300017792 | Bacteria | 5044 |
| 132 | Ga0206356_10361440 | 3300020070 | Eukaryota | 1950 |
| 133 | Ga0206349_1076403 | 3300020075 | Eukaryota | 1868 |
| 134 | Ga0214544_1000213 | 3300021320 | Eukaryota | 93807 |
| 135 | Ga0214544_1003722 | 3300021320 | Eukaryota | 31165 |
| 136 | Ga0214544_1008947 | 3300021320 | Eukaryota | 16179 |
| 137 | Ga0214544_1014384 | 3300021320 | Eukaryota | 8894 |
| 138 | Ga0214544_1015320 | 3300021320 | Eukaryota | 8056 |
| 139 | Ga0214542_1000103 | 3300021321 | Eukaryota | 113180 |
| 140 | Ga0214542_1003237 | 3300021321 | Eukaryota | 33466 |
| 141 | Ga0214542_1014675 | 3300021321 | Eukaryota | 8599 |
| 142 | Ga0214542_1014958 | 3300021321 | Eukaryota | 8369 |
| 143 | Ga0214545_1000252 | 3300021324 | Eukaryota | 75346 |
| 144 | Ga0214545_1006288 | 3300021324 | Eukaryota | 20772 |
| 145 | Ga0214545_1008081 | 3300021324 | Eukaryota | 17091 |
| 146 | Ga0214545_1014787 | 3300021324 | Eukaryota | 8884 |
| 147 | Ga0214545_1015704 | 3300021324 | Eukaryota | 8145 |
| 148 | Ga0214543_1002083 | 3300021327 | Eukaryota | 39324 |
| 149 | Ga0214543_1002928 | 3300021327 | Eukaryota | 33544 |
| 150 | Ga0214543_1010234 | 3300021327 | Eukaryota | 14032 |
| 151 | Ga0214543_1014913 | 3300021327 | Eukaryota | 8876 |
| 152 | Ga0224712_10027421 | 3300022467 | Eukaryota | 2026 |
| 153 | Ga0228711_1001769 | 3300022739 | Eukaryota | 32404 |
| 154 | Ga0228711_1007623 | 3300022739 | Eukaryota | 15585 |
| 155 | Ga0228710_1000477 | 3300022740 | Eukaryota | 50637 |
| 156 | Ga0228710_1001876 | 3300022740 | Eukaryota | 32402 |
| 157 | Ga0228710_1008270 | 3300022740 | Eukaryota | 14989 |
| 158 | Ga0256714_122685 | 3300023304 | Eukaryota | 1899 |
| 159 | Ga0256714_131853 | 3300023304 | Eukaryota | 1744 |
| 160 | Ga0256744_140402 | 3300023309 | Eukaryota | 1905 |
| 161 | Ga0256743_129875 | 3300023436 | Eukaryota | 1909 |
| 162 | Ga0256720_130359 | 3300023438 | Eukaryota | 1978 |
| 163 | Ga0247524_101315 | 3300023553 | Eukaryota | 2044 |
| 164 | Ga0247524_101813 | 3300023553 | Eukaryota | 1849 |
| 165 | Ga0247519_101369 | 3300023556 | Eukaryota | 2235 |
| 166 | Ga0247519_101496 | 3300023556 | Eukaryota | 2169 |
| 167 | Ga0247521_101578 | 3300023557 | Eukaryota | 2099 |
| 168 | Ga0247521_101669 | 3300023557 | Eukaryota | 2056 |
| 169 | Ga0247526_101347 | 3300023558 | Eukaryota | 2166 |
| 170 | Ga0247526_101736 | 3300023558 | Eukaryota | 1994 |
| 171 | Ga0247529_101636 | 3300023559 | Eukaryota | 2036 |
| 172 | Ga0247529_101871 | 3300023559 | Eukaryota | 1947 |
| 173 | Ga0247514_100888 | 3300023560 | Eukaryota | 2923 |
| 174 | Ga0247514_102510 | 3300023560 | Eukaryota | 2105 |
| 175 | Ga0247514_102915 | 3300023560 | Eukaryota | 1988 |
| 176 | Ga0247518_102379 | 3300023561 | Eukaryota | 2120 |
| 177 | Ga0247518_102880 | 3300023561 | Eukaryota | 1976 |
| 178 | Ga0247516_102636 | 3300023562 | Eukaryota | 1998 |
| 179 | Ga0247530_101245 | 3300023563 | Eukaryota | 2056 |
| 180 | Ga0247530_102338 | 3300023563 | Eukaryota | 1674 |
| 181 | Ga0247515_102230 | 3300023564 | Eukaryota | 2084 |
| 182 | Ga0247515_102377 | 3300023564 | Eukaryota | 2039 |
| 183 | Ga0247527_101032 | 3300023664 | Eukaryota | 2097 |
| 184 | Ga0247527_101221 | 3300023664 | Eukaryota | 1993 |
| 185 | Ga0247531_101364 | 3300023666 | Eukaryota | 2094 |
| 186 | Ga0247531_101646 | 3300023666 | Eukaryota | 1970 |
| 187 | Ga0247525_101094 | 3300023668 | Eukaryota | 2396 |
| 188 | Ga0247525_101864 | 3300023668 | Eukaryota | 2022 |
| 189 | Ga0247528_101148 | 3300023680 | Eukaryota | 1995 |
| 190 | Ga0247528_101612 | 3300023680 | Eukaryota | 1787 |
| 191 | Ga0247513_101857 | 3300023682 | Eukaryota | 2036 |
| 192 | Ga0247513_102164 | 3300023682 | Eukaryota | 1932 |
| 193 | Ga0247513_103366 | 3300023682 | Eukaryota | 1630 |
| 194 | Ga0247523_101768 | 3300023684 | Eukaryota | 2047 |
| 195 | Ga0247523_102341 | 3300023684 | Eukaryota | 1857 |
| 196 | Ga0247520_101429 | 3300023686 | Eukaryota | 2149 |
| 197 | Ga0247520_101562 | 3300023686 | Eukaryota | 2087 |
| 198 | Ga0247520_102929 | 3300023686 | Eukaryota | 1683 |
| 199 | Ga0247522_101894 | 3300023688 | Eukaryota | 2029 |
| 200 | Ga0247522_102177 | 3300023688 | Eukaryota | 1930 |
| 201 | Ga0247517_101084 | 3300023689 | Eukaryota | 2482 |
| 202 | Ga0247517_102061 | 3300023689 | Eukaryota | 2032 |
| 203 | Ga0247512_102482 | 3300023690 | Eukaryota | 2059 |
| 204 | Ga0247512_104336 | 3300023690 | Eukaryota | 1657 |
| 205 | Ga0207705_10002106 | 3300025909 | Bacteria | 15476 |
| 206 | Ga0207671_10000987 | 3300025914 | Bacteria | 35078 |
| 207 | Ga0207649_10000278 | 3300025920 | Bacteria | 40413 |
| 208 | Ga0207690_10009239 | 3300025932 | Bacteria | 5854 |
| 209 | Ga0207689_10000497 | 3300025942 | Bacteria | 37074 |
| 210 | Ga0207661_10019749 | 3300025944 | Bacteria | 5029 |
| 211 | Ga0207679_10014265 | 3300025945 | Bacteria | 5220 |
| 212 | Ga0207640_10023895 | 3300025981 | Bacteria | 3680 |
| 213 | Ga0207678_10170185 | 3300026067 | Bacteria | 1860 |
| 214 | Ga0207702_10000829 | 3300026078 | Bacteria | 32602 |
| 215 | Ga0207702_10001007 | 3300026078 | Bacteria | 28922 |
| 216 | Ga0207648_10011836 | 3300026089 | Bacteria | 8199 |
| 217 | Ga0207683_10023395 | 3300026121 | Bacteria | 5315 |
| 218 | Ga0209389_1015128 | 3300027296 | Eukaryota | 7006 |
| 219 | Ga0209389_1022707 | 3300027296 | Eukaryota | 5553 |
| 220 | Ga0209389_1030264 | 3300027296 | Eukaryota | 4572 |
| 221 | Ga0209389_1034210 | 3300027296 | Eukaryota | 4164 |
| 222 | Ga0209389_1047017 | 3300027296 | Eukaryota | 3118 |
| 223 | Ga0209589_1001010 | 3300027357 | Eukaryota | 44036 |
| 224 | Ga0209589_1002819 | 3300027357 | Eukaryota | 30286 |
| 225 | Ga0209589_1005408 | 3300027357 | Eukaryota | 21661 |
| 226 | Ga0209589_1015606 | 3300027357 | Eukaryota | 9041 |
| 227 | Ga0209589_1016599 | 3300027357 | Eukaryota | 8373 |
| 228 | Ga0209489_100068 | 3300027361 | Eukaryota | 141350 |
| 229 | Ga0209489_100150 | 3300027361 | Eukaryota | 106104 |
| 230 | Ga0209489_100154 | 3300027361 | Eukaryota | 104068 |
| 231 | Ga0209489_100161 | 3300027361 | Eukaryota | 102823 |
| 232 | Ga0209489_110956 | 3300027361 | Eukaryota | 9690 |
| 233 | Ga0209700_100910 | 3300027363 | Eukaryota | 59403 |
| 234 | Ga0209700_101042 | 3300027363 | Eukaryota | 56008 |
| 235 | Ga0209700_101974 | 3300027363 | Eukaryota | 42493 |
| 236 | Ga0209700_103288 | 3300027363 | Eukaryota | 31215 |
| 237 | Ga0209700_103477 | 3300027363 | Eukaryota | 30052 |
| 238 | Ga0209282_1000930 | 3300027666 | Eukaryota | 15294 |
| 239 | Ga0209282_1004483 | 3300027666 | Eukaryota | 8419 |
| 240 | Ga0209282_1019781 | 3300027666 | Eukaryota | 4273 |
| 241 | Ga0265337_1015646 | 3300028556 | Bacteria | 2476 |
| 242 | Ga0265319_1000008 | 3300028563 | Bacteria | 215029 |
| 243 | Ga0265319_1000163 | 3300028563 | Bacteria | 50418 |
| 244 | Ga0265319_1000880 | 3300028563 | Bacteria | 19045 |
| 245 | Ga0265319_1004923 | 3300028563 | Bacteria | 6524 |
| 246 | Ga0265319_1006129 | 3300028563 | Bacteria | 5619 |
| 247 | Ga0265319_1010933 | 3300028563 | Bacteria | 3757 |
| 248 | Ga0265319_1015852 | 3300028563 | Bacteria | 2905 |
| 249 | Ga0265319_1020959 | 3300028563 | Bacteria | 2409 |
| 250 | Ga0265334_10001450 | 3300028573 | Bacteria | 11401 |
| 251 | Ga0265334_10004868 | 3300028573 | Bacteria | 5902 |
| 252 | Ga0265318_10000005 | 3300028577 | Bacteria | 303630 |
| 253 | Ga0265318_10001015 | 3300028577 | Bacteria | 17934 |
| 254 | Ga0265318_10001020 | 3300028577 | Bacteria | 17898 |
| 255 | Ga0265318_10004179 | 3300028577 | Bacteria | 7056 |
| 256 | Ga0265323_10002261 | 3300028653 | Bacteria | 8938 |
| 257 | Ga0265323_10003979 | 3300028653 | Bacteria | 6412 |
| 258 | Ga0265323_10033143 | 3300028653 | Bacteria | 1914 |
| 259 | Ga0265322_10002463 | 3300028654 | Bacteria | 5709 |
| 260 | Ga0265336_10001541 | 3300028666 | Bacteria | 10355 |
| 261 | Ga0307517_10004041 | 3300028786 | Eukaryota | 22681 |
| 262 | Ga0307517_10022127 | 3300028786 | Eukaryota | 7981 |
| 263 | Ga0307517_10052253 | 3300028786 | Eukaryota | 4100 |
| 264 | Ga0307517_10084867 | 3300028786 | Eukaryota | 2659 |
| 265 | Ga0307515_10012453 | 3300028794 | Eukaryota | 15997 |
| 266 | Ga0307515_10016304 | 3300028794 | Eukaryota | 13614 |
| 267 | Ga0307515_10023705 | 3300028794 | Eukaryota | 10737 |
| 268 | Ga0307515_10062290 | 3300028794 | Eukaryota | 5271 |
| 269 | Ga0265338_10000299 | 3300028800 | Bacteria | 89317 |
| 270 | Ga0265338_10002938 | 3300028800 | Bacteria | 24725 |
| 271 | Ga0265338_10167351 | 3300028800 | Bacteria | 1691 |
| 272 | Ga0311000_116166 | 3300029272 | Eukaryota | 1766 |
| 273 | Ga0311008_120313 | 3300029273 | Eukaryota | 1906 |
| 274 | Ga0311001_1049994 | 3300029277 | Eukaryota | 2038 |
| 275 | Ga0311011_129510 | 3300029280 | Eukaryota | 2873 |
| 276 | Ga0311003_114429 | 3300029282 | Eukaryota | 2220 |
| 277 | Ga0311003_139614 | 3300029282 | Eukaryota | 3358 |
| 278 | Ga0310982_120901 | 3300029283 | Eukaryota | 1904 |
| 279 | Ga0310981_1044871 | 3300029285 | Eukaryota | 1986 |
| 280 | Ga0310981_1074111 | 3300029285 | Eukaryota | 1580 |
| 281 | Ga0265324_10005523 | 3300029957 | Bacteria | 5447 |
| 282 | Ga0307511_10005543 | 3300030521 | Eukaryota | 12823 |
| 283 | Ga0307511_10029695 | 3300030521 | Eukaryota | 4928 |
| 284 | Ga0307511_10048187 | 3300030521 | Eukaryota | 3470 |
| 285 | Ga0307511_10102631 | 3300030521 | Eukaryota | 1867 |
| 286 | Ga0307512_10019886 | 3300030522 | Eukaryota | 6099 |
| 287 | Ga0307512_10055420 | 3300030522 | Eukaryota | 3126 |
| 288 | Ga0307512_10089619 | 3300030522 | Eukaryota | 2150 |
| 289 | Ga0265320_10000351 | 3300031240 | Bacteria | 37562 |
| 290 | Ga0265320_10000634 | 3300031240 | Bacteria | 26857 |
| 291 | Ga0265320_10000992 | 3300031240 | Bacteria | 21054 |
| 292 | Ga0265320_10004190 | 3300031240 | Bacteria | 9475 |
| 293 | Ga0265320_10004942 | 3300031240 | Bacteria | 8647 |
| 294 | Ga0265320_10005990 | 3300031240 | Bacteria | 7725 |
| 295 | Ga0265320_10006558 | 3300031240 | Bacteria | 7322 |
| 296 | Ga0265320_10023395 | 3300031240 | Bacteria | 3289 |
| 297 | Ga0265320_10031681 | 3300031240 | Bacteria | 2714 |
| 298 | Ga0265340_10010136 | 3300031247 | Bacteria | 5049 |
| 299 | Ga0265340_10042758 | 3300031247 | Bacteria | 2223 |
| 300 | Ga0265331_10001596 | 3300031250 | Bacteria | 16565 |
| 301 | Ga0265331_10010589 | 3300031250 | Bacteria | 5093 |
| 302 | Ga0265327_10002240 | 3300031251 | Bacteria | 20965 |
| 303 | Ga0265327_10005669 | 3300031251 | Bacteria | 10335 |
| 304 | Ga0265327_10007630 | 3300031251 | Bacteria | 8291 |
| 305 | Ga0265327_10071407 | 3300031251 | Bacteria | 1737 |
| 306 | Ga0265316_10029259 | 3300031344 | Bacteria | 4531 |
| 307 | Ga0265316_10041391 | 3300031344 | Bacteria | 3688 |
| 308 | Ga0265316_10074227 | 3300031344 | Eukaryota | 2618 |
| 309 | Ga0307513_10015765 | 3300031456 | Eukaryota | 9146 |
| 310 | Ga0307509_10107252 | 3300031507 | Eukaryota | 2809 |
| 311 | Ga0307509_10165770 | 3300031507 | Eukaryota | 2098 |
| 312 | Ga0307408_100000007 | 3300031548 | Bacteria | 463086 |
| 313 | Ga0310116_103785 | 3300031591 | Eukaryota | 1565 |
| 314 | Ga0310117_101725 | 3300031592 | Eukaryota | 2102 |
| 315 | Ga0310117_102007 | 3300031592 | Eukaryota | 2004 |
| 316 | Ga0265313_10001729 | 3300031595 | Bacteria | 20091 |
| 317 | Ga0265313_10004398 | 3300031595 | Bacteria | 10867 |
| 318 | Ga0265313_10017444 | 3300031595 | Bacteria | 4079 |
| 319 | Ga0265313_10031907 | 3300031595 | Eukaryota | 2697 |
| 320 | Ga0310103_102678 | 3300031614 | Eukaryota | 2167 |
| 321 | Ga0310103_103137 | 3300031614 | Eukaryota | 2059 |
| 322 | Ga0310107_102443 | 3300031615 | Eukaryota | 2249 |
| 323 | Ga0310107_103329 | 3300031615 | Eukaryota | 2020 |
| 324 | Ga0310107_106584 | 3300031615 | Eukaryota | 1540 |
| 325 | Ga0307508_10000200 | 3300031616 | Bacteria | 71996 |
| 326 | Ga0307508_10000340 | 3300031616 | Bacteria | 56710 |
| 327 | Ga0307508_10022289 | 3300031616 | Eukaryota | 5756 |
| 328 | Ga0307508_10038364 | 3300031616 | Eukaryota | 4306 |
| 329 | Ga0310108_101700 | 3300031633 | Eukaryota | 2246 |
| 330 | Ga0310106_100604 | 3300031634 | Eukaryota | 2204 |
| 331 | Ga0310106_100874 | 3300031634 | Eukaryota | 1976 |
| 332 | Ga0310115_102339 | 3300031635 | Eukaryota | 2182 |
| 333 | Ga0310115_102928 | 3300031635 | Eukaryota | 2013 |
| 334 | Ga0310113_101712 | 3300031636 | Eukaryota | 2177 |
| 335 | Ga0310113_102273 | 3300031636 | Eukaryota | 2002 |
| 336 | Ga0307514_10006951 | 3300031649 | Eukaryota | 9792 |
| 337 | Ga0307514_10036253 | 3300031649 | Eukaryota | 3920 |
| 338 | Ga0307514_10068701 | 3300031649 | Eukaryota | 2669 |
| 339 | Ga0310118_101303 | 3300031664 | Eukaryota | 1906 |
| 340 | Ga0310105_102390 | 3300031666 | Eukaryota | 2049 |
| 341 | Ga0310105_102435 | 3300031666 | Eukaryota | 2035 |
| 342 | Ga0310111_102295 | 3300031667 | Eukaryota | 2213 |
| 343 | Ga0310111_103458 | 3300031667 | Eukaryota | 1930 |
| 344 | Ga0310114_101282 | 3300031678 | Eukaryota | 2227 |
| 345 | Ga0310119_103072 | 3300031686 | Eukaryota | 1996 |
| 346 | Ga0310101_102158 | 3300031690 | Eukaryota | 2220 |
| 347 | Ga0310101_103028 | 3300031690 | Eukaryota | 1972 |
| 348 | Ga0265314_10000619 | 3300031711 | Bacteria | 43744 |
| 349 | Ga0265314_10006437 | 3300031711 | Bacteria | 10399 |
| 350 | Ga0265314_10024034 | 3300031711 | Bacteria | 4630 |
| 351 | Ga0265314_10038328 | 3300031711 | Bacteria | 3463 |
| 352 | Ga0265342_10017325 | 3300031712 | Bacteria | 4689 |
| 353 | Ga0265342_10040673 | 3300031712 | Bacteria | 2819 |
| 354 | Ga0265342_10076487 | 3300031712 | Bacteria | 1940 |
| 355 | Ga0307516_10000347 | 3300031730 | Eukaryota | 60281 |
| 356 | Ga0307516_10167491 | 3300031730 | Eukaryota | 1940 |
| 357 | Ga0307405_10000005 | 3300031731 | Bacteria | 376536 |
| 358 | Ga0316044_102586 | 3300031810 | Eukaryota | 2163 |
| 359 | Ga0316044_102865 | 3300031810 | Eukaryota | 2084 |
| 360 | Ga0316045_102865 | 3300031815 | Eukaryota | 2059 |
| 361 | Ga0316042_103208 | 3300031816 | Eukaryota | 2276 |
| 362 | Ga0316043_103270 | 3300031828 | Eukaryota | 2243 |
| 363 | Ga0316043_107330 | 3300031828 | Eukaryota | 1573 |
| 364 | Ga0307518_10024537 | 3300031838 | Eukaryota | 4347 |
| 365 | Ga0307518_10037225 | 3300031838 | Eukaryota | 3537 |
| 366 | Ga0307518_10040938 | 3300031838 | Eukaryota | 3371 |
| 367 | Ga0307410_10000001 | 3300031852 | Bacteria | 162839 |
| 368 | Ga0307407_10023230 | 3300031903 | Bacteria | 3232 |
| 369 | Ga0315914_1002089 | 3300031967 | Eukaryota | 30525 |
| 370 | Ga0315914_1006743 | 3300031967 | Eukaryota | 16152 |
| 371 | Ga0315914_1011060 | 3300031967 | Eukaryota | 10973 |
| 372 | Ga0307409_100000033 | 3300031995 | Bacteria | 48825 |
| 373 | Ga0307416_100000111 | 3300032002 | Bacteria | 50097 |
| 374 | Ga0316593_10023633 | 3300032168 | Eukaryota | 1942 |
| 375 | Ga0307507_10010486 | 3300033179 | Eukaryota | 11961 |
| 376 | Ga0307507_10030137 | 3300033179 | Eukaryota | 5729 |
| 377 | Ga0307507_10053167 | 3300033179 | Eukaryota | 3873 |
| 378 | Ga0307510_10025325 | 3300033180 | Eukaryota | 6842 |
| 379 | Ga0307510_10078013 | 3300033180 | Eukaryota | 3243 |
| 380 | Ga0307510_10103156 | 3300033180 | Eukaryota | 2630 |
| 381 | Ga0315913_1000768 | 3300033430 | Eukaryota | 31264 |
| 382 | Ga0315913_1006457 | 3300033430 | Eukaryota | 14177 |
| 383 | Ga0315913_1023161 | 3300033430 | Eukaryota | 5386 |
| 384 | Ga0315915_1010060 | 3300033464 | Eukaryota | 10579 |
| 385 | Ga0315915_1019462 | 3300033464 | Eukaryota | 5819 |
| 386 | Ga0315915_1019540 | 3300033464 | Eukaryota | 5799 |
| 387 | Ga0316587_1006434 | 3300033529 | Eukaryota | 1794 |
| 388 | Ga0316596_1018112 | 3300033541 | Eukaryota | 1777 |
| 389 | Ga0310104_00931 | 3300036242 | Eukaryota | 2187 |
| 390 | Ga0310104_01038 | 3300036242 | Eukaryota | 2114 |
| 391 | Ga0310112_002815 | 3300036458 | Eukaryota | 2234 |
| 392 | Ga0310112_005197 | 3300036458 | Eukaryota | 1803 |
| 393 | Ga0310112_006178 | 3300036458 | Eukaryota | 1690 |
| 394 | Ga0372808_002132 | 3300036459 | Eukaryota | 2226 |
| 395 | Ga0372808_002365 | 3300036459 | Eukaryota | 2162 |
| 396 | Ga0310109_002600 | 3300036534 | Eukaryota | 2045 |
| 397 | Ga0310109_003595 | 3300036534 | Eukaryota | 1859 |
| 398 | Ga0310109_003889 | 3300036534 | Eukaryota | 1814 |
| 399 | Ga0310109_004615 | 3300036534 | Eukaryota | 1720 |
| 400 | Ga0310110_002539 | 3300036535 | Eukaryota | 2401 |
| 401 | Ga0310110_003442 | 3300036535 | Eukaryota | 2167 |
| 402 | Ga0310110_005089 | 3300036535 | Eukaryota | 1879 |
| 403 | Ga0395899_0000020 | 3300037312 | Bacteria | 404354 |
| 404 | Ga0395898_0000005 | 3300037466 | Bacteria | 621247 |
| 405 | Ga0395905_0000018 | 3300037471 | Bacteria | 369321 |
| 406 | Ga0451794_09172 | 3300041446 | Eukaryota | 1863 |
| 407 | Ga0451796_00324 | 3300041450 | Eukaryota | 1960 |
| 408 | Ga0451799_01234 | 3300041454 | Eukaryota | 1578 |
| 409 | Ga0451805_044110 | 3300041461 | Eukaryota | 1798 |
| 410 | Ga0451806_577397 | 3300041462 | Eukaryota | 2125 |
| 411 | Ga0451833_0685941 | 3300041491 | Eukaryota | 3419 |
| 412 | Ga0451833_0851624 | 3300041491 | Eukaryota | 2854 |
| 413 | Ga0451833_1176887 | 3300041491 | Eukaryota | 2866 |
| 414 | Ga0451835_0017006 | 3300041492 | Eukaryota | 2471 |
| 415 | Ga0451835_0174742 | 3300041492 | Eukaryota | 2932 |
| 416 | Ga0451835_1194046 | 3300041492 | Eukaryota | 2135 |
| 417 | Ga0451838_08859 | 3300041495 | Eukaryota | 1693 |
| 418 | Ga0451839_1466467 | 3300041496 | Eukaryota | 1942 |
| 419 | Ga0451839_1650310 | 3300041496 | Eukaryota | 1818 |
| 420 | Ga0451840_10723 | 3300041497 | Eukaryota | 1636 |
| 421 | Ga0451841_0533417 | 3300041498 | Eukaryota | 2012 |
| 422 | Ga0451841_0611370 | 3300041498 | Eukaryota | 2562 |
| 423 | Ga0451842_7844 | 3300041499 | Eukaryota | 1674 |
| 424 | Ga0451844_00544 | 3300041500 | Eukaryota | 1835 |
| 425 | Ga0451844_24279 | 3300041500 | Eukaryota | 1690 |
| 426 | Ga0451845_0749138 | 3300041501 | Eukaryota | 1656 |
| 427 | Ga0451846_45774 | 3300041502 | Eukaryota | 1771 |
| 428 | Ga0451847_0242737 | 3300041503 | Eukaryota | 2295 |
| 429 | Ga0451849_1412885 | 3300041505 | Eukaryota | 2786 |
| 430 | Ga0451850_39160 | 3300041506 | Eukaryota | 1510 |
| 431 | Ga0451851_0392815 | 3300041507 | Eukaryota | 3410 |
| 432 | Ga0451851_0558824 | 3300041507 | Eukaryota | 3528 |
| 433 | Ga0451843_1217268 | 3300041509 | Eukaryota | 2393 |
| 434 | Ga0451843_1281996 | 3300041509 | Eukaryota | 1960 |
| 435 | Ga0451854_02552 | 3300041510 | Eukaryota | 1704 |
| 436 | Ga0451855_1762203 | 3300041511 | Eukaryota | 1871 |
| 437 | Ga0451853_1650285 | 3300041512 | Eukaryota | 2074 |
| 438 | Ga0451577_0000024 | 3300042876 | Bacteria | 411758 |
| 439 | Ga0451577_0001876 | 3300042876 | Bacteria | 26753 |
| 440 | Ga0451577_0106498 | 3300042876 | Eukaryota | 2506 |
| 441 | Ga0451577_0145846 | 3300042876 | Bacteria | 2128 |
| 442 | Ga0466988_0007673 | 3300044536 | Eukaryota | 5137 |
| 443 | Ga0466988_0009755 | 3300044536 | Eukaryota | 4752 |
| 444 | Ga0466988_0016463 | 3300044536 | Eukaryota | 3936 |
| 445 | Ga0466988_0110322 | 3300044536 | Eukaryota | 1622 |
| 446 | Ga0466984_0009030 | 3300044649 | Eukaryota | 6345 |
| 447 | Ga0466984_0010203 | 3300044649 | Eukaryota | 6055 |
| 448 | Ga0466984_0018079 | 3300044649 | Eukaryota | 4843 |
| 449 | Ga0466986_0000343 | 3300044650 | Eukaryota | 14383 |
| 450 | Ga0466986_0005089 | 3300044650 | Eukaryota | 7254 |
| 451 | Ga0466986_0015412 | 3300044650 | Eukaryota | 4890 |
| 452 | Ga0466986_0045011 | 3300044650 | Eukaryota | 3046 |
| 453 | Ga0466985_0003547 | 3300044651 | Eukaryota | 8205 |
| 454 | Ga0466985_0006728 | 3300044651 | Eukaryota | 6687 |
| 455 | Ga0466985_0008710 | 3300044651 | Eukaryota | 6129 |
| 456 | Ga0466985_0108416 | 3300044651 | Eukaryota | 1895 |
| 457 | Ga0466973_0002148 | 3300044659 | Eukaryota | 14653 |
| 458 | Ga0466973_0011898 | 3300044659 | Eukaryota | 8093 |
| 459 | Ga0466973_0045953 | 3300044659 | Eukaryota | 4075 |
| 460 | Ga0466973_0050625 | 3300044659 | Eukaryota | 3839 |
| 461 | Ga0466973_0109405 | 3300044659 | Eukaryota | 2315 |
| 462 | Ga0466973_0157842 | 3300044659 | Eukaryota | 1777 |
| 463 | Ga0466974_0007742 | 3300044660 | Eukaryota | 5999 |
| 464 | Ga0466974_0031305 | 3300044660 | Eukaryota | 3474 |
| 465 | Ga0466974_0034096 | 3300044660 | Eukaryota | 3343 |
| 466 | Ga0466975_0006100 | 3300044661 | Eukaryota | 6930 |
| 467 | Ga0466975_0006410 | 3300044661 | Eukaryota | 6814 |
| 468 | Ga0466975_0008154 | 3300044661 | Eukaryota | 6252 |
| 469 | Ga0466975_0017914 | 3300044661 | Eukaryota | 4702 |
| 470 | Ga0466975_0041346 | 3300044661 | Eukaryota | 3261 |
| 471 | Ga0466976_0009870 | 3300044662 | Eukaryota | 4912 |
| 472 | Ga0466976_0013705 | 3300044662 | Eukaryota | 4361 |
| 473 | Ga0466976_0049094 | 3300044662 | Eukaryota | 2539 |
| 474 | Ga0466989_0002824 | 3300044663 | Eukaryota | 7359 |
| 475 | Ga0466989_0003765 | 3300044663 | Eukaryota | 6775 |
| 476 | Ga0466989_0011827 | 3300044663 | Eukaryota | 4716 |
| 477 | Ga0466989_0024911 | 3300044663 | Eukaryota | 3508 |
| 478 | Ga0466987_0007724 | 3300044665 | Eukaryota | 5592 |
| 479 | Ga0466987_0011688 | 3300044665 | Eukaryota | 4851 |
| 480 | Ga0466977_0009723 | 3300044666 | Eukaryota | 5431 |
| 481 | Ga0466977_0032453 | 3300044666 | Eukaryota | 3348 |
| 482 | Ga0466977_0038759 | 3300044666 | Eukaryota | 3089 |
| 483 | Ga0466977_0042435 | 3300044666 | Eukaryota | 2959 |
| 484 | Ga0466977_0066336 | 3300044666 | Eukaryota | 2370 |
| 485 | Ga0466980_0004923 | 3300044668 | Eukaryota | 7453 |
| 486 | Ga0466980_0024063 | 3300044668 | Eukaryota | 4147 |
| 487 | Ga0466980_0067966 | 3300044668 | Eukaryota | 2484 |
| 488 | Ga0466981_0005328 | 3300044669 | Eukaryota | 7503 |
| 489 | Ga0466981_0020088 | 3300044669 | Eukaryota | 4605 |
| 490 | Ga0466981_0051217 | 3300044669 | Eukaryota | 2975 |
| 491 | Ga0466978_0004882 | 3300044671 | Eukaryota | 6536 |
| 492 | Ga0466978_0006631 | 3300044671 | Eukaryota | 5921 |
| 493 | Ga0466978_0012245 | 3300044671 | Eukaryota | 4783 |
| 494 | Ga0466978_0014155 | 3300044671 | Eukaryota | 4526 |
| 495 | Ga0466982_0008497 | 3300044672 | Eukaryota | 5171 |
| 496 | Ga0466982_0011537 | 3300044672 | Eukaryota | 4651 |
| 497 | Ga0466982_0022789 | 3300044672 | Eukaryota | 3606 |
| 498 | Ga0466982_0024737 | 3300044672 | Eukaryota | 3482 |
| 499 | Ga0453683_0000926 | 3300044673 | Bacteria | 27966 |
| 500 | Ga0453683_0099046 | 3300044673 | Bacteria | 1830 |
| 501 | Ga0453684_0000118 | 3300044712 | Bacteria | 346595 |
| 502 | Ga0453684_0005807 | 3300044712 | Bacteria | 24052 |
| 503 | Ga0453684_0009256 | 3300044712 | Bacteria | 17298 |
| 504 | Ga0453684_0012921 | 3300044712 | Bacteria | 13677 |
| 505 | Ga0453684_0041966 | 3300044712 | Bacteria | 6175 |
| 506 | Ga0453684_0089618 | 3300044712 | Bacteria | 3803 |
| 507 | Ga0453684_0116215 | 3300044712 | Bacteria | 3241 |
| 508 | Ga0453684_0165067 | 3300044712 | Bacteria | 2615 |
| 509 | Ga0466971_0000142 | 3300044719 | Bacteria | 26695 |
| 510 | Ga0466957_0015434 | 3300044842 | Bacteria | 4462 |
| 511 | Ga0451576_0000716 | 3300045051 | Bacteria | 66828 |
| 512 | Ga0451576_0001447 | 3300045051 | Bacteria | 40390 |
| 513 | Ga0451576_0001510 | 3300045051 | Bacteria | 39222 |
| 514 | Ga0451576_0002345 | 3300045051 | Bacteria | 28553 |
| 515 | Ga0451576_0002668 | 3300045051 | Bacteria | 25986 |
| 516 | Ga0451576_0004997 | 3300045051 | Bacteria | 16861 |
| 517 | Ga0451576_0005120 | 3300045051 | Bacteria | 16615 |
| 518 | Ga0451576_0271693 | 3300045051 | Eukaryota | 1772 |
| 519 | Ga0466967_0020759 | 3300045976 | Bacteria | 5319 |
| 520 | Ga0495585_0068370 | 3300046492 | Eukaryota | 1941 |
| 521 | Ga0495616_0002285 | 3300046513 | Bacteria | 12816 |
| 522 | Ga0495643_0008614 | 3300046522 | Bacteria | 6439 |
| 523 | Ga0495597_0050960 | 3300046542 | Eukaryota | 1826 |
| 524 | Ga0466979_0003968 | 3300048619 | Eukaryota | 9458 |
| 525 | Ga0466979_0005837 | 3300048619 | Eukaryota | 8287 |
| 526 | Ga0466979_0008126 | 3300048619 | Eukaryota | 7323 |
| 527 | Ga0466979_0049779 | 3300048619 | Eukaryota | 3219 |
| 528 | Ga0496104_0034887 | 3300048907 | Bacteria | 4693 |
| 529 | Ga0496108_0008138 | 3300048911 | Bacteria | 8504 |
| 530 | Ga0496109_0005422 | 3300048912 | Bacteria | 10672 |
| 531 | Ga0496110_0005459 | 3300048913 | Bacteria | 9972 |
| 532 | Ga0496112_0002847 | 3300048915 | Bacteria | 14056 |
| 533 | Ga0496116_0060725 | 3300048919 | Eukaryota | 2450 |
| 534 | Ga0466983_0006096 | 3300048986 | Eukaryota | 8489 |
| 535 | Ga0466983_0018830 | 3300048986 | Eukaryota | 5498 |
| 536 | Ga0466983_0073664 | 3300048986 | Eukaryota | 2863 |
| 537 | Ga0466983_0108993 | 3300048986 | Eukaryota | 2303 |
| 538 | Ga0501306_001361 | 3300049127 | Eukaryota | 2276 |
| 539 | Ga0501306_002193 | 3300049127 | Eukaryota | 1967 |
| 540 | Ga0501309_001559 | 3300049129 | Eukaryota | 2289 |
| 541 | Ga0501309_002736 | 3300049129 | Eukaryota | 1935 |
| 542 | Ga0501310_001691 | 3300049130 | Eukaryota | 2028 |
| 543 | Ga0501305_002650 | 3300049161 | Eukaryota | 1954 |
| 544 | Ga0501311_001670 | 3300049527 | Eukaryota | 1991 |
| 545 | Ga0501312_001732 | 3300049528 | Eukaryota | 2222 |
| 546 | Ga0501313_001472 | 3300049529 | Eukaryota | 2059 |
| 547 | Ga0501313_002183 | 3300049529 | Eukaryota | 1825 |
| 548 | Ga0501315_001458 | 3300049531 | Eukaryota | 2033 |
| 549 | Ga0501316_001403 | 3300049532 | Eukaryota | 2034 |
| 550 | Ga0501323_001855 | 3300049539 | Eukaryota | 1957 |
| 551 | Ga0501324_000698 | 3300049540 | Eukaryota | 1960 |
| 552 | Ga0501031_0063465 | 3300049568 | Bacteria | 2406 |
| 553 | Ga0501032_0000712 | 3300049569 | Bacteria | 27065 |
| 554 | Ga0501032_0000825 | 3300049569 | Bacteria | 25213 |
| 555 | Ga0501032_0032295 | 3300049569 | Bacteria | 3587 |
| 556 | Ga0501032_0114742 | 3300049569 | Bacteria | 1781 |
| 557 | Ga0501033_0000058 | 3300049570 | Bacteria | 107337 |
| 558 | Ga0501033_0000235 | 3300049570 | Bacteria | 53367 |
| 559 | Ga0501033_0000312 | 3300049570 | Bacteria | 46009 |
| 560 | Ga0501034_0020865 | 3300049571 | Bacteria | 6686 |
| 561 | Ga0501034_0060793 | 3300049571 | Bacteria | 3795 |
| 562 | Ga0501036_0029548 | 3300049572 | Bacteria | 4630 |
| 563 | Ga0501036_0038073 | 3300049572 | Bacteria | 4069 |
| 564 | Ga0501036_0287196 | 3300049572 | Bacteria | 1376 |
| 565 | Ga0501037_0000175 | 3300049573 | Bacteria | 60682 |
| 566 | Ga0501038_0000797 | 3300049574 | Bacteria | 27973 |
| 567 | Ga0501038_0001597 | 3300049574 | Bacteria | 21038 |
| 568 | Ga0501038_0021447 | 3300049574 | Bacteria | 5797 |
| 569 | Ga0501039_0083003 | 3300049575 | Bacteria | 2495 |
| 570 | Ga0501042_0057914 | 3300049578 | Bacteria | 2765 |
| 571 | Ga0501043_0000196 | 3300049579 | Bacteria | 55069 |
| 572 | Ga0501043_0000786 | 3300049579 | Bacteria | 28245 |
| 573 | Ga0501046_0001572 | 3300049580 | Bacteria | 21815 |
| 574 | Ga0501046_0048351 | 3300049580 | Bacteria | 3368 |
| 575 | Ga0501047_0052546 | 3300049581 | Bacteria | 3938 |
| 576 | Ga0501047_0148733 | 3300049581 | Bacteria | 2218 |
| 577 | Ga0501067_0031951 | 3300049583 | Bacteria | 2921 |
| 578 | Ga0501070_0003465 | 3300049586 | Bacteria | 13685 |
| 579 | Ga0501243_000609 | 3300049675 | Bacteria | 4840 |
| 580 | Ga0501083_0038599 | 3300049744 | Bacteria | 3246 |
| 581 | Ga0501035_0000001 | 3300049822 | Bacteria | 1037138 |
| 582 | Ga0501035_0000239 | 3300049822 | Bacteria | 65762 |
| 583 | Ga0501044_0000866 | 3300049823 | Bacteria | 36444 |
| 584 | Ga0501044_0001125 | 3300049823 | Bacteria | 31755 |
| 585 | Ga0501044_0005881 | 3300049823 | Bacteria | 13590 |
| 586 | Ga0501044_0113033 | 3300049823 | Bacteria | 2722 |
| 587 | Ga0500610_0042685 | 3300053079 | Eukaryota | 2347 |
| 588 | Ga0500578_0000219 | 3300053086 | Eukaryota | 71042 |
| 589 | Ga0500578_0001325 | 3300053086 | Eukaryota | 25418 |
| 590 | Ga0500578_0032281 | 3300053086 | Eukaryota | 3365 |
| 591 | Ga0500644_0013794 | 3300053088 | Eukaryota | 2265 |
| 592 | Ga0500581_016021 | 3300053089 | Eukaryota | 3748 |
| 593 | Ga0500581_019126 | 3300053089 | Eukaryota | 3452 |
| 594 | Ga0500581_034892 | 3300053089 | Eukaryota | 2575 |
| 595 | Ga0500647_0005773 | 3300053091 | Eukaryota | 5174 |
| 596 | Ga0500647_0064354 | 3300053091 | Eukaryota | 1763 |
| 597 | Ga0500651_0007187 | 3300053093 | Eukaryota | 6482 |
| 598 | Ga0500651_0008646 | 3300053093 | Bacteria | 6008 |
| 599 | Ga0500651_0024590 | 3300053093 | Eukaryota | 3777 |
| 600 | Ga0500651_0025491 | 3300053093 | Eukaryota | 3710 |
| 601 | Ga0500651_0032280 | 3300053093 | Eukaryota | 3299 |
| 602 | Ga0500566_0013312 | 3300053094 | Eukaryota | 4843 |
| 603 | Ga0500566_0028326 | 3300053094 | Eukaryota | 3273 |
| 604 | Ga0500566_0044772 | 3300053094 | Eukaryota | 2549 |
| 605 | Ga0500566_0054581 | 3300053094 | Eukaryota | 2277 |
| 606 | Ga0500640_015120 | 3300053095 | Eukaryota | 3224 |
| 607 | Ga0500640_017392 | 3300053095 | Eukaryota | 3049 |
| 608 | Ga0500648_015599 | 3300053097 | Eukaryota | 4135 |
| 609 | Ga0500648_031062 | 3300053097 | Eukaryota | 3003 |
| 610 | Ga0500648_067009 | 3300053097 | Eukaryota | 2032 |
| 611 | Ga0500650_0041540 | 3300053098 | Eukaryota | 2123 |
| 612 | Ga0500654_001295 | 3300053099 | Eukaryota | 17873 |
| 613 | Ga0500654_004403 | 3300053099 | Eukaryota | 10029 |
| 614 | Ga0500654_020559 | 3300053099 | Eukaryota | 4226 |
| 615 | Ga0500654_031568 | 3300053099 | Eukaryota | 3177 |
| 616 | Ga0500660_010964 | 3300053100 | Eukaryota | 4887 |
| 617 | Ga0500660_017812 | 3300053100 | Eukaryota | 3807 |
| 618 | Ga0500660_019045 | 3300053100 | Eukaryota | 3668 |
| 619 | Ga0500660_023954 | 3300053100 | Eukaryota | 3231 |
| 620 | Ga0500553_004659 | 3300053101 | Eukaryota | 6629 |
| 621 | Ga0500553_022057 | 3300053101 | Eukaryota | 3218 |
| 622 | Ga0500553_040376 | 3300053101 | Eukaryota | 2290 |
| 623 | Ga0500553_066900 | 3300053101 | Eukaryota | 1663 |
| 624 | Ga0500556_0008439 | 3300053104 | Eukaryota | 2972 |
| 625 | Ga0500556_0042283 | 3300053104 | Eukaryota | 1611 |
| 626 | Ga0500557_008588 | 3300053105 | Eukaryota | 2456 |
| 627 | Ga0500558_015446 | 3300053106 | Eukaryota | 3148 |
| 628 | Ga0500558_035651 | 3300053106 | Eukaryota | 2122 |
| 629 | Ga0500571_000196 | 3300053110 | Eukaryota | 21912 |
| 630 | Ga0500571_000799 | 3300053110 | Eukaryota | 13448 |
| 631 | Ga0500571_010917 | 3300053110 | Eukaryota | 5029 |
| 632 | Ga0500572_011218 | 3300053111 | Eukaryota | 2161 |
| 633 | Ga0500575_000476 | 3300053112 | Eukaryota | 6983 |
| 634 | Ga0500575_015348 | 3300053112 | Eukaryota | 2708 |
| 635 | Ga0500575_015828 | 3300053112 | Eukaryota | 2674 |
| 636 | Ga0500580_024782 | 3300053113 | Eukaryota | 2528 |
| 637 | Ga0500580_026843 | 3300053113 | Eukaryota | 2432 |
| 638 | Ga0500580_036617 | 3300053113 | Eukaryota | 2080 |
| 639 | Ga0500582_001329 | 3300053114 | Eukaryota | 3611 |
| 640 | Ga0500591_007990 | 3300053115 | Eukaryota | 4910 |
| 641 | Ga0500591_010695 | 3300053115 | Eukaryota | 4345 |
| 642 | Ga0500591_032690 | 3300053115 | Eukaryota | 2504 |
| 643 | Ga0500591_036136 | 3300053115 | Eukaryota | 2370 |
| 644 | Ga0500593_012648 | 3300053117 | Eukaryota | 3584 |
| 645 | Ga0500593_021760 | 3300053117 | Eukaryota | 2826 |
| 646 | Ga0500607_008938 | 3300053121 | Eukaryota | 6046 |
| 647 | Ga0500607_025759 | 3300053121 | Eukaryota | 3272 |
| 648 | Ga0500608_014622 | 3300053122 | Eukaryota | 3508 |
| 649 | Ga0500617_006739 | 3300053124 | Eukaryota | 4541 |
| 650 | Ga0500621_011987 | 3300053126 | Eukaryota | 3069 |
| 651 | Ga0500621_029726 | 3300053126 | Eukaryota | 2164 |
| 652 | Ga0500623_015690 | 3300053127 | Eukaryota | 3894 |
| 653 | Ga0500623_016353 | 3300053127 | Eukaryota | 3822 |
| 654 | Ga0500623_021810 | 3300053127 | Eukaryota | 3326 |
| 655 | Ga0500623_038800 | 3300053127 | Eukaryota | 2441 |
| 656 | Ga0500626_010715 | 3300053128 | Eukaryota | 3862 |
| 657 | Ga0500626_023312 | 3300053128 | Eukaryota | 2771 |
| 658 | Ga0500626_025438 | 3300053128 | Eukaryota | 2659 |
| 659 | Ga0500659_0025161 | 3300053135 | Eukaryota | 3245 |
| 660 | Ga0500573_0011829 | 3300053140 | Eukaryota | 4891 |
| 661 | Ga0500573_0023091 | 3300053140 | Eukaryota | 3571 |
| 662 | Ga0500573_0024878 | 3300053140 | Eukaryota | 3442 |
| 663 | Ga0500573_0025348 | 3300053140 | Eukaryota | 3409 |
| 664 | Ga0500577_0041806 | 3300053142 | Eukaryota | 1674 |
| 665 | Ga0500579_000151 | 3300053143 | Eukaryota | 38746 |
| 666 | Ga0500579_000173 | 3300053143 | Eukaryota | 36606 |
| 667 | Ga0500579_005016 | 3300053143 | Eukaryota | 8106 |
| 668 | Ga0500585_002253 | 3300053144 | Eukaryota | 4087 |
| 669 | Ga0500585_007526 | 3300053144 | Eukaryota | 2980 |
| 670 | Ga0500586_009913 | 3300053145 | Eukaryota | 2666 |
| 671 | Ga0500588_0007478 | 3300053146 | Eukaryota | 2520 |
| 672 | Ga0500590_013083 | 3300053148 | Eukaryota | 4250 |
| 673 | Ga0500590_019674 | 3300053148 | Eukaryota | 3500 |
| 674 | Ga0500590_022908 | 3300053148 | Eukaryota | 3244 |
| 675 | Ga0500590_045834 | 3300053148 | Eukaryota | 2237 |
| 676 | Ga0500600_0012393 | 3300053149 | Eukaryota | 5175 |
| 677 | Ga0500606_005322 | 3300053152 | Eukaryota | 3048 |
| 678 | Ga0500606_011574 | 3300053152 | Eukaryota | 2432 |
| 679 | Ga0500606_017261 | 3300053152 | Eukaryota | 2135 |
| 680 | Ga0500620_011261 | 3300053155 | Eukaryota | 2392 |
| 681 | Ga0500620_024340 | 3300053155 | Eukaryota | 1848 |
| 682 | Ga0500622_0004374 | 3300053156 | Bacteria | 8912 |
| 683 | Ga0500622_0016381 | 3300053156 | Eukaryota | 3962 |
| 684 | Ga0500622_0018256 | 3300053156 | Eukaryota | 3730 |
| 685 | Ga0500622_0025376 | 3300053156 | Eukaryota | 3131 |
| 686 | Ga0500630_007343 | 3300053159 | Eukaryota | 5405 |
| 687 | Ga0500630_009505 | 3300053159 | Eukaryota | 4774 |
| 688 | Ga0500630_026138 | 3300053159 | Eukaryota | 2877 |
| 689 | Ga0500630_033542 | 3300053159 | Eukaryota | 2518 |
| 690 | Ga0500634_0030474 | 3300053161 | Eukaryota | 2940 |
| 691 | Ga0500634_0036218 | 3300053161 | Eukaryota | 2686 |
| 692 | Ga0500638_004065 | 3300053162 | Eukaryota | 5553 |
| 693 | Ga0500638_009431 | 3300053162 | Eukaryota | 4225 |
| 694 | Ga0500639_001510 | 3300053163 | Eukaryota | 11737 |
| 695 | Ga0500639_012391 | 3300053163 | Eukaryota | 4475 |
| 696 | Ga0500639_035843 | 3300053163 | Eukaryota | 2617 |
| 697 | Ga0500639_058336 | 3300053163 | Eukaryota | 1994 |
| 698 | Ga0500636_0042536 | 3300053177 | Eukaryota | 2684 |
| 699 | Ga0500636_0051626 | 3300053177 | Eukaryota | 2417 |
| 700 | Ga0500637_0008195 | 3300053178 | Eukaryota | 5261 |
| 701 | Ga0500637_0016610 | 3300053178 | Eukaryota | 3926 |
| 702 | Ga0500637_0020158 | 3300053178 | Eukaryota | 3606 |
| 703 | Ga0500649_012708 | 3300053722 | Eukaryota | 3242 |
| 704 | Ga0500567_023528 | 3300053723 | Eukaryota | 2948 |
| 705 | Ga0500567_025515 | 3300053723 | Eukaryota | 2822 |
| 706 | Ga0500570_008592 | 3300053724 | Eukaryota | 5649 |
| 707 | Ga0500570_050065 | 3300053724 | Eukaryota | 2111 |
| 708 | Ga0500576_000112 | 3300053725 | Eukaryota | 14702 |
| 709 | Ga0500576_003833 | 3300053725 | Eukaryota | 5957 |
| 710 | Ga0500576_003842 | 3300053725 | Eukaryota | 5951 |
| 711 | Ga0500584_007187 | 3300053726 | Eukaryota | 4819 |
| 712 | Ga0500584_011799 | 3300053726 | Eukaryota | 3952 |
| 713 | Ga0500584_031081 | 3300053726 | Eukaryota | 2475 |
| 714 | Ga0500625_016356 | 3300053729 | Eukaryota | 3453 |
| 715 | Ga0500625_019223 | 3300053729 | Eukaryota | 3206 |
| 716 | Ga0500625_054025 | 3300053729 | Eukaryota | 1846 |
| 717 | Ga0500625_055409 | 3300053729 | Eukaryota | 1818 |
| 718 | Ga0587070_003157 | 3300059491 | Eukaryota | 1950 |
| 719 | Ga0587080_001067 | 3300059503 | Eukaryota | 2786 |
| 720 | Ga0587080_002950 | 3300059503 | Eukaryota | 2068 |
| 721 | Ga0587082_002955 | 3300059504 | Eukaryota | 1988 |
| 722 | Ga0587082_003177 | 3300059504 | Eukaryota | 1947 |
| 723 | Ga0587083_0003487 | 3300059505 | Eukaryota | 2092 |
| 724 | Ga0587088_001999 | 3300059508 | Eukaryota | 2237 |
| 725 | Ga0587089_001323 | 3300059509 | Eukaryota | 2266 |
| 726 | Ga0587090_001912 | 3300059510 | Eukaryota | 2199 |
| 727 | Ga0587091_002788 | 3300059511 | Eukaryota | 2118 |
| 728 | Ga0587094_001367 | 3300059513 | Eukaryota | 2284 |
| 729 | Ga0587074_00060 | 3300059602 | Eukaryota | 2274 |
| 730 | Ga0587098_000806 | 3300059604 | Eukaryota | 2136 |
| 731 | Ga0587106_001334 | 3300059605 | Eukaryota | 2150 |
| 732 | Ga0587109_003719 | 3300059624 | Eukaryota | 2056 |
| 733 | Ga0587113_000664 | 3300059625 | Eukaryota | 1935 |
| 734 | Ga0587128_001202 | 3300059630 | Eukaryota | 2360 |
| 735 | Ga0587062_001777 | 3300059639 | Eukaryota | 1941 |
| 736 | Ga0587067_002124 | 3300059640 | Eukaryota | 2292 |
| 737 | Ga0587068_002512 | 3300059641 | Eukaryota | 2237 |
| 738 | Ga0587068_004242 | 3300059641 | Eukaryota | 1885 |
| 739 | Ga0587069_001549 | 3300059642 | Eukaryota | 2145 |
| 740 | Ga0587072_001241 | 3300059643 | Eukaryota | 3083 |
| 741 | Ga0587072_002741 | 3300059643 | Eukaryota | 2396 |
| 742 | Ga0587075_000635 | 3300059644 | Eukaryota | 2945 |
| 743 | Ga0587076_001901 | 3300059645 | Eukaryota | 2239 |
| 744 | Ga0587078_001475 | 3300059646 | Eukaryota | 2109 |
| 745 | Ga0587102_000726 | 3300059649 | Eukaryota | 2025 |
| 746 | Ga0587104_000300 | 3300059650 | Eukaryota | 1942 |
| 747 | Ga0587107_001425 | 3300059652 | Eukaryota | 1945 |
| 748 | Ga0587108_000383 | 3300059653 | Eukaryota | 2202 |
| 749 | Ga0587118_00531 | 3300059657 | Eukaryota | 1952 |
| 750 | Ga0587120_000514 | 3300059659 | Eukaryota | 2016 |
| 751 | Ga0587060_000615 | 3300060243 | Eukaryota | 2048 |
| 752 | Ga0587071_001243 | 3300060344 | Eukaryota | 3093 |
| 753 | Ga0587071_003824 | 3300060344 | Eukaryota | 2197 |
| 754 | Ga0587111_0003259 | 3300060346 | Eukaryota | 2286 |
| 755 | Ga0587111_0004089 | 3300060346 | Eukaryota | 2140 |
| 756 | Ga0466962_0000021 | 3300061719 | Bacteria | 89078 |
| 757 | 2688393244 | 2687453341 | Bacteria | 6534136 |
| 758 | 2738733032 | 2738541279 | Bacteria | 6149495 |
| 759 | 2738765570 | 2738541285 | Bacteria | 6150075 |
| 760 | 2739214613 | 2738543007 | Bacteria | 6149845 |
| 761 | 2787506798 | 2786546548 | Bacteria | 4745694 |
| 762 | 2788436468 | 2786546940 | Bacteria | 6396474 |
| 763 | 2919512231 | 2919509842 | Bacteria | 4104664 |
| 764 | 2958514895 | 2958512119 | Bacteria | 4528530 |
| 765 | 8056443483 | 8056440228 | Bacteria | 4946504 |
| 766 | Ga0587077_003077 | |||
| 767 | JGI24743J22301_10000033 | |||
| 768 | JGI24033J26618_1000091 | |||
| 769 | Ga0006760J45825_100944 | |||
| 770 | Ga0006770J48903_1039640 | |||
| 771 | rootH1_10017807 | |||
| 772 | rootH2_10002506 | |||
| 773 | rootH2_10056337 | |||
| 774 | rootH2_10079256 | |||
| 775 | rootL2_10067010 | |||
| 776 | rootL2_10169922 | |||
| 777 | rootH1_10015810 | |||
| 778 | rootH1_10029938 | |||
| 779 | rootH1_10059113 | |||
| 780 | rootH1_10290663 | |||
| 781 | Ga0006556J51387_1001852 | |||
| 782 | Ga0006556J51387_1003319 | |||
| 783 | Ga0006556J51387_1006011 | |||
| 784 | Ga0006556J51387_1006012 | |||
| 785 | Ga0007417J51691_1005279 | |||
| 786 | Ga0006557J51388_1003258 | |||
| 787 | Ga0006557J51388_1007654 | |||
| 788 | Ga0006557J51388_1011294 | |||
| 789 | Ga0006558J51389_1007620 | |||
| 790 | Ga0006558J51389_1012456 | |||
| 791 | Ga0006559J51393_1002030 | |||
| 792 | Ga0006559J51393_1004417 | |||
| 793 | Ga0006559J51393_1005472 | |||
| 794 | Ga0006553J51392_1002676 | |||
| 795 | Ga0006553J51392_1002677 | |||
| 796 | Ga0006553J51392_1006354 | |||
| 797 | Ga0006553J51392_1009232 | |||
| 798 | Ga0006553J51392_1009233 | |||
| 799 | Ga0006555J51386_1002101 | |||
| 800 | Ga0006555J51386_1003454 | |||
| 801 | Ga0006555J51386_1004584 | |||
| 802 | Ga0006560J51390_1002148 | |||
| 803 | Ga0006560J51390_1002468 | |||
| 804 | Ga0006560J51390_1003168 | |||
| 805 | Ga0006554J51385_1005673 | |||
| 806 | Ga0006554J51385_1009750 | |||
| 807 | Ga0007410J51695_1015327 | |||
| 808 | Ga0007409J51694_1002305 | |||
| 809 | Ga0007409J51694_1004040 | |||
| 810 | Ga0007409J51694_1005953 | |||
| 811 | Ga0007416J51690_1002064 | |||
| 812 | Ga0006562J51391_1009759 | |||
| 813 | Ga0058863_10104301 | |||
| 814 | Ga0058860_10118984 | |||
| 815 | Ga0058862_10072939 | |||
| 816 | Ga0065714_10008350 | |||
| 817 | Ga0065714_10074752 | |||
| 818 | Ga0065704_10071143 | |||
| 819 | Ga0065704_10072412 | |||
| 820 | Ga0065715_10089560 | |||
| 821 | Ga0070658_10000334 | |||
| 822 | Ga0070683_100032301 | |||
| 823 | Ga0070683_100192796 | |||
| 824 | Ga0070690_100091704 | |||
| 825 | Ga0070670_100026965 | |||
| 826 | Ga0068869_100000177 | |||
| 827 | Ga0068868_100004199 | |||
| 828 | Ga0070668_100014552 | |||
| 829 | Ga0070688_100072861 | |||
| 830 | Ga0070667_100114532 | |||
| 831 | Ga0070663_100092801 | |||
| 832 | Ga0070678_100012449 | |||
| 833 | Ga0068867_100009825 | |||
| 834 | Ga0070684_100005152 | |||
| 835 | Ga0070704_100040712 | |||
| 836 | Ga0070664_100008522 | |||
| 837 | Ga0068856_100001795 | |||
| 838 | Ga0068856_100002539 | |||
| 839 | Ga0068866_10010773 | |||
| 840 | Ga0070717_10000060 | |||
| 841 | Ga0070712_100005031 | |||
| 842 | Ga0068871_100055115 | |||
| 843 | Ga0075428_100013048 | |||
| 844 | Ga0099825_1000968 | |||
| 845 | Ga0099825_1006620 | |||
| 846 | Ga0099825_1008186 | |||
| 847 | Ga0099825_1012731 | |||
| 848 | Ga0099825_1015924 | |||
| 849 | Ga0099824_1000152 | |||
| 850 | Ga0099824_1001369 | |||
| 851 | Ga0099824_1002882 | |||
| 852 | Ga0099824_1011337 | |||
| 853 | Ga0099824_1016693 | |||
| 854 | Ga0099822_1001507 | |||
| 855 | Ga0099822_1014542 | |||
| 856 | Ga0099822_1016133 | |||
| 857 | Ga0099822_1016811 | |||
| 858 | Ga0099822_1029439 | |||
| 859 | Ga0099823_1012196 | |||
| 860 | Ga0099823_1014063 | |||
| 861 | Ga0099823_1014698 | |||
| 862 | Ga0099823_1032315 | |||
| 863 | Ga0099823_1042911 | |||
| 864 | Ga0111539_10076711 | |||
| 865 | Ga0105248_10024605 | |||
| 866 | Ga0105237_10001258 | |||
| 867 | Ga0123340_1012829 | |||
| 868 | Ga0123340_1014312 | |||
| 869 | Ga0123340_1019357 | |||
| 870 | Ga0123340_1020935 | |||
| 871 | Ga0123340_1024538 | |||
| 872 | Ga0123341_1020325 | |||
| 873 | Ga0123341_1021674 | |||
| 874 | Ga0123341_1030624 | |||
| 875 | Ga0123341_1031846 | |||
| 876 | Ga0123341_1049410 | |||
| 877 | Ga0123342_1000675 | |||
| 878 | Ga0123342_1000777 | |||
| 879 | Ga0123342_1001375 | |||
| 880 | Ga0123342_1015060 | |||
| 881 | Ga0123342_1036996 | |||
| 882 | Ga0130086_1051381 | |||
| 883 | Ga0130085_1009033 | |||
| 884 | Ga0157373_10000100 | |||
| 885 | Ga0157370_10000156 | |||
| 886 | Ga0157370_10022212 | |||
| 887 | Ga0157369_10180539 | |||
| 888 | Ga0157378_10001118 | |||
| 889 | Ga0163163_10021623 | |||
| 890 | Ga0163163_10105615 | |||
| 891 | Ga0182004_10001901 | |||
| 892 | Ga0182004_10006101 | |||
| 893 | Ga0182004_10020967 | |||
| 894 | Ga0163161_10000039 | |||
| 895 | Ga0163161_10017299 | |||
| 896 | Ga0206356_10361440 | |||
| 897 | Ga0206349_1076403 | |||
| 898 | Ga0214544_1000213 | |||
| 899 | Ga0214544_1003722 | |||
| 900 | Ga0214544_1008947 | |||
| 901 | Ga0214544_1014384 | |||
| 902 | Ga0214544_1015320 | |||
| 903 | Ga0214542_1000103 | |||
| 904 | Ga0214542_1003237 | |||
| 905 | Ga0214542_1014675 | |||
| 906 | Ga0214542_1014958 | |||
| 907 | Ga0214545_1000252 | |||
| 908 | Ga0214545_1006288 | |||
| 909 | Ga0214545_1008081 | |||
| 910 | Ga0214545_1014787 | |||
| 911 | Ga0214545_1015704 | |||
| 912 | Ga0214543_1002083 | |||
| 913 | Ga0214543_1002928 | |||
| 914 | Ga0214543_1010234 | |||
| 915 | Ga0214543_1014913 | |||
| 916 | Ga0224712_10027421 | |||
| 917 | Ga0228711_1001769 | |||
| 918 | Ga0228711_1007623 | |||
| 919 | Ga0228710_1000477 | |||
| 920 | Ga0228710_1001876 | |||
| 921 | Ga0228710_1008270 | |||
| 922 | Ga0256714_122685 | |||
| 923 | Ga0256714_131853 | |||
| 924 | Ga0256744_140402 | |||
| 925 | Ga0256743_129875 | |||
| 926 | Ga0256720_130359 | |||
| 927 | Ga0247524_101315 | |||
| 928 | Ga0247524_101813 | |||
| 929 | Ga0247519_101369 | |||
| 930 | Ga0247519_101496 | |||
| 931 | Ga0247521_101578 | |||
| 932 | Ga0247521_101669 | |||
| 933 | Ga0247526_101347 | |||
| 934 | Ga0247526_101736 | |||
| 935 | Ga0247529_101636 | |||
| 936 | Ga0247529_101871 | |||
| 937 | Ga0247514_100888 | |||
| 938 | Ga0247514_102510 | |||
| 939 | Ga0247514_102915 | |||
| 940 | Ga0247518_102379 | |||
| 941 | Ga0247518_102880 | |||
| 942 | Ga0247516_102636 | |||
| 943 | Ga0247530_101245 | |||
| 944 | Ga0247530_102338 | |||
| 945 | Ga0247515_102230 | |||
| 946 | Ga0247515_102377 | |||
| 947 | Ga0247527_101032 | |||
| 948 | Ga0247527_101221 | |||
| 949 | Ga0247531_101364 | |||
| 950 | Ga0247531_101646 | |||
| 951 | Ga0247525_101094 | |||
| 952 | Ga0247525_101864 | |||
| 953 | Ga0247528_101148 | |||
| 954 | Ga0247528_101612 | |||
| 955 | Ga0247513_101857 | |||
| 956 | Ga0247513_102164 | |||
| 957 | Ga0247513_103366 | |||
| 958 | Ga0247523_101768 | |||
| 959 | Ga0247523_102341 | |||
| 960 | Ga0247520_101429 | |||
| 961 | Ga0247520_101562 | |||
| 962 | Ga0247520_102929 | |||
| 963 | Ga0247522_101894 | |||
| 964 | Ga0247522_102177 | |||
| 965 | Ga0247517_101084 | |||
| 966 | Ga0247517_102061 | |||
| 967 | Ga0247512_102482 | |||
| 968 | Ga0247512_104336 | |||
| 969 | Ga0207705_10002106 | |||
| 970 | Ga0207671_10000987 | |||
| 971 | Ga0207649_10000278 | |||
| 972 | Ga0207690_10009239 | |||
| 973 | Ga0207689_10000497 | |||
| 974 | Ga0207661_10019749 | |||
| 975 | Ga0207679_10014265 | |||
| 976 | Ga0207640_10023895 | |||
| 977 | Ga0207678_10170185 | |||
| 978 | Ga0207702_10000829 | |||
| 979 | Ga0207702_10001007 | |||
| 980 | Ga0207648_10011836 | |||
| 981 | Ga0207683_10023395 | |||
| 982 | Ga0209389_1015128 | |||
| 983 | Ga0209389_1022707 | |||
| 984 | Ga0209389_1030264 | |||
| 985 | Ga0209389_1034210 | |||
| 986 | Ga0209389_1047017 | |||
| 987 | Ga0209589_1001010 | |||
| 988 | Ga0209589_1002819 | |||
| 989 | Ga0209589_1005408 | |||
| 990 | Ga0209589_1015606 | |||
| 991 | Ga0209589_1016599 | |||
| 992 | Ga0209489_100068 | |||
| 993 | Ga0209489_100150 | |||
| 994 | Ga0209489_100154 | |||
| 995 | Ga0209489_100161 | |||
| 996 | Ga0209489_110956 | |||
| 997 | Ga0209700_100910 | |||
| 998 | Ga0209700_101042 | |||
| 999 | Ga0209700_101974 | |||
| 1000 | Ga0209700_103288 | |||
| 1001 | Ga0209700_103477 | |||
| 1002 | Ga0209282_1000930 | |||
| 1003 | Ga0209282_1004483 | |||
| 1004 | Ga0209282_1019781 | |||
| 1005 | Ga0265337_1015646 | |||
| 1006 | Ga0265319_1000008 | |||
| 1007 | Ga0265319_1000163 | |||
| 1008 | Ga0265319_1000880 | |||
| 1009 | Ga0265319_1004923 | |||
| 1010 | Ga0265319_1006129 | |||
| 1011 | Ga0265319_1010933 | |||
| 1012 | Ga0265319_1015852 | |||
| 1013 | Ga0265319_1020959 | |||
| 1014 | Ga0265334_10001450 | |||
| 1015 | Ga0265334_10004868 | |||
| 1016 | Ga0265318_10000005 | |||
| 1017 | Ga0265318_10001015 | |||
| 1018 | Ga0265318_10001020 | |||
| 1019 | Ga0265318_10004179 | |||
| 1020 | Ga0265323_10002261 | |||
| 1021 | Ga0265323_10003979 | |||
| 1022 | Ga0265323_10033143 | |||
| 1023 | Ga0265322_10002463 | |||
| 1024 | Ga0265336_10001541 | |||
| 1025 | Ga0307517_10004041 | |||
| 1026 | Ga0307517_10022127 | |||
| 1027 | Ga0307517_10052253 | |||
| 1028 | Ga0307517_10084867 | |||
| 1029 | Ga0307515_10012453 | |||
| 1030 | Ga0307515_10016304 | |||
| 1031 | Ga0307515_10023705 | |||
| 1032 | Ga0307515_10062290 | |||
| 1033 | Ga0265338_10000299 | |||
| 1034 | Ga0265338_10002938 | |||
| 1035 | Ga0265338_10167351 | |||
| 1036 | Ga0311000_116166 | |||
| 1037 | Ga0311008_120313 | |||
| 1038 | Ga0311001_1049994 | |||
| 1039 | Ga0311011_129510 | |||
| 1040 | Ga0311003_114429 | |||
| 1041 | Ga0311003_139614 | |||
| 1042 | Ga0310982_120901 | |||
| 1043 | Ga0310981_1044871 | |||
| 1044 | Ga0310981_1074111 | |||
| 1045 | Ga0265324_10005523 | |||
| 1046 | Ga0307511_10005543 | |||
| 1047 | Ga0307511_10029695 | |||
| 1048 | Ga0307511_10048187 | |||
| 1049 | Ga0307511_10102631 | |||
| 1050 | Ga0307512_10019886 | |||
| 1051 | Ga0307512_10055420 | |||
| 1052 | Ga0307512_10089619 | |||
| 1053 | Ga0265320_10000351 | |||
| 1054 | Ga0265320_10000634 | |||
| 1055 | Ga0265320_10000992 | |||
| 1056 | Ga0265320_10004190 | |||
| 1057 | Ga0265320_10004942 | |||
| 1058 | Ga0265320_10005990 | |||
| 1059 | Ga0265320_10006558 | |||
| 1060 | Ga0265320_10023395 | |||
| 1061 | Ga0265320_10031681 | |||
| 1062 | Ga0265340_10010136 | |||
| 1063 | Ga0265340_10042758 | |||
| 1064 | Ga0265331_10001596 | |||
| 1065 | Ga0265331_10010589 | |||
| 1066 | Ga0265327_10002240 | |||
| 1067 | Ga0265327_10005669 | |||
| 1068 | Ga0265327_10007630 | |||
| 1069 | Ga0265327_10071407 | |||
| 1070 | Ga0265316_10029259 | |||
| 1071 | Ga0265316_10041391 | |||
| 1072 | Ga0265316_10074227 | |||
| 1073 | Ga0307513_10015765 | |||
| 1074 | Ga0307509_10107252 | |||
| 1075 | Ga0307509_10165770 | |||
| 1076 | Ga0307408_100000007 | |||
| 1077 | Ga0310116_103785 | |||
| 1078 | Ga0310117_101725 | |||
| 1079 | Ga0310117_102007 | |||
| 1080 | Ga0265313_10001729 | |||
| 1081 | Ga0265313_10004398 | |||
| 1082 | Ga0265313_10017444 | |||
| 1083 | Ga0265313_10031907 | |||
| 1084 | Ga0310103_102678 | |||
| 1085 | Ga0310103_103137 | |||
| 1086 | Ga0310107_102443 | |||
| 1087 | Ga0310107_103329 | |||
| 1088 | Ga0310107_106584 | |||
| 1089 | Ga0307508_10000200 | |||
| 1090 | Ga0307508_10000340 | |||
| 1091 | Ga0307508_10022289 | |||
| 1092 | Ga0307508_10038364 | |||
| 1093 | Ga0310108_101700 | |||
| 1094 | Ga0310106_100604 | |||
| 1095 | Ga0310106_100874 | |||
| 1096 | Ga0310115_102339 | |||
| 1097 | Ga0310115_102928 | |||
| 1098 | Ga0310113_101712 | |||
| 1099 | Ga0310113_102273 | |||
| 1100 | Ga0307514_10006951 | |||
| 1101 | Ga0307514_10036253 | |||
| 1102 | Ga0307514_10068701 | |||
| 1103 | Ga0310118_101303 | |||
| 1104 | Ga0310105_102390 | |||
| 1105 | Ga0310105_102435 | |||
| 1106 | Ga0310111_102295 | |||
| 1107 | Ga0310111_103458 | |||
| 1108 | Ga0310114_101282 | |||
| 1109 | Ga0310119_103072 | |||
| 1110 | Ga0310101_102158 | |||
| 1111 | Ga0310101_103028 | |||
| 1112 | Ga0265314_10000619 | |||
| 1113 | Ga0265314_10006437 | |||
| 1114 | Ga0265314_10024034 | |||
| 1115 | Ga0265314_10038328 | |||
| 1116 | Ga0265342_10017325 | |||
| 1117 | Ga0265342_10040673 | |||
| 1118 | Ga0265342_10076487 | |||
| 1119 | Ga0307516_10000347 | |||
| 1120 | Ga0307516_10167491 | |||
| 1121 | Ga0307405_10000005 | |||
| 1122 | Ga0316044_102586 | |||
| 1123 | Ga0316044_102865 | |||
| 1124 | Ga0316045_102865 | |||
| 1125 | Ga0316042_103208 | |||
| 1126 | Ga0316043_103270 | |||
| 1127 | Ga0316043_107330 | |||
| 1128 | Ga0307518_10024537 | |||
| 1129 | Ga0307518_10037225 | |||
| 1130 | Ga0307518_10040938 | |||
| 1131 | Ga0307410_10000001 | |||
| 1132 | Ga0307407_10023230 | |||
| 1133 | Ga0315914_1002089 | |||
| 1134 | Ga0315914_1006743 | |||
| 1135 | Ga0315914_1011060 | |||
| 1136 | Ga0307409_100000033 | |||
| 1137 | Ga0307416_100000111 | |||
| 1138 | Ga0316593_10023633 | |||
| 1139 | Ga0307507_10010486 | |||
| 1140 | Ga0307507_10030137 | |||
| 1141 | Ga0307507_10053167 | |||
| 1142 | Ga0307510_10025325 | |||
| 1143 | Ga0307510_10078013 | |||
| 1144 | Ga0307510_10103156 | |||
| 1145 | Ga0315913_1000768 | |||
| 1146 | Ga0315913_1006457 | |||
| 1147 | Ga0315913_1023161 | |||
| 1148 | Ga0315915_1010060 | |||
| 1149 | Ga0315915_1019462 | |||
| 1150 | Ga0315915_1019540 | |||
| 1151 | Ga0316587_1006434 | |||
| 1152 | Ga0316596_1018112 | |||
| 1153 | Ga0310104_00931 | |||
| 1154 | Ga0310104_01038 | |||
| 1155 | Ga0310112_002815 | |||
| 1156 | Ga0310112_005197 | |||
| 1157 | Ga0310112_006178 | |||
| 1158 | Ga0372808_002132 | |||
| 1159 | Ga0372808_002365 | |||
| 1160 | Ga0310109_002600 | |||
| 1161 | Ga0310109_003595 | |||
| 1162 | Ga0310109_003889 | |||
| 1163 | Ga0310109_004615 | |||
| 1164 | Ga0310110_002539 | |||
| 1165 | Ga0310110_003442 | |||
| 1166 | Ga0310110_005089 | |||
| 1167 | Ga0395899_0000020 | |||
| 1168 | Ga0395898_0000005 | |||
| 1169 | Ga0395905_0000018 | |||
| 1170 | Ga0451794_09172 | |||
| 1171 | Ga0451796_00324 | |||
| 1172 | Ga0451799_01234 | |||
| 1173 | Ga0451805_044110 | |||
| 1174 | Ga0451806_577397 | |||
| 1175 | Ga0451833_0685941 | |||
| 1176 | Ga0451833_0851624 | |||
| 1177 | Ga0451833_1176887 | |||
| 1178 | Ga0451835_0017006 | |||
| 1179 | Ga0451835_0174742 | |||
| 1180 | Ga0451835_1194046 | |||
| 1181 | Ga0451838_08859 | |||
| 1182 | Ga0451839_1466467 | |||
| 1183 | Ga0451839_1650310 | |||
| 1184 | Ga0451840_10723 | |||
| 1185 | Ga0451841_0533417 | |||
| 1186 | Ga0451841_0611370 | |||
| 1187 | Ga0451842_7844 | |||
| 1188 | Ga0451844_00544 | |||
| 1189 | Ga0451844_24279 | |||
| 1190 | Ga0451845_0749138 | |||
| 1191 | Ga0451846_45774 | |||
| 1192 | Ga0451847_0242737 | |||
| 1193 | Ga0451849_1412885 | |||
| 1194 | Ga0451850_39160 | |||
| 1195 | Ga0451851_0392815 | |||
| 1196 | Ga0451851_0558824 | |||
| 1197 | Ga0451843_1217268 | |||
| 1198 | Ga0451843_1281996 | |||
| 1199 | Ga0451854_02552 | |||
| 1200 | Ga0451855_1762203 | |||
| 1201 | Ga0451853_1650285 | |||
| 1202 | Ga0451577_0000024 | |||
| 1203 | Ga0451577_0001876 | |||
| 1204 | Ga0451577_0106498 | |||
| 1205 | Ga0451577_0145846 | |||
| 1206 | Ga0466988_0007673 | |||
| 1207 | Ga0466988_0009755 | |||
| 1208 | Ga0466988_0016463 | |||
| 1209 | Ga0466988_0110322 | |||
| 1210 | Ga0466984_0009030 | |||
| 1211 | Ga0466984_0010203 | |||
| 1212 | Ga0466984_0018079 | |||
| 1213 | Ga0466986_0000343 | |||
| 1214 | Ga0466986_0005089 | |||
| 1215 | Ga0466986_0015412 | |||
| 1216 | Ga0466986_0045011 | |||
| 1217 | Ga0466985_0003547 | |||
| 1218 | Ga0466985_0006728 | |||
| 1219 | Ga0466985_0008710 | |||
| 1220 | Ga0466985_0108416 | |||
| 1221 | Ga0466973_0002148 | |||
| 1222 | Ga0466973_0011898 | |||
| 1223 | Ga0466973_0045953 | |||
| 1224 | Ga0466973_0050625 | |||
| 1225 | Ga0466973_0109405 | |||
| 1226 | Ga0466973_0157842 | |||
| 1227 | Ga0466974_0007742 | |||
| 1228 | Ga0466974_0031305 | |||
| 1229 | Ga0466974_0034096 | |||
| 1230 | Ga0466975_0006100 | |||
| 1231 | Ga0466975_0006410 | |||
| 1232 | Ga0466975_0008154 | |||
| 1233 | Ga0466975_0017914 | |||
| 1234 | Ga0466975_0041346 | |||
| 1235 | Ga0466976_0009870 | |||
| 1236 | Ga0466976_0013705 | |||
| 1237 | Ga0466976_0049094 | |||
| 1238 | Ga0466989_0002824 | |||
| 1239 | Ga0466989_0003765 | |||
| 1240 | Ga0466989_0011827 | |||
| 1241 | Ga0466989_0024911 | |||
| 1242 | Ga0466987_0007724 | |||
| 1243 | Ga0466987_0011688 | |||
| 1244 | Ga0466977_0009723 | |||
| 1245 | Ga0466977_0032453 | |||
| 1246 | Ga0466977_0038759 | |||
| 1247 | Ga0466977_0042435 | |||
| 1248 | Ga0466977_0066336 | |||
| 1249 | Ga0466980_0004923 | |||
| 1250 | Ga0466980_0024063 | |||
| 1251 | Ga0466980_0067966 | |||
| 1252 | Ga0466981_0005328 | |||
| 1253 | Ga0466981_0020088 | |||
| 1254 | Ga0466981_0051217 | |||
| 1255 | Ga0466978_0004882 | |||
| 1256 | Ga0466978_0006631 | |||
| 1257 | Ga0466978_0012245 | |||
| 1258 | Ga0466978_0014155 | |||
| 1259 | Ga0466982_0008497 | |||
| 1260 | Ga0466982_0011537 | |||
| 1261 | Ga0466982_0022789 | |||
| 1262 | Ga0466982_0024737 | |||
| 1263 | Ga0453683_0000926 | |||
| 1264 | Ga0453683_0099046 | |||
| 1265 | Ga0453684_0000118 | |||
| 1266 | Ga0453684_0005807 | |||
| 1267 | Ga0453684_0009256 | |||
| 1268 | Ga0453684_0012921 | |||
| 1269 | Ga0453684_0041966 | |||
| 1270 | Ga0453684_0089618 | |||
| 1271 | Ga0453684_0116215 | |||
| 1272 | Ga0453684_0165067 | |||
| 1273 | Ga0466971_0000142 | |||
| 1274 | Ga0466957_0015434 | |||
| 1275 | Ga0451576_0000716 | |||
| 1276 | Ga0451576_0001447 | |||
| 1277 | Ga0451576_0001510 | |||
| 1278 | Ga0451576_0002345 | |||
| 1279 | Ga0451576_0002668 | |||
| 1280 | Ga0451576_0004997 | |||
| 1281 | Ga0451576_0005120 | |||
| 1282 | Ga0451576_0271693 | |||
| 1283 | Ga0466967_0020759 | |||
| 1284 | Ga0495585_0068370 | |||
| 1285 | Ga0495616_0002285 | |||
| 1286 | Ga0495643_0008614 | |||
| 1287 | Ga0495597_0050960 | |||
| 1288 | Ga0466979_0003968 | |||
| 1289 | Ga0466979_0005837 | |||
| 1290 | Ga0466979_0008126 | |||
| 1291 | Ga0466979_0049779 | |||
| 1292 | Ga0496104_0034887 | |||
| 1293 | Ga0496108_0008138 | |||
| 1294 | Ga0496109_0005422 | |||
| 1295 | Ga0496110_0005459 | |||
| 1296 | Ga0496112_0002847 | |||
| 1297 | Ga0496116_0060725 | |||
| 1298 | Ga0466983_0006096 | |||
| 1299 | Ga0466983_0018830 | |||
| 1300 | Ga0466983_0073664 | |||
| 1301 | Ga0466983_0108993 | |||
| 1302 | Ga0501306_001361 | |||
| 1303 | Ga0501306_002193 | |||
| 1304 | Ga0501309_001559 | |||
| 1305 | Ga0501309_002736 | |||
| 1306 | Ga0501310_001691 | |||
| 1307 | Ga0501305_002650 | |||
| 1308 | Ga0501311_001670 | |||
| 1309 | Ga0501312_001732 | |||
| 1310 | Ga0501313_001472 | |||
| 1311 | Ga0501313_002183 | |||
| 1312 | Ga0501315_001458 | |||
| 1313 | Ga0501316_001403 | |||
| 1314 | Ga0501323_001855 | |||
| 1315 | Ga0501324_000698 | |||
| 1316 | Ga0501031_0063465 | |||
| 1317 | Ga0501032_0000712 | |||
| 1318 | Ga0501032_0000825 | |||
| 1319 | Ga0501032_0032295 | |||
| 1320 | Ga0501032_0114742 | |||
| 1321 | Ga0501033_0000058 | |||
| 1322 | Ga0501033_0000235 | |||
| 1323 | Ga0501033_0000312 | |||
| 1324 | Ga0501034_0020865 | |||
| 1325 | Ga0501034_0060793 | |||
| 1326 | Ga0501036_0029548 | |||
| 1327 | Ga0501036_0038073 | |||
| 1328 | Ga0501036_0287196 | |||
| 1329 | Ga0501037_0000175 | |||
| 1330 | Ga0501038_0000797 | |||
| 1331 | Ga0501038_0001597 | |||
| 1332 | Ga0501038_0021447 | |||
| 1333 | Ga0501039_0083003 | |||
| 1334 | Ga0501042_0057914 | |||
| 1335 | Ga0501043_0000196 | |||
| 1336 | Ga0501043_0000786 | |||
| 1337 | Ga0501046_0001572 | |||
| 1338 | Ga0501046_0048351 | |||
| 1339 | Ga0501047_0052546 | |||
| 1340 | Ga0501047_0148733 | |||
| 1341 | Ga0501067_0031951 | |||
| 1342 | Ga0501070_0003465 | |||
| 1343 | Ga0501243_000609 | |||
| 1344 | Ga0501083_0038599 | |||
| 1345 | Ga0501035_0000001 | |||
| 1346 | Ga0501035_0000239 | |||
| 1347 | Ga0501044_0000866 | |||
| 1348 | Ga0501044_0001125 | |||
| 1349 | Ga0501044_0005881 | |||
| 1350 | Ga0501044_0113033 | |||
| 1351 | Ga0500610_0042685 | |||
| 1352 | Ga0500578_0000219 | |||
| 1353 | Ga0500578_0001325 | |||
| 1354 | Ga0500578_0032281 | |||
| 1355 | Ga0500644_0013794 | |||
| 1356 | Ga0500581_016021 | |||
| 1357 | Ga0500581_019126 | |||
| 1358 | Ga0500581_034892 | |||
| 1359 | Ga0500647_0005773 | |||
| 1360 | Ga0500647_0064354 | |||
| 1361 | Ga0500651_0007187 | |||
| 1362 | Ga0500651_0008646 | |||
| 1363 | Ga0500651_0024590 | |||
| 1364 | Ga0500651_0025491 | |||
| 1365 | Ga0500651_0032280 | |||
| 1366 | Ga0500566_0013312 | |||
| 1367 | Ga0500566_0028326 | |||
| 1368 | Ga0500566_0044772 | |||
| 1369 | Ga0500566_0054581 | |||
| 1370 | Ga0500640_015120 | |||
| 1371 | Ga0500640_017392 | |||
| 1372 | Ga0500648_015599 | |||
| 1373 | Ga0500648_031062 | |||
| 1374 | Ga0500648_067009 | |||
| 1375 | Ga0500650_0041540 | |||
| 1376 | Ga0500654_001295 | |||
| 1377 | Ga0500654_004403 | |||
| 1378 | Ga0500654_020559 | |||
| 1379 | Ga0500654_031568 | |||
| 1380 | Ga0500660_010964 | |||
| 1381 | Ga0500660_017812 | |||
| 1382 | Ga0500660_019045 | |||
| 1383 | Ga0500660_023954 | |||
| 1384 | Ga0500553_004659 | |||
| 1385 | Ga0500553_022057 | |||
| 1386 | Ga0500553_040376 | |||
| 1387 | Ga0500553_066900 | |||
| 1388 | Ga0500556_0008439 | |||
| 1389 | Ga0500556_0042283 | |||
| 1390 | Ga0500557_008588 | |||
| 1391 | Ga0500558_015446 | |||
| 1392 | Ga0500558_035651 | |||
| 1393 | Ga0500571_000196 | |||
| 1394 | Ga0500571_000799 | |||
| 1395 | Ga0500571_010917 | |||
| 1396 | Ga0500572_011218 | |||
| 1397 | Ga0500575_000476 | |||
| 1398 | Ga0500575_015348 | |||
| 1399 | Ga0500575_015828 | |||
| 1400 | Ga0500580_024782 | |||
| 1401 | Ga0500580_026843 | |||
| 1402 | Ga0500580_036617 | |||
| 1403 | Ga0500582_001329 | |||
| 1404 | Ga0500591_007990 | |||
| 1405 | Ga0500591_010695 | |||
| 1406 | Ga0500591_032690 | |||
| 1407 | Ga0500591_036136 | |||
| 1408 | Ga0500593_012648 | |||
| 1409 | Ga0500593_021760 | |||
| 1410 | Ga0500607_008938 | |||
| 1411 | Ga0500607_025759 | |||
| 1412 | Ga0500608_014622 | |||
| 1413 | Ga0500617_006739 | |||
| 1414 | Ga0500621_011987 | |||
| 1415 | Ga0500621_029726 | |||
| 1416 | Ga0500623_015690 | |||
| 1417 | Ga0500623_016353 | |||
| 1418 | Ga0500623_021810 | |||
| 1419 | Ga0500623_038800 | |||
| 1420 | Ga0500626_010715 | |||
| 1421 | Ga0500626_023312 | |||
| 1422 | Ga0500626_025438 | |||
| 1423 | Ga0500659_0025161 | |||
| 1424 | Ga0500573_0011829 | |||
| 1425 | Ga0500573_0023091 | |||
| 1426 | Ga0500573_0024878 | |||
| 1427 | Ga0500573_0025348 | |||
| 1428 | Ga0500577_0041806 | |||
| 1429 | Ga0500579_000151 | |||
| 1430 | Ga0500579_000173 | |||
| 1431 | Ga0500579_005016 | |||
| 1432 | Ga0500585_002253 | |||
| 1433 | Ga0500585_007526 | |||
| 1434 | Ga0500586_009913 | |||
| 1435 | Ga0500588_0007478 | |||
| 1436 | Ga0500590_013083 | |||
| 1437 | Ga0500590_019674 | |||
| 1438 | Ga0500590_022908 | |||
| 1439 | Ga0500590_045834 | |||
| 1440 | Ga0500600_0012393 | |||
| 1441 | Ga0500606_005322 | |||
| 1442 | Ga0500606_011574 | |||
| 1443 | Ga0500606_017261 | |||
| 1444 | Ga0500620_011261 | |||
| 1445 | Ga0500620_024340 | |||
| 1446 | Ga0500622_0004374 | |||
| 1447 | Ga0500622_0016381 | |||
| 1448 | Ga0500622_0018256 | |||
| 1449 | Ga0500622_0025376 | |||
| 1450 | Ga0500630_007343 | |||
| 1451 | Ga0500630_009505 | |||
| 1452 | Ga0500630_026138 | |||
| 1453 | Ga0500630_033542 | |||
| 1454 | Ga0500634_0030474 | |||
| 1455 | Ga0500634_0036218 | |||
| 1456 | Ga0500638_004065 | |||
| 1457 | Ga0500638_009431 | |||
| 1458 | Ga0500639_001510 | |||
| 1459 | Ga0500639_012391 | |||
| 1460 | Ga0500639_035843 | |||
| 1461 | Ga0500639_058336 | |||
| 1462 | Ga0500636_0042536 | |||
| 1463 | Ga0500636_0051626 | |||
| 1464 | Ga0500637_0008195 | |||
| 1465 | Ga0500637_0016610 | |||
| 1466 | Ga0500637_0020158 | |||
| 1467 | Ga0500649_012708 | |||
| 1468 | Ga0500567_023528 | |||
| 1469 | Ga0500567_025515 | |||
| 1470 | Ga0500570_008592 | |||
| 1471 | Ga0500570_050065 | |||
| 1472 | Ga0500576_000112 | |||
| 1473 | Ga0500576_003833 | |||
| 1474 | Ga0500576_003842 | |||
| 1475 | Ga0500584_007187 | |||
| 1476 | Ga0500584_011799 | |||
| 1477 | Ga0500584_031081 | |||
| 1478 | Ga0500625_016356 | |||
| 1479 | Ga0500625_019223 | |||
| 1480 | Ga0500625_054025 | |||
| 1481 | Ga0500625_055409 | |||
| 1482 | Ga0587070_003157 | |||
| 1483 | Ga0587080_001067 | |||
| 1484 | Ga0587080_002950 | |||
| 1485 | Ga0587082_002955 | |||
| 1486 | Ga0587082_003177 | |||
| 1487 | Ga0587083_0003487 | |||
| 1488 | Ga0587088_001999 | |||
| 1489 | Ga0587089_001323 | |||
| 1490 | Ga0587090_001912 | |||
| 1491 | Ga0587091_002788 | |||
| 1492 | Ga0587094_001367 | |||
| 1493 | Ga0587074_00060 | |||
| 1494 | Ga0587098_000806 | |||
| 1495 | Ga0587106_001334 | |||
| 1496 | Ga0587109_003719 | |||
| 1497 | Ga0587113_000664 | |||
| 1498 | Ga0587128_001202 | |||
| 1499 | Ga0587062_001777 | |||
| 1500 | Ga0587067_002124 | |||
| 1501 | Ga0587068_002512 | |||
| 1502 | Ga0587068_004242 | |||
| 1503 | Ga0587069_001549 | |||
| 1504 | Ga0587072_001241 | |||
| 1505 | Ga0587072_002741 | |||
| 1506 | Ga0587075_000635 | |||
| 1507 | Ga0587076_001901 | |||
| 1508 | Ga0587078_001475 | |||
| 1509 | Ga0587102_000726 | |||
| 1510 | Ga0587104_000300 | |||
| 1511 | Ga0587107_001425 | |||
| 1512 | Ga0587108_000383 | |||
| 1513 | Ga0587118_00531 | |||
| 1514 | Ga0587120_000514 | |||
| 1515 | Ga0587060_000615 | |||
| 1516 | Ga0587071_001243 | |||
| 1517 | Ga0587071_003824 | |||
| 1518 | Ga0587111_0003259 | |||
| 1519 | Ga0587111_0004089 | |||
| 1520 | Ga0466962_0000021 | |||
| 1521 | 2688393244 | |||
| 1522 | 2738733032 | |||
| 1523 | 2738765570 | |||
| 1524 | 2739214613 | |||
| 1525 | 2787506798 | |||
| 1526 | 2788436468 | |||
| 1527 | 2919512231 | |||
| 1528 | 2958514895 | |||
| 1529 | 8056443483 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF03720
UDPG_MGDP_dh_C
UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain
356
480
0.98
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6om8-assembly2.cif.gz_G | caenorhabditis elegans udp-glucose dehydrogenase in complex with udp-xylose | 0.9807 | 2 | 452 |
| 5vr8-assembly1.cif.gz_C | human udp-glucose dehydrogenase with udp-xylose bound to the co-enzyme site | 0.9794 | 2 | 451 |
| 3tdk-assembly2.cif.gz_K | crystal structure of human udp-glucose dehydrogenase | 0.9774 | 2 | 453 |
| 3itk-assembly1.cif.gz_F | crystal structure of human udp-glucose dehydrogenase thr131ala, apo form. | 0.9772 | 2 | 453 |
| 6c58-assembly1.cif.gz_A | human udp-glucose dehydrogenase a225l substitutuion with udp-xylose bound | 0.9771 | 2 | 451 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1J5Y9_241_478_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.986 | 240 | 454 | 3.40.50.720 |
| 3itkA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.976 | 2 | 207 | 3.40.50.720 |
| 4edfA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.963 | 2 | 207 | 3.40.50.720 |
| af_A0A0R0GLX2_122_330_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9612 | 254 | 455 | 3.40.50.720 |
| af_O07248_235_441_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9525 | 240 | 454 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3P5YKV5-F1-model_v4 | UDP-glucose/GDP-mannose dehydrogenase N-terminal domain-containing protein | 1.004 | 1 | 71 |
GO:0003979
GO:0051287 |
| AF-A0A7S3SY84-F1-model_v4 | UDP-glucose/GDP-mannose dehydrogenase N-terminal domain-containing protein | 1.001 | 2 | 106 |
GO:0003979
GO:0005634 GO:0006024 GO:0051287 |
| AF-A0A196SAE6-F1-model_v4 | UDP-glucose 6-dehydrogenase 2 | 1.001 | 2 | 125 |
GO:0003979
GO:0005634 GO:0006024 GO:0051287 |
| AF-A0A5K0V305-F1-model_v4 | UDP-glucose/GDP-mannose dehydrogenase dimerisation domain-containing protein | 1 | 219 | 309 |
GO:0003979
GO:0005634 GO:0006024 GO:0051287 |
| AF-A0A392QBD0-F1-model_v4 | UDP-glucose 6-dehydrogenase 1-like | 0.9993 | 1 | 117 |
GO:0003979
GO:0005634 GO:0006024 GO:0051287 |