F479812

General Info

Members Datasets Scaffolds Average Seq Length
765 373 1529 470

Family's Representative Sequence

Representative Sequence 3300059493|Ga0587077_003077|Ga0587077_003077_398_1924
Length 508
Sequence MSGSLWVLFYNPLKKHLLQLQVTDLAVKMVKICCIGAGYVGGPTMAVIALKCPDIEVVVVDISKPRIEAWNSDTLPIYEPGLDDVVKQCRGKNLFFSTDVEKHVAEADIIFVSVNTPTKTRGLGAGKAADLTYWESAARMIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGINYQILSNPEFLAEGTAIEDLFKPDRVLIGGRETPEGRKAVQALKDVYAHWVPEDRILTTNLWSAELSKLAANAFLAQRISSVNAISALCEATGANVSEVAYAVGKDTRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVIKINDYQKSRFVNRVVSSMFNTVAGKKIAVLGFAFKKDTGDTRETPAIDVCKGLLGDKAQISIYDPQVTEDQIQRDLAMNKFDWDHPMHLQPTSPTAVKQVSCVWDAYEATKGAHGLCILTEWDEFKTLDYQKIFDNMQKPAFVFDGRNIVDPEKLREIGFIVYSIGKPLDAWLKDMPAVA

Samples

Sample ID Description Type Environment
1 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003158 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003556 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_09_fullP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003560 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_13_lowP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003561 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_01_fullP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003564 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_05_lowP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
23 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
25 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
51 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
52 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
53 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
58 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
59 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
60 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
61 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014486 Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG Metagenome Unclassified
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
72 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
73 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
74 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
77 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
78 3300023304 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctno.R1 Metatranscriptome Rhizosphere
79 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
80 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
81 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
82 3300023553 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
83 3300023556 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
84 3300023557 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
85 3300023558 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
86 3300023559 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
87 3300023560 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
88 3300023561 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
89 3300023562 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
90 3300023563 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
91 3300023564 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
92 3300023664 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
93 3300023666 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
94 3300023668 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
95 3300023680 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
96 3300023682 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
97 3300023684 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
98 3300023686 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
99 3300023688 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
100 3300023689 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
101 3300023690 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
115 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
116 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
117 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
118 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
119 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
120 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
121 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
122 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
123 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
124 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
125 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
126 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300029272 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 Metatranscriptome Rhizosphere
130 3300029273 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stno.R1 Metatranscriptome Rhizosphere
131 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
132 3300029280 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stcc.R1 Metatranscriptome Rhizosphere
133 3300029282 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 Metatranscriptome Rhizosphere
134 3300029283 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 Metatranscriptome Rhizosphere
135 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
136 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
137 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
138 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031591 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
148 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
151 3300031615 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031633 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
154 3300031634 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
155 3300031635 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
156 3300031636 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
157 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
158 3300031664 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
159 3300031666 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
160 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
161 3300031678 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
162 3300031686 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
163 3300031690 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031810 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
169 3300031815 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
170 3300031816 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
171 3300031828 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
172 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
182 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
183 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
186 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
187 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
188 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
189 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
194 3300041450 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaT Metatranscriptome Rhizoplane
195 3300041454 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT Metatranscriptome Rhizoplane
196 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
197 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
198 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
199 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
200 3300041495 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaT Metatranscriptome Unclassified
201 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
202 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
203 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
204 3300041499 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaT Metatranscriptome Unclassified
205 3300041500 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaT Metatranscriptome Unclassified
206 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
207 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
208 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
209 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
210 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
211 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
212 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
213 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
214 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
217 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
218 3300044649 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4E Metagenome Unclassified
219 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
220 3300044651 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC4E Metagenome Unclassified
221 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
222 3300044660 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E1 Metagenome Unclassified
223 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
224 3300044662 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA4E Metagenome Unclassified
225 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
226 3300044665 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC1E Metagenome Unclassified
227 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
228 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
229 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
230 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
231 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
232 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
233 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
234 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
235 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
239 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
240 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
241 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
242 3300048619 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC3E Metagenome Unclassified
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
249 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
250 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
276 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
280 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
281 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
282 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
283 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
284 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
285 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
286 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
287 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
288 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
289 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
290 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
291 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
292 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
293 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
294 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
295 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
296 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
297 3300053112 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 endosphere Metagenome Endosphere
298 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
299 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
300 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
301 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
302 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
303 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
304 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
305 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
306 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
307 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
308 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
309 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
310 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
311 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
312 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
313 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
314 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
315 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
316 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
317 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
318 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
319 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
320 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
321 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
322 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
323 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
324 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
325 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
326 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
327 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
328 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
329 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
330 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
331 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
332 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059602 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 15R_AD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
365 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
366 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
367 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
368 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
369 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
370 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
371 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
372 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
373 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.37
Metatranscriptomes 27.45
Isolates 1.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.12
Nodule 11.76
Rhizoplane 1.31
Rhizosphere 38.82
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587077_003077 3300059493 Eukaryota 2064
2 JGI24743J22301_10000033 3300001991 Bacteria 12324
3 JGI24033J26618_1000091 3300002155 Bacteria 12794
4 Ga0006760J45825_100944 3300003158 Eukaryota 1847
5 Ga0006770J48903_1039640 3300003305 Eukaryota 1852
6 rootH1_10017807 3300003316 Eukaryota 2608
7 rootH2_10002506 3300003320 Bacteria 47487
8 rootH2_10056337 3300003320 Bacteria 11946
9 rootH2_10079256 3300003320 Bacteria 6983
10 rootL2_10067010 3300003322 Unclassified 4822
11 rootL2_10169922 3300003322 Eukaryota 2242
12 rootH1_10015810 3300003316 Bacteria 1931
13 rootH1_10015810 3300003323 Bacteria 19240
14 rootH1_10029938 3300003323 Bacteria 3142
15 rootH1_10059113 3300003323 Bacteria 15831
16 rootH1_10290663 3300003323 Bacteria 3613
17 Ga0006556J51387_1001852 3300003479 Eukaryota 2142
18 Ga0006556J51387_1003319 3300003479 Eukaryota 1831
19 Ga0006556J51387_1006011 3300003479 Eukaryota 1759
20 Ga0006556J51387_1006012 3300003479 Eukaryota 2162
21 Ga0007417J51691_1005279 3300003544 Eukaryota 1886
22 Ga0006557J51388_1003258 3300003556 Eukaryota 2030
23 Ga0006557J51388_1007654 3300003556 Eukaryota 1854
24 Ga0006557J51388_1011294 3300003556 Eukaryota 1738
25 Ga0006558J51389_1007620 3300003558 Eukaryota 1797
26 Ga0006558J51389_1012456 3300003558 Eukaryota 1734
27 Ga0006559J51393_1002030 3300003560 Eukaryota 2142
28 Ga0006559J51393_1004417 3300003560 Eukaryota 1766
29 Ga0006559J51393_1005472 3300003560 Eukaryota 1772
30 Ga0006553J51392_1002676 3300003561 Eukaryota 1810
31 Ga0006553J51392_1002677 3300003561 Eukaryota 2123
32 Ga0006553J51392_1006354 3300003561 Eukaryota 1770
33 Ga0006553J51392_1009232 3300003561 Eukaryota 1766
34 Ga0006553J51392_1009233 3300003561 Eukaryota 2052
35 Ga0006555J51386_1002101 3300003564 Eukaryota 2143
36 Ga0006555J51386_1003454 3300003564 Eukaryota 1754
37 Ga0006555J51386_1004584 3300003564 Eukaryota 1773
38 Ga0006560J51390_1002148 3300003565 Eukaryota 1941
39 Ga0006560J51390_1002468 3300003565 Eukaryota 1929
40 Ga0006560J51390_1003168 3300003565 Eukaryota 1774
41 Ga0006554J51385_1005673 3300003567 Eukaryota 1804
42 Ga0006554J51385_1009750 3300003567 Eukaryota 1770
43 Ga0007410J51695_1015327 3300003574 Eukaryota 1881
44 Ga0007409J51694_1002305 3300003575 Eukaryota 1866
45 Ga0007409J51694_1004040 3300003575 Eukaryota 1874
46 Ga0007409J51694_1005953 3300003575 Eukaryota 1849
47 Ga0007416J51690_1002064 3300003577 Eukaryota 1865
48 Ga0006562J51391_1009759 3300003578 Bacteria 4485
49 Ga0058863_10104301 3300004799 Eukaryota 1956
50 Ga0058860_10118984 3300004801 Eukaryota 1884
51 Ga0058862_10072939 3300004803 Eukaryota 1940
52 Ga0065714_10008350 3300005288 Bacteria 8477
53 Ga0065714_10074752 3300005288 Bacteria 2988
54 Ga0065704_10071143 3300005289 Bacteria 12868
55 Ga0065704_10072412 3300005289 Bacteria 8573
56 Ga0065715_10089560 3300005293 Bacteria 9483
57 Ga0070658_10000334 3300005327 Bacteria 40558
58 Ga0070683_100032301 3300005329 Bacteria 4767
59 Ga0070683_100192796 3300005329 Bacteria 1935
60 Ga0070690_100091704 3300005330 Bacteria 2002
61 Ga0070670_100026965 3300005331 Bacteria 4942
62 Ga0068869_100000177 3300005334 Bacteria 32439
63 Ga0068868_100004199 3300005338 Bacteria 10072
64 Ga0070668_100014552 3300005347 Bacteria 5879
65 Ga0070688_100072861 3300005365 Bacteria 2202
66 Ga0070667_100114532 3300005367 Bacteria 2341
67 Ga0070663_100092801 3300005455 Bacteria 2239
68 Ga0070678_100012449 3300005456 Bacteria 5289
69 Ga0068867_100009825 3300005459 Bacteria 6743
70 Ga0070684_100005152 3300005535 Bacteria 9993
71 Ga0070704_100040712 3300005549 Eukaryota 3201
72 Ga0070664_100008522 3300005564 Bacteria 8291
73 Ga0068856_100001795 3300005614 Bacteria 22416
74 Ga0068856_100002539 3300005614 Bacteria 18824
75 Ga0068866_10010773 3300005718 Bacteria 3931
76 Ga0070717_10000060 3300006028 Bacteria 92521
77 Ga0070712_100005031 3300006175 Bacteria 8187
78 Ga0068871_100055115 3300006358 Bacteria 3227
79 Ga0075428_100013048 3300006844 Bacteria 9235
80 Ga0099825_1000968 3300006941 Eukaryota 34607
81 Ga0099825_1006620 3300006941 Eukaryota 14401
82 Ga0099825_1008186 3300006941 Eukaryota 12475
83 Ga0099825_1012731 3300006941 Eukaryota 8427
84 Ga0099825_1015924 3300006941 Eukaryota 6603
85 Ga0099824_1000152 3300006942 Eukaryota 61859
86 Ga0099824_1001369 3300006942 Eukaryota 34001
87 Ga0099824_1002882 3300006942 Eukaryota 25168
88 Ga0099824_1011337 3300006942 Eukaryota 10125
89 Ga0099824_1016693 3300006942 Eukaryota 6586
90 Ga0099822_1001507 3300006943 Eukaryota 27291
91 Ga0099822_1014542 3300006943 Eukaryota 9015
92 Ga0099822_1016133 3300006943 Eukaryota 8259
93 Ga0099822_1016811 3300006943 Eukaryota 7961
94 Ga0099822_1029439 3300006943 Eukaryota 4268
95 Ga0099823_1012196 3300006944 Eukaryota 8703
96 Ga0099823_1014063 3300006944 Eukaryota 8013
97 Ga0099823_1014698 3300006944 Eukaryota 7814
98 Ga0099823_1032315 3300006944 Eukaryota 4268
99 Ga0099823_1042911 3300006944 Eukaryota 3144
100 Ga0111539_10076711 3300009094 Bacteria 3935
101 Ga0105248_10024605 3300009177 Bacteria 6695
102 Ga0105237_10001258 3300009545 Bacteria 33852
103 Ga0123340_1012829 3300009763 Eukaryota 7519
104 Ga0123340_1014312 3300009763 Eukaryota 6974
105 Ga0123340_1019357 3300009763 Eukaryota 5442
106 Ga0123340_1020935 3300009763 Eukaryota 5042
107 Ga0123340_1024538 3300009763 Eukaryota 4298
108 Ga0123341_1020325 3300009765 Eukaryota 5659
109 Ga0123341_1021674 3300009765 Eukaryota 5387
110 Ga0123341_1030624 3300009765 Eukaryota 4047
111 Ga0123341_1031846 3300009765 Eukaryota 3897
112 Ga0123341_1049410 3300009765 Eukaryota 2420
113 Ga0123342_1000675 3300009766 Eukaryota 55083
114 Ga0123342_1000777 3300009766 Eukaryota 51976
115 Ga0123342_1001375 3300009766 Eukaryota 40897
116 Ga0123342_1015060 3300009766 Eukaryota 7180
117 Ga0123342_1036996 3300009766 Eukaryota 1983
118 Ga0130086_1051381 3300009829 Eukaryota 2063
119 Ga0130085_1009033 3300009850 Eukaryota 2063
120 Ga0157373_10000100 3300013100 Bacteria 70609
121 Ga0157370_10000156 3300013104 Bacteria 84357
122 Ga0157370_10022212 3300013104 Bacteria 6313
123 Ga0157369_10180539 3300013105 Bacteria 2221
124 Ga0157378_10001118 3300013297 Bacteria 24448
125 Ga0163163_10021623 3300014325 Bacteria 6074
126 Ga0163163_10105615 3300014325 Bacteria 2842
127 Ga0182004_10001901 3300014486 Eukaryota 15861
128 Ga0182004_10006101 3300014486 Eukaryota 9837
129 Ga0182004_10020967 3300014486 Eukaryota 4900
130 Ga0163161_10000039 3300017792 Bacteria 148130
131 Ga0163161_10017299 3300017792 Bacteria 5044
132 Ga0206356_10361440 3300020070 Eukaryota 1950
133 Ga0206349_1076403 3300020075 Eukaryota 1868
134 Ga0214544_1000213 3300021320 Eukaryota 93807
135 Ga0214544_1003722 3300021320 Eukaryota 31165
136 Ga0214544_1008947 3300021320 Eukaryota 16179
137 Ga0214544_1014384 3300021320 Eukaryota 8894
138 Ga0214544_1015320 3300021320 Eukaryota 8056
139 Ga0214542_1000103 3300021321 Eukaryota 113180
140 Ga0214542_1003237 3300021321 Eukaryota 33466
141 Ga0214542_1014675 3300021321 Eukaryota 8599
142 Ga0214542_1014958 3300021321 Eukaryota 8369
143 Ga0214545_1000252 3300021324 Eukaryota 75346
144 Ga0214545_1006288 3300021324 Eukaryota 20772
145 Ga0214545_1008081 3300021324 Eukaryota 17091
146 Ga0214545_1014787 3300021324 Eukaryota 8884
147 Ga0214545_1015704 3300021324 Eukaryota 8145
148 Ga0214543_1002083 3300021327 Eukaryota 39324
149 Ga0214543_1002928 3300021327 Eukaryota 33544
150 Ga0214543_1010234 3300021327 Eukaryota 14032
151 Ga0214543_1014913 3300021327 Eukaryota 8876
152 Ga0224712_10027421 3300022467 Eukaryota 2026
153 Ga0228711_1001769 3300022739 Eukaryota 32404
154 Ga0228711_1007623 3300022739 Eukaryota 15585
155 Ga0228710_1000477 3300022740 Eukaryota 50637
156 Ga0228710_1001876 3300022740 Eukaryota 32402
157 Ga0228710_1008270 3300022740 Eukaryota 14989
158 Ga0256714_122685 3300023304 Eukaryota 1899
159 Ga0256714_131853 3300023304 Eukaryota 1744
160 Ga0256744_140402 3300023309 Eukaryota 1905
161 Ga0256743_129875 3300023436 Eukaryota 1909
162 Ga0256720_130359 3300023438 Eukaryota 1978
163 Ga0247524_101315 3300023553 Eukaryota 2044
164 Ga0247524_101813 3300023553 Eukaryota 1849
165 Ga0247519_101369 3300023556 Eukaryota 2235
166 Ga0247519_101496 3300023556 Eukaryota 2169
167 Ga0247521_101578 3300023557 Eukaryota 2099
168 Ga0247521_101669 3300023557 Eukaryota 2056
169 Ga0247526_101347 3300023558 Eukaryota 2166
170 Ga0247526_101736 3300023558 Eukaryota 1994
171 Ga0247529_101636 3300023559 Eukaryota 2036
172 Ga0247529_101871 3300023559 Eukaryota 1947
173 Ga0247514_100888 3300023560 Eukaryota 2923
174 Ga0247514_102510 3300023560 Eukaryota 2105
175 Ga0247514_102915 3300023560 Eukaryota 1988
176 Ga0247518_102379 3300023561 Eukaryota 2120
177 Ga0247518_102880 3300023561 Eukaryota 1976
178 Ga0247516_102636 3300023562 Eukaryota 1998
179 Ga0247530_101245 3300023563 Eukaryota 2056
180 Ga0247530_102338 3300023563 Eukaryota 1674
181 Ga0247515_102230 3300023564 Eukaryota 2084
182 Ga0247515_102377 3300023564 Eukaryota 2039
183 Ga0247527_101032 3300023664 Eukaryota 2097
184 Ga0247527_101221 3300023664 Eukaryota 1993
185 Ga0247531_101364 3300023666 Eukaryota 2094
186 Ga0247531_101646 3300023666 Eukaryota 1970
187 Ga0247525_101094 3300023668 Eukaryota 2396
188 Ga0247525_101864 3300023668 Eukaryota 2022
189 Ga0247528_101148 3300023680 Eukaryota 1995
190 Ga0247528_101612 3300023680 Eukaryota 1787
191 Ga0247513_101857 3300023682 Eukaryota 2036
192 Ga0247513_102164 3300023682 Eukaryota 1932
193 Ga0247513_103366 3300023682 Eukaryota 1630
194 Ga0247523_101768 3300023684 Eukaryota 2047
195 Ga0247523_102341 3300023684 Eukaryota 1857
196 Ga0247520_101429 3300023686 Eukaryota 2149
197 Ga0247520_101562 3300023686 Eukaryota 2087
198 Ga0247520_102929 3300023686 Eukaryota 1683
199 Ga0247522_101894 3300023688 Eukaryota 2029
200 Ga0247522_102177 3300023688 Eukaryota 1930
201 Ga0247517_101084 3300023689 Eukaryota 2482
202 Ga0247517_102061 3300023689 Eukaryota 2032
203 Ga0247512_102482 3300023690 Eukaryota 2059
204 Ga0247512_104336 3300023690 Eukaryota 1657
205 Ga0207705_10002106 3300025909 Bacteria 15476
206 Ga0207671_10000987 3300025914 Bacteria 35078
207 Ga0207649_10000278 3300025920 Bacteria 40413
208 Ga0207690_10009239 3300025932 Bacteria 5854
209 Ga0207689_10000497 3300025942 Bacteria 37074
210 Ga0207661_10019749 3300025944 Bacteria 5029
211 Ga0207679_10014265 3300025945 Bacteria 5220
212 Ga0207640_10023895 3300025981 Bacteria 3680
213 Ga0207678_10170185 3300026067 Bacteria 1860
214 Ga0207702_10000829 3300026078 Bacteria 32602
215 Ga0207702_10001007 3300026078 Bacteria 28922
216 Ga0207648_10011836 3300026089 Bacteria 8199
217 Ga0207683_10023395 3300026121 Bacteria 5315
218 Ga0209389_1015128 3300027296 Eukaryota 7006
219 Ga0209389_1022707 3300027296 Eukaryota 5553
220 Ga0209389_1030264 3300027296 Eukaryota 4572
221 Ga0209389_1034210 3300027296 Eukaryota 4164
222 Ga0209389_1047017 3300027296 Eukaryota 3118
223 Ga0209589_1001010 3300027357 Eukaryota 44036
224 Ga0209589_1002819 3300027357 Eukaryota 30286
225 Ga0209589_1005408 3300027357 Eukaryota 21661
226 Ga0209589_1015606 3300027357 Eukaryota 9041
227 Ga0209589_1016599 3300027357 Eukaryota 8373
228 Ga0209489_100068 3300027361 Eukaryota 141350
229 Ga0209489_100150 3300027361 Eukaryota 106104
230 Ga0209489_100154 3300027361 Eukaryota 104068
231 Ga0209489_100161 3300027361 Eukaryota 102823
232 Ga0209489_110956 3300027361 Eukaryota 9690
233 Ga0209700_100910 3300027363 Eukaryota 59403
234 Ga0209700_101042 3300027363 Eukaryota 56008
235 Ga0209700_101974 3300027363 Eukaryota 42493
236 Ga0209700_103288 3300027363 Eukaryota 31215
237 Ga0209700_103477 3300027363 Eukaryota 30052
238 Ga0209282_1000930 3300027666 Eukaryota 15294
239 Ga0209282_1004483 3300027666 Eukaryota 8419
240 Ga0209282_1019781 3300027666 Eukaryota 4273
241 Ga0265337_1015646 3300028556 Bacteria 2476
242 Ga0265319_1000008 3300028563 Bacteria 215029
243 Ga0265319_1000163 3300028563 Bacteria 50418
244 Ga0265319_1000880 3300028563 Bacteria 19045
245 Ga0265319_1004923 3300028563 Bacteria 6524
246 Ga0265319_1006129 3300028563 Bacteria 5619
247 Ga0265319_1010933 3300028563 Bacteria 3757
248 Ga0265319_1015852 3300028563 Bacteria 2905
249 Ga0265319_1020959 3300028563 Bacteria 2409
250 Ga0265334_10001450 3300028573 Bacteria 11401
251 Ga0265334_10004868 3300028573 Bacteria 5902
252 Ga0265318_10000005 3300028577 Bacteria 303630
253 Ga0265318_10001015 3300028577 Bacteria 17934
254 Ga0265318_10001020 3300028577 Bacteria 17898
255 Ga0265318_10004179 3300028577 Bacteria 7056
256 Ga0265323_10002261 3300028653 Bacteria 8938
257 Ga0265323_10003979 3300028653 Bacteria 6412
258 Ga0265323_10033143 3300028653 Bacteria 1914
259 Ga0265322_10002463 3300028654 Bacteria 5709
260 Ga0265336_10001541 3300028666 Bacteria 10355
261 Ga0307517_10004041 3300028786 Eukaryota 22681
262 Ga0307517_10022127 3300028786 Eukaryota 7981
263 Ga0307517_10052253 3300028786 Eukaryota 4100
264 Ga0307517_10084867 3300028786 Eukaryota 2659
265 Ga0307515_10012453 3300028794 Eukaryota 15997
266 Ga0307515_10016304 3300028794 Eukaryota 13614
267 Ga0307515_10023705 3300028794 Eukaryota 10737
268 Ga0307515_10062290 3300028794 Eukaryota 5271
269 Ga0265338_10000299 3300028800 Bacteria 89317
270 Ga0265338_10002938 3300028800 Bacteria 24725
271 Ga0265338_10167351 3300028800 Bacteria 1691
272 Ga0311000_116166 3300029272 Eukaryota 1766
273 Ga0311008_120313 3300029273 Eukaryota 1906
274 Ga0311001_1049994 3300029277 Eukaryota 2038
275 Ga0311011_129510 3300029280 Eukaryota 2873
276 Ga0311003_114429 3300029282 Eukaryota 2220
277 Ga0311003_139614 3300029282 Eukaryota 3358
278 Ga0310982_120901 3300029283 Eukaryota 1904
279 Ga0310981_1044871 3300029285 Eukaryota 1986
280 Ga0310981_1074111 3300029285 Eukaryota 1580
281 Ga0265324_10005523 3300029957 Bacteria 5447
282 Ga0307511_10005543 3300030521 Eukaryota 12823
283 Ga0307511_10029695 3300030521 Eukaryota 4928
284 Ga0307511_10048187 3300030521 Eukaryota 3470
285 Ga0307511_10102631 3300030521 Eukaryota 1867
286 Ga0307512_10019886 3300030522 Eukaryota 6099
287 Ga0307512_10055420 3300030522 Eukaryota 3126
288 Ga0307512_10089619 3300030522 Eukaryota 2150
289 Ga0265320_10000351 3300031240 Bacteria 37562
290 Ga0265320_10000634 3300031240 Bacteria 26857
291 Ga0265320_10000992 3300031240 Bacteria 21054
292 Ga0265320_10004190 3300031240 Bacteria 9475
293 Ga0265320_10004942 3300031240 Bacteria 8647
294 Ga0265320_10005990 3300031240 Bacteria 7725
295 Ga0265320_10006558 3300031240 Bacteria 7322
296 Ga0265320_10023395 3300031240 Bacteria 3289
297 Ga0265320_10031681 3300031240 Bacteria 2714
298 Ga0265340_10010136 3300031247 Bacteria 5049
299 Ga0265340_10042758 3300031247 Bacteria 2223
300 Ga0265331_10001596 3300031250 Bacteria 16565
301 Ga0265331_10010589 3300031250 Bacteria 5093
302 Ga0265327_10002240 3300031251 Bacteria 20965
303 Ga0265327_10005669 3300031251 Bacteria 10335
304 Ga0265327_10007630 3300031251 Bacteria 8291
305 Ga0265327_10071407 3300031251 Bacteria 1737
306 Ga0265316_10029259 3300031344 Bacteria 4531
307 Ga0265316_10041391 3300031344 Bacteria 3688
308 Ga0265316_10074227 3300031344 Eukaryota 2618
309 Ga0307513_10015765 3300031456 Eukaryota 9146
310 Ga0307509_10107252 3300031507 Eukaryota 2809
311 Ga0307509_10165770 3300031507 Eukaryota 2098
312 Ga0307408_100000007 3300031548 Bacteria 463086
313 Ga0310116_103785 3300031591 Eukaryota 1565
314 Ga0310117_101725 3300031592 Eukaryota 2102
315 Ga0310117_102007 3300031592 Eukaryota 2004
316 Ga0265313_10001729 3300031595 Bacteria 20091
317 Ga0265313_10004398 3300031595 Bacteria 10867
318 Ga0265313_10017444 3300031595 Bacteria 4079
319 Ga0265313_10031907 3300031595 Eukaryota 2697
320 Ga0310103_102678 3300031614 Eukaryota 2167
321 Ga0310103_103137 3300031614 Eukaryota 2059
322 Ga0310107_102443 3300031615 Eukaryota 2249
323 Ga0310107_103329 3300031615 Eukaryota 2020
324 Ga0310107_106584 3300031615 Eukaryota 1540
325 Ga0307508_10000200 3300031616 Bacteria 71996
326 Ga0307508_10000340 3300031616 Bacteria 56710
327 Ga0307508_10022289 3300031616 Eukaryota 5756
328 Ga0307508_10038364 3300031616 Eukaryota 4306
329 Ga0310108_101700 3300031633 Eukaryota 2246
330 Ga0310106_100604 3300031634 Eukaryota 2204
331 Ga0310106_100874 3300031634 Eukaryota 1976
332 Ga0310115_102339 3300031635 Eukaryota 2182
333 Ga0310115_102928 3300031635 Eukaryota 2013
334 Ga0310113_101712 3300031636 Eukaryota 2177
335 Ga0310113_102273 3300031636 Eukaryota 2002
336 Ga0307514_10006951 3300031649 Eukaryota 9792
337 Ga0307514_10036253 3300031649 Eukaryota 3920
338 Ga0307514_10068701 3300031649 Eukaryota 2669
339 Ga0310118_101303 3300031664 Eukaryota 1906
340 Ga0310105_102390 3300031666 Eukaryota 2049
341 Ga0310105_102435 3300031666 Eukaryota 2035
342 Ga0310111_102295 3300031667 Eukaryota 2213
343 Ga0310111_103458 3300031667 Eukaryota 1930
344 Ga0310114_101282 3300031678 Eukaryota 2227
345 Ga0310119_103072 3300031686 Eukaryota 1996
346 Ga0310101_102158 3300031690 Eukaryota 2220
347 Ga0310101_103028 3300031690 Eukaryota 1972
348 Ga0265314_10000619 3300031711 Bacteria 43744
349 Ga0265314_10006437 3300031711 Bacteria 10399
350 Ga0265314_10024034 3300031711 Bacteria 4630
351 Ga0265314_10038328 3300031711 Bacteria 3463
352 Ga0265342_10017325 3300031712 Bacteria 4689
353 Ga0265342_10040673 3300031712 Bacteria 2819
354 Ga0265342_10076487 3300031712 Bacteria 1940
355 Ga0307516_10000347 3300031730 Eukaryota 60281
356 Ga0307516_10167491 3300031730 Eukaryota 1940
357 Ga0307405_10000005 3300031731 Bacteria 376536
358 Ga0316044_102586 3300031810 Eukaryota 2163
359 Ga0316044_102865 3300031810 Eukaryota 2084
360 Ga0316045_102865 3300031815 Eukaryota 2059
361 Ga0316042_103208 3300031816 Eukaryota 2276
362 Ga0316043_103270 3300031828 Eukaryota 2243
363 Ga0316043_107330 3300031828 Eukaryota 1573
364 Ga0307518_10024537 3300031838 Eukaryota 4347
365 Ga0307518_10037225 3300031838 Eukaryota 3537
366 Ga0307518_10040938 3300031838 Eukaryota 3371
367 Ga0307410_10000001 3300031852 Bacteria 162839
368 Ga0307407_10023230 3300031903 Bacteria 3232
369 Ga0315914_1002089 3300031967 Eukaryota 30525
370 Ga0315914_1006743 3300031967 Eukaryota 16152
371 Ga0315914_1011060 3300031967 Eukaryota 10973
372 Ga0307409_100000033 3300031995 Bacteria 48825
373 Ga0307416_100000111 3300032002 Bacteria 50097
374 Ga0316593_10023633 3300032168 Eukaryota 1942
375 Ga0307507_10010486 3300033179 Eukaryota 11961
376 Ga0307507_10030137 3300033179 Eukaryota 5729
377 Ga0307507_10053167 3300033179 Eukaryota 3873
378 Ga0307510_10025325 3300033180 Eukaryota 6842
379 Ga0307510_10078013 3300033180 Eukaryota 3243
380 Ga0307510_10103156 3300033180 Eukaryota 2630
381 Ga0315913_1000768 3300033430 Eukaryota 31264
382 Ga0315913_1006457 3300033430 Eukaryota 14177
383 Ga0315913_1023161 3300033430 Eukaryota 5386
384 Ga0315915_1010060 3300033464 Eukaryota 10579
385 Ga0315915_1019462 3300033464 Eukaryota 5819
386 Ga0315915_1019540 3300033464 Eukaryota 5799
387 Ga0316587_1006434 3300033529 Eukaryota 1794
388 Ga0316596_1018112 3300033541 Eukaryota 1777
389 Ga0310104_00931 3300036242 Eukaryota 2187
390 Ga0310104_01038 3300036242 Eukaryota 2114
391 Ga0310112_002815 3300036458 Eukaryota 2234
392 Ga0310112_005197 3300036458 Eukaryota 1803
393 Ga0310112_006178 3300036458 Eukaryota 1690
394 Ga0372808_002132 3300036459 Eukaryota 2226
395 Ga0372808_002365 3300036459 Eukaryota 2162
396 Ga0310109_002600 3300036534 Eukaryota 2045
397 Ga0310109_003595 3300036534 Eukaryota 1859
398 Ga0310109_003889 3300036534 Eukaryota 1814
399 Ga0310109_004615 3300036534 Eukaryota 1720
400 Ga0310110_002539 3300036535 Eukaryota 2401
401 Ga0310110_003442 3300036535 Eukaryota 2167
402 Ga0310110_005089 3300036535 Eukaryota 1879
403 Ga0395899_0000020 3300037312 Bacteria 404354
404 Ga0395898_0000005 3300037466 Bacteria 621247
405 Ga0395905_0000018 3300037471 Bacteria 369321
406 Ga0451794_09172 3300041446 Eukaryota 1863
407 Ga0451796_00324 3300041450 Eukaryota 1960
408 Ga0451799_01234 3300041454 Eukaryota 1578
409 Ga0451805_044110 3300041461 Eukaryota 1798
410 Ga0451806_577397 3300041462 Eukaryota 2125
411 Ga0451833_0685941 3300041491 Eukaryota 3419
412 Ga0451833_0851624 3300041491 Eukaryota 2854
413 Ga0451833_1176887 3300041491 Eukaryota 2866
414 Ga0451835_0017006 3300041492 Eukaryota 2471
415 Ga0451835_0174742 3300041492 Eukaryota 2932
416 Ga0451835_1194046 3300041492 Eukaryota 2135
417 Ga0451838_08859 3300041495 Eukaryota 1693
418 Ga0451839_1466467 3300041496 Eukaryota 1942
419 Ga0451839_1650310 3300041496 Eukaryota 1818
420 Ga0451840_10723 3300041497 Eukaryota 1636
421 Ga0451841_0533417 3300041498 Eukaryota 2012
422 Ga0451841_0611370 3300041498 Eukaryota 2562
423 Ga0451842_7844 3300041499 Eukaryota 1674
424 Ga0451844_00544 3300041500 Eukaryota 1835
425 Ga0451844_24279 3300041500 Eukaryota 1690
426 Ga0451845_0749138 3300041501 Eukaryota 1656
427 Ga0451846_45774 3300041502 Eukaryota 1771
428 Ga0451847_0242737 3300041503 Eukaryota 2295
429 Ga0451849_1412885 3300041505 Eukaryota 2786
430 Ga0451850_39160 3300041506 Eukaryota 1510
431 Ga0451851_0392815 3300041507 Eukaryota 3410
432 Ga0451851_0558824 3300041507 Eukaryota 3528
433 Ga0451843_1217268 3300041509 Eukaryota 2393
434 Ga0451843_1281996 3300041509 Eukaryota 1960
435 Ga0451854_02552 3300041510 Eukaryota 1704
436 Ga0451855_1762203 3300041511 Eukaryota 1871
437 Ga0451853_1650285 3300041512 Eukaryota 2074
438 Ga0451577_0000024 3300042876 Bacteria 411758
439 Ga0451577_0001876 3300042876 Bacteria 26753
440 Ga0451577_0106498 3300042876 Eukaryota 2506
441 Ga0451577_0145846 3300042876 Bacteria 2128
442 Ga0466988_0007673 3300044536 Eukaryota 5137
443 Ga0466988_0009755 3300044536 Eukaryota 4752
444 Ga0466988_0016463 3300044536 Eukaryota 3936
445 Ga0466988_0110322 3300044536 Eukaryota 1622
446 Ga0466984_0009030 3300044649 Eukaryota 6345
447 Ga0466984_0010203 3300044649 Eukaryota 6055
448 Ga0466984_0018079 3300044649 Eukaryota 4843
449 Ga0466986_0000343 3300044650 Eukaryota 14383
450 Ga0466986_0005089 3300044650 Eukaryota 7254
451 Ga0466986_0015412 3300044650 Eukaryota 4890
452 Ga0466986_0045011 3300044650 Eukaryota 3046
453 Ga0466985_0003547 3300044651 Eukaryota 8205
454 Ga0466985_0006728 3300044651 Eukaryota 6687
455 Ga0466985_0008710 3300044651 Eukaryota 6129
456 Ga0466985_0108416 3300044651 Eukaryota 1895
457 Ga0466973_0002148 3300044659 Eukaryota 14653
458 Ga0466973_0011898 3300044659 Eukaryota 8093
459 Ga0466973_0045953 3300044659 Eukaryota 4075
460 Ga0466973_0050625 3300044659 Eukaryota 3839
461 Ga0466973_0109405 3300044659 Eukaryota 2315
462 Ga0466973_0157842 3300044659 Eukaryota 1777
463 Ga0466974_0007742 3300044660 Eukaryota 5999
464 Ga0466974_0031305 3300044660 Eukaryota 3474
465 Ga0466974_0034096 3300044660 Eukaryota 3343
466 Ga0466975_0006100 3300044661 Eukaryota 6930
467 Ga0466975_0006410 3300044661 Eukaryota 6814
468 Ga0466975_0008154 3300044661 Eukaryota 6252
469 Ga0466975_0017914 3300044661 Eukaryota 4702
470 Ga0466975_0041346 3300044661 Eukaryota 3261
471 Ga0466976_0009870 3300044662 Eukaryota 4912
472 Ga0466976_0013705 3300044662 Eukaryota 4361
473 Ga0466976_0049094 3300044662 Eukaryota 2539
474 Ga0466989_0002824 3300044663 Eukaryota 7359
475 Ga0466989_0003765 3300044663 Eukaryota 6775
476 Ga0466989_0011827 3300044663 Eukaryota 4716
477 Ga0466989_0024911 3300044663 Eukaryota 3508
478 Ga0466987_0007724 3300044665 Eukaryota 5592
479 Ga0466987_0011688 3300044665 Eukaryota 4851
480 Ga0466977_0009723 3300044666 Eukaryota 5431
481 Ga0466977_0032453 3300044666 Eukaryota 3348
482 Ga0466977_0038759 3300044666 Eukaryota 3089
483 Ga0466977_0042435 3300044666 Eukaryota 2959
484 Ga0466977_0066336 3300044666 Eukaryota 2370
485 Ga0466980_0004923 3300044668 Eukaryota 7453
486 Ga0466980_0024063 3300044668 Eukaryota 4147
487 Ga0466980_0067966 3300044668 Eukaryota 2484
488 Ga0466981_0005328 3300044669 Eukaryota 7503
489 Ga0466981_0020088 3300044669 Eukaryota 4605
490 Ga0466981_0051217 3300044669 Eukaryota 2975
491 Ga0466978_0004882 3300044671 Eukaryota 6536
492 Ga0466978_0006631 3300044671 Eukaryota 5921
493 Ga0466978_0012245 3300044671 Eukaryota 4783
494 Ga0466978_0014155 3300044671 Eukaryota 4526
495 Ga0466982_0008497 3300044672 Eukaryota 5171
496 Ga0466982_0011537 3300044672 Eukaryota 4651
497 Ga0466982_0022789 3300044672 Eukaryota 3606
498 Ga0466982_0024737 3300044672 Eukaryota 3482
499 Ga0453683_0000926 3300044673 Bacteria 27966
500 Ga0453683_0099046 3300044673 Bacteria 1830
501 Ga0453684_0000118 3300044712 Bacteria 346595
502 Ga0453684_0005807 3300044712 Bacteria 24052
503 Ga0453684_0009256 3300044712 Bacteria 17298
504 Ga0453684_0012921 3300044712 Bacteria 13677
505 Ga0453684_0041966 3300044712 Bacteria 6175
506 Ga0453684_0089618 3300044712 Bacteria 3803
507 Ga0453684_0116215 3300044712 Bacteria 3241
508 Ga0453684_0165067 3300044712 Bacteria 2615
509 Ga0466971_0000142 3300044719 Bacteria 26695
510 Ga0466957_0015434 3300044842 Bacteria 4462
511 Ga0451576_0000716 3300045051 Bacteria 66828
512 Ga0451576_0001447 3300045051 Bacteria 40390
513 Ga0451576_0001510 3300045051 Bacteria 39222
514 Ga0451576_0002345 3300045051 Bacteria 28553
515 Ga0451576_0002668 3300045051 Bacteria 25986
516 Ga0451576_0004997 3300045051 Bacteria 16861
517 Ga0451576_0005120 3300045051 Bacteria 16615
518 Ga0451576_0271693 3300045051 Eukaryota 1772
519 Ga0466967_0020759 3300045976 Bacteria 5319
520 Ga0495585_0068370 3300046492 Eukaryota 1941
521 Ga0495616_0002285 3300046513 Bacteria 12816
522 Ga0495643_0008614 3300046522 Bacteria 6439
523 Ga0495597_0050960 3300046542 Eukaryota 1826
524 Ga0466979_0003968 3300048619 Eukaryota 9458
525 Ga0466979_0005837 3300048619 Eukaryota 8287
526 Ga0466979_0008126 3300048619 Eukaryota 7323
527 Ga0466979_0049779 3300048619 Eukaryota 3219
528 Ga0496104_0034887 3300048907 Bacteria 4693
529 Ga0496108_0008138 3300048911 Bacteria 8504
530 Ga0496109_0005422 3300048912 Bacteria 10672
531 Ga0496110_0005459 3300048913 Bacteria 9972
532 Ga0496112_0002847 3300048915 Bacteria 14056
533 Ga0496116_0060725 3300048919 Eukaryota 2450
534 Ga0466983_0006096 3300048986 Eukaryota 8489
535 Ga0466983_0018830 3300048986 Eukaryota 5498
536 Ga0466983_0073664 3300048986 Eukaryota 2863
537 Ga0466983_0108993 3300048986 Eukaryota 2303
538 Ga0501306_001361 3300049127 Eukaryota 2276
539 Ga0501306_002193 3300049127 Eukaryota 1967
540 Ga0501309_001559 3300049129 Eukaryota 2289
541 Ga0501309_002736 3300049129 Eukaryota 1935
542 Ga0501310_001691 3300049130 Eukaryota 2028
543 Ga0501305_002650 3300049161 Eukaryota 1954
544 Ga0501311_001670 3300049527 Eukaryota 1991
545 Ga0501312_001732 3300049528 Eukaryota 2222
546 Ga0501313_001472 3300049529 Eukaryota 2059
547 Ga0501313_002183 3300049529 Eukaryota 1825
548 Ga0501315_001458 3300049531 Eukaryota 2033
549 Ga0501316_001403 3300049532 Eukaryota 2034
550 Ga0501323_001855 3300049539 Eukaryota 1957
551 Ga0501324_000698 3300049540 Eukaryota 1960
552 Ga0501031_0063465 3300049568 Bacteria 2406
553 Ga0501032_0000712 3300049569 Bacteria 27065
554 Ga0501032_0000825 3300049569 Bacteria 25213
555 Ga0501032_0032295 3300049569 Bacteria 3587
556 Ga0501032_0114742 3300049569 Bacteria 1781
557 Ga0501033_0000058 3300049570 Bacteria 107337
558 Ga0501033_0000235 3300049570 Bacteria 53367
559 Ga0501033_0000312 3300049570 Bacteria 46009
560 Ga0501034_0020865 3300049571 Bacteria 6686
561 Ga0501034_0060793 3300049571 Bacteria 3795
562 Ga0501036_0029548 3300049572 Bacteria 4630
563 Ga0501036_0038073 3300049572 Bacteria 4069
564 Ga0501036_0287196 3300049572 Bacteria 1376
565 Ga0501037_0000175 3300049573 Bacteria 60682
566 Ga0501038_0000797 3300049574 Bacteria 27973
567 Ga0501038_0001597 3300049574 Bacteria 21038
568 Ga0501038_0021447 3300049574 Bacteria 5797
569 Ga0501039_0083003 3300049575 Bacteria 2495
570 Ga0501042_0057914 3300049578 Bacteria 2765
571 Ga0501043_0000196 3300049579 Bacteria 55069
572 Ga0501043_0000786 3300049579 Bacteria 28245
573 Ga0501046_0001572 3300049580 Bacteria 21815
574 Ga0501046_0048351 3300049580 Bacteria 3368
575 Ga0501047_0052546 3300049581 Bacteria 3938
576 Ga0501047_0148733 3300049581 Bacteria 2218
577 Ga0501067_0031951 3300049583 Bacteria 2921
578 Ga0501070_0003465 3300049586 Bacteria 13685
579 Ga0501243_000609 3300049675 Bacteria 4840
580 Ga0501083_0038599 3300049744 Bacteria 3246
581 Ga0501035_0000001 3300049822 Bacteria 1037138
582 Ga0501035_0000239 3300049822 Bacteria 65762
583 Ga0501044_0000866 3300049823 Bacteria 36444
584 Ga0501044_0001125 3300049823 Bacteria 31755
585 Ga0501044_0005881 3300049823 Bacteria 13590
586 Ga0501044_0113033 3300049823 Bacteria 2722
587 Ga0500610_0042685 3300053079 Eukaryota 2347
588 Ga0500578_0000219 3300053086 Eukaryota 71042
589 Ga0500578_0001325 3300053086 Eukaryota 25418
590 Ga0500578_0032281 3300053086 Eukaryota 3365
591 Ga0500644_0013794 3300053088 Eukaryota 2265
592 Ga0500581_016021 3300053089 Eukaryota 3748
593 Ga0500581_019126 3300053089 Eukaryota 3452
594 Ga0500581_034892 3300053089 Eukaryota 2575
595 Ga0500647_0005773 3300053091 Eukaryota 5174
596 Ga0500647_0064354 3300053091 Eukaryota 1763
597 Ga0500651_0007187 3300053093 Eukaryota 6482
598 Ga0500651_0008646 3300053093 Bacteria 6008
599 Ga0500651_0024590 3300053093 Eukaryota 3777
600 Ga0500651_0025491 3300053093 Eukaryota 3710
601 Ga0500651_0032280 3300053093 Eukaryota 3299
602 Ga0500566_0013312 3300053094 Eukaryota 4843
603 Ga0500566_0028326 3300053094 Eukaryota 3273
604 Ga0500566_0044772 3300053094 Eukaryota 2549
605 Ga0500566_0054581 3300053094 Eukaryota 2277
606 Ga0500640_015120 3300053095 Eukaryota 3224
607 Ga0500640_017392 3300053095 Eukaryota 3049
608 Ga0500648_015599 3300053097 Eukaryota 4135
609 Ga0500648_031062 3300053097 Eukaryota 3003
610 Ga0500648_067009 3300053097 Eukaryota 2032
611 Ga0500650_0041540 3300053098 Eukaryota 2123
612 Ga0500654_001295 3300053099 Eukaryota 17873
613 Ga0500654_004403 3300053099 Eukaryota 10029
614 Ga0500654_020559 3300053099 Eukaryota 4226
615 Ga0500654_031568 3300053099 Eukaryota 3177
616 Ga0500660_010964 3300053100 Eukaryota 4887
617 Ga0500660_017812 3300053100 Eukaryota 3807
618 Ga0500660_019045 3300053100 Eukaryota 3668
619 Ga0500660_023954 3300053100 Eukaryota 3231
620 Ga0500553_004659 3300053101 Eukaryota 6629
621 Ga0500553_022057 3300053101 Eukaryota 3218
622 Ga0500553_040376 3300053101 Eukaryota 2290
623 Ga0500553_066900 3300053101 Eukaryota 1663
624 Ga0500556_0008439 3300053104 Eukaryota 2972
625 Ga0500556_0042283 3300053104 Eukaryota 1611
626 Ga0500557_008588 3300053105 Eukaryota 2456
627 Ga0500558_015446 3300053106 Eukaryota 3148
628 Ga0500558_035651 3300053106 Eukaryota 2122
629 Ga0500571_000196 3300053110 Eukaryota 21912
630 Ga0500571_000799 3300053110 Eukaryota 13448
631 Ga0500571_010917 3300053110 Eukaryota 5029
632 Ga0500572_011218 3300053111 Eukaryota 2161
633 Ga0500575_000476 3300053112 Eukaryota 6983
634 Ga0500575_015348 3300053112 Eukaryota 2708
635 Ga0500575_015828 3300053112 Eukaryota 2674
636 Ga0500580_024782 3300053113 Eukaryota 2528
637 Ga0500580_026843 3300053113 Eukaryota 2432
638 Ga0500580_036617 3300053113 Eukaryota 2080
639 Ga0500582_001329 3300053114 Eukaryota 3611
640 Ga0500591_007990 3300053115 Eukaryota 4910
641 Ga0500591_010695 3300053115 Eukaryota 4345
642 Ga0500591_032690 3300053115 Eukaryota 2504
643 Ga0500591_036136 3300053115 Eukaryota 2370
644 Ga0500593_012648 3300053117 Eukaryota 3584
645 Ga0500593_021760 3300053117 Eukaryota 2826
646 Ga0500607_008938 3300053121 Eukaryota 6046
647 Ga0500607_025759 3300053121 Eukaryota 3272
648 Ga0500608_014622 3300053122 Eukaryota 3508
649 Ga0500617_006739 3300053124 Eukaryota 4541
650 Ga0500621_011987 3300053126 Eukaryota 3069
651 Ga0500621_029726 3300053126 Eukaryota 2164
652 Ga0500623_015690 3300053127 Eukaryota 3894
653 Ga0500623_016353 3300053127 Eukaryota 3822
654 Ga0500623_021810 3300053127 Eukaryota 3326
655 Ga0500623_038800 3300053127 Eukaryota 2441
656 Ga0500626_010715 3300053128 Eukaryota 3862
657 Ga0500626_023312 3300053128 Eukaryota 2771
658 Ga0500626_025438 3300053128 Eukaryota 2659
659 Ga0500659_0025161 3300053135 Eukaryota 3245
660 Ga0500573_0011829 3300053140 Eukaryota 4891
661 Ga0500573_0023091 3300053140 Eukaryota 3571
662 Ga0500573_0024878 3300053140 Eukaryota 3442
663 Ga0500573_0025348 3300053140 Eukaryota 3409
664 Ga0500577_0041806 3300053142 Eukaryota 1674
665 Ga0500579_000151 3300053143 Eukaryota 38746
666 Ga0500579_000173 3300053143 Eukaryota 36606
667 Ga0500579_005016 3300053143 Eukaryota 8106
668 Ga0500585_002253 3300053144 Eukaryota 4087
669 Ga0500585_007526 3300053144 Eukaryota 2980
670 Ga0500586_009913 3300053145 Eukaryota 2666
671 Ga0500588_0007478 3300053146 Eukaryota 2520
672 Ga0500590_013083 3300053148 Eukaryota 4250
673 Ga0500590_019674 3300053148 Eukaryota 3500
674 Ga0500590_022908 3300053148 Eukaryota 3244
675 Ga0500590_045834 3300053148 Eukaryota 2237
676 Ga0500600_0012393 3300053149 Eukaryota 5175
677 Ga0500606_005322 3300053152 Eukaryota 3048
678 Ga0500606_011574 3300053152 Eukaryota 2432
679 Ga0500606_017261 3300053152 Eukaryota 2135
680 Ga0500620_011261 3300053155 Eukaryota 2392
681 Ga0500620_024340 3300053155 Eukaryota 1848
682 Ga0500622_0004374 3300053156 Bacteria 8912
683 Ga0500622_0016381 3300053156 Eukaryota 3962
684 Ga0500622_0018256 3300053156 Eukaryota 3730
685 Ga0500622_0025376 3300053156 Eukaryota 3131
686 Ga0500630_007343 3300053159 Eukaryota 5405
687 Ga0500630_009505 3300053159 Eukaryota 4774
688 Ga0500630_026138 3300053159 Eukaryota 2877
689 Ga0500630_033542 3300053159 Eukaryota 2518
690 Ga0500634_0030474 3300053161 Eukaryota 2940
691 Ga0500634_0036218 3300053161 Eukaryota 2686
692 Ga0500638_004065 3300053162 Eukaryota 5553
693 Ga0500638_009431 3300053162 Eukaryota 4225
694 Ga0500639_001510 3300053163 Eukaryota 11737
695 Ga0500639_012391 3300053163 Eukaryota 4475
696 Ga0500639_035843 3300053163 Eukaryota 2617
697 Ga0500639_058336 3300053163 Eukaryota 1994
698 Ga0500636_0042536 3300053177 Eukaryota 2684
699 Ga0500636_0051626 3300053177 Eukaryota 2417
700 Ga0500637_0008195 3300053178 Eukaryota 5261
701 Ga0500637_0016610 3300053178 Eukaryota 3926
702 Ga0500637_0020158 3300053178 Eukaryota 3606
703 Ga0500649_012708 3300053722 Eukaryota 3242
704 Ga0500567_023528 3300053723 Eukaryota 2948
705 Ga0500567_025515 3300053723 Eukaryota 2822
706 Ga0500570_008592 3300053724 Eukaryota 5649
707 Ga0500570_050065 3300053724 Eukaryota 2111
708 Ga0500576_000112 3300053725 Eukaryota 14702
709 Ga0500576_003833 3300053725 Eukaryota 5957
710 Ga0500576_003842 3300053725 Eukaryota 5951
711 Ga0500584_007187 3300053726 Eukaryota 4819
712 Ga0500584_011799 3300053726 Eukaryota 3952
713 Ga0500584_031081 3300053726 Eukaryota 2475
714 Ga0500625_016356 3300053729 Eukaryota 3453
715 Ga0500625_019223 3300053729 Eukaryota 3206
716 Ga0500625_054025 3300053729 Eukaryota 1846
717 Ga0500625_055409 3300053729 Eukaryota 1818
718 Ga0587070_003157 3300059491 Eukaryota 1950
719 Ga0587080_001067 3300059503 Eukaryota 2786
720 Ga0587080_002950 3300059503 Eukaryota 2068
721 Ga0587082_002955 3300059504 Eukaryota 1988
722 Ga0587082_003177 3300059504 Eukaryota 1947
723 Ga0587083_0003487 3300059505 Eukaryota 2092
724 Ga0587088_001999 3300059508 Eukaryota 2237
725 Ga0587089_001323 3300059509 Eukaryota 2266
726 Ga0587090_001912 3300059510 Eukaryota 2199
727 Ga0587091_002788 3300059511 Eukaryota 2118
728 Ga0587094_001367 3300059513 Eukaryota 2284
729 Ga0587074_00060 3300059602 Eukaryota 2274
730 Ga0587098_000806 3300059604 Eukaryota 2136
731 Ga0587106_001334 3300059605 Eukaryota 2150
732 Ga0587109_003719 3300059624 Eukaryota 2056
733 Ga0587113_000664 3300059625 Eukaryota 1935
734 Ga0587128_001202 3300059630 Eukaryota 2360
735 Ga0587062_001777 3300059639 Eukaryota 1941
736 Ga0587067_002124 3300059640 Eukaryota 2292
737 Ga0587068_002512 3300059641 Eukaryota 2237
738 Ga0587068_004242 3300059641 Eukaryota 1885
739 Ga0587069_001549 3300059642 Eukaryota 2145
740 Ga0587072_001241 3300059643 Eukaryota 3083
741 Ga0587072_002741 3300059643 Eukaryota 2396
742 Ga0587075_000635 3300059644 Eukaryota 2945
743 Ga0587076_001901 3300059645 Eukaryota 2239
744 Ga0587078_001475 3300059646 Eukaryota 2109
745 Ga0587102_000726 3300059649 Eukaryota 2025
746 Ga0587104_000300 3300059650 Eukaryota 1942
747 Ga0587107_001425 3300059652 Eukaryota 1945
748 Ga0587108_000383 3300059653 Eukaryota 2202
749 Ga0587118_00531 3300059657 Eukaryota 1952
750 Ga0587120_000514 3300059659 Eukaryota 2016
751 Ga0587060_000615 3300060243 Eukaryota 2048
752 Ga0587071_001243 3300060344 Eukaryota 3093
753 Ga0587071_003824 3300060344 Eukaryota 2197
754 Ga0587111_0003259 3300060346 Eukaryota 2286
755 Ga0587111_0004089 3300060346 Eukaryota 2140
756 Ga0466962_0000021 3300061719 Bacteria 89078
757 2688393244 2687453341 Bacteria 6534136
758 2738733032 2738541279 Bacteria 6149495
759 2738765570 2738541285 Bacteria 6150075
760 2739214613 2738543007 Bacteria 6149845
761 2787506798 2786546548 Bacteria 4745694
762 2788436468 2786546940 Bacteria 6396474
763 2919512231 2919509842 Bacteria 4104664
764 2958514895 2958512119 Bacteria 4528530
765 8056443483 8056440228 Bacteria 4946504
766 Ga0587077_003077
767 JGI24743J22301_10000033
768 JGI24033J26618_1000091
769 Ga0006760J45825_100944
770 Ga0006770J48903_1039640
771 rootH1_10017807
772 rootH2_10002506
773 rootH2_10056337
774 rootH2_10079256
775 rootL2_10067010
776 rootL2_10169922
777 rootH1_10015810
778 rootH1_10029938
779 rootH1_10059113
780 rootH1_10290663
781 Ga0006556J51387_1001852
782 Ga0006556J51387_1003319
783 Ga0006556J51387_1006011
784 Ga0006556J51387_1006012
785 Ga0007417J51691_1005279
786 Ga0006557J51388_1003258
787 Ga0006557J51388_1007654
788 Ga0006557J51388_1011294
789 Ga0006558J51389_1007620
790 Ga0006558J51389_1012456
791 Ga0006559J51393_1002030
792 Ga0006559J51393_1004417
793 Ga0006559J51393_1005472
794 Ga0006553J51392_1002676
795 Ga0006553J51392_1002677
796 Ga0006553J51392_1006354
797 Ga0006553J51392_1009232
798 Ga0006553J51392_1009233
799 Ga0006555J51386_1002101
800 Ga0006555J51386_1003454
801 Ga0006555J51386_1004584
802 Ga0006560J51390_1002148
803 Ga0006560J51390_1002468
804 Ga0006560J51390_1003168
805 Ga0006554J51385_1005673
806 Ga0006554J51385_1009750
807 Ga0007410J51695_1015327
808 Ga0007409J51694_1002305
809 Ga0007409J51694_1004040
810 Ga0007409J51694_1005953
811 Ga0007416J51690_1002064
812 Ga0006562J51391_1009759
813 Ga0058863_10104301
814 Ga0058860_10118984
815 Ga0058862_10072939
816 Ga0065714_10008350
817 Ga0065714_10074752
818 Ga0065704_10071143
819 Ga0065704_10072412
820 Ga0065715_10089560
821 Ga0070658_10000334
822 Ga0070683_100032301
823 Ga0070683_100192796
824 Ga0070690_100091704
825 Ga0070670_100026965
826 Ga0068869_100000177
827 Ga0068868_100004199
828 Ga0070668_100014552
829 Ga0070688_100072861
830 Ga0070667_100114532
831 Ga0070663_100092801
832 Ga0070678_100012449
833 Ga0068867_100009825
834 Ga0070684_100005152
835 Ga0070704_100040712
836 Ga0070664_100008522
837 Ga0068856_100001795
838 Ga0068856_100002539
839 Ga0068866_10010773
840 Ga0070717_10000060
841 Ga0070712_100005031
842 Ga0068871_100055115
843 Ga0075428_100013048
844 Ga0099825_1000968
845 Ga0099825_1006620
846 Ga0099825_1008186
847 Ga0099825_1012731
848 Ga0099825_1015924
849 Ga0099824_1000152
850 Ga0099824_1001369
851 Ga0099824_1002882
852 Ga0099824_1011337
853 Ga0099824_1016693
854 Ga0099822_1001507
855 Ga0099822_1014542
856 Ga0099822_1016133
857 Ga0099822_1016811
858 Ga0099822_1029439
859 Ga0099823_1012196
860 Ga0099823_1014063
861 Ga0099823_1014698
862 Ga0099823_1032315
863 Ga0099823_1042911
864 Ga0111539_10076711
865 Ga0105248_10024605
866 Ga0105237_10001258
867 Ga0123340_1012829
868 Ga0123340_1014312
869 Ga0123340_1019357
870 Ga0123340_1020935
871 Ga0123340_1024538
872 Ga0123341_1020325
873 Ga0123341_1021674
874 Ga0123341_1030624
875 Ga0123341_1031846
876 Ga0123341_1049410
877 Ga0123342_1000675
878 Ga0123342_1000777
879 Ga0123342_1001375
880 Ga0123342_1015060
881 Ga0123342_1036996
882 Ga0130086_1051381
883 Ga0130085_1009033
884 Ga0157373_10000100
885 Ga0157370_10000156
886 Ga0157370_10022212
887 Ga0157369_10180539
888 Ga0157378_10001118
889 Ga0163163_10021623
890 Ga0163163_10105615
891 Ga0182004_10001901
892 Ga0182004_10006101
893 Ga0182004_10020967
894 Ga0163161_10000039
895 Ga0163161_10017299
896 Ga0206356_10361440
897 Ga0206349_1076403
898 Ga0214544_1000213
899 Ga0214544_1003722
900 Ga0214544_1008947
901 Ga0214544_1014384
902 Ga0214544_1015320
903 Ga0214542_1000103
904 Ga0214542_1003237
905 Ga0214542_1014675
906 Ga0214542_1014958
907 Ga0214545_1000252
908 Ga0214545_1006288
909 Ga0214545_1008081
910 Ga0214545_1014787
911 Ga0214545_1015704
912 Ga0214543_1002083
913 Ga0214543_1002928
914 Ga0214543_1010234
915 Ga0214543_1014913
916 Ga0224712_10027421
917 Ga0228711_1001769
918 Ga0228711_1007623
919 Ga0228710_1000477
920 Ga0228710_1001876
921 Ga0228710_1008270
922 Ga0256714_122685
923 Ga0256714_131853
924 Ga0256744_140402
925 Ga0256743_129875
926 Ga0256720_130359
927 Ga0247524_101315
928 Ga0247524_101813
929 Ga0247519_101369
930 Ga0247519_101496
931 Ga0247521_101578
932 Ga0247521_101669
933 Ga0247526_101347
934 Ga0247526_101736
935 Ga0247529_101636
936 Ga0247529_101871
937 Ga0247514_100888
938 Ga0247514_102510
939 Ga0247514_102915
940 Ga0247518_102379
941 Ga0247518_102880
942 Ga0247516_102636
943 Ga0247530_101245
944 Ga0247530_102338
945 Ga0247515_102230
946 Ga0247515_102377
947 Ga0247527_101032
948 Ga0247527_101221
949 Ga0247531_101364
950 Ga0247531_101646
951 Ga0247525_101094
952 Ga0247525_101864
953 Ga0247528_101148
954 Ga0247528_101612
955 Ga0247513_101857
956 Ga0247513_102164
957 Ga0247513_103366
958 Ga0247523_101768
959 Ga0247523_102341
960 Ga0247520_101429
961 Ga0247520_101562
962 Ga0247520_102929
963 Ga0247522_101894
964 Ga0247522_102177
965 Ga0247517_101084
966 Ga0247517_102061
967 Ga0247512_102482
968 Ga0247512_104336
969 Ga0207705_10002106
970 Ga0207671_10000987
971 Ga0207649_10000278
972 Ga0207690_10009239
973 Ga0207689_10000497
974 Ga0207661_10019749
975 Ga0207679_10014265
976 Ga0207640_10023895
977 Ga0207678_10170185
978 Ga0207702_10000829
979 Ga0207702_10001007
980 Ga0207648_10011836
981 Ga0207683_10023395
982 Ga0209389_1015128
983 Ga0209389_1022707
984 Ga0209389_1030264
985 Ga0209389_1034210
986 Ga0209389_1047017
987 Ga0209589_1001010
988 Ga0209589_1002819
989 Ga0209589_1005408
990 Ga0209589_1015606
991 Ga0209589_1016599
992 Ga0209489_100068
993 Ga0209489_100150
994 Ga0209489_100154
995 Ga0209489_100161
996 Ga0209489_110956
997 Ga0209700_100910
998 Ga0209700_101042
999 Ga0209700_101974
1000 Ga0209700_103288
1001 Ga0209700_103477
1002 Ga0209282_1000930
1003 Ga0209282_1004483
1004 Ga0209282_1019781
1005 Ga0265337_1015646
1006 Ga0265319_1000008
1007 Ga0265319_1000163
1008 Ga0265319_1000880
1009 Ga0265319_1004923
1010 Ga0265319_1006129
1011 Ga0265319_1010933
1012 Ga0265319_1015852
1013 Ga0265319_1020959
1014 Ga0265334_10001450
1015 Ga0265334_10004868
1016 Ga0265318_10000005
1017 Ga0265318_10001015
1018 Ga0265318_10001020
1019 Ga0265318_10004179
1020 Ga0265323_10002261
1021 Ga0265323_10003979
1022 Ga0265323_10033143
1023 Ga0265322_10002463
1024 Ga0265336_10001541
1025 Ga0307517_10004041
1026 Ga0307517_10022127
1027 Ga0307517_10052253
1028 Ga0307517_10084867
1029 Ga0307515_10012453
1030 Ga0307515_10016304
1031 Ga0307515_10023705
1032 Ga0307515_10062290
1033 Ga0265338_10000299
1034 Ga0265338_10002938
1035 Ga0265338_10167351
1036 Ga0311000_116166
1037 Ga0311008_120313
1038 Ga0311001_1049994
1039 Ga0311011_129510
1040 Ga0311003_114429
1041 Ga0311003_139614
1042 Ga0310982_120901
1043 Ga0310981_1044871
1044 Ga0310981_1074111
1045 Ga0265324_10005523
1046 Ga0307511_10005543
1047 Ga0307511_10029695
1048 Ga0307511_10048187
1049 Ga0307511_10102631
1050 Ga0307512_10019886
1051 Ga0307512_10055420
1052 Ga0307512_10089619
1053 Ga0265320_10000351
1054 Ga0265320_10000634
1055 Ga0265320_10000992
1056 Ga0265320_10004190
1057 Ga0265320_10004942
1058 Ga0265320_10005990
1059 Ga0265320_10006558
1060 Ga0265320_10023395
1061 Ga0265320_10031681
1062 Ga0265340_10010136
1063 Ga0265340_10042758
1064 Ga0265331_10001596
1065 Ga0265331_10010589
1066 Ga0265327_10002240
1067 Ga0265327_10005669
1068 Ga0265327_10007630
1069 Ga0265327_10071407
1070 Ga0265316_10029259
1071 Ga0265316_10041391
1072 Ga0265316_10074227
1073 Ga0307513_10015765
1074 Ga0307509_10107252
1075 Ga0307509_10165770
1076 Ga0307408_100000007
1077 Ga0310116_103785
1078 Ga0310117_101725
1079 Ga0310117_102007
1080 Ga0265313_10001729
1081 Ga0265313_10004398
1082 Ga0265313_10017444
1083 Ga0265313_10031907
1084 Ga0310103_102678
1085 Ga0310103_103137
1086 Ga0310107_102443
1087 Ga0310107_103329
1088 Ga0310107_106584
1089 Ga0307508_10000200
1090 Ga0307508_10000340
1091 Ga0307508_10022289
1092 Ga0307508_10038364
1093 Ga0310108_101700
1094 Ga0310106_100604
1095 Ga0310106_100874
1096 Ga0310115_102339
1097 Ga0310115_102928
1098 Ga0310113_101712
1099 Ga0310113_102273
1100 Ga0307514_10006951
1101 Ga0307514_10036253
1102 Ga0307514_10068701
1103 Ga0310118_101303
1104 Ga0310105_102390
1105 Ga0310105_102435
1106 Ga0310111_102295
1107 Ga0310111_103458
1108 Ga0310114_101282
1109 Ga0310119_103072
1110 Ga0310101_102158
1111 Ga0310101_103028
1112 Ga0265314_10000619
1113 Ga0265314_10006437
1114 Ga0265314_10024034
1115 Ga0265314_10038328
1116 Ga0265342_10017325
1117 Ga0265342_10040673
1118 Ga0265342_10076487
1119 Ga0307516_10000347
1120 Ga0307516_10167491
1121 Ga0307405_10000005
1122 Ga0316044_102586
1123 Ga0316044_102865
1124 Ga0316045_102865
1125 Ga0316042_103208
1126 Ga0316043_103270
1127 Ga0316043_107330
1128 Ga0307518_10024537
1129 Ga0307518_10037225
1130 Ga0307518_10040938
1131 Ga0307410_10000001
1132 Ga0307407_10023230
1133 Ga0315914_1002089
1134 Ga0315914_1006743
1135 Ga0315914_1011060
1136 Ga0307409_100000033
1137 Ga0307416_100000111
1138 Ga0316593_10023633
1139 Ga0307507_10010486
1140 Ga0307507_10030137
1141 Ga0307507_10053167
1142 Ga0307510_10025325
1143 Ga0307510_10078013
1144 Ga0307510_10103156
1145 Ga0315913_1000768
1146 Ga0315913_1006457
1147 Ga0315913_1023161
1148 Ga0315915_1010060
1149 Ga0315915_1019462
1150 Ga0315915_1019540
1151 Ga0316587_1006434
1152 Ga0316596_1018112
1153 Ga0310104_00931
1154 Ga0310104_01038
1155 Ga0310112_002815
1156 Ga0310112_005197
1157 Ga0310112_006178
1158 Ga0372808_002132
1159 Ga0372808_002365
1160 Ga0310109_002600
1161 Ga0310109_003595
1162 Ga0310109_003889
1163 Ga0310109_004615
1164 Ga0310110_002539
1165 Ga0310110_003442
1166 Ga0310110_005089
1167 Ga0395899_0000020
1168 Ga0395898_0000005
1169 Ga0395905_0000018
1170 Ga0451794_09172
1171 Ga0451796_00324
1172 Ga0451799_01234
1173 Ga0451805_044110
1174 Ga0451806_577397
1175 Ga0451833_0685941
1176 Ga0451833_0851624
1177 Ga0451833_1176887
1178 Ga0451835_0017006
1179 Ga0451835_0174742
1180 Ga0451835_1194046
1181 Ga0451838_08859
1182 Ga0451839_1466467
1183 Ga0451839_1650310
1184 Ga0451840_10723
1185 Ga0451841_0533417
1186 Ga0451841_0611370
1187 Ga0451842_7844
1188 Ga0451844_00544
1189 Ga0451844_24279
1190 Ga0451845_0749138
1191 Ga0451846_45774
1192 Ga0451847_0242737
1193 Ga0451849_1412885
1194 Ga0451850_39160
1195 Ga0451851_0392815
1196 Ga0451851_0558824
1197 Ga0451843_1217268
1198 Ga0451843_1281996
1199 Ga0451854_02552
1200 Ga0451855_1762203
1201 Ga0451853_1650285
1202 Ga0451577_0000024
1203 Ga0451577_0001876
1204 Ga0451577_0106498
1205 Ga0451577_0145846
1206 Ga0466988_0007673
1207 Ga0466988_0009755
1208 Ga0466988_0016463
1209 Ga0466988_0110322
1210 Ga0466984_0009030
1211 Ga0466984_0010203
1212 Ga0466984_0018079
1213 Ga0466986_0000343
1214 Ga0466986_0005089
1215 Ga0466986_0015412
1216 Ga0466986_0045011
1217 Ga0466985_0003547
1218 Ga0466985_0006728
1219 Ga0466985_0008710
1220 Ga0466985_0108416
1221 Ga0466973_0002148
1222 Ga0466973_0011898
1223 Ga0466973_0045953
1224 Ga0466973_0050625
1225 Ga0466973_0109405
1226 Ga0466973_0157842
1227 Ga0466974_0007742
1228 Ga0466974_0031305
1229 Ga0466974_0034096
1230 Ga0466975_0006100
1231 Ga0466975_0006410
1232 Ga0466975_0008154
1233 Ga0466975_0017914
1234 Ga0466975_0041346
1235 Ga0466976_0009870
1236 Ga0466976_0013705
1237 Ga0466976_0049094
1238 Ga0466989_0002824
1239 Ga0466989_0003765
1240 Ga0466989_0011827
1241 Ga0466989_0024911
1242 Ga0466987_0007724
1243 Ga0466987_0011688
1244 Ga0466977_0009723
1245 Ga0466977_0032453
1246 Ga0466977_0038759
1247 Ga0466977_0042435
1248 Ga0466977_0066336
1249 Ga0466980_0004923
1250 Ga0466980_0024063
1251 Ga0466980_0067966
1252 Ga0466981_0005328
1253 Ga0466981_0020088
1254 Ga0466981_0051217
1255 Ga0466978_0004882
1256 Ga0466978_0006631
1257 Ga0466978_0012245
1258 Ga0466978_0014155
1259 Ga0466982_0008497
1260 Ga0466982_0011537
1261 Ga0466982_0022789
1262 Ga0466982_0024737
1263 Ga0453683_0000926
1264 Ga0453683_0099046
1265 Ga0453684_0000118
1266 Ga0453684_0005807
1267 Ga0453684_0009256
1268 Ga0453684_0012921
1269 Ga0453684_0041966
1270 Ga0453684_0089618
1271 Ga0453684_0116215
1272 Ga0453684_0165067
1273 Ga0466971_0000142
1274 Ga0466957_0015434
1275 Ga0451576_0000716
1276 Ga0451576_0001447
1277 Ga0451576_0001510
1278 Ga0451576_0002345
1279 Ga0451576_0002668
1280 Ga0451576_0004997
1281 Ga0451576_0005120
1282 Ga0451576_0271693
1283 Ga0466967_0020759
1284 Ga0495585_0068370
1285 Ga0495616_0002285
1286 Ga0495643_0008614
1287 Ga0495597_0050960
1288 Ga0466979_0003968
1289 Ga0466979_0005837
1290 Ga0466979_0008126
1291 Ga0466979_0049779
1292 Ga0496104_0034887
1293 Ga0496108_0008138
1294 Ga0496109_0005422
1295 Ga0496110_0005459
1296 Ga0496112_0002847
1297 Ga0496116_0060725
1298 Ga0466983_0006096
1299 Ga0466983_0018830
1300 Ga0466983_0073664
1301 Ga0466983_0108993
1302 Ga0501306_001361
1303 Ga0501306_002193
1304 Ga0501309_001559
1305 Ga0501309_002736
1306 Ga0501310_001691
1307 Ga0501305_002650
1308 Ga0501311_001670
1309 Ga0501312_001732
1310 Ga0501313_001472
1311 Ga0501313_002183
1312 Ga0501315_001458
1313 Ga0501316_001403
1314 Ga0501323_001855
1315 Ga0501324_000698
1316 Ga0501031_0063465
1317 Ga0501032_0000712
1318 Ga0501032_0000825
1319 Ga0501032_0032295
1320 Ga0501032_0114742
1321 Ga0501033_0000058
1322 Ga0501033_0000235
1323 Ga0501033_0000312
1324 Ga0501034_0020865
1325 Ga0501034_0060793
1326 Ga0501036_0029548
1327 Ga0501036_0038073
1328 Ga0501036_0287196
1329 Ga0501037_0000175
1330 Ga0501038_0000797
1331 Ga0501038_0001597
1332 Ga0501038_0021447
1333 Ga0501039_0083003
1334 Ga0501042_0057914
1335 Ga0501043_0000196
1336 Ga0501043_0000786
1337 Ga0501046_0001572
1338 Ga0501046_0048351
1339 Ga0501047_0052546
1340 Ga0501047_0148733
1341 Ga0501067_0031951
1342 Ga0501070_0003465
1343 Ga0501243_000609
1344 Ga0501083_0038599
1345 Ga0501035_0000001
1346 Ga0501035_0000239
1347 Ga0501044_0000866
1348 Ga0501044_0001125
1349 Ga0501044_0005881
1350 Ga0501044_0113033
1351 Ga0500610_0042685
1352 Ga0500578_0000219
1353 Ga0500578_0001325
1354 Ga0500578_0032281
1355 Ga0500644_0013794
1356 Ga0500581_016021
1357 Ga0500581_019126
1358 Ga0500581_034892
1359 Ga0500647_0005773
1360 Ga0500647_0064354
1361 Ga0500651_0007187
1362 Ga0500651_0008646
1363 Ga0500651_0024590
1364 Ga0500651_0025491
1365 Ga0500651_0032280
1366 Ga0500566_0013312
1367 Ga0500566_0028326
1368 Ga0500566_0044772
1369 Ga0500566_0054581
1370 Ga0500640_015120
1371 Ga0500640_017392
1372 Ga0500648_015599
1373 Ga0500648_031062
1374 Ga0500648_067009
1375 Ga0500650_0041540
1376 Ga0500654_001295
1377 Ga0500654_004403
1378 Ga0500654_020559
1379 Ga0500654_031568
1380 Ga0500660_010964
1381 Ga0500660_017812
1382 Ga0500660_019045
1383 Ga0500660_023954
1384 Ga0500553_004659
1385 Ga0500553_022057
1386 Ga0500553_040376
1387 Ga0500553_066900
1388 Ga0500556_0008439
1389 Ga0500556_0042283
1390 Ga0500557_008588
1391 Ga0500558_015446
1392 Ga0500558_035651
1393 Ga0500571_000196
1394 Ga0500571_000799
1395 Ga0500571_010917
1396 Ga0500572_011218
1397 Ga0500575_000476
1398 Ga0500575_015348
1399 Ga0500575_015828
1400 Ga0500580_024782
1401 Ga0500580_026843
1402 Ga0500580_036617
1403 Ga0500582_001329
1404 Ga0500591_007990
1405 Ga0500591_010695
1406 Ga0500591_032690
1407 Ga0500591_036136
1408 Ga0500593_012648
1409 Ga0500593_021760
1410 Ga0500607_008938
1411 Ga0500607_025759
1412 Ga0500608_014622
1413 Ga0500617_006739
1414 Ga0500621_011987
1415 Ga0500621_029726
1416 Ga0500623_015690
1417 Ga0500623_016353
1418 Ga0500623_021810
1419 Ga0500623_038800
1420 Ga0500626_010715
1421 Ga0500626_023312
1422 Ga0500626_025438
1423 Ga0500659_0025161
1424 Ga0500573_0011829
1425 Ga0500573_0023091
1426 Ga0500573_0024878
1427 Ga0500573_0025348
1428 Ga0500577_0041806
1429 Ga0500579_000151
1430 Ga0500579_000173
1431 Ga0500579_005016
1432 Ga0500585_002253
1433 Ga0500585_007526
1434 Ga0500586_009913
1435 Ga0500588_0007478
1436 Ga0500590_013083
1437 Ga0500590_019674
1438 Ga0500590_022908
1439 Ga0500590_045834
1440 Ga0500600_0012393
1441 Ga0500606_005322
1442 Ga0500606_011574
1443 Ga0500606_017261
1444 Ga0500620_011261
1445 Ga0500620_024340
1446 Ga0500622_0004374
1447 Ga0500622_0016381
1448 Ga0500622_0018256
1449 Ga0500622_0025376
1450 Ga0500630_007343
1451 Ga0500630_009505
1452 Ga0500630_026138
1453 Ga0500630_033542
1454 Ga0500634_0030474
1455 Ga0500634_0036218
1456 Ga0500638_004065
1457 Ga0500638_009431
1458 Ga0500639_001510
1459 Ga0500639_012391
1460 Ga0500639_035843
1461 Ga0500639_058336
1462 Ga0500636_0042536
1463 Ga0500636_0051626
1464 Ga0500637_0008195
1465 Ga0500637_0016610
1466 Ga0500637_0020158
1467 Ga0500649_012708
1468 Ga0500567_023528
1469 Ga0500567_025515
1470 Ga0500570_008592
1471 Ga0500570_050065
1472 Ga0500576_000112
1473 Ga0500576_003833
1474 Ga0500576_003842
1475 Ga0500584_007187
1476 Ga0500584_011799
1477 Ga0500584_031081
1478 Ga0500625_016356
1479 Ga0500625_019223
1480 Ga0500625_054025
1481 Ga0500625_055409
1482 Ga0587070_003157
1483 Ga0587080_001067
1484 Ga0587080_002950
1485 Ga0587082_002955
1486 Ga0587082_003177
1487 Ga0587083_0003487
1488 Ga0587088_001999
1489 Ga0587089_001323
1490 Ga0587090_001912
1491 Ga0587091_002788
1492 Ga0587094_001367
1493 Ga0587074_00060
1494 Ga0587098_000806
1495 Ga0587106_001334
1496 Ga0587109_003719
1497 Ga0587113_000664
1498 Ga0587128_001202
1499 Ga0587062_001777
1500 Ga0587067_002124
1501 Ga0587068_002512
1502 Ga0587068_004242
1503 Ga0587069_001549
1504 Ga0587072_001241
1505 Ga0587072_002741
1506 Ga0587075_000635
1507 Ga0587076_001901
1508 Ga0587078_001475
1509 Ga0587102_000726
1510 Ga0587104_000300
1511 Ga0587107_001425
1512 Ga0587108_000383
1513 Ga0587118_00531
1514 Ga0587120_000514
1515 Ga0587060_000615
1516 Ga0587071_001243
1517 Ga0587071_003824
1518 Ga0587111_0003259
1519 Ga0587111_0004089
1520 Ga0466962_0000021
1521 2688393244
1522 2738733032
1523 2738765570
1524 2739214613
1525 2787506798
1526 2788436468
1527 2919512231
1528 2958514895
1529 8056443483

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00984

UDPG_MGDP_dh

UDP-glucose/GDP-mannose dehydrogenase family, central domain

238

333

0.98

PF03720

UDPG_MGDP_dh_C

UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain

356

480

0.98

PF03721

UDPG_MGDP_dh_N

UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain

30

219

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6om8-assembly2.cif.gz_G caenorhabditis elegans udp-glucose dehydrogenase in complex with udp-xylose 0.9807 2 452
5vr8-assembly1.cif.gz_C human udp-glucose dehydrogenase with udp-xylose bound to the co-enzyme site 0.9794 2 451
3tdk-assembly2.cif.gz_K crystal structure of human udp-glucose dehydrogenase 0.9774 2 453
3itk-assembly1.cif.gz_F crystal structure of human udp-glucose dehydrogenase thr131ala, apo form. 0.9772 2 453
6c58-assembly1.cif.gz_A human udp-glucose dehydrogenase a225l substitutuion with udp-xylose bound 0.9771 2 451
ID Description Score Start End Superfamily
af_I1J5Y9_241_478_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.986 240 454 3.40.50.720
3itkA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.976 2 207 3.40.50.720
4edfA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.963 2 207 3.40.50.720
af_A0A0R0GLX2_122_330_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9612 254 455 3.40.50.720
af_O07248_235_441_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9525 240 454 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3P5YKV5-F1-model_v4 UDP-glucose/GDP-mannose dehydrogenase N-terminal domain-containing protein 1.004 1 71 GO:0003979
GO:0051287
AF-A0A7S3SY84-F1-model_v4 UDP-glucose/GDP-mannose dehydrogenase N-terminal domain-containing protein 1.001 2 106 GO:0003979
GO:0005634
GO:0006024
GO:0051287
AF-A0A196SAE6-F1-model_v4 UDP-glucose 6-dehydrogenase 2 1.001 2 125 GO:0003979
GO:0005634
GO:0006024
GO:0051287
AF-A0A5K0V305-F1-model_v4 UDP-glucose/GDP-mannose dehydrogenase dimerisation domain-containing protein 1 219 309 GO:0003979
GO:0005634
GO:0006024
GO:0051287
AF-A0A392QBD0-F1-model_v4 UDP-glucose 6-dehydrogenase 1-like 0.9993 1 117 GO:0003979
GO:0005634
GO:0006024
GO:0051287

Map