F477456

General Info

Members Datasets Scaffolds Average Seq Length
722 389 1444 78

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_727981_c1|nmdc:mga09592_727981_c1_166_450
Length 94
Sequence MADETEATDTMAMTADEIERLIREAMPDAEVEIRDLAGDGDHYAARIVSAAFRGKNRVQQHQLVYQALKGRMGGELHALALTTAPPPDERKETP

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
107 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
113 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
114 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
118 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
181 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
186 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
189 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
202 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
208 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
216 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
222 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
225 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
226 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
227 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
228 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
229 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
230 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
231 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
232 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
233 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
234 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
235 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
236 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
237 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
238 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
241 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
242 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
243 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
244 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
245 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
253 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
254 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
255 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
258 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
259 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
260 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
265 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
270 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
273 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
274 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
275 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
280 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
283 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
284 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
287 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
288 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
304 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
317 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
318 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
319 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
320 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
321 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
322 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
323 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
324 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
328 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
329 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
330 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
331 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
332 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
333 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
336 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
337 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
340 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
341 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
342 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
343 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
344 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
345 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
346 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
347 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
348 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
349 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
350 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
351 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
352 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
353 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
354 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
355 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
356 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
357 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
358 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
359 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
360 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
361 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
362 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
363 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
364 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
365 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
366 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
367 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
368 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
369 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
370 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
388 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
389 2842775625 Roseomonas sp. R-71825 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.97
Metatranscriptomes 7.89
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.79
Nodule 0
Rhizoplane 4.29
Rhizosphere 84.9
Stem 0
Stem Tuber 0
Unclassified 0.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_727981_c1 3300050508 Bacteria 843
2 Ga0006777J48905_1049257 3300003308 Bacteria 736
3 Ga0007416J51690_1055074 3300003577 Bacteria 660
4 Ga0058859_11724400 3300004798 Bacteria 521
5 Ga0058859_11781655 3300004798 Bacteria 797
6 Ga0058861_11934103 3300004800 Bacteria 948
7 Ga0058860_10019268 3300004801 Bacteria 647
8 Ga0058860_11761699 3300004801 Bacteria 1204
9 Ga0058860_12225969 3300004801 Bacteria 524
10 Ga0065165_1000041 3300005262 Bacteria 203876
11 Ga0065712_10208099 3300005290 Bacteria 1083
12 Ga0065707_11044598 3300005295 Bacteria 528
13 Ga0070658_10576360 3300005327 Bacteria 974
14 Ga0070676_11311884 3300005328 Bacteria 553
15 Ga0070683_101393161 3300005329 Bacteria 674
16 Ga0070670_100181781 3300005331 Bacteria 1826
17 Ga0070670_101733491 3300005331 Bacteria 575
18 Ga0070677_10139266 3300005333 Bacteria 1117
19 Ga0068869_100426677 3300005334 Bacteria 1095
20 Ga0068869_102071053 3300005334 Bacteria 511
21 Ga0070666_10022439 3300005335 Bacteria 4098
22 Ga0070660_100108817 3300005339 Bacteria 2203
23 Ga0070660_101084759 3300005339 Bacteria 677
24 Ga0070660_101810954 3300005339 Bacteria 520
25 Ga0070689_101925450 3300005340 Bacteria 540
26 Ga0070691_10193715 3300005341 Bacteria 1065
27 Ga0070661_100941188 3300005344 Bacteria 715
28 Ga0070661_101037964 3300005344 Unclassified 681
29 Ga0070668_100002639 3300005347 Bacteria 13171
30 Ga0070668_100005564 3300005347 Bacteria 9352
31 Ga0070668_100006876 3300005347 Bacteria 8431
32 Ga0070668_100643638 3300005347 Bacteria 931
33 Ga0070668_100646207 3300005347 Bacteria 929
34 Ga0070668_100815314 3300005347 Bacteria 830
35 Ga0070669_100089337 3300005353 Bacteria 2307
36 Ga0070669_100428462 3300005353 Bacteria 1087
37 Ga0070669_100542296 3300005353 Bacteria 969
38 Ga0070669_100749405 3300005353 Bacteria 827
39 Ga0070669_101704968 3300005353 Bacteria 549
40 Ga0070671_100048681 3300005355 Bacteria 3526
41 Ga0070674_101066461 3300005356 Bacteria 712
42 Ga0070674_101867429 3300005356 Bacteria 545
43 Ga0070659_100170272 3300005366 Bacteria 1783
44 Ga0070659_100475720 3300005366 Bacteria 1062
45 Ga0070667_100000260 3300005367 Bacteria 60154
46 Ga0070667_100083339 3300005367 Bacteria 2739
47 Ga0070667_100094806 3300005367 Bacteria 2572
48 Ga0070667_100183843 3300005367 Bacteria 1849
49 Ga0070667_101950033 3300005367 Bacteria 553
50 Ga0070714_100144107 3300005435 Bacteria 2141
51 Ga0070714_100161300 3300005435 Bacteria 2029
52 Ga0070713_100073029 3300005436 Bacteria 2903
53 Ga0070713_100509266 3300005436 Bacteria 1136
54 Ga0070713_100593112 3300005436 Bacteria 1052
55 Ga0070713_102284855 3300005436 Bacteria 523
56 Ga0070710_11349449 3300005437 Bacteria 532
57 Ga0070711_100867528 3300005439 Bacteria 769
58 Ga0070708_100297413 3300005445 Bacteria 1520
59 Ga0070663_101017979 3300005455 Bacteria 721
60 Ga0070663_102087033 3300005455 Bacteria 511
61 Ga0070678_100864134 3300005456 Bacteria 825
62 Ga0070678_101096788 3300005456 Bacteria 735
63 Ga0070662_100358809 3300005457 Bacteria 1195
64 Ga0070681_10038260 3300005458 Bacteria 4810
65 Ga0070681_10480803 3300005458 Bacteria 1155
66 Ga0070681_11834400 3300005458 Bacteria 533
67 Ga0070707_100684781 3300005468 Bacteria 988
68 Ga0070698_100246957 3300005471 Bacteria 1717
69 Ga0070698_100606880 3300005471 Bacteria 1035
70 Ga0070679_100355559 3300005530 Bacteria 1412
71 Ga0070679_101069785 3300005530 Bacteria 751
72 Ga0068853_100545562 3300005539 Bacteria 1098
73 Ga0068853_101839626 3300005539 Bacteria 587
74 Ga0070672_100008924 3300005543 Bacteria 6889
75 Ga0070686_100425094 3300005544 Bacteria 1016
76 Ga0070686_101229425 3300005544 Bacteria 623
77 Ga0070665_100002230 3300005548 Bacteria 21591
78 Ga0070665_100010548 3300005548 Bacteria 9352
79 Ga0070665_100052336 3300005548 Bacteria 4096
80 Ga0070665_100773999 3300005548 Bacteria 973
81 Ga0070665_100964940 3300005548 Bacteria 865
82 Ga0068855_100018740 3300005563 Bacteria 8322
83 Ga0068855_100222369 3300005563 Bacteria 2116
84 Ga0068855_100478039 3300005563 Bacteria 1357
85 Ga0068855_100512844 3300005563 Bacteria 1302
86 Ga0070664_100931883 3300005564 Bacteria 815
87 Ga0068857_101425032 3300005577 Bacteria 674
88 Ga0068854_100361285 3300005578 Bacteria 1191
89 Ga0068854_100424601 3300005578 Bacteria 1105
90 Ga0068854_100986165 3300005578 Bacteria 745
91 Ga0068856_100520499 3300005614 Bacteria 1211
92 Ga0068856_100688130 3300005614 Bacteria 1043
93 Ga0068856_101567667 3300005614 Bacteria 672
94 Ga0068856_101712209 3300005614 Bacteria 641
95 Ga0068856_101808283 3300005614 Bacteria 623
96 Ga0068859_100000437 3300005617 Bacteria 41851
97 Ga0068859_101146183 3300005617 Bacteria 856
98 Ga0068859_101663882 3300005617 Bacteria 705
99 Ga0068864_100000496 3300005618 Bacteria 33880
100 Ga0068861_101760256 3300005719 Bacteria 614
101 Ga0068861_101924375 3300005719 Bacteria 589
102 Ga0068851_10677727 3300005834 Bacteria 633
103 Ga0068863_100001649 3300005841 Bacteria 22078
104 Ga0068863_100006085 3300005841 Bacteria 11837
105 Ga0068863_100824281 3300005841 Bacteria 926
106 Ga0068858_100036068 3300005842 Bacteria 4585
107 Ga0068858_100244459 3300005842 Bacteria 1703
108 Ga0068860_100000309 3300005843 Bacteria 67252
109 Ga0068860_100015356 3300005843 Bacteria 7481
110 Ga0068860_100087799 3300005843 Bacteria 2960
111 Ga0068860_100090219 3300005843 Bacteria 2919
112 Ga0068860_100497468 3300005843 Bacteria 1217
113 Ga0068862_100001520 3300005844 Bacteria 21267
114 Ga0068862_100014608 3300005844 Bacteria 6520
115 Ga0081455_10021562 3300005937 Bacteria 6039
116 Ga0081455_10439226 3300005937 Bacteria 895
117 Ga0081455_10641568 3300005937 Bacteria 685
118 Ga0070717_10577906 3300006028 Bacteria 1019
119 Ga0075363_100199180 3300006048 Bacteria 1144
120 Ga0075363_100451132 3300006048 Bacteria 760
121 Ga0075363_100702604 3300006048 Bacteria 611
122 Ga0070712_101388305 3300006175 Bacteria 613
123 Ga0070712_101594085 3300006175 Bacteria 571
124 Ga0075362_10101625 3300006177 Bacteria 1345
125 Ga0075367_10788724 3300006178 Bacteria 605
126 Ga0075369_10317886 3300006186 Bacteria 728
127 Ga0097621_100157532 3300006237 Bacteria 1950
128 Ga0097621_100424470 3300006237 Bacteria 1194
129 Ga0097621_101308137 3300006237 Bacteria 685
130 Ga0075370_10702465 3300006353 Bacteria 615
131 Ga0068871_100606746 3300006358 Bacteria 996
132 Ga0068871_102139682 3300006358 Bacteria 533
133 Ga0075428_100865889 3300006844 Bacteria 959
134 Ga0075430_100124507 3300006846 Bacteria 2149
135 Ga0075430_100141437 3300006846 Bacteria 2004
136 Ga0075431_100025055 3300006847 Bacteria 6117
137 Ga0075431_100123218 3300006847 Bacteria 2674
138 Ga0075431_100397343 3300006847 Bacteria 1380
139 Ga0075429_100210880 3300006880 Bacteria 1702
140 Ga0075429_100240784 3300006880 Bacteria 1585
141 Ga0068865_101444637 3300006881 Bacteria 615
142 Ga0075436_100592863 3300006914 Bacteria 816
143 Ga0097620_100000437 3300006931 Bacteria 41851
144 Ga0097620_101146074 3300006931 Bacteria 856
145 Ga0097620_101663785 3300006931 Bacteria 705
146 Ga0105240_10532862 3300009093 Unclassified 1302
147 Ga0105240_11311418 3300009093 Bacteria 763
148 Ga0111539_10983998 3300009094 Bacteria 981
149 Ga0105245_11792885 3300009098 Bacteria 666
150 Ga0105247_10152763 3300009101 Bacteria 1522
151 Ga0105247_10341852 3300009101 Bacteria 1050
152 Ga0105247_10588135 3300009101 Bacteria 824
153 Ga0114129_10155368 3300009147 Bacteria 3129
154 Ga0114129_10231445 3300009147 Bacteria 2489
155 Ga0114129_10510871 3300009147 Bacteria 1568
156 Ga0114129_10599927 3300009147 Bacteria 1427
157 Ga0105243_10239973 3300009148 Bacteria 1612
158 Ga0105243_10277210 3300009148 Bacteria 1508
159 Ga0105243_12046007 3300009148 Bacteria 608
160 Ga0105241_10414947 3300009174 Bacteria 1183
161 Ga0105241_12005393 3300009174 Bacteria 570
162 Ga0105242_10135194 3300009176 Bacteria 2133
163 Ga0105248_10008553 3300009177 Bacteria 11237
164 Ga0105248_10055327 3300009177 Bacteria 4450
165 Ga0105248_10072017 3300009177 Bacteria 3884
166 Ga0105248_10149988 3300009177 Bacteria 2630
167 Ga0105237_11083966 3300009545 Bacteria 808
168 Ga0105237_11621597 3300009545 Bacteria 654
169 Ga0105238_10011521 3300009551 Bacteria 8908
170 Ga0105238_10182063 3300009551 Bacteria 2078
171 Ga0105238_10645806 3300009551 Bacteria 1068
172 Ga0105238_11237135 3300009551 Bacteria 772
173 Ga0105249_10005538 3300009553 Bacteria 10915
174 Ga0105249_10062995 3300009553 Bacteria 3405
175 Ga0105249_11356275 3300009553 Bacteria 783
176 Ga0105249_11391011 3300009553 Bacteria 774
177 Ga0105249_12080875 3300009553 Bacteria 640
178 Ga0105239_10313679 3300010375 Bacteria 1768
179 Ga0105239_12627588 3300010375 Bacteria 587
180 Ga0105246_12540235 3300011119 Bacteria 505
181 Ga0154012_157729 3300013059 Bacteria 623
182 Ga0157373_11067446 3300013100 Bacteria 605
183 Ga0157371_10022339 3300013102 Bacteria 4638
184 Ga0157371_10374150 3300013102 Bacteria 1039
185 Ga0157370_10711405 3300013104 Bacteria 916
186 Ga0157370_11497596 3300013104 Bacteria 607
187 Ga0157369_10474459 3300013105 Bacteria 1295
188 Ga0157378_12748851 3300013297 Unclassified 545
189 Ga0163162_10375749 3300013306 Bacteria 1554
190 Ga0163162_10413433 3300013306 Bacteria 1481
191 Ga0163162_10583209 3300013306 Bacteria 1245
192 Ga0163162_10647398 3300013306 Bacteria 1181
193 Ga0163162_10684794 3300013306 Bacteria 1148
194 Ga0163162_11200210 3300013306 Bacteria 861
195 Ga0157372_10026131 3300013307 Bacteria 6352
196 Ga0157375_10049365 3300013308 Bacteria 4123
197 Ga0163163_10263715 3300014325 Bacteria 1774
198 Ga0163163_11341499 3300014325 Bacteria 777
199 Ga0157380_12024557 3300014326 Bacteria 638
200 Ga0157380_12507658 3300014326 Bacteria 581
201 Ga0182008_10027287 3300014497 Bacteria 2894
202 Ga0157379_10000373 3300014968 Bacteria 36116
203 Ga0157379_10030580 3300014968 Bacteria 4794
204 Ga0157379_10533785 3300014968 Bacteria 1090
205 Ga0157376_10439324 3300014969 Bacteria 1270
206 Ga0157376_10786353 3300014969 Bacteria 963
207 Ga0182005_1294579 3300015265 Bacteria 511
208 Ga0163161_10004551 3300017792 Bacteria 9655
209 Ga0163161_11504809 3300017792 Bacteria 591
210 Ga0184603_104055 3300019192 Bacteria 546
211 Ga0206356_10110059 3300020070 Bacteria 774
212 Ga0206356_11523172 3300020070 Bacteria 737
213 Ga0206349_1171119 3300020075 Bacteria 725
214 Ga0206349_1842965 3300020075 Bacteria 920
215 Ga0206355_1120641 3300020076 Bacteria 957
216 Ga0206351_10028857 3300020077 Bacteria 648
217 Ga0206351_10419817 3300020077 Bacteria 1042
218 Ga0206351_10594541 3300020077 Bacteria 702
219 Ga0206352_10271920 3300020078 Bacteria 884
220 Ga0206350_10794378 3300020080 Bacteria 523
221 Ga0206350_10886961 3300020080 Bacteria 664
222 Ga0206350_11291946 3300020080 Bacteria 533
223 Ga0206354_10990331 3300020081 Bacteria 748
224 Ga0206354_11091809 3300020081 Bacteria 568
225 Ga0206354_11177659 3300020081 Bacteria 521
226 Ga0206354_11657213 3300020081 Bacteria 1108
227 Ga0154015_1288437 3300020610 Bacteria 713
228 Ga0213873_10093033 3300021358 Bacteria 858
229 Ga0213872_10005246 3300021361 Bacteria 6702
230 Ga0213872_10039553 3300021361 Bacteria 2152
231 Ga0213872_10050376 3300021361 Bacteria 1890
232 Ga0213872_10055110 3300021361 Bacteria 1802
233 Ga0213872_10075083 3300021361 Bacteria 1521
234 Ga0213872_10196472 3300021361 Bacteria 866
235 Ga0213872_10223638 3300021361 Bacteria 800
236 Ga0213874_10072783 3300021377 Bacteria 1099
237 Ga0213876_10008380 3300021384 Bacteria 5594
238 Ga0213876_10063803 3300021384 Bacteria 1945
239 Ga0213876_10073266 3300021384 Bacteria 1808
240 Ga0213876_10283997 3300021384 Bacteria 880
241 Ga0213875_10019110 3300021388 Bacteria 3297
242 Ga0213875_10042500 3300021388 Bacteria 2135
243 Ga0213871_10087846 3300021441 Bacteria 898
244 Ga0224712_10096343 3300022467 Bacteria 1247
245 Ga0224712_10122206 3300022467 Bacteria 1129
246 Ga0224712_10240126 3300022467 Bacteria 834
247 Ga0224712_10262623 3300022467 Bacteria 800
248 Ga0224712_10290850 3300022467 Bacteria 762
249 Ga0209233_1024869 3300025261 Bacteria 1491
250 Ga0209455_1039385 3300025272 Bacteria 730
251 Ga0207697_10271626 3300025315 Bacteria 751
252 Ga0207697_10412278 3300025315 Bacteria 600
253 Ga0207656_10414364 3300025321 Bacteria 678
254 Ga0207692_10216144 3300025898 Bacteria 1134
255 Ga0207710_10054524 3300025900 Bacteria 1800
256 Ga0207710_10376548 3300025900 Bacteria 726
257 Ga0207680_10070471 3300025903 Bacteria 2164
258 Ga0207643_10679712 3300025908 Bacteria 665
259 Ga0207705_10179021 3300025909 Bacteria 1599
260 Ga0207705_10366391 3300025909 Bacteria 1112
261 Ga0207705_11061003 3300025909 Bacteria 625
262 Ga0207654_10237202 3300025911 Bacteria 1217
263 Ga0207707_10008836 3300025912 Bacteria 8749
264 Ga0207707_10270641 3300025912 Bacteria 1472
265 Ga0207707_11037957 3300025912 Bacteria 671
266 Ga0207695_10001687 3300025913 Bacteria 35481
267 Ga0207695_10100739 3300025913 Bacteria 2884
268 Ga0207695_11437575 3300025913 Bacteria 570
269 Ga0207693_11117890 3300025915 Bacteria 598
270 Ga0207663_10906067 3300025916 Unclassified 705
271 Ga0207660_10012939 3300025917 Bacteria 5465
272 Ga0207657_10000896 3300025919 Bacteria 31469
273 Ga0207649_11212625 3300025920 Unclassified 596
274 Ga0207652_10006121 3300025921 Bacteria 9730
275 Ga0207652_10410705 3300025921 Bacteria 1221
276 Ga0207652_10510920 3300025921 Bacteria 1081
277 Ga0207652_10947373 3300025921 Bacteria 759
278 Ga0207646_10681987 3300025922 Bacteria 919
279 Ga0207681_10002433 3300025923 Bacteria 11804
280 Ga0207681_10238626 3300025923 Bacteria 1414
281 Ga0207681_10416752 3300025923 Bacteria 1087
282 Ga0207681_10420762 3300025923 Bacteria 1082
283 Ga0207694_10364442 3300025924 Bacteria 1198
284 Ga0207694_10784939 3300025924 Bacteria 804
285 Ga0207650_10025375 3300025925 Bacteria 4222
286 Ga0207650_10381342 3300025925 Bacteria 1164
287 Ga0207650_10629708 3300025925 Bacteria 903
288 Ga0207650_10797076 3300025925 Bacteria 801
289 Ga0207659_10958651 3300025926 Bacteria 736
290 Ga0207700_10208564 3300025928 Bacteria 1651
291 Ga0207700_10336014 3300025928 Bacteria 1312
292 Ga0207700_10463815 3300025928 Bacteria 1118
293 Ga0207700_10660709 3300025928 Bacteria 932
294 Ga0207700_10923867 3300025928 Bacteria 781
295 Ga0207664_10129212 3300025929 Bacteria 2125
296 Ga0207664_10886956 3300025929 Bacteria 801
297 Ga0207644_10041159 3300025931 Bacteria 3267
298 Ga0207644_10423273 3300025931 Bacteria 1091
299 Ga0207686_10143780 3300025934 Bacteria 1652
300 Ga0207686_10291177 3300025934 Bacteria 1209
301 Ga0207686_11182461 3300025934 Bacteria 626
302 Ga0207709_10410049 3300025935 Bacteria 1038
303 Ga0207709_10539316 3300025935 Bacteria 916
304 Ga0207669_11360020 3300025937 Bacteria 604
305 Ga0207669_11370063 3300025937 Bacteria 602
306 Ga0207691_10081239 3300025940 Bacteria 2914
307 Ga0207711_10002832 3300025941 Bacteria 15237
308 Ga0207711_10039945 3300025941 Bacteria 3991
309 Ga0207711_10457277 3300025941 Bacteria 1189
310 Ga0207711_11694496 3300025941 Bacteria 575
311 Ga0207689_10417628 3300025942 Bacteria 1119
312 Ga0207689_11641796 3300025942 Bacteria 534
313 Ga0207667_10108602 3300025949 Bacteria 2862
314 Ga0207667_11027471 3300025949 Bacteria 810
315 Ga0207667_12168117 3300025949 Bacteria 513
316 Ga0207712_10000569 3300025961 Bacteria 29784
317 Ga0207712_10369031 3300025961 Bacteria 1198
318 Ga0207712_11516086 3300025961 Bacteria 601
319 Ga0207712_12107636 3300025961 Bacteria 504
320 Ga0207668_10000003 3300025972 Bacteria 206959
321 Ga0207668_10000678 3300025972 Bacteria 20916
322 Ga0207668_10043288 3300025972 Bacteria 3054
323 Ga0207668_11354218 3300025972 Bacteria 641
324 Ga0207640_10119998 3300025981 Bacteria 1882
325 Ga0207640_10302581 3300025981 Bacteria 1266
326 Ga0207640_10736274 3300025981 Bacteria 849
327 Ga0207658_10000470 3300025986 Bacteria 37577
328 Ga0207658_10005614 3300025986 Bacteria 8580
329 Ga0207658_10075281 3300025986 Bacteria 2568
330 Ga0207658_10157827 3300025986 Bacteria 1856
331 Ga0207658_10746002 3300025986 Bacteria 886
332 Ga0207677_10497176 3300026023 Bacteria 1054
333 Ga0207703_10009963 3300026035 Bacteria 7455
334 Ga0207703_10025799 3300026035 Bacteria 4625
335 Ga0207703_10413447 3300026035 Bacteria 1254
336 Ga0207639_10615785 3300026041 Bacteria 1002
337 Ga0207639_10932062 3300026041 Bacteria 812
338 Ga0207678_10661521 3300026067 Bacteria 918
339 Ga0207678_11637373 3300026067 Bacteria 566
340 Ga0207708_11325847 3300026075 Bacteria 631
341 Ga0207702_10321956 3300026078 Bacteria 1473
342 Ga0207702_11068824 3300026078 Bacteria 801
343 Ga0207702_11572471 3300026078 Bacteria 651
344 Ga0207702_11912525 3300026078 Bacteria 584
345 Ga0207641_10002338 3300026088 Bacteria 17553
346 Ga0207641_10002399 3300026088 Bacteria 17295
347 Ga0207641_11476092 3300026088 Bacteria 681
348 Ga0207676_10000285 3300026095 Bacteria 43703
349 Ga0207676_11477773 3300026095 Bacteria 676
350 Ga0207675_100413152 3300026118 Bacteria 1332
351 Ga0207675_101011573 3300026118 Bacteria 850
352 Ga0207675_101115962 3300026118 Bacteria 808
353 Ga0207675_102736287 3300026118 Bacteria 501
354 Ga0207683_10293296 3300026121 Bacteria 1487
355 Ga0209981_1000340 3300027378 Bacteria 6003
356 Ga0209984_1018307 3300027424 Bacteria 946
357 Ga0210000_1019661 3300027462 Bacteria 1029
358 Ga0209999_1017729 3300027543 Bacteria 1300
359 Ga0209983_1046093 3300027665 Bacteria 949
360 Ga0209974_10064383 3300027876 Bacteria 1244
361 Ga0268266_10001802 3300028379 Bacteria 24277
362 Ga0268266_10038272 3300028379 Bacteria 4083
363 Ga0268266_10506547 3300028379 Bacteria 1153
364 Ga0268266_10760645 3300028379 Bacteria 935
365 Ga0268265_10005576 3300028380 Bacteria 8592
366 Ga0268265_10007726 3300028380 Bacteria 7257
367 Ga0268265_10017303 3300028380 Bacteria 4971
368 Ga0268265_12584090 3300028380 Bacteria 514
369 Ga0268264_10000118 3300028381 Bacteria 193487
370 Ga0268264_10082718 3300028381 Bacteria 2748
371 Ga0268264_10916333 3300028381 Bacteria 880
372 Ga0268264_12081816 3300028381 Bacteria 576
373 Ga0307517_10162375 3300028786 Bacteria 1495
374 Ga0265338_10011636 3300028800 Bacteria 10140
375 Ga0265338_10021909 3300028800 Bacteria 6640
376 Ga0265338_10264762 3300028800 Bacteria 1262
377 Ga0265338_10306725 3300028800 Bacteria 1152
378 Ga0265760_10139697 3300031090 Bacteria 788
379 Ga0265330_10033163 3300031235 Bacteria 2311
380 Ga0265330_10180123 3300031235 Bacteria 895
381 Ga0265325_10328081 3300031241 Bacteria 679
382 Ga0265340_10024300 3300031247 Bacteria 3079
383 Ga0265340_10040812 3300031247 Bacteria 2284
384 Ga0265339_10042840 3300031249 Bacteria 2505
385 Ga0265339_10208674 3300031249 Bacteria 960
386 Ga0265327_10005115 3300031251 Bacteria 11138
387 Ga0265327_10093726 3300031251 Bacteria 1460
388 Ga0265327_10142738 3300031251 Bacteria 1118
389 Ga0265316_10354930 3300031344 Bacteria 1061
390 Ga0307408_100169423 3300031548 Bacteria 1742
391 Ga0307408_101676147 3300031548 Bacteria 605
392 Ga0307408_102095199 3300031548 Bacteria 545
393 Ga0265313_10000684 3300031595 Bacteria 34937
394 Ga0316575_10126335 3300031665 Bacteria 1048
395 Ga0265314_10029093 3300031711 Bacteria 4111
396 Ga0265342_10525352 3300031712 Bacteria 602
397 Ga0316576_10827729 3300031727 Bacteria 665
398 Ga0307405_10822757 3300031731 Bacteria 780
399 Ga0307405_11747843 3300031731 Bacteria 552
400 Ga0307405_11900426 3300031731 Bacteria 531
401 Ga0307413_10689065 3300031824 Bacteria 847
402 Ga0307410_10898960 3300031852 Bacteria 758
403 Ga0307406_10192438 3300031901 Bacteria 1494
404 Ga0307406_10955804 3300031901 Bacteria 733
405 Ga0307407_10031674 3300031903 Bacteria 2867
406 Ga0307412_10168721 3300031911 Bacteria 1634
407 Ga0307409_100117196 3300031995 Bacteria 2247
408 Ga0307409_100187513 3300031995 Bacteria 1837
409 Ga0307416_100153423 3300032002 Bacteria 2116
410 Ga0307416_100542636 3300032002 Bacteria 1235
411 Ga0307414_10050455 3300032004 Bacteria 2882
412 Ga0307414_10068988 3300032004 Bacteria 2539
413 Ga0307414_11064521 3300032004 Bacteria 746
414 Ga0307414_11086425 3300032004 Bacteria 738
415 Ga0307411_12105345 3300032005 Bacteria 528
416 Ga0307415_100039831 3300032126 Bacteria 3109
417 Ga0373930_0186756 3300034816 Bacteria 534
418 Ga0373934_0116580 3300035086 Bacteria 1085
419 Ga0373923_0581373 3300035111 Bacteria 550
420 Ga0373957_0309451 3300035120 Bacteria 671
421 Ga0373957_0443421 3300035120 Bacteria 561
422 Ga0373943_0255644 3300035170 Bacteria 985
423 Ga0373946_0447635 3300035171 Bacteria 657
424 Ga0373962_0259567 3300035242 Bacteria 605
425 Ga0373924_0089152 3300035410 Bacteria 1318
426 Ga0373935_0082762 3300035692 Bacteria 2088
427 Ga0373935_0682705 3300035692 Bacteria 755
428 Ga0373927_0271652 3300035695 Bacteria 1115
429 Ga0373933_0073199 3300035724 Bacteria 2087
430 Ga0373947_0042308 3300035725 Bacteria 2719
431 Ga0373937_0104792 3300036401 Bacteria 2627
432 Ga0373937_2160929 3300036401 Bacteria 503
433 Ga0265778_018478 3300036457 Bacteria 848
434 Ga0265778_026552 3300036457 Bacteria 735
435 Ga0316582_0226718 3300036647 Bacteria 1279
436 Ga0316584_0286670 3300036712 Bacteria 1195
437 Ga0373925_0041994 3300037068 Bacteria 3392
438 Ga0373925_0943223 3300037068 Bacteria 711
439 Ga0395899_0493530 3300037312 Bacteria 795
440 Ga0395899_0769080 3300037312 Bacteria 598
441 Ga0395900_1609426 3300037418 Bacteria 561
442 Ga0395905_0359897 3300037471 Bacteria 1348
443 Ga0436364_0073909 3300037853 Bacteria 9825
444 Ga0436364_0105856 3300037853 Bacteria 2982
445 Ga0436364_0451416 3300037853 Bacteria 1834
446 Ga0436364_0792782 3300037853 Bacteria 2683
447 Ga0436364_1084258 3300037853 Bacteria 571
448 Ga0436364_1158097 3300037853 Bacteria 3797
449 Ga0436364_1305733 3300037853 Bacteria 2993
450 Ga0395901_1149825 3300038443 Bacteria 744
451 Ga0436365_0212575 3300039437 Bacteria 3524
452 Ga0436365_0853858 3300039437 Bacteria 3570
453 Ga0436365_1677065 3300039437 Bacteria 2587
454 Ga0436365_1910301 3300039437 Bacteria 4222
455 Ga0436360_0027323 3300039438 Bacteria 558
456 Ga0436360_0036575 3300039438 Bacteria 911
457 Ga0436360_0172092 3300039438 Bacteria 2630
458 Ga0436360_0184139 3300039438 Bacteria 624
459 Ga0436360_0395146 3300039438 Bacteria 520
460 Ga0436360_0405634 3300039438 Archaea 642
461 Ga0436360_0441734 3300039438 Bacteria 933
462 Ga0436360_0551744 3300039438 Bacteria 505
463 Ga0436360_1035682 3300039438 Bacteria 2107
464 Ga0436360_1100992 3300039438 Bacteria 971
465 Ga0436360_1177339 3300039438 Bacteria 928
466 Ga0436360_1280339 3300039438 Bacteria 529
467 Ga0436360_1288774 3300039438 Bacteria 9263
468 Ga0436361_0112287 3300039447 Bacteria 22106
469 Ga0436361_0492353 3300039447 Bacteria 1815
470 Ga0436361_0581466 3300039447 Bacteria 1555
471 Ga0436361_0675692 3300039447 Bacteria 671
472 Ga0436361_0802179 3300039447 Bacteria 1628
473 Ga0436361_0936322 3300039447 Bacteria 956
474 Ga0436361_1022522 3300039447 Bacteria 1285
475 Ga0436361_1159471 3300039447 Bacteria 1229
476 Ga0436361_1167885 3300039447 Bacteria 672
477 Ga0436361_1168248 3300039447 Bacteria 2862
478 Ga0436361_1198780 3300039447 Bacteria 5266
479 Ga0436363_1690096 3300039450 Bacteria 740
480 Ga0436362_0509888 3300039453 Bacteria 4499
481 Ga0436362_1018720 3300039453 Bacteria 1230
482 Ga0439466_0143996 3300041411 Bacteria 730
483 Ga0451791_0777285 3300041451 Bacteria 534
484 Ga0451797_1498156 3300041453 Bacteria 798
485 Ga0451807_0356939 3300041486 Bacteria 587
486 Ga0451837_0748982 3300041494 Bacteria 658
487 Ga0451839_0195717 3300041496 Bacteria 600
488 Ga0439449_0154656 3300042007 Bacteria 856
489 Ga0439458_0068787 3300042157 Bacteria 892
490 Ga0439464_0211338 3300042439 Bacteria 621
491 Ga0451577_0689250 3300042876 Bacteria 926
492 Ga0466966_0062715 3300044684 Bacteria 2343
493 Ga0453684_0547143 3300044712 Bacteria 1276
494 Ga0466971_0308070 3300044719 Bacteria 761
495 Ga0466971_0679491 3300044719 Bacteria 517
496 Ga0466970_0653381 3300044765 Bacteria 612
497 Ga0466957_0012215 3300044842 Bacteria 4970
498 Ga0466957_0154861 3300044842 Bacteria 1485
499 Ga0466957_1072135 3300044842 Bacteria 580
500 Ga0466960_0176531 3300044901 Bacteria 1156
501 Ga0466960_0694115 3300044901 Bacteria 610
502 Ga0451576_1529158 3300045051 Bacteria 693
503 Ga0466958_0031268 3300045836 Bacteria 3163
504 Ga0466958_0577021 3300045836 Bacteria 731
505 Ga0466958_0934845 3300045836 Bacteria 566
506 Ga0466967_1054975 3300045976 Bacteria 809
507 Ga0466967_1369930 3300045976 Bacteria 705
508 Ga0466967_1647300 3300045976 Bacteria 639
509 Ga0495592_0194678 3300046454 Bacteria 1372
510 Ga0495590_0238800 3300046457 Bacteria 674
511 Ga0495629_0020533 3300046459 Bacteria 4717
512 Ga0495629_0669064 3300046459 Unclassified 691
513 Ga0495651_0004432 3300046462 Bacteria 10760
514 Ga0495653_0296027 3300046463 Bacteria 1057
515 Ga0495664_0293346 3300046477 Bacteria 982
516 Ga0495585_0171225 3300046492 Bacteria 1121
517 Ga0495585_0378321 3300046492 Bacteria 684
518 Ga0495594_0686050 3300046499 Bacteria 579
519 Ga0495583_0074662 3300046506 Bacteria 1484
520 Ga0495583_0428933 3300046506 Bacteria 518
521 Ga0495606_0056706 3300046507 Bacteria 2527
522 Ga0495608_0106272 3300046511 Bacteria 1807
523 Ga0495610_0128255 3300046512 Bacteria 1104
524 Ga0495643_0035583 3300046522 Bacteria 2741
525 Ga0495654_0121668 3300046530 Bacteria 1181
526 Ga0495665_0448801 3300046531 Bacteria 652
527 Ga0495640_0049685 3300046533 Bacteria 2891
528 Ga0495640_0159020 3300046533 Bacteria 1449
529 Ga0495640_0660854 3300046533 Bacteria 628
530 Ga0495640_0841484 3300046533 Bacteria 545
531 Ga0495586_0094975 3300046535 Bacteria 1650
532 Ga0495609_0132432 3300046538 Bacteria 1067
533 Ga0495597_0002249 3300046542 Bacteria 12585
534 Ga0495645_0278737 3300046543 Bacteria 1100
535 Ga0495622_0190679 3300046557 Bacteria 916
536 Ga0495667_0227280 3300046559 Bacteria 1190
537 Ga0495668_0122415 3300046616 Bacteria 1423
538 Ga0495668_0211419 3300046616 Bacteria 1062
539 Ga0495611_0041849 3300046648 Bacteria 2044
540 Ga0495625_0654316 3300046660 Bacteria 625
541 Ga0495635_0123943 3300046663 Bacteria 1762
542 Ga0495635_0434526 3300046663 Bacteria 869
543 Ga0495659_0427678 3300046664 Bacteria 574
544 Ga0495657_0895578 3300046675 Bacteria 504
545 Ga0495599_0253632 3300046678 Bacteria 1070
546 Ga0495600_0296343 3300046809 Bacteria 1021
547 Ga0495600_0320000 3300046809 Bacteria 976
548 Ga0495581_0168967 3300047315 Bacteria 1279
549 Ga0495604_0411970 3300047317 Bacteria 888
550 Ga0495674_0041193 3300047319 Bacteria 4128
551 Ga0495674_0495144 3300047319 Bacteria 978
552 Ga0495676_0969564 3300047321 Bacteria 543
553 Ga0495680_0287608 3300047322 Bacteria 1157
554 Ga0495687_187653 3300047443 Bacteria 669
555 Ga0495675_0404486 3300047444 Bacteria 795
556 Ga0495681_0234559 3300047470 Bacteria 731
557 Ga0495684_0081409 3300047471 Bacteria 2457
558 Ga0495684_0381867 3300047471 Bacteria 993
559 Ga0495686_0036249 3300047472 Bacteria 3166
560 Ga0495686_0175905 3300047472 Bacteria 1243
561 Ga0495593_0010024 3300047673 Bacteria 5491
562 Ga0495602_0130765 3300048088 Bacteria 2003
563 Ga0495602_0490715 3300048088 Bacteria 860
564 Ga0495602_0872892 3300048088 Unclassified 600
565 Ga0496101_0181549 3300048904 Bacteria 1621
566 Ga0496101_0487173 3300048904 Bacteria 974
567 Ga0496101_0719955 3300048904 Bacteria 788
568 Ga0496101_1370872 3300048904 Bacteria 552
569 Ga0496102_1231616 3300048905 Bacteria 668
570 Ga0496102_1489673 3300048905 Bacteria 595
571 Ga0496102_1500058 3300048905 Bacteria 593
572 Ga0496103_0299053 3300048906 Bacteria 1035
573 Ga0496104_0799523 3300048907 Bacteria 849
574 Ga0496104_0985587 3300048907 Bacteria 747
575 Ga0496106_0219750 3300048909 Bacteria 1515
576 Ga0496107_0243020 3300048910 Bacteria 1340
577 Ga0496107_0683304 3300048910 Bacteria 756
578 Ga0496107_1162201 3300048910 Bacteria 556
579 Ga0496108_0567402 3300048911 Bacteria 990
580 Ga0496108_0978221 3300048911 Bacteria 724
581 Ga0496108_1258432 3300048911 Bacteria 624
582 Ga0496109_0197809 3300048912 Bacteria 1890
583 Ga0496109_1865529 3300048912 Bacteria 534
584 Ga0496110_0082494 3300048913 Bacteria 2867
585 Ga0496110_0362224 3300048913 Bacteria 1321
586 Ga0496111_0825875 3300048914 Bacteria 670
587 Ga0496112_0981474 3300048915 Bacteria 765
588 Ga0496112_1421689 3300048915 Bacteria 608
589 Ga0496112_1543403 3300048915 Bacteria 578
590 Ga0496114_0057979 3300048917 Bacteria 3233
591 Ga0496115_0192554 3300048918 Bacteria 1685
592 Ga0496115_0205077 3300048918 Bacteria 1629
593 Ga0496126_0678650 3300048929 Bacteria 803
594 Ga0495682_0032030 3300049460 Bacteria 1942
595 Ga0501031_0035480 3300049568 Bacteria 3253
596 Ga0501033_0215323 3300049570 Bacteria 1369
597 Ga0501033_0411566 3300049570 Bacteria 942
598 Ga0501033_1017077 3300049570 Bacteria 553
599 Ga0501034_0155841 3300049571 Bacteria 2258
600 Ga0501034_1308015 3300049571 Bacteria 602
601 Ga0501036_0688524 3300049572 Bacteria 845
602 Ga0501037_0648628 3300049573 Bacteria 706
603 Ga0501037_0772162 3300049573 Bacteria 636
604 Ga0501038_0086902 3300049574 Bacteria 2626
605 Ga0501038_0153582 3300049574 Bacteria 1876
606 Ga0501039_1230163 3300049575 Bacteria 579
607 Ga0501040_1311465 3300049576 Bacteria 525
608 Ga0501043_0236009 3300049579 Bacteria 1411
609 Ga0501043_0291131 3300049579 Bacteria 1250
610 Ga0501043_0657375 3300049579 Bacteria 769
611 Ga0501046_0988848 3300049580 Bacteria 584
612 Ga0501047_0081477 3300049581 Bacteria 3111
613 Ga0501047_0319011 3300049581 Bacteria 1394
614 Ga0501047_0324922 3300049581 Bacteria 1378
615 Ga0501047_0412942 3300049581 Bacteria 1182
616 Ga0501047_0670711 3300049581 Bacteria 855
617 Ga0501047_1133167 3300049581 Bacteria 596
618 Ga0501048_1083544 3300049582 Bacteria 576
619 Ga0501069_0350225 3300049585 Bacteria 870
620 Ga0501070_0000289 3300049586 Bacteria 47035
621 Ga0501070_0143164 3300049586 Bacteria 1973
622 Ga0501070_1230024 3300049586 Bacteria 574
623 Ga0501071_0638838 3300049587 Bacteria 819
624 Ga0501071_1535992 3300049587 Bacteria 514
625 Ga0501072_0657496 3300049588 Bacteria 825
626 Ga0501072_1120215 3300049588 Bacteria 612
627 Ga0501073_0378195 3300049589 Bacteria 978
628 Ga0501073_1088034 3300049589 Bacteria 549
629 Ga0501214_018301 3300049659 Bacteria 865
630 Ga0501235_218105 3300049669 Bacteria 522
631 Ga0501080_0002366 3300049742 Bacteria 16446
632 Ga0501080_0282719 3300049742 Bacteria 1508
633 Ga0501080_1508817 3300049742 Bacteria 571
634 Ga0501083_0465537 3300049744 Bacteria 823
635 Ga0501035_0003211 3300049822 Bacteria 15666
636 Ga0501035_0208511 3300049822 Bacteria 1673
637 Ga0501035_0429231 3300049822 Bacteria 1096
638 Ga0501044_0002850 3300049823 Bacteria 19676
639 Ga0501044_0041101 3300049823 Bacteria 4814
640 Ga0501044_0227343 3300049823 Bacteria 1815
641 Ga0501044_0545233 3300049823 Bacteria 1057
642 Ga0501044_0640950 3300049823 Bacteria 952
643 Ga0501044_0754243 3300049823 Bacteria 855
644 Ga0501045_0405102 3300049824 Bacteria 1015
645 nmdc:mga03683_142223_c1 3300050489 Bacteria 1079
646 nmdc:mga03683_677712_c1 3300050489 Bacteria 509
647 nmdc:mga03n38_457359_c1 3300050490 Bacteria 711
648 nmdc:mga03n38_519411_c1 3300050490 Bacteria 670
649 nmdc:mga03n38_692071_c1 3300050490 Bacteria 587
650 nmdc:mga07m45_724013_c1 3300050496 Bacteria 572
651 nmdc:mga05p37_146314_c1 3300050507 Bacteria 1745
652 nmdc:mga05p37_17978_c1 3300050507 Bacteria 8536
653 nmdc:mga05p37_757946_c1 3300050507 Bacteria 1069
654 nmdc:mga09592_125813_c1 3300050508 Bacteria 2203
655 nmdc:mga0qj67_181577_c1 3300050509 Bacteria 1709
656 nmdc:mga0qj67_68102_c1 3300050509 Bacteria 2837
657 nmdc:mga06r32_170409_c1 3300050510 Bacteria 2161
658 nmdc:mga06r32_560093_c1 3300050510 Bacteria 1116
659 nmdc:mga06r32_62491_c1 3300050510 Bacteria 3588
660 nmdc:mga0n895_898229_c1 3300050512 Bacteria 871
661 nmdc:mga08x19_579855_c1 3300050514 Bacteria 794
662 Ga0495612_0307931 3300053078 Bacteria 711
663 Ga0500635_0000253 3300053080 Bacteria 22197
664 Ga0495619_0314762 3300053085 Bacteria 1084
665 Ga0500578_0158662 3300053086 Bacteria 1405
666 Ga0500643_007450 3300053087 Bacteria 4411
667 Ga0500647_0313951 3300053091 Bacteria 665
668 Ga0500583_0224420 3300053092 Bacteria 931
669 Ga0500651_0038526 3300053093 Bacteria 3011
670 Ga0500566_0304766 3300053094 Bacteria 748
671 Ga0500566_0344246 3300053094 Bacteria 685
672 Ga0500641_0048501 3300053096 Bacteria 1740
673 Ga0500555_017711 3300053103 Bacteria 2052
674 Ga0500556_0028989 3300053104 Bacteria 1862
675 Ga0500569_009054 3300053109 Bacteria 2301
676 Ga0500572_253763 3300053111 Bacteria 572
677 Ga0500591_226538 3300053115 Bacteria 610
678 Ga0500595_056873 3300053119 Bacteria 1193
679 Ga0500608_039533 3300053122 Bacteria 2258
680 Ga0500614_021795 3300053123 Bacteria 1489
681 Ga0500642_0003023 3300053130 Bacteria 5018
682 Ga0500642_0047020 3300053130 Bacteria 1889
683 Ga0500658_0112350 3300053134 Bacteria 1200
684 Ga0500559_0046442 3300053136 Bacteria 1904
685 Ga0500577_0212070 3300053142 Bacteria 837
686 Ga0500590_214380 3300053148 Bacteria 800
687 Ga0500603_136190 3300053150 Bacteria 753
688 Ga0500620_012808 3300053155 Bacteria 2297
689 Ga0500624_010350 3300053157 Bacteria 1342
690 Ga0500638_217077 3300053162 Bacteria 796
691 Ga0500639_176223 3300053163 Bacteria 952
692 Ga0500637_0006851 3300053178 Bacteria 5656
693 Ga0500576_101398 3300053725 Bacteria 1174
694 Ga0500625_050968 3300053729 Bacteria 1911
695 Ga0500645_139428 3300053730 Bacteria 671
696 Ga0500596_004623 3300053735 Bacteria 2509
697 Ga0590071_013418 3300059421 Bacteria 1918
698 Ga0587066_056668 3300059490 Bacteria 788
699 Ga0587066_115645 3300059490 Bacteria 627
700 Ga0587066_127718 3300059490 Bacteria 607
701 Ga0587070_099483 3300059491 Bacteria 667
702 Ga0587073_0038062 3300059492 Bacteria 1034
703 Ga0587073_0124491 3300059492 Bacteria 700
704 Ga0587082_025673 3300059504 Bacteria 992
705 Ga0587082_073600 3300059504 Bacteria 699
706 Ga0587083_0129362 3300059505 Bacteria 661
707 Ga0587090_095119 3300059510 Bacteria 616
708 Ga0587094_079823 3300059513 Bacteria 603
709 Ga0587101_076994 3300059623 Bacteria 625
710 Ga0587128_086024 3300059630 Bacteria 637
711 Ga0587128_159644 3300059630 Bacteria 519
712 Ga0587062_066331 3300059639 Bacteria 644
713 Ga0587068_018994 3300059641 Bacteria 1111
714 Ga0587072_019674 3300059643 Bacteria 1183
715 Ga0587076_014233 3300059645 Bacteria 1221
716 Ga0587078_037717 3300059646 Bacteria 674
717 Ga0587100_005594 3300059648 Bacteria 941
718 Ga0587114_013227 3300059655 Bacteria 1059
719 Ga0587124_020612 3300059660 Bacteria 671
720 Ga0501082_0598531 3300060353 Bacteria 965
721 Ga0466962_0367970 3300061719 Bacteria 717
722 2842777945 2842775625 Bacteria 5587290
723 nmdc:mga09592_727981_c1
724 Ga0006777J48905_1049257
725 Ga0007416J51690_1055074
726 Ga0058859_11724400
727 Ga0058859_11781655
728 Ga0058861_11934103
729 Ga0058860_10019268
730 Ga0058860_11761699
731 Ga0058860_12225969
732 Ga0065165_1000041
733 Ga0065712_10208099
734 Ga0065707_11044598
735 Ga0070658_10576360
736 Ga0070676_11311884
737 Ga0070683_101393161
738 Ga0070670_100181781
739 Ga0070670_101733491
740 Ga0070677_10139266
741 Ga0068869_100426677
742 Ga0068869_102071053
743 Ga0070666_10022439
744 Ga0070660_100108817
745 Ga0070660_101084759
746 Ga0070660_101810954
747 Ga0070689_101925450
748 Ga0070691_10193715
749 Ga0070661_100941188
750 Ga0070661_101037964
751 Ga0070668_100002639
752 Ga0070668_100005564
753 Ga0070668_100006876
754 Ga0070668_100643638
755 Ga0070668_100646207
756 Ga0070668_100815314
757 Ga0070669_100089337
758 Ga0070669_100428462
759 Ga0070669_100542296
760 Ga0070669_100749405
761 Ga0070669_101704968
762 Ga0070671_100048681
763 Ga0070674_101066461
764 Ga0070674_101867429
765 Ga0070659_100170272
766 Ga0070659_100475720
767 Ga0070667_100000260
768 Ga0070667_100083339
769 Ga0070667_100094806
770 Ga0070667_100183843
771 Ga0070667_101950033
772 Ga0070714_100144107
773 Ga0070714_100161300
774 Ga0070713_100073029
775 Ga0070713_100509266
776 Ga0070713_100593112
777 Ga0070713_102284855
778 Ga0070710_11349449
779 Ga0070711_100867528
780 Ga0070708_100297413
781 Ga0070663_101017979
782 Ga0070663_102087033
783 Ga0070678_100864134
784 Ga0070678_101096788
785 Ga0070662_100358809
786 Ga0070681_10038260
787 Ga0070681_10480803
788 Ga0070681_11834400
789 Ga0070707_100684781
790 Ga0070698_100246957
791 Ga0070698_100606880
792 Ga0070679_100355559
793 Ga0070679_101069785
794 Ga0068853_100545562
795 Ga0068853_101839626
796 Ga0070672_100008924
797 Ga0070686_100425094
798 Ga0070686_101229425
799 Ga0070665_100002230
800 Ga0070665_100010548
801 Ga0070665_100052336
802 Ga0070665_100773999
803 Ga0070665_100964940
804 Ga0068855_100018740
805 Ga0068855_100222369
806 Ga0068855_100478039
807 Ga0068855_100512844
808 Ga0070664_100931883
809 Ga0068857_101425032
810 Ga0068854_100361285
811 Ga0068854_100424601
812 Ga0068854_100986165
813 Ga0068856_100520499
814 Ga0068856_100688130
815 Ga0068856_101567667
816 Ga0068856_101712209
817 Ga0068856_101808283
818 Ga0068859_100000437
819 Ga0068859_101146183
820 Ga0068859_101663882
821 Ga0068864_100000496
822 Ga0068861_101760256
823 Ga0068861_101924375
824 Ga0068851_10677727
825 Ga0068863_100001649
826 Ga0068863_100006085
827 Ga0068863_100824281
828 Ga0068858_100036068
829 Ga0068858_100244459
830 Ga0068860_100000309
831 Ga0068860_100015356
832 Ga0068860_100087799
833 Ga0068860_100090219
834 Ga0068860_100497468
835 Ga0068862_100001520
836 Ga0068862_100014608
837 Ga0081455_10021562
838 Ga0081455_10439226
839 Ga0081455_10641568
840 Ga0070717_10577906
841 Ga0075363_100199180
842 Ga0075363_100451132
843 Ga0075363_100702604
844 Ga0070712_101388305
845 Ga0070712_101594085
846 Ga0075362_10101625
847 Ga0075367_10788724
848 Ga0075369_10317886
849 Ga0097621_100157532
850 Ga0097621_100424470
851 Ga0097621_101308137
852 Ga0075370_10702465
853 Ga0068871_100606746
854 Ga0068871_102139682
855 Ga0075428_100865889
856 Ga0075430_100124507
857 Ga0075430_100141437
858 Ga0075431_100025055
859 Ga0075431_100123218
860 Ga0075431_100397343
861 Ga0075429_100210880
862 Ga0075429_100240784
863 Ga0068865_101444637
864 Ga0075436_100592863
865 Ga0097620_100000437
866 Ga0097620_101146074
867 Ga0097620_101663785
868 Ga0105240_10532862
869 Ga0105240_11311418
870 Ga0111539_10983998
871 Ga0105245_11792885
872 Ga0105247_10152763
873 Ga0105247_10341852
874 Ga0105247_10588135
875 Ga0114129_10155368
876 Ga0114129_10231445
877 Ga0114129_10510871
878 Ga0114129_10599927
879 Ga0105243_10239973
880 Ga0105243_10277210
881 Ga0105243_12046007
882 Ga0105241_10414947
883 Ga0105241_12005393
884 Ga0105242_10135194
885 Ga0105248_10008553
886 Ga0105248_10055327
887 Ga0105248_10072017
888 Ga0105248_10149988
889 Ga0105237_11083966
890 Ga0105237_11621597
891 Ga0105238_10011521
892 Ga0105238_10182063
893 Ga0105238_10645806
894 Ga0105238_11237135
895 Ga0105249_10005538
896 Ga0105249_10062995
897 Ga0105249_11356275
898 Ga0105249_11391011
899 Ga0105249_12080875
900 Ga0105239_10313679
901 Ga0105239_12627588
902 Ga0105246_12540235
903 Ga0154012_157729
904 Ga0157373_11067446
905 Ga0157371_10022339
906 Ga0157371_10374150
907 Ga0157370_10711405
908 Ga0157370_11497596
909 Ga0157369_10474459
910 Ga0157378_12748851
911 Ga0163162_10375749
912 Ga0163162_10413433
913 Ga0163162_10583209
914 Ga0163162_10647398
915 Ga0163162_10684794
916 Ga0163162_11200210
917 Ga0157372_10026131
918 Ga0157375_10049365
919 Ga0163163_10263715
920 Ga0163163_11341499
921 Ga0157380_12024557
922 Ga0157380_12507658
923 Ga0182008_10027287
924 Ga0157379_10000373
925 Ga0157379_10030580
926 Ga0157379_10533785
927 Ga0157376_10439324
928 Ga0157376_10786353
929 Ga0182005_1294579
930 Ga0163161_10004551
931 Ga0163161_11504809
932 Ga0184603_104055
933 Ga0206356_10110059
934 Ga0206356_11523172
935 Ga0206349_1171119
936 Ga0206349_1842965
937 Ga0206355_1120641
938 Ga0206351_10028857
939 Ga0206351_10419817
940 Ga0206351_10594541
941 Ga0206352_10271920
942 Ga0206350_10794378
943 Ga0206350_10886961
944 Ga0206350_11291946
945 Ga0206354_10990331
946 Ga0206354_11091809
947 Ga0206354_11177659
948 Ga0206354_11657213
949 Ga0154015_1288437
950 Ga0213873_10093033
951 Ga0213872_10005246
952 Ga0213872_10039553
953 Ga0213872_10050376
954 Ga0213872_10055110
955 Ga0213872_10075083
956 Ga0213872_10196472
957 Ga0213872_10223638
958 Ga0213874_10072783
959 Ga0213876_10008380
960 Ga0213876_10063803
961 Ga0213876_10073266
962 Ga0213876_10283997
963 Ga0213875_10019110
964 Ga0213875_10042500
965 Ga0213871_10087846
966 Ga0224712_10096343
967 Ga0224712_10122206
968 Ga0224712_10240126
969 Ga0224712_10262623
970 Ga0224712_10290850
971 Ga0209233_1024869
972 Ga0209455_1039385
973 Ga0207697_10271626
974 Ga0207697_10412278
975 Ga0207656_10414364
976 Ga0207692_10216144
977 Ga0207710_10054524
978 Ga0207710_10376548
979 Ga0207680_10070471
980 Ga0207643_10679712
981 Ga0207705_10179021
982 Ga0207705_10366391
983 Ga0207705_11061003
984 Ga0207654_10237202
985 Ga0207707_10008836
986 Ga0207707_10270641
987 Ga0207707_11037957
988 Ga0207695_10001687
989 Ga0207695_10100739
990 Ga0207695_11437575
991 Ga0207693_11117890
992 Ga0207663_10906067
993 Ga0207660_10012939
994 Ga0207657_10000896
995 Ga0207649_11212625
996 Ga0207652_10006121
997 Ga0207652_10410705
998 Ga0207652_10510920
999 Ga0207652_10947373
1000 Ga0207646_10681987
1001 Ga0207681_10002433
1002 Ga0207681_10238626
1003 Ga0207681_10416752
1004 Ga0207681_10420762
1005 Ga0207694_10364442
1006 Ga0207694_10784939
1007 Ga0207650_10025375
1008 Ga0207650_10381342
1009 Ga0207650_10629708
1010 Ga0207650_10797076
1011 Ga0207659_10958651
1012 Ga0207700_10208564
1013 Ga0207700_10336014
1014 Ga0207700_10463815
1015 Ga0207700_10660709
1016 Ga0207700_10923867
1017 Ga0207664_10129212
1018 Ga0207664_10886956
1019 Ga0207644_10041159
1020 Ga0207644_10423273
1021 Ga0207686_10143780
1022 Ga0207686_10291177
1023 Ga0207686_11182461
1024 Ga0207709_10410049
1025 Ga0207709_10539316
1026 Ga0207669_11360020
1027 Ga0207669_11370063
1028 Ga0207691_10081239
1029 Ga0207711_10002832
1030 Ga0207711_10039945
1031 Ga0207711_10457277
1032 Ga0207711_11694496
1033 Ga0207689_10417628
1034 Ga0207689_11641796
1035 Ga0207667_10108602
1036 Ga0207667_11027471
1037 Ga0207667_12168117
1038 Ga0207712_10000569
1039 Ga0207712_10369031
1040 Ga0207712_11516086
1041 Ga0207712_12107636
1042 Ga0207668_10000003
1043 Ga0207668_10000678
1044 Ga0207668_10043288
1045 Ga0207668_11354218
1046 Ga0207640_10119998
1047 Ga0207640_10302581
1048 Ga0207640_10736274
1049 Ga0207658_10000470
1050 Ga0207658_10005614
1051 Ga0207658_10075281
1052 Ga0207658_10157827
1053 Ga0207658_10746002
1054 Ga0207677_10497176
1055 Ga0207703_10009963
1056 Ga0207703_10025799
1057 Ga0207703_10413447
1058 Ga0207639_10615785
1059 Ga0207639_10932062
1060 Ga0207678_10661521
1061 Ga0207678_11637373
1062 Ga0207708_11325847
1063 Ga0207702_10321956
1064 Ga0207702_11068824
1065 Ga0207702_11572471
1066 Ga0207702_11912525
1067 Ga0207641_10002338
1068 Ga0207641_10002399
1069 Ga0207641_11476092
1070 Ga0207676_10000285
1071 Ga0207676_11477773
1072 Ga0207675_100413152
1073 Ga0207675_101011573
1074 Ga0207675_101115962
1075 Ga0207675_102736287
1076 Ga0207683_10293296
1077 Ga0209981_1000340
1078 Ga0209984_1018307
1079 Ga0210000_1019661
1080 Ga0209999_1017729
1081 Ga0209983_1046093
1082 Ga0209974_10064383
1083 Ga0268266_10001802
1084 Ga0268266_10038272
1085 Ga0268266_10506547
1086 Ga0268266_10760645
1087 Ga0268265_10005576
1088 Ga0268265_10007726
1089 Ga0268265_10017303
1090 Ga0268265_12584090
1091 Ga0268264_10000118
1092 Ga0268264_10082718
1093 Ga0268264_10916333
1094 Ga0268264_12081816
1095 Ga0307517_10162375
1096 Ga0265338_10011636
1097 Ga0265338_10021909
1098 Ga0265338_10264762
1099 Ga0265338_10306725
1100 Ga0265760_10139697
1101 Ga0265330_10033163
1102 Ga0265330_10180123
1103 Ga0265325_10328081
1104 Ga0265340_10024300
1105 Ga0265340_10040812
1106 Ga0265339_10042840
1107 Ga0265339_10208674
1108 Ga0265327_10005115
1109 Ga0265327_10093726
1110 Ga0265327_10142738
1111 Ga0265316_10354930
1112 Ga0307408_100169423
1113 Ga0307408_101676147
1114 Ga0307408_102095199
1115 Ga0265313_10000684
1116 Ga0316575_10126335
1117 Ga0265314_10029093
1118 Ga0265342_10525352
1119 Ga0316576_10827729
1120 Ga0307405_10822757
1121 Ga0307405_11747843
1122 Ga0307405_11900426
1123 Ga0307413_10689065
1124 Ga0307410_10898960
1125 Ga0307406_10192438
1126 Ga0307406_10955804
1127 Ga0307407_10031674
1128 Ga0307412_10168721
1129 Ga0307409_100117196
1130 Ga0307409_100187513
1131 Ga0307416_100153423
1132 Ga0307416_100542636
1133 Ga0307414_10050455
1134 Ga0307414_10068988
1135 Ga0307414_11064521
1136 Ga0307414_11086425
1137 Ga0307411_12105345
1138 Ga0307415_100039831
1139 Ga0373930_0186756
1140 Ga0373934_0116580
1141 Ga0373923_0581373
1142 Ga0373957_0309451
1143 Ga0373957_0443421
1144 Ga0373943_0255644
1145 Ga0373946_0447635
1146 Ga0373962_0259567
1147 Ga0373924_0089152
1148 Ga0373935_0082762
1149 Ga0373935_0682705
1150 Ga0373927_0271652
1151 Ga0373933_0073199
1152 Ga0373947_0042308
1153 Ga0373937_0104792
1154 Ga0373937_2160929
1155 Ga0265778_018478
1156 Ga0265778_026552
1157 Ga0316582_0226718
1158 Ga0316584_0286670
1159 Ga0373925_0041994
1160 Ga0373925_0943223
1161 Ga0395899_0493530
1162 Ga0395899_0769080
1163 Ga0395900_1609426
1164 Ga0395905_0359897
1165 Ga0436364_0073909
1166 Ga0436364_0105856
1167 Ga0436364_0451416
1168 Ga0436364_0792782
1169 Ga0436364_1084258
1170 Ga0436364_1158097
1171 Ga0436364_1305733
1172 Ga0395901_1149825
1173 Ga0436365_0212575
1174 Ga0436365_0853858
1175 Ga0436365_1677065
1176 Ga0436365_1910301
1177 Ga0436360_0027323
1178 Ga0436360_0036575
1179 Ga0436360_0172092
1180 Ga0436360_0184139
1181 Ga0436360_0395146
1182 Ga0436360_0405634
1183 Ga0436360_0441734
1184 Ga0436360_0551744
1185 Ga0436360_1035682
1186 Ga0436360_1100992
1187 Ga0436360_1177339
1188 Ga0436360_1280339
1189 Ga0436360_1288774
1190 Ga0436361_0112287
1191 Ga0436361_0492353
1192 Ga0436361_0581466
1193 Ga0436361_0675692
1194 Ga0436361_0802179
1195 Ga0436361_0936322
1196 Ga0436361_1022522
1197 Ga0436361_1159471
1198 Ga0436361_1167885
1199 Ga0436361_1168248
1200 Ga0436361_1198780
1201 Ga0436363_1690096
1202 Ga0436362_0509888
1203 Ga0436362_1018720
1204 Ga0439466_0143996
1205 Ga0451791_0777285
1206 Ga0451797_1498156
1207 Ga0451807_0356939
1208 Ga0451837_0748982
1209 Ga0451839_0195717
1210 Ga0439449_0154656
1211 Ga0439458_0068787
1212 Ga0439464_0211338
1213 Ga0451577_0689250
1214 Ga0466966_0062715
1215 Ga0453684_0547143
1216 Ga0466971_0308070
1217 Ga0466971_0679491
1218 Ga0466970_0653381
1219 Ga0466957_0012215
1220 Ga0466957_0154861
1221 Ga0466957_1072135
1222 Ga0466960_0176531
1223 Ga0466960_0694115
1224 Ga0451576_1529158
1225 Ga0466958_0031268
1226 Ga0466958_0577021
1227 Ga0466958_0934845
1228 Ga0466967_1054975
1229 Ga0466967_1369930
1230 Ga0466967_1647300
1231 Ga0495592_0194678
1232 Ga0495590_0238800
1233 Ga0495629_0020533
1234 Ga0495629_0669064
1235 Ga0495651_0004432
1236 Ga0495653_0296027
1237 Ga0495664_0293346
1238 Ga0495585_0171225
1239 Ga0495585_0378321
1240 Ga0495594_0686050
1241 Ga0495583_0074662
1242 Ga0495583_0428933
1243 Ga0495606_0056706
1244 Ga0495608_0106272
1245 Ga0495610_0128255
1246 Ga0495643_0035583
1247 Ga0495654_0121668
1248 Ga0495665_0448801
1249 Ga0495640_0049685
1250 Ga0495640_0159020
1251 Ga0495640_0660854
1252 Ga0495640_0841484
1253 Ga0495586_0094975
1254 Ga0495609_0132432
1255 Ga0495597_0002249
1256 Ga0495645_0278737
1257 Ga0495622_0190679
1258 Ga0495667_0227280
1259 Ga0495668_0122415
1260 Ga0495668_0211419
1261 Ga0495611_0041849
1262 Ga0495625_0654316
1263 Ga0495635_0123943
1264 Ga0495635_0434526
1265 Ga0495659_0427678
1266 Ga0495657_0895578
1267 Ga0495599_0253632
1268 Ga0495600_0296343
1269 Ga0495600_0320000
1270 Ga0495581_0168967
1271 Ga0495604_0411970
1272 Ga0495674_0041193
1273 Ga0495674_0495144
1274 Ga0495676_0969564
1275 Ga0495680_0287608
1276 Ga0495687_187653
1277 Ga0495675_0404486
1278 Ga0495681_0234559
1279 Ga0495684_0081409
1280 Ga0495684_0381867
1281 Ga0495686_0036249
1282 Ga0495686_0175905
1283 Ga0495593_0010024
1284 Ga0495602_0130765
1285 Ga0495602_0490715
1286 Ga0495602_0872892
1287 Ga0496101_0181549
1288 Ga0496101_0487173
1289 Ga0496101_0719955
1290 Ga0496101_1370872
1291 Ga0496102_1231616
1292 Ga0496102_1489673
1293 Ga0496102_1500058
1294 Ga0496103_0299053
1295 Ga0496104_0799523
1296 Ga0496104_0985587
1297 Ga0496106_0219750
1298 Ga0496107_0243020
1299 Ga0496107_0683304
1300 Ga0496107_1162201
1301 Ga0496108_0567402
1302 Ga0496108_0978221
1303 Ga0496108_1258432
1304 Ga0496109_0197809
1305 Ga0496109_1865529
1306 Ga0496110_0082494
1307 Ga0496110_0362224
1308 Ga0496111_0825875
1309 Ga0496112_0981474
1310 Ga0496112_1421689
1311 Ga0496112_1543403
1312 Ga0496114_0057979
1313 Ga0496115_0192554
1314 Ga0496115_0205077
1315 Ga0496126_0678650
1316 Ga0495682_0032030
1317 Ga0501031_0035480
1318 Ga0501033_0215323
1319 Ga0501033_0411566
1320 Ga0501033_1017077
1321 Ga0501034_0155841
1322 Ga0501034_1308015
1323 Ga0501036_0688524
1324 Ga0501037_0648628
1325 Ga0501037_0772162
1326 Ga0501038_0086902
1327 Ga0501038_0153582
1328 Ga0501039_1230163
1329 Ga0501040_1311465
1330 Ga0501043_0236009
1331 Ga0501043_0291131
1332 Ga0501043_0657375
1333 Ga0501046_0988848
1334 Ga0501047_0081477
1335 Ga0501047_0319011
1336 Ga0501047_0324922
1337 Ga0501047_0412942
1338 Ga0501047_0670711
1339 Ga0501047_1133167
1340 Ga0501048_1083544
1341 Ga0501069_0350225
1342 Ga0501070_0000289
1343 Ga0501070_0143164
1344 Ga0501070_1230024
1345 Ga0501071_0638838
1346 Ga0501071_1535992
1347 Ga0501072_0657496
1348 Ga0501072_1120215
1349 Ga0501073_0378195
1350 Ga0501073_1088034
1351 Ga0501214_018301
1352 Ga0501235_218105
1353 Ga0501080_0002366
1354 Ga0501080_0282719
1355 Ga0501080_1508817
1356 Ga0501083_0465537
1357 Ga0501035_0003211
1358 Ga0501035_0208511
1359 Ga0501035_0429231
1360 Ga0501044_0002850
1361 Ga0501044_0041101
1362 Ga0501044_0227343
1363 Ga0501044_0545233
1364 Ga0501044_0640950
1365 Ga0501044_0754243
1366 Ga0501045_0405102
1367 nmdc:mga03683_142223_c1
1368 nmdc:mga03683_677712_c1
1369 nmdc:mga03n38_457359_c1
1370 nmdc:mga03n38_519411_c1
1371 nmdc:mga03n38_692071_c1
1372 nmdc:mga07m45_724013_c1
1373 nmdc:mga05p37_146314_c1
1374 nmdc:mga05p37_17978_c1
1375 nmdc:mga05p37_757946_c1
1376 nmdc:mga09592_125813_c1
1377 nmdc:mga0qj67_181577_c1
1378 nmdc:mga0qj67_68102_c1
1379 nmdc:mga06r32_170409_c1
1380 nmdc:mga06r32_560093_c1
1381 nmdc:mga06r32_62491_c1
1382 nmdc:mga0n895_898229_c1
1383 nmdc:mga08x19_579855_c1
1384 Ga0495612_0307931
1385 Ga0500635_0000253
1386 Ga0495619_0314762
1387 Ga0500578_0158662
1388 Ga0500643_007450
1389 Ga0500647_0313951
1390 Ga0500583_0224420
1391 Ga0500651_0038526
1392 Ga0500566_0304766
1393 Ga0500566_0344246
1394 Ga0500641_0048501
1395 Ga0500555_017711
1396 Ga0500556_0028989
1397 Ga0500569_009054
1398 Ga0500572_253763
1399 Ga0500591_226538
1400 Ga0500595_056873
1401 Ga0500608_039533
1402 Ga0500614_021795
1403 Ga0500642_0003023
1404 Ga0500642_0047020
1405 Ga0500658_0112350
1406 Ga0500559_0046442
1407 Ga0500577_0212070
1408 Ga0500590_214380
1409 Ga0500603_136190
1410 Ga0500620_012808
1411 Ga0500624_010350
1412 Ga0500638_217077
1413 Ga0500639_176223
1414 Ga0500637_0006851
1415 Ga0500576_101398
1416 Ga0500625_050968
1417 Ga0500645_139428
1418 Ga0500596_004623
1419 Ga0590071_013418
1420 Ga0587066_056668
1421 Ga0587066_115645
1422 Ga0587066_127718
1423 Ga0587070_099483
1424 Ga0587073_0038062
1425 Ga0587073_0124491
1426 Ga0587082_025673
1427 Ga0587082_073600
1428 Ga0587083_0129362
1429 Ga0587090_095119
1430 Ga0587094_079823
1431 Ga0587101_076994
1432 Ga0587128_086024
1433 Ga0587128_159644
1434 Ga0587062_066331
1435 Ga0587068_018994
1436 Ga0587072_019674
1437 Ga0587076_014233
1438 Ga0587078_037717
1439 Ga0587100_005594
1440 Ga0587114_013227
1441 Ga0587124_020612
1442 Ga0501082_0598531
1443 Ga0466962_0367970
1444 2842777945

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

15

88

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nfl-assembly1.cif.gz_A crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. 0.893 4 77
5nfl-assembly1.cif.gz_A crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. 0.882 4 77
3tr3-assembly2.cif.gz_A structure of a bola protein homologue from coxiella burnetii 0.843 3 76
2mma-assembly1.cif.gz_B nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.8415 5 76
3o2e-assembly1.cif.gz_A crystal structure of a bol-like protein from babesia bovis 0.8408 3 76
ID Description Score Start End Superfamily
af_Q53S33_27_107_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9122 5 78 3.30.300.90
af_Q67VQ4_70_166_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.8989 5 76 3.10.20.90
af_P0A9W6_1_84_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8931 3 76 3.30.300.90
5nflA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.893 4 77 3.30.300.90
af_P53082_9_118_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.8885 1 77 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A533Y5Q0-F1-model_v4 BolA family transcriptional regulator 0.9823 3 75
AF-A0A525VIF3-F1-model_v4 BolA family transcriptional regulator 0.9747 3 75
AF-A0A4Y6PPR3-F1-model_v4 BolA family transcriptional regulator 0.9736 3 77
AF-A0A2Z4FR06-F1-model_v4 BolA family transcriptional regulator 0.9732 3 76
AF-A0A328CBN2-F1-model_v4 BolA family transcriptional regulator 0.973 3 77

Map