F476234
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 702 | 391 | 675 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300046615|Ga0495656_0122175|Ga0495656_0122175_602_952 |
| Length | 116 |
| Sequence | MMGTNAILGAKRMTDGLVALYIFMLAAIAGNVIISRVPVILHTPLMSGSNFIHGIVLIGAMVVLGHADTTLEKVIGFLAVLLGAGNAAGGYVVTERMLEMFKPSQKKSVGSDGSKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 3 | 2524614857 | Deinococcus ficus DSM 19119 | Isolate | Rhizosphere |
| 4 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 5 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 6 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 7 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 8 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 9 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 10 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 11 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 12 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 13 | 2739367875 | Deinococcus ficus CC-FR2-10 | Isolate | Unclassified |
| 14 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 15 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 16 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 17 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 18 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 19 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 20 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 21 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 22 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 23 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 24 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 25 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 26 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 71 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 72 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 80 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 81 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 82 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 86 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013874 | Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 98 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 161 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 164 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 170 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 173 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 175 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 176 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 178 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 179 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 186 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 190 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 191 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 192 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 193 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 194 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 195 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 202 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 207 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 212 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 213 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 216 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 217 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 218 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 219 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 220 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 221 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 222 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 223 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 224 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 228 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 229 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 230 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 231 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 232 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 233 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 234 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 235 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 236 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 237 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 238 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 239 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 240 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 241 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 242 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 243 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 244 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 245 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 246 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 247 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 248 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 249 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 250 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 251 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 252 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 253 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 254 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 255 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 256 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 257 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 258 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 259 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 260 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 261 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 262 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 263 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 264 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 265 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 266 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 267 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 268 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 269 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 270 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 271 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 272 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 273 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 274 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 275 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 276 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 277 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 278 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 279 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 306 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 307 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 308 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 309 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 312 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 317 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 318 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 319 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 320 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 321 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 322 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 323 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 324 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 325 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 352 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 353 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 354 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 355 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 356 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 357 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 362 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 367 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 376 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 377 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 378 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 379 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 380 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 381 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 382 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 384 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 387 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 388 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 389 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 390 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 391 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.44 |
| Metatranscriptomes | 0.71 |
| Isolates | 3.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.28 |
| Nodule | 0 |
| Rhizoplane | 3.85 |
| Rhizosphere | 87.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3396017 | 2162886007 | Bacteria | 1159 |
| 2 | Ga0058692_1000032 | 3300003856 | Bacteria | 179581 |
| 3 | Ga0065714_10433482 | 3300005288 | Bacteria | 547 |
| 4 | Ga0065704_10071825 | 3300005289 | Bacteria | 9819 |
| 5 | Ga0065704_10508426 | 3300005289 | Bacteria | 638 |
| 6 | Ga0065712_10037529 | 3300005290 | Bacteria | 1278 |
| 7 | Ga0065712_10270178 | 3300005290 | Bacteria | 917 |
| 8 | Ga0065715_10228295 | 3300005293 | Bacteria | 1244 |
| 9 | Ga0065715_10463170 | 3300005293 | Bacteria | 814 |
| 10 | Ga0070670_100011189 | 3300005331 | Bacteria | 7668 |
| 11 | Ga0070670_100440567 | 3300005331 | Bacteria | 1154 |
| 12 | Ga0068869_100125916 | 3300005334 | Bacteria | 1964 |
| 13 | Ga0070692_10446391 | 3300005345 | Bacteria | 827 |
| 14 | Ga0070668_100257185 | 3300005347 | Bacteria | 1451 |
| 15 | Ga0070669_100006914 | 3300005353 | Bacteria | 8155 |
| 16 | Ga0070669_101412992 | 3300005353 | Bacteria | 604 |
| 17 | Ga0070675_101883526 | 3300005354 | Bacteria | 552 |
| 18 | Ga0070671_100568056 | 3300005355 | Bacteria | 979 |
| 19 | Ga0070673_100013760 | 3300005364 | Bacteria | 5612 |
| 20 | Ga0070714_100328036 | 3300005435 | Bacteria | 1433 |
| 21 | Ga0070713_100455731 | 3300005436 | Bacteria | 1202 |
| 22 | Ga0070710_10722778 | 3300005437 | Bacteria | 705 |
| 23 | Ga0070701_10462021 | 3300005438 | Bacteria | 817 |
| 24 | Ga0070705_100195860 | 3300005440 | Bacteria | 1381 |
| 25 | Ga0070705_101320259 | 3300005440 | Bacteria | 599 |
| 26 | Ga0070694_101031481 | 3300005444 | Bacteria | 684 |
| 27 | Ga0070708_102124676 | 3300005445 | Bacteria | 519 |
| 28 | Ga0070681_11997704 | 3300005458 | Bacteria | 508 |
| 29 | Ga0068867_100263053 | 3300005459 | Bacteria | 1407 |
| 30 | Ga0068867_101630007 | 3300005459 | Bacteria | 604 |
| 31 | Ga0070684_101340236 | 3300005535 | Bacteria | 674 |
| 32 | Ga0070672_100006730 | 3300005543 | Bacteria | 7752 |
| 33 | Ga0070672_100412610 | 3300005543 | Bacteria | 1159 |
| 34 | Ga0070695_100126647 | 3300005545 | Bacteria | 1755 |
| 35 | Ga0070696_100006453 | 3300005546 | Bacteria | 7844 |
| 36 | Ga0070696_100365609 | 3300005546 | Bacteria | 1121 |
| 37 | Ga0070696_100457810 | 3300005546 | Bacteria | 1008 |
| 38 | Ga0070704_100082361 | 3300005549 | Bacteria | 2373 |
| 39 | Ga0068855_101654046 | 3300005563 | Bacteria | 654 |
| 40 | Ga0070664_100778683 | 3300005564 | Bacteria | 894 |
| 41 | Ga0070664_101149351 | 3300005564 | Bacteria | 732 |
| 42 | Ga0068857_101113759 | 3300005577 | Bacteria | 763 |
| 43 | Ga0068859_100606518 | 3300005617 | Bacteria | 1187 |
| 44 | Ga0068864_101349831 | 3300005618 | Bacteria | 714 |
| 45 | Ga0068861_100959644 | 3300005719 | Bacteria | 814 |
| 46 | Ga0068870_10033093 | 3300005840 | Bacteria | 2635 |
| 47 | Ga0068870_10221291 | 3300005840 | Bacteria | 1159 |
| 48 | Ga0068870_11247610 | 3300005840 | Bacteria | 540 |
| 49 | Ga0068863_100750246 | 3300005841 | Bacteria | 972 |
| 50 | Ga0068863_100791074 | 3300005841 | Bacteria | 946 |
| 51 | Ga0068860_101369562 | 3300005843 | Bacteria | 729 |
| 52 | Ga0068862_100442183 | 3300005844 | Bacteria | 1224 |
| 53 | Ga0068862_100717912 | 3300005844 | Bacteria | 970 |
| 54 | Ga0070716_100045012 | 3300006173 | Bacteria | 2475 |
| 55 | Ga0068871_100237851 | 3300006358 | Bacteria | 1582 |
| 56 | Ga0075430_100089700 | 3300006846 | Bacteria | 2572 |
| 57 | Ga0075433_10000063 | 3300006852 | Bacteria | 46869 |
| 58 | Ga0068865_100376550 | 3300006881 | Bacteria | 1157 |
| 59 | Ga0075436_100001594 | 3300006914 | Bacteria | 15499 |
| 60 | Ga0075436_100007279 | 3300006914 | Bacteria | 7569 |
| 61 | Ga0097620_100606513 | 3300006931 | Bacteria | 1187 |
| 62 | Ga0075435_100000215 | 3300007076 | Bacteria | 35478 |
| 63 | Ga0099794_10062491 | 3300007265 | Bacteria | 1811 |
| 64 | Ga0099795_10000028 | 3300007788 | Bacteria | 41981 |
| 65 | Ga0099795_10000378 | 3300007788 | Bacteria | 8054 |
| 66 | Ga0105251_10000509 | 3300009011 | Bacteria | 36783 |
| 67 | Ga0105250_10000010 | 3300009092 | Bacteria | 298384 |
| 68 | Ga0105240_10022420 | 3300009093 | Bacteria | 8371 |
| 69 | Ga0105240_10284018 | 3300009093 | Bacteria | 1900 |
| 70 | Ga0105243_10021218 | 3300009148 | Bacteria | 4929 |
| 71 | Ga0105243_10349256 | 3300009148 | Bacteria | 1358 |
| 72 | Ga0105243_12411677 | 3300009148 | Bacteria | 564 |
| 73 | Ga0105241_10859476 | 3300009174 | Bacteria | 840 |
| 74 | Ga0105241_12112590 | 3300009174 | Bacteria | 557 |
| 75 | Ga0105248_12176294 | 3300009177 | Bacteria | 631 |
| 76 | Ga0105248_13022903 | 3300009177 | Bacteria | 536 |
| 77 | Ga0105238_10966112 | 3300009551 | Bacteria | 872 |
| 78 | Ga0105238_12959097 | 3300009551 | Bacteria | 511 |
| 79 | Ga0105148_102895 | 3300009978 | Bacteria | 1212 |
| 80 | Ga0105029_113209 | 3300009984 | Bacteria | 647 |
| 81 | Ga0105030_100289 | 3300009987 | Bacteria | 4386 |
| 82 | Ga0099796_10000091 | 3300010159 | Bacteria | 15012 |
| 83 | Ga0099796_10000149 | 3300010159 | Bacteria | 10399 |
| 84 | Ga0105239_10101110 | 3300010375 | Bacteria | 3189 |
| 85 | Ga0105246_10656841 | 3300011119 | Bacteria | 914 |
| 86 | Ga0157325_1014751 | 3300012485 | Bacteria | 631 |
| 87 | Ga0157316_1060899 | 3300012510 | Bacteria | 546 |
| 88 | Ga0157370_10302845 | 3300013104 | Bacteria | 1475 |
| 89 | Ga0163162_11124643 | 3300013306 | Bacteria | 890 |
| 90 | Ga0157375_10007013 | 3300013308 | Bacteria | 9840 |
| 91 | Ga0157514_105533 | 3300013874 | Bacteria | 1995 |
| 92 | Ga0157380_10075546 | 3300014326 | Bacteria | 2739 |
| 93 | Ga0157380_10137030 | 3300014326 | Bacteria | 2097 |
| 94 | Ga0157377_11321378 | 3300014745 | Bacteria | 565 |
| 95 | Ga0157379_10000022 | 3300014968 | Bacteria | 90949 |
| 96 | Ga0157379_11794745 | 3300014968 | Bacteria | 603 |
| 97 | Ga0182005_1008069 | 3300015265 | Bacteria | 3122 |
| 98 | Ga0183369_1007 | 3300015685 | Bacteria | 414878 |
| 99 | Ga0163161_11066445 | 3300017792 | Bacteria | 693 |
| 100 | Ga0163161_11465808 | 3300017792 | Bacteria | 598 |
| 101 | Ga0163161_11791891 | 3300017792 | Bacteria | 546 |
| 102 | Ga0213874_10031626 | 3300021377 | Bacteria | 1532 |
| 103 | Ga0207696_1000159 | 3300025711 | Bacteria | 111473 |
| 104 | Ga0207713_1000856 | 3300025735 | Bacteria | 27912 |
| 105 | Ga0207682_10081496 | 3300025893 | Bacteria | 1388 |
| 106 | Ga0207710_10030850 | 3300025900 | Bacteria | 2340 |
| 107 | Ga0207680_10050019 | 3300025903 | Bacteria | 2492 |
| 108 | Ga0207680_10224420 | 3300025903 | Bacteria | 1289 |
| 109 | Ga0207685_10156458 | 3300025905 | Bacteria | 1036 |
| 110 | Ga0207645_10005481 | 3300025907 | Bacteria | 9188 |
| 111 | Ga0207645_10091903 | 3300025907 | Bacteria | 1952 |
| 112 | Ga0207643_10075223 | 3300025908 | Bacteria | 1949 |
| 113 | Ga0207643_10150735 | 3300025908 | Bacteria | 1394 |
| 114 | Ga0207705_10638438 | 3300025909 | Bacteria | 828 |
| 115 | Ga0207654_11373341 | 3300025911 | Bacteria | 515 |
| 116 | Ga0207695_10269854 | 3300025913 | Bacteria | 1597 |
| 117 | Ga0207663_10052499 | 3300025916 | Bacteria | 2543 |
| 118 | Ga0207660_10184838 | 3300025917 | Bacteria | 1620 |
| 119 | Ga0207660_10331192 | 3300025917 | Bacteria | 1217 |
| 120 | Ga0207660_10890768 | 3300025917 | Bacteria | 726 |
| 121 | Ga0207660_11327407 | 3300025917 | Bacteria | 584 |
| 122 | Ga0207657_10203303 | 3300025919 | Bacteria | 1592 |
| 123 | Ga0207657_10287143 | 3300025919 | Bacteria | 1305 |
| 124 | Ga0207652_10263663 | 3300025921 | Bacteria | 1554 |
| 125 | Ga0207681_10012758 | 3300025923 | Bacteria | 5191 |
| 126 | Ga0207681_10109885 | 3300025923 | Bacteria | 2003 |
| 127 | Ga0207694_11578018 | 3300025924 | Bacteria | 553 |
| 128 | Ga0207650_10001502 | 3300025925 | Bacteria | 16694 |
| 129 | Ga0207659_10020969 | 3300025926 | Bacteria | 4329 |
| 130 | Ga0207659_10640832 | 3300025926 | Bacteria | 908 |
| 131 | Ga0207687_10188341 | 3300025927 | Bacteria | 1604 |
| 132 | Ga0207700_10096564 | 3300025928 | Bacteria | 2347 |
| 133 | Ga0207664_10027618 | 3300025929 | Bacteria | 4305 |
| 134 | Ga0207664_10110464 | 3300025929 | Bacteria | 2286 |
| 135 | Ga0207644_10032965 | 3300025931 | Bacteria | 3617 |
| 136 | Ga0207690_10888030 | 3300025932 | Bacteria | 739 |
| 137 | Ga0207690_11441865 | 3300025932 | Bacteria | 576 |
| 138 | Ga0207706_10001774 | 3300025933 | Bacteria | 21187 |
| 139 | Ga0207706_10153036 | 3300025933 | Bacteria | 2029 |
| 140 | Ga0207686_11842101 | 3300025934 | Bacteria | 501 |
| 141 | Ga0207709_10011282 | 3300025935 | Bacteria | 4928 |
| 142 | Ga0207709_10745085 | 3300025935 | Bacteria | 787 |
| 143 | Ga0207669_10008044 | 3300025937 | Bacteria | 4929 |
| 144 | Ga0207669_10189023 | 3300025937 | Bacteria | 1484 |
| 145 | Ga0207669_10239972 | 3300025937 | Bacteria | 1343 |
| 146 | Ga0207704_10019262 | 3300025938 | Bacteria | 3580 |
| 147 | Ga0207704_10169850 | 3300025938 | Bacteria | 1563 |
| 148 | Ga0207704_10174581 | 3300025938 | Bacteria | 1546 |
| 149 | Ga0207665_10260663 | 3300025939 | Bacteria | 1284 |
| 150 | Ga0207691_10001282 | 3300025940 | Bacteria | 25090 |
| 151 | Ga0207691_10005952 | 3300025940 | Bacteria | 11780 |
| 152 | Ga0207691_10089309 | 3300025940 | Bacteria | 2764 |
| 153 | Ga0207711_10010944 | 3300025941 | Bacteria | 7539 |
| 154 | Ga0207711_11637724 | 3300025941 | Bacteria | 587 |
| 155 | Ga0207689_10062377 | 3300025942 | Bacteria | 3065 |
| 156 | Ga0207689_10174723 | 3300025942 | Bacteria | 1771 |
| 157 | Ga0207679_10011450 | 3300025945 | Bacteria | 5748 |
| 158 | Ga0207679_10168633 | 3300025945 | Bacteria | 1800 |
| 159 | Ga0207679_10242950 | 3300025945 | Bacteria | 1527 |
| 160 | Ga0207651_10055569 | 3300025960 | Bacteria | 2720 |
| 161 | Ga0207651_10289076 | 3300025960 | Bacteria | 1358 |
| 162 | Ga0207712_10452549 | 3300025961 | Bacteria | 1089 |
| 163 | Ga0207668_10057659 | 3300025972 | Bacteria | 2710 |
| 164 | Ga0207640_10646428 | 3300025981 | Bacteria | 901 |
| 165 | Ga0207658_10017465 | 3300025986 | Bacteria | 4944 |
| 166 | Ga0207658_10203106 | 3300025986 | Bacteria | 1656 |
| 167 | Ga0207677_10040675 | 3300026023 | Bacteria | 3067 |
| 168 | Ga0207677_10541009 | 3300026023 | Bacteria | 1013 |
| 169 | Ga0207703_10050377 | 3300026035 | Bacteria | 3370 |
| 170 | Ga0207639_10306005 | 3300026041 | Bacteria | 1406 |
| 171 | Ga0207639_10991217 | 3300026041 | Bacteria | 787 |
| 172 | Ga0207641_10648449 | 3300026088 | Bacteria | 1037 |
| 173 | Ga0207641_10725985 | 3300026088 | Bacteria | 979 |
| 174 | Ga0207648_10002228 | 3300026089 | Bacteria | 20997 |
| 175 | Ga0207648_10191417 | 3300026089 | Bacteria | 1813 |
| 176 | Ga0207648_10523602 | 3300026089 | Bacteria | 1087 |
| 177 | Ga0207648_10801010 | 3300026089 | Bacteria | 877 |
| 178 | Ga0207676_10014743 | 3300026095 | Bacteria | 5630 |
| 179 | Ga0207676_11661801 | 3300026095 | Bacteria | 637 |
| 180 | Ga0207676_11675609 | 3300026095 | Bacteria | 634 |
| 181 | Ga0207675_100002928 | 3300026118 | Bacteria | 16791 |
| 182 | Ga0209371_1000055 | 3300027312 | Bacteria | 257599 |
| 183 | Ga0209984_1001688 | 3300027424 | Bacteria | 2411 |
| 184 | Ga0210000_1047213 | 3300027462 | Bacteria | 689 |
| 185 | Ga0209179_1000002 | 3300027512 | Bacteria | 124932 |
| 186 | Ga0209179_1001261 | 3300027512 | Bacteria | 3034 |
| 187 | Ga0209982_1038806 | 3300027552 | Bacteria | 758 |
| 188 | Ga0209970_1000691 | 3300027614 | Bacteria | 5860 |
| 189 | Ga0209970_1021002 | 3300027614 | Bacteria | 1105 |
| 190 | Ga0210002_1001343 | 3300027617 | Bacteria | 3441 |
| 191 | Ga0209983_1001442 | 3300027665 | Bacteria | 5283 |
| 192 | Ga0209983_1051649 | 3300027665 | Bacteria | 900 |
| 193 | Ga0209971_1000129 | 3300027682 | Bacteria | 22542 |
| 194 | Ga0209998_10000502 | 3300027717 | Bacteria | 10732 |
| 195 | Ga0209974_10002902 | 3300027876 | Bacteria | 6216 |
| 196 | Ga0209974_10024493 | 3300027876 | Bacteria | 1997 |
| 197 | Ga0207428_10062402 | 3300027907 | Bacteria | 2947 |
| 198 | Ga0268266_10061566 | 3300028379 | Bacteria | 3237 |
| 199 | Ga0268265_10010958 | 3300028380 | Bacteria | 6122 |
| 200 | Ga0268264_10133371 | 3300028381 | Bacteria | 2205 |
| 201 | Ga0268264_11318084 | 3300028381 | Bacteria | 732 |
| 202 | Ga0265334_10000007 | 3300028573 | Bacteria | 217454 |
| 203 | Ga0265323_10231957 | 3300028653 | Bacteria | 576 |
| 204 | Ga0265338_10086571 | 3300028800 | Bacteria | 2607 |
| 205 | Ga0265338_10909258 | 3300028800 | Bacteria | 599 |
| 206 | Ga0265324_10021632 | 3300029957 | Bacteria | 2305 |
| 207 | Ga0268256_1000054 | 3300030500 | Bacteria | 257599 |
| 208 | Ga0265762_1028045 | 3300030760 | Bacteria | 1059 |
| 209 | Ga0265760_10011206 | 3300031090 | Bacteria | 2563 |
| 210 | Ga0265330_10000073 | 3300031235 | Archaea | 87378 |
| 211 | Ga0265330_10122665 | 3300031235 | Archaea | 1107 |
| 212 | Ga0265332_10007289 | 3300031238 | Bacteria | 5002 |
| 213 | Ga0265332_10041853 | 3300031238 | Archaea | 1981 |
| 214 | Ga0265320_10267748 | 3300031240 | Bacteria | 757 |
| 215 | Ga0265340_10152366 | 3300031247 | Archaea | 1053 |
| 216 | Ga0265339_10083048 | 3300031249 | Unclassified | 1691 |
| 217 | Ga0265316_10008749 | 3300031344 | Bacteria | 9360 |
| 218 | Ga0265316_10011568 | 3300031344 | Archaea | 7947 |
| 219 | Ga0265316_10035918 | 3300031344 | Bacteria | 4010 |
| 220 | Ga0265316_10542015 | 3300031344 | Archaea | 829 |
| 221 | Ga0265316_10607998 | 3300031344 | Archaea | 775 |
| 222 | Ga0265316_10879067 | 3300031344 | Archaea | 627 |
| 223 | Ga0307509_10511161 | 3300031507 | Bacteria | 884 |
| 224 | Ga0307509_10803985 | 3300031507 | Bacteria | 605 |
| 225 | Ga0265313_10000113 | 3300031595 | Bacteria | 81921 |
| 226 | Ga0265313_10222042 | 3300031595 | Bacteria | 779 |
| 227 | Ga0316575_10063560 | 3300031665 | Bacteria | 1477 |
| 228 | Ga0316575_10139043 | 3300031665 | Bacteria | 999 |
| 229 | Ga0316575_10173400 | 3300031665 | Bacteria | 894 |
| 230 | Ga0316575_10336695 | 3300031665 | Bacteria | 641 |
| 231 | Ga0316579_10005865 | 3300031691 | Bacteria | 4979 |
| 232 | Ga0316579_10008512 | 3300031691 | Bacteria | 4280 |
| 233 | Ga0316579_10033499 | 3300031691 | Bacteria | 2359 |
| 234 | Ga0316579_10202242 | 3300031691 | Bacteria | 960 |
| 235 | Ga0265342_10000056 | 3300031712 | Archaea | 120731 |
| 236 | Ga0316576_10029909 | 3300031727 | Bacteria | 3853 |
| 237 | Ga0316576_10082102 | 3300031727 | Bacteria | 2392 |
| 238 | Ga0316576_10261509 | 3300031727 | Bacteria | 1298 |
| 239 | Ga0316578_10023208 | 3300031728 | Bacteria | 3470 |
| 240 | Ga0316578_10094508 | 3300031728 | Bacteria | 1788 |
| 241 | Ga0316578_10665469 | 3300031728 | Bacteria | 607 |
| 242 | Ga0307516_10026943 | 3300031730 | Bacteria | 5833 |
| 243 | Ga0307405_10582531 | 3300031731 | Bacteria | 910 |
| 244 | Ga0316577_10001489 | 3300031733 | Bacteria | 11097 |
| 245 | Ga0316577_10017794 | 3300031733 | Bacteria | 3928 |
| 246 | Ga0316577_10034105 | 3300031733 | Bacteria | 2844 |
| 247 | Ga0316577_10052630 | 3300031733 | Bacteria | 2272 |
| 248 | Ga0316577_10058605 | 3300031733 | Bacteria | 2150 |
| 249 | Ga0316577_10546988 | 3300031733 | Bacteria | 658 |
| 250 | Ga0307413_10186342 | 3300031824 | Bacteria | 1485 |
| 251 | Ga0307410_10015175 | 3300031852 | Bacteria | 4561 |
| 252 | Ga0307410_10457387 | 3300031852 | Bacteria | 1042 |
| 253 | Ga0307406_10263410 | 3300031901 | Bacteria | 1305 |
| 254 | Ga0307406_11006726 | 3300031901 | Bacteria | 715 |
| 255 | Ga0307407_10116983 | 3300031903 | Bacteria | 1683 |
| 256 | Ga0307412_10144353 | 3300031911 | Bacteria | 1747 |
| 257 | Ga0307409_100225859 | 3300031995 | Bacteria | 1693 |
| 258 | Ga0307416_100778340 | 3300032002 | Bacteria | 1051 |
| 259 | Ga0307416_103280123 | 3300032002 | Bacteria | 541 |
| 260 | Ga0307414_10046240 | 3300032004 | Bacteria | 2986 |
| 261 | Ga0307414_10057493 | 3300032004 | Bacteria | 2734 |
| 262 | Ga0307414_10973912 | 3300032004 | Bacteria | 780 |
| 263 | Ga0307411_10011081 | 3300032005 | Bacteria | 4843 |
| 264 | Ga0307411_10159906 | 3300032005 | Bacteria | 1685 |
| 265 | Ga0307415_100180168 | 3300032126 | Bacteria | 1657 |
| 266 | Ga0316583_10040516 | 3300032133 | Bacteria | 1649 |
| 267 | Ga0316585_10021463 | 3300032137 | Bacteria | 1983 |
| 268 | Ga0316585_10034476 | 3300032137 | Bacteria | 1600 |
| 269 | Ga0316585_10160774 | 3300032137 | Bacteria | 742 |
| 270 | Ga0316585_10188451 | 3300032137 | Bacteria | 681 |
| 271 | Ga0316580_10027668 | 3300032139 | Bacteria | 1752 |
| 272 | Ga0316580_10045982 | 3300032139 | Bacteria | 1346 |
| 273 | Ga0316593_10008121 | 3300032168 | Bacteria | 2914 |
| 274 | Ga0316593_10231535 | 3300032168 | Bacteria | 688 |
| 275 | Ga0316587_1014395 | 3300033529 | Bacteria | 1304 |
| 276 | Ga0373944_0213894 | 3300035089 | Bacteria | 702 |
| 277 | Ga0373951_0021974 | 3300035091 | Bacteria | 1467 |
| 278 | Ga0373954_0277020 | 3300035118 | Bacteria | 827 |
| 279 | Ga0373946_0079462 | 3300035171 | Bacteria | 1433 |
| 280 | Ga0316574_0003694 | 3300035398 | Bacteria | 7927 |
| 281 | Ga0316574_0009003 | 3300035398 | Bacteria | 5576 |
| 282 | Ga0316574_0046262 | 3300035398 | Bacteria | 2698 |
| 283 | Ga0316574_0161201 | 3300035398 | Bacteria | 1444 |
| 284 | Ga0316574_0201990 | 3300035398 | Bacteria | 1276 |
| 285 | Ga0316574_0219224 | 3300035398 | Bacteria | 1219 |
| 286 | Ga0316574_0257158 | 3300035398 | Bacteria | 1115 |
| 287 | Ga0316574_0533480 | 3300035398 | Bacteria | 730 |
| 288 | Ga0316574_0586879 | 3300035398 | Bacteria | 689 |
| 289 | Ga0316574_0590256 | 3300035398 | Bacteria | 687 |
| 290 | Ga0316574_0734660 | 3300035398 | Bacteria | 604 |
| 291 | Ga0373924_0054559 | 3300035410 | Bacteria | 1662 |
| 292 | Ga0373931_0257940 | 3300035691 | Bacteria | 1063 |
| 293 | Ga0373933_0313697 | 3300035724 | Bacteria | 1016 |
| 294 | Ga0373937_0138498 | 3300036401 | Bacteria | 2276 |
| 295 | Ga0316582_0006517 | 3300036647 | Bacteria | 6138 |
| 296 | Ga0316582_0019885 | 3300036647 | Bacteria | 3938 |
| 297 | Ga0316582_0033134 | 3300036647 | Bacteria | 3170 |
| 298 | Ga0316582_0113748 | 3300036647 | Bacteria | 1804 |
| 299 | Ga0316582_0158704 | 3300036647 | Bacteria | 1531 |
| 300 | Ga0316582_0200058 | 3300036647 | Bacteria | 1363 |
| 301 | Ga0316582_0519861 | 3300036647 | Bacteria | 820 |
| 302 | Ga0316584_0015404 | 3300036712 | Bacteria | 5468 |
| 303 | Ga0316584_0156882 | 3300036712 | Bacteria | 1692 |
| 304 | Ga0316584_0333176 | 3300036712 | Bacteria | 1092 |
| 305 | Ga0316584_0338734 | 3300036712 | Bacteria | 1081 |
| 306 | Ga0316584_0349718 | 3300036712 | Bacteria | 1061 |
| 307 | Ga0373925_0087137 | 3300037068 | Bacteria | 2383 |
| 308 | Ga0373925_1097402 | 3300037068 | Bacteria | 655 |
| 309 | Ga0395899_0043235 | 3300037312 | Bacteria | 3361 |
| 310 | Ga0395899_0959672 | 3300037312 | Bacteria | 518 |
| 311 | Ga0395900_0019454 | 3300037418 | Bacteria | 6922 |
| 312 | Ga0395900_0036109 | 3300037418 | Bacteria | 5094 |
| 313 | Ga0395900_0175846 | 3300037418 | Bacteria | 2177 |
| 314 | Ga0395898_0005586 | 3300037466 | Bacteria | 13561 |
| 315 | Ga0395905_0963302 | 3300037471 | Bacteria | 756 |
| 316 | Ga0395905_1068518 | 3300037471 | Bacteria | 710 |
| 317 | Ga0316581_0022497 | 3300037588 | Bacteria | 1859 |
| 318 | Ga0316581_0024365 | 3300037588 | Bacteria | 1794 |
| 319 | Ga0395901_0000161 | 3300038443 | Bacteria | 87191 |
| 320 | Ga0395901_0377700 | 3300038443 | Bacteria | 1459 |
| 321 | Ga0395901_0412795 | 3300038443 | Bacteria | 1386 |
| 322 | Ga0400487_26052 | 3300039110 | Bacteria | 21189 |
| 323 | Ga0436365_0656847 | 3300039437 | Bacteria | 879 |
| 324 | Ga0436365_0681911 | 3300039437 | Bacteria | 2025 |
| 325 | Ga0436360_0643048 | 3300039438 | Bacteria | 796 |
| 326 | Ga0436360_0702009 | 3300039438 | Bacteria | 14257 |
| 327 | Ga0436360_0863835 | 3300039438 | Bacteria | 622 |
| 328 | Ga0436361_0748250 | 3300039447 | Bacteria | 2328 |
| 329 | Ga0436363_1604190 | 3300039450 | Bacteria | 1516 |
| 330 | Ga0439436_0045616 | 3300041404 | Bacteria | 1247 |
| 331 | Ga0439453_0002338 | 3300041408 | Bacteria | 2602 |
| 332 | Ga0439461_0023606 | 3300041410 | Bacteria | 1238 |
| 333 | Ga0439466_0127793 | 3300041411 | Bacteria | 783 |
| 334 | Ga0451793_0119191 | 3300041452 | Bacteria | 523 |
| 335 | Ga0451797_0247884 | 3300041453 | Bacteria | 955 |
| 336 | Ga0451795_0155080 | 3300041456 | Bacteria | 809 |
| 337 | Ga0451795_0478428 | 3300041456 | Bacteria | 909 |
| 338 | Ga0451833_0621084 | 3300041491 | Bacteria | 891 |
| 339 | Ga0451833_0858295 | 3300041491 | Bacteria | 756 |
| 340 | Ga0451837_0549059 | 3300041494 | Bacteria | 899 |
| 341 | Ga0451837_1251020 | 3300041494 | Bacteria | 801 |
| 342 | Ga0451839_0570728 | 3300041496 | Bacteria | 1376 |
| 343 | Ga0451841_0586404 | 3300041498 | Bacteria | 1691 |
| 344 | Ga0451849_1042972 | 3300041505 | Bacteria | 1611 |
| 345 | Ga0451851_1238763 | 3300041507 | Bacteria | 609 |
| 346 | Ga0451843_1191470 | 3300041509 | Bacteria | 1270 |
| 347 | Ga0451855_0017499 | 3300041511 | Bacteria | 1533 |
| 348 | Ga0451853_0395963 | 3300041512 | Bacteria | 1535 |
| 349 | Ga0439431_0048804 | 3300041997 | Bacteria | 1094 |
| 350 | Ga0439441_057724 | 3300042001 | Bacteria | 811 |
| 351 | Ga0439442_010813 | 3300042002 | Bacteria | 1854 |
| 352 | Ga0439443_000122 | 3300042003 | Bacteria | 5083 |
| 353 | Ga0439432_003922 | 3300042006 | Bacteria | 5475 |
| 354 | Ga0439454_046867 | 3300042011 | Bacteria | 721 |
| 355 | Ga0439456_055462 | 3300042013 | Bacteria | 868 |
| 356 | Ga0439457_181280 | 3300042014 | Bacteria | 514 |
| 357 | Ga0439462_0012111 | 3300042015 | Bacteria | 2201 |
| 358 | Ga0450912_000483 | 3300042116 | Bacteria | 1990 |
| 359 | Ga0450915_004233 | 3300042119 | Bacteria | 843 |
| 360 | Ga0450920_003038 | 3300042122 | Bacteria | 2894 |
| 361 | Ga0450921_009560 | 3300042123 | Bacteria | 803 |
| 362 | Ga0450922_008479 | 3300042124 | Bacteria | 970 |
| 363 | Ga0450923_000037 | 3300042125 | Bacteria | 9892 |
| 364 | Ga0450923_003535 | 3300042125 | Bacteria | 2371 |
| 365 | Ga0450923_016062 | 3300042125 | Bacteria | 1406 |
| 366 | Ga0450888_020100 | 3300042126 | Bacteria | 846 |
| 367 | Ga0450897_003390 | 3300042128 | Bacteria | 1275 |
| 368 | Ga0450891_014805 | 3300042129 | Bacteria | 737 |
| 369 | Ga0450894_002188 | 3300042131 | Bacteria | 2658 |
| 370 | Ga0450896_002393 | 3300042133 | Bacteria | 2416 |
| 371 | Ga0450907_003860 | 3300042146 | Bacteria | 2623 |
| 372 | Ga0439446_0008710 | 3300042156 | Bacteria | 2702 |
| 373 | Ga0439446_0031143 | 3300042156 | Bacteria | 1543 |
| 374 | Ga0439446_0032719 | 3300042156 | Bacteria | 1509 |
| 375 | Ga0450908_006385 | 3300042184 | Bacteria | 2242 |
| 376 | Ga0439434_0004130 | 3300042435 | Bacteria | 4240 |
| 377 | Ga0439435_0000050 | 3300042436 | Bacteria | 13331 |
| 378 | Ga0439444_0010325 | 3300042437 | Bacteria | 1490 |
| 379 | Ga0439460_0001301 | 3300042461 | Bacteria | 5864 |
| 380 | Ga0439460_0283617 | 3300042461 | Bacteria | 577 |
| 381 | Ga0450918_003009 | 3300042531 | Bacteria | 3154 |
| 382 | Ga0450893_0059584 | 3300042532 | Bacteria | 727 |
| 383 | Ga0451577_0028480 | 3300042876 | Bacteria | 5052 |
| 384 | Ga0466969_0032744 | 3300044656 | Bacteria | 2642 |
| 385 | Ga0466972_0045778 | 3300044658 | Bacteria | 2119 |
| 386 | Ga0466982_0000005 | 3300044672 | Bacteria | 364340 |
| 387 | Ga0453683_0086742 | 3300044673 | Bacteria | 1961 |
| 388 | Ga0453683_0150554 | 3300044673 | Bacteria | 1470 |
| 389 | Ga0453683_1159975 | 3300044673 | Bacteria | 516 |
| 390 | Ga0466966_0013932 | 3300044684 | Bacteria | 5323 |
| 391 | Ga0466961_0114757 | 3300044693 | Bacteria | 1693 |
| 392 | Ga0466964_0006458 | 3300044706 | Bacteria | 4369 |
| 393 | Ga0453684_0008869 | 3300044712 | Bacteria | 17818 |
| 394 | Ga0453684_0019458 | 3300044712 | Bacteria | 10335 |
| 395 | Ga0453684_0048951 | 3300044712 | Archaea | 5580 |
| 396 | Ga0453684_0055336 | 3300044712 | Bacteria | 5159 |
| 397 | Ga0453684_0688373 | 3300044712 | Bacteria | 1112 |
| 398 | Ga0453684_0896542 | 3300044712 | Bacteria | 950 |
| 399 | Ga0466971_0039519 | 3300044719 | Bacteria | 2117 |
| 400 | Ga0466968_0009985 | 3300044735 | Bacteria | 3666 |
| 401 | Ga0466970_0035286 | 3300044765 | Bacteria | 2649 |
| 402 | Ga0466960_0022968 | 3300044901 | Bacteria | 2794 |
| 403 | Ga0451576_0073592 | 3300045051 | Bacteria | 3555 |
| 404 | Ga0451576_0088729 | 3300045051 | Bacteria | 3216 |
| 405 | Ga0451576_0863179 | 3300045051 | Bacteria | 950 |
| 406 | Ga0451576_0942091 | 3300045051 | Bacteria | 906 |
| 407 | Ga0495629_0562541 | 3300046459 | Bacteria | 765 |
| 408 | Ga0495629_1100086 | 3300046459 | Bacteria | 514 |
| 409 | Ga0495580_0120003 | 3300046472 | Bacteria | 1826 |
| 410 | Ga0495605_0261682 | 3300046474 | Bacteria | 738 |
| 411 | Ga0495606_0007588 | 3300046507 | Bacteria | 9657 |
| 412 | Ga0495610_0071454 | 3300046512 | Bacteria | 1618 |
| 413 | Ga0495616_0451314 | 3300046513 | Bacteria | 521 |
| 414 | Ga0495628_0567753 | 3300046516 | Bacteria | 813 |
| 415 | Ga0495631_0529368 | 3300046518 | Bacteria | 502 |
| 416 | Ga0495632_0070130 | 3300046519 | Bacteria | 1686 |
| 417 | Ga0495632_0086898 | 3300046519 | Bacteria | 1487 |
| 418 | Ga0495663_0200465 | 3300046525 | Bacteria | 696 |
| 419 | Ga0495640_0598782 | 3300046533 | Bacteria | 666 |
| 420 | Ga0495598_0016212 | 3300046537 | Bacteria | 1897 |
| 421 | Ga0495621_0009256 | 3300046539 | Bacteria | 2986 |
| 422 | Ga0495633_0073065 | 3300046558 | Bacteria | 1599 |
| 423 | Ga0495656_0122175 | 3300046615 | Bacteria | 1230 |
| 424 | Ga0495656_0674888 | 3300046615 | Bacteria | 555 |
| 425 | Ga0495659_0508449 | 3300046664 | Bacteria | 528 |
| 426 | Ga0495658_0767993 | 3300046683 | Bacteria | 617 |
| 427 | Ga0495649_0183867 | 3300046694 | Bacteria | 1090 |
| 428 | Ga0495660_0244694 | 3300046810 | Bacteria | 835 |
| 429 | Ga0495636_0047655 | 3300047318 | Bacteria | 1789 |
| 430 | Ga0495636_0391878 | 3300047318 | Bacteria | 660 |
| 431 | Ga0495685_071561 | 3300047447 | Bacteria | 1161 |
| 432 | Ga0495681_0061985 | 3300047470 | Bacteria | 1721 |
| 433 | Ga0495686_0002349 | 3300047472 | Bacteria | 18053 |
| 434 | Ga0495602_0941295 | 3300048088 | Bacteria | 573 |
| 435 | Ga0496100_0559713 | 3300048903 | Bacteria | 885 |
| 436 | Ga0496101_0151071 | 3300048904 | Bacteria | 1776 |
| 437 | Ga0496101_0303429 | 3300048904 | Bacteria | 1251 |
| 438 | Ga0496104_0003488 | 3300048907 | Bacteria | 13566 |
| 439 | Ga0496104_0004860 | 3300048907 | Bacteria | 11708 |
| 440 | Ga0496105_0002578 | 3300048908 | Bacteria | 13176 |
| 441 | Ga0496105_0004476 | 3300048908 | Bacteria | 10520 |
| 442 | Ga0496106_1472656 | 3300048909 | Bacteria | 524 |
| 443 | Ga0496107_0050755 | 3300048910 | Bacteria | 2991 |
| 444 | Ga0496107_0209697 | 3300048910 | Bacteria | 1449 |
| 445 | Ga0496108_0008954 | 3300048911 | Bacteria | 8110 |
| 446 | Ga0496108_0045283 | 3300048911 | Bacteria | 3675 |
| 447 | Ga0496109_0012655 | 3300048912 | Bacteria | 7288 |
| 448 | Ga0496109_0309782 | 3300048912 | Bacteria | 1489 |
| 449 | Ga0496109_1144552 | 3300048912 | Bacteria | 715 |
| 450 | Ga0496110_0081072 | 3300048913 | Bacteria | 2892 |
| 451 | Ga0496111_0002702 | 3300048914 | Bacteria | 10773 |
| 452 | Ga0496111_0260524 | 3300048914 | Bacteria | 1287 |
| 453 | Ga0496113_0860891 | 3300048916 | Bacteria | 718 |
| 454 | Ga0496114_0000823 | 3300048917 | Bacteria | 23290 |
| 455 | Ga0496114_0083260 | 3300048917 | Bacteria | 2706 |
| 456 | Ga0496114_0178701 | 3300048917 | Bacteria | 1852 |
| 457 | Ga0496115_0002092 | 3300048918 | Bacteria | 14291 |
| 458 | Ga0496117_0020667 | 3300048920 | Bacteria | 5358 |
| 459 | Ga0496118_0000271 | 3300048921 | Bacteria | 91025 |
| 460 | Ga0496118_0028666 | 3300048921 | Bacteria | 4683 |
| 461 | Ga0496118_0106945 | 3300048921 | Bacteria | 1869 |
| 462 | Ga0496119_0001083 | 3300048922 | Bacteria | 34389 |
| 463 | Ga0496120_0000537 | 3300048923 | Bacteria | 58209 |
| 464 | Ga0496122_0000859 | 3300048925 | Bacteria | 57207 |
| 465 | Ga0496122_0023840 | 3300048925 | Bacteria | 5375 |
| 466 | Ga0496123_0000417 | 3300048926 | Bacteria | 77334 |
| 467 | Ga0496123_0023536 | 3300048926 | Bacteria | 4712 |
| 468 | Ga0496124_0000653 | 3300048927 | Bacteria | 57229 |
| 469 | Ga0496125_0056897 | 3300048928 | Bacteria | 3172 |
| 470 | Ga0496126_0032297 | 3300048929 | Bacteria | 4933 |
| 471 | Ga0496126_0065023 | 3300048929 | Bacteria | 3265 |
| 472 | Ga0501031_0042920 | 3300049568 | Bacteria | 2952 |
| 473 | Ga0501031_0121689 | 3300049568 | Bacteria | 1705 |
| 474 | Ga0501031_0434042 | 3300049568 | Bacteria | 849 |
| 475 | Ga0501031_0620371 | 3300049568 | Bacteria | 695 |
| 476 | Ga0501032_0064237 | 3300049569 | Bacteria | 2457 |
| 477 | Ga0501032_0074655 | 3300049569 | Bacteria | 2259 |
| 478 | Ga0501032_0134902 | 3300049569 | Bacteria | 1627 |
| 479 | Ga0501032_0325077 | 3300049569 | Bacteria | 992 |
| 480 | Ga0501032_0408169 | 3300049569 | Bacteria | 872 |
| 481 | Ga0501033_0051782 | 3300049570 | Bacteria | 3043 |
| 482 | Ga0501033_0058188 | 3300049570 | Bacteria | 2856 |
| 483 | Ga0501033_0062713 | 3300049570 | Bacteria | 2737 |
| 484 | Ga0501033_0397867 | 3300049570 | Bacteria | 961 |
| 485 | Ga0501033_0412495 | 3300049570 | Bacteria | 941 |
| 486 | Ga0501033_0890394 | 3300049570 | Bacteria | 598 |
| 487 | Ga0501033_1017502 | 3300049570 | Bacteria | 553 |
| 488 | Ga0501034_0267815 | 3300049571 | Bacteria | 1650 |
| 489 | Ga0501034_1378498 | 3300049571 | Bacteria | 580 |
| 490 | Ga0501034_1687466 | 3300049571 | Bacteria | 506 |
| 491 | Ga0501036_0008597 | 3300049572 | Bacteria | 8375 |
| 492 | Ga0501036_0071911 | 3300049572 | Bacteria | 2924 |
| 493 | Ga0501036_0079609 | 3300049572 | Bacteria | 2771 |
| 494 | Ga0501036_0383168 | 3300049572 | Bacteria | 1173 |
| 495 | Ga0501036_1171042 | 3300049572 | Bacteria | 627 |
| 496 | Ga0501036_1672112 | 3300049572 | Bacteria | 513 |
| 497 | Ga0501037_0014426 | 3300049573 | Bacteria | 5817 |
| 498 | Ga0501037_0134054 | 3300049573 | Bacteria | 1774 |
| 499 | Ga0501037_0454785 | 3300049573 | Bacteria | 873 |
| 500 | Ga0501037_0646240 | 3300049573 | Bacteria | 707 |
| 501 | Ga0501038_0041855 | 3300049574 | Bacteria | 3993 |
| 502 | Ga0501038_0083088 | 3300049574 | Bacteria | 2696 |
| 503 | Ga0501038_0150833 | 3300049574 | Bacteria | 1895 |
| 504 | Ga0501038_0334058 | 3300049574 | Bacteria | 1183 |
| 505 | Ga0501038_0403418 | 3300049574 | Bacteria | 1057 |
| 506 | Ga0501038_0405661 | 3300049574 | Bacteria | 1054 |
| 507 | Ga0501038_0447253 | 3300049574 | Bacteria | 994 |
| 508 | Ga0501039_0002195 | 3300049575 | Bacteria | 14437 |
| 509 | Ga0501039_0040894 | 3300049575 | Bacteria | 3579 |
| 510 | Ga0501039_0840749 | 3300049575 | Bacteria | 715 |
| 511 | Ga0501039_0945204 | 3300049575 | Bacteria | 670 |
| 512 | Ga0501039_1542544 | 3300049575 | Bacteria | 510 |
| 513 | Ga0501040_0001530 | 3300049576 | Bacteria | 14701 |
| 514 | Ga0501040_0062883 | 3300049576 | Bacteria | 2553 |
| 515 | Ga0501040_0191374 | 3300049576 | Bacteria | 1452 |
| 516 | Ga0501040_0200992 | 3300049576 | Bacteria | 1415 |
| 517 | Ga0501040_0951840 | 3300049576 | Bacteria | 622 |
| 518 | Ga0501041_0008134 | 3300049577 | Bacteria | 6172 |
| 519 | Ga0501041_0047303 | 3300049577 | Bacteria | 2618 |
| 520 | Ga0501041_0112128 | 3300049577 | Bacteria | 1692 |
| 521 | Ga0501041_0748290 | 3300049577 | Bacteria | 626 |
| 522 | Ga0501042_0007427 | 3300049578 | Bacteria | 7178 |
| 523 | Ga0501042_0035687 | 3300049578 | Bacteria | 3527 |
| 524 | Ga0501042_0071439 | 3300049578 | Bacteria | 2483 |
| 525 | Ga0501042_0378854 | 3300049578 | Bacteria | 1024 |
| 526 | Ga0501042_0461455 | 3300049578 | Bacteria | 921 |
| 527 | Ga0501043_0016518 | 3300049579 | Bacteria | 5786 |
| 528 | Ga0501043_0057717 | 3300049579 | Bacteria | 3047 |
| 529 | Ga0501043_0229445 | 3300049579 | Bacteria | 1434 |
| 530 | Ga0501043_1137418 | 3300049579 | Bacteria | 550 |
| 531 | Ga0501046_0010394 | 3300049580 | Bacteria | 7995 |
| 532 | Ga0501046_0046492 | 3300049580 | Bacteria | 3444 |
| 533 | Ga0501046_0142142 | 3300049580 | Bacteria | 1815 |
| 534 | Ga0501046_0544064 | 3300049580 | Bacteria | 828 |
| 535 | Ga0501046_0551989 | 3300049580 | Bacteria | 821 |
| 536 | Ga0501046_0557359 | 3300049580 | Bacteria | 816 |
| 537 | Ga0501047_0007616 | 3300049581 | Bacteria | 10191 |
| 538 | Ga0501047_0045804 | 3300049581 | Bacteria | 4228 |
| 539 | Ga0501047_0139382 | 3300049581 | Bacteria | 2304 |
| 540 | Ga0501047_0142335 | 3300049581 | Bacteria | 2276 |
| 541 | Ga0501047_0578630 | 3300049581 | Bacteria | 946 |
| 542 | Ga0501048_0003654 | 3300049582 | Bacteria | 11717 |
| 543 | Ga0501048_0086117 | 3300049582 | Bacteria | 2216 |
| 544 | Ga0501048_0186917 | 3300049582 | Bacteria | 1468 |
| 545 | Ga0501048_0415319 | 3300049582 | Bacteria | 962 |
| 546 | Ga0501048_1165455 | 3300049582 | Bacteria | 554 |
| 547 | Ga0501067_0012580 | 3300049583 | Bacteria | 4696 |
| 548 | Ga0501068_0088193 | 3300049584 | Bacteria | 1911 |
| 549 | Ga0501068_0150276 | 3300049584 | Bacteria | 1463 |
| 550 | Ga0501068_1117708 | 3300049584 | Bacteria | 521 |
| 551 | Ga0501068_1129910 | 3300049584 | Bacteria | 518 |
| 552 | Ga0501069_0147284 | 3300049585 | Bacteria | 1352 |
| 553 | Ga0501070_0352624 | 3300049586 | Bacteria | 1194 |
| 554 | Ga0501071_0004781 | 3300049587 | Bacteria | 8624 |
| 555 | Ga0501071_0026788 | 3300049587 | Bacteria | 4049 |
| 556 | Ga0501071_0098306 | 3300049587 | Bacteria | 2156 |
| 557 | Ga0501071_0688194 | 3300049587 | Bacteria | 787 |
| 558 | Ga0501071_0760793 | 3300049587 | Bacteria | 746 |
| 559 | Ga0501072_0003373 | 3300049588 | Bacteria | 12011 |
| 560 | Ga0501072_0100967 | 3300049588 | Bacteria | 2293 |
| 561 | Ga0501072_0105174 | 3300049588 | Bacteria | 2244 |
| 562 | Ga0501072_0127772 | 3300049588 | Bacteria | 2025 |
| 563 | Ga0501072_0507927 | 3300049588 | Bacteria | 953 |
| 564 | Ga0501072_1577159 | 3300049588 | Bacteria | 506 |
| 565 | Ga0501073_0038408 | 3300049589 | Bacteria | 3395 |
| 566 | Ga0501073_0073043 | 3300049589 | Bacteria | 2389 |
| 567 | Ga0501073_0081560 | 3300049589 | Bacteria | 2250 |
| 568 | Ga0501073_0201553 | 3300049589 | Bacteria | 1376 |
| 569 | Ga0501074_0078001 | 3300049590 | Bacteria | 2377 |
| 570 | Ga0501074_0233105 | 3300049590 | Bacteria | 1310 |
| 571 | Ga0501075_0002426 | 3300049591 | Bacteria | 12405 |
| 572 | Ga0501075_0008688 | 3300049591 | Bacteria | 7084 |
| 573 | Ga0501075_0014336 | 3300049591 | Bacteria | 5679 |
| 574 | Ga0501075_0032700 | 3300049591 | Bacteria | 3866 |
| 575 | Ga0501075_1077063 | 3300049591 | Bacteria | 610 |
| 576 | Ga0501076_0000414 | 3300049592 | Bacteria | 26787 |
| 577 | Ga0501076_0007397 | 3300049592 | Bacteria | 7991 |
| 578 | Ga0501076_0038865 | 3300049592 | Bacteria | 3735 |
| 579 | Ga0501076_0175353 | 3300049592 | Bacteria | 1747 |
| 580 | Ga0501076_0202166 | 3300049592 | Bacteria | 1622 |
| 581 | Ga0501076_0212989 | 3300049592 | Bacteria | 1579 |
| 582 | Ga0501077_0002757 | 3300049593 | Bacteria | 10533 |
| 583 | Ga0501077_0027388 | 3300049593 | Bacteria | 3619 |
| 584 | Ga0501077_0094211 | 3300049593 | Bacteria | 1898 |
| 585 | Ga0501077_0293029 | 3300049593 | Bacteria | 1036 |
| 586 | Ga0501202_206281 | 3300049652 | Bacteria | 540 |
| 587 | Ga0501217_199869 | 3300049661 | Bacteria | 622 |
| 588 | Ga0501223_065141 | 3300049663 | Bacteria | 715 |
| 589 | Ga0501243_061746 | 3300049675 | Bacteria | 696 |
| 590 | Ga0501255_082883 | 3300049684 | Bacteria | 541 |
| 591 | Ga0501259_004053 | 3300049688 | Bacteria | 2330 |
| 592 | Ga0501079_0007321 | 3300049741 | Bacteria | 8340 |
| 593 | Ga0501079_0024369 | 3300049741 | Bacteria | 4642 |
| 594 | Ga0501079_0058033 | 3300049741 | Bacteria | 2986 |
| 595 | Ga0501079_0090122 | 3300049741 | Bacteria | 2375 |
| 596 | Ga0501079_0111562 | 3300049741 | Bacteria | 2125 |
| 597 | Ga0501079_0367960 | 3300049741 | Bacteria | 1127 |
| 598 | Ga0501079_1045983 | 3300049741 | Bacteria | 643 |
| 599 | Ga0501079_1172824 | 3300049741 | Bacteria | 605 |
| 600 | Ga0501080_0002336 | 3300049742 | Bacteria | 16547 |
| 601 | Ga0501080_0005323 | 3300049742 | Bacteria | 11467 |
| 602 | Ga0501080_0083865 | 3300049742 | Bacteria | 2961 |
| 603 | Ga0501080_0230187 | 3300049742 | Bacteria | 1694 |
| 604 | Ga0501080_0320490 | 3300049742 | Bacteria | 1403 |
| 605 | Ga0501080_1152737 | 3300049742 | Bacteria | 668 |
| 606 | Ga0501081_0001798 | 3300049743 | Bacteria | 13296 |
| 607 | Ga0501081_0062221 | 3300049743 | Bacteria | 2588 |
| 608 | Ga0501081_0095912 | 3300049743 | Bacteria | 2091 |
| 609 | Ga0501081_0146423 | 3300049743 | Bacteria | 1695 |
| 610 | Ga0501081_0279912 | 3300049743 | Bacteria | 1221 |
| 611 | Ga0501081_0347687 | 3300049743 | Bacteria | 1092 |
| 612 | Ga0501081_1230152 | 3300049743 | Bacteria | 567 |
| 613 | Ga0501083_0054056 | 3300049744 | Bacteria | 2695 |
| 614 | Ga0501083_0071345 | 3300049744 | Bacteria | 2309 |
| 615 | Ga0501083_0087061 | 3300049744 | Bacteria | 2066 |
| 616 | Ga0501083_0670963 | 3300049744 | Bacteria | 674 |
| 617 | Ga0501266_004938 | 3300049763 | Bacteria | 1661 |
| 618 | Ga0501270_005551 | 3300049767 | Bacteria | 1471 |
| 619 | Ga0501035_0009530 | 3300049822 | Bacteria | 9031 |
| 620 | Ga0501035_0061135 | 3300049822 | Bacteria | 3353 |
| 621 | Ga0501035_0126661 | 3300049822 | Bacteria | 2229 |
| 622 | Ga0501035_0195086 | 3300049822 | Bacteria | 1739 |
| 623 | Ga0501035_0399518 | 3300049822 | Bacteria | 1144 |
| 624 | Ga0501035_0557432 | 3300049822 | Bacteria | 938 |
| 625 | Ga0501035_0848889 | 3300049822 | Bacteria | 726 |
| 626 | Ga0501035_0964142 | 3300049822 | Bacteria | 672 |
| 627 | Ga0501044_0092646 | 3300049823 | Bacteria | 3047 |
| 628 | Ga0501044_0321657 | 3300049823 | Bacteria | 1471 |
| 629 | Ga0501044_0342895 | 3300049823 | Bacteria | 1415 |
| 630 | Ga0501044_0351838 | 3300049823 | Bacteria | 1392 |
| 631 | Ga0501044_0490286 | 3300049823 | Bacteria | 1131 |
| 632 | Ga0501044_0635391 | 3300049823 | Bacteria | 958 |
| 633 | Ga0501044_0745126 | 3300049823 | Bacteria | 862 |
| 634 | Ga0501045_0000556 | 3300049824 | Bacteria | 23439 |
| 635 | Ga0501045_0017885 | 3300049824 | Bacteria | 5034 |
| 636 | Ga0501045_0210001 | 3300049824 | Bacteria | 1450 |
| 637 | Ga0501045_1382265 | 3300049824 | Bacteria | 511 |
| 638 | Ga0501212_068128 | 3300049851 | Bacteria | 626 |
| 639 | nmdc:mga05p37_297991_c1 | 3300050507 | Bacteria | 1917 |
| 640 | nmdc:mga0qj67_475138_c1 | 3300050509 | Bacteria | 1006 |
| 641 | nmdc:mga0qj67_47881_c1 | 3300050509 | Bacteria | 3378 |
| 642 | nmdc:mga08y16_59781_c1 | 3300050511 | Bacteria | 3981 |
| 643 | nmdc:mga0n895_60522_c1 | 3300050512 | Bacteria | 3737 |
| 644 | nmdc:mga0rr50_1842_c1 | 3300050513 | Bacteria | 11736 |
| 645 | nmdc:mga08x19_1092_c1 | 3300050514 | Bacteria | 16911 |
| 646 | nmdc:mga08x19_3101_c1 | 3300050514 | Bacteria | 9989 |
| 647 | nmdc:mga0a205_237_c1 | 3300050515 | Bacteria | 38953 |
| 648 | Ga0495619_0654708 | 3300053085 | Bacteria | 716 |
| 649 | Ga0500644_0250730 | 3300053088 | Bacteria | 746 |
| 650 | Ga0500646_0079921 | 3300053090 | Bacteria | 996 |
| 651 | Ga0500583_0055241 | 3300053092 | Bacteria | 1856 |
| 652 | Ga0500562_136194 | 3300053108 | Bacteria | 669 |
| 653 | Ga0500658_0307728 | 3300053134 | Bacteria | 728 |
| 654 | Ga0500604_0232804 | 3300053151 | Bacteria | 636 |
| 655 | Ga0500622_0002211 | 3300053156 | Bacteria | 14349 |
| 656 | Ga0500627_0415652 | 3300053158 | Bacteria | 571 |
| 657 | Ga0500611_005184 | 3300053727 | Bacteria | 1817 |
| 658 | Ga0501084_0014697 | 3300054114 | Bacteria | 6492 |
| 659 | Ga0501084_0021152 | 3300054114 | Bacteria | 5425 |
| 660 | Ga0501084_0075727 | 3300054114 | Bacteria | 2819 |
| 661 | Ga0501084_0599812 | 3300054114 | Bacteria | 930 |
| 662 | Ga0501084_0900349 | 3300054114 | Bacteria | 744 |
| 663 | Ga0501082_0002635 | 3300060353 | Bacteria | 15686 |
| 664 | Ga0501082_0074001 | 3300060353 | Bacteria | 2933 |
| 665 | Ga0501082_0098358 | 3300060353 | Bacteria | 2530 |
| 666 | Ga0501082_0175118 | 3300060353 | Bacteria | 1865 |
| 667 | Ga0501082_0209944 | 3300060353 | Bacteria | 1694 |
| 668 | Ga0501082_0221080 | 3300060353 | Bacteria | 1648 |
| 669 | Ga0501082_1701166 | 3300060353 | Bacteria | 550 |
| 670 | Ga0466962_0000490 | 3300061719 | Bacteria | 17174 |
| 671 | Ga0530510_0001474 | 3300061734 | Bacteria | 15795 |
| 672 | Ga0530510_0061730 | 3300061734 | Bacteria | 2713 |
| 673 | Ga0530510_0070499 | 3300061734 | Bacteria | 2537 |
| 674 | Ga0530510_1262518 | 3300061734 | Bacteria | 566 |
| 675 | Ga0530510_1302092 | 3300061734 | Bacteria | 557 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005844 | Ga0068862_100442183 | Ga0068862_1004421832 | 87 |
| 2 | 3300013308 | Ga0157375_10007013 | Ga0157375_100070132 | 87 |
| 3 | 3300048909 | Ga0496106_1472656 | Ga0496106_1472656_230_511 | 87 |
| 4 | 3300049588 | Ga0501072_1577159 | Ga0501072_1577159_26_307 | 88 |
| 5 | 3300006358 | Ga0068871_100237851 | Ga0068871_1002378512 | 89 |
| 6 | 3300053088 | Ga0500644_0250730 | Ga0500644_0250730_131_439 | 89 |
| 7 | 3300053090 | Ga0500646_0079921 | Ga0500646_0079921_315_623 | 89 |
| 8 | 3300053156 | Ga0500622_0002211 | Ga0500622_0002211_8605_8913 | 89 |
| 9 | 3300039438 | Ga0436360_0702009 | Ga0436360_0702009_1037_1348 | 91 |
| 10 | 3300039447 | Ga0436361_0748250 | Ga0436361_0748250_1094_1405 | 91 |
| 11 | iso_pu_bacteria | 2547132512 | 2548848639 | 91 |
| 12 | iso_pu_bacteria | 2524614729 | 2525556188 | 92 |
| 13 | iso_pu_bacteria | 2627854209 | 2630649418 | 92 |
| 14 | iso_pu_bacteria | 2739367700 | 2739732178 | 92 |
| 15 | 3300028653 | Ga0265323_10231957 | Ga0265323_102319572 | 93 |
| 16 | 3300031344 | Ga0265316_10008749 | Ga0265316_1000874911 | 93 |
| 17 | 3300035091 | Ga0373951_0021974 | Ga0373951_0021974_871_1152 | 93 |
| 18 | 3300041453 | Ga0451797_0247884 | Ga0451797_0247884_243_524 | 93 |
| 19 | 3300044673 | Ga0453683_0086742 | Ga0453683_0086742_223_504 | 93 |
| 20 | 3300044712 | Ga0453684_0019458 | Ga0453684_0019458_9693_9974 | 93 |
| 21 | 3300044712 | Ga0453684_0055336 | Ga0453684_0055336_4196_4477 | 93 |
| 22 | 3300049823 | Ga0501044_0342895 | Ga0501044_0342895_586_867 | 93 |
| 23 | iso_pu_bacteria | 2537561836 | 2538834829 | 93 |
| 24 | iso_pu_bacteria | 2643221562 | 2643829481 | 93 |
| 25 | iso_pu_bacteria | 2643221577 | 2643893750 | 93 |
| 26 | iso_pu_bacteria | 2643221685 | 2644475975 | 93 |
| 27 | iso_pu_bacteria | 2687453130 | 2687584087 | 93 |
| 28 | iso_pu_bacteria | 2884411467 | 2884413682 | 93 |
| 29 | iso_pu_bacteria | 2928963466 | 2928964865 | 93 |
| 30 | iso_pu_bacteria | 2939611941 | 2939612789 | 93 |
| 31 | iso_pu_bacteria | 8057160832 | 8057160929 | 93 |
| 32 | 3300005618 | Ga0068864_101349831 | Ga0068864_1013498312 | 94 |
| 33 | 3300005840 | Ga0068870_11247610 | Ga0068870_112476101 | 94 |
| 34 | 3300005841 | Ga0068863_100750246 | Ga0068863_1007502462 | 94 |
| 35 | 3300009092 | Ga0105250_10000010 | Ga0105250_10000010133 | 94 |
| 36 | 3300009093 | Ga0105240_10022420 | Ga0105240_100224202 | 94 |
| 37 | 3300010375 | Ga0105239_10101110 | Ga0105239_101011103 | 94 |
| 38 | 3300011119 | Ga0105246_10656841 | Ga0105246_106568412 | 94 |
| 39 | 3300014968 | Ga0157379_10000022 | Ga0157379_1000002236 | 94 |
| 40 | 3300025903 | Ga0207680_10224420 | Ga0207680_102244202 | 94 |
| 41 | 3300025907 | Ga0207645_10091903 | Ga0207645_100919031 | 94 |
| 42 | 3300025926 | Ga0207659_10640832 | Ga0207659_106408322 | 94 |
| 43 | 3300025933 | Ga0207706_10153036 | Ga0207706_101530362 | 94 |
| 44 | 3300025945 | Ga0207679_10011450 | Ga0207679_100114505 | 94 |
| 45 | 3300025981 | Ga0207640_10646428 | Ga0207640_106464281 | 94 |
| 46 | 3300026023 | Ga0207677_10541009 | Ga0207677_105410092 | 94 |
| 47 | 3300026041 | Ga0207639_10991217 | Ga0207639_109912171 | 94 |
| 48 | 3300026088 | Ga0207641_10648449 | Ga0207641_106484492 | 94 |
| 49 | 3300026095 | Ga0207676_11675609 | Ga0207676_116756092 | 94 |
| 50 | 3300029957 | Ga0265324_10021632 | Ga0265324_100216322 | 94 |
| 51 | 3300031238 | Ga0265332_10007289 | Ga0265332_100072895 | 94 |
| 52 | 3300031344 | Ga0265316_10035918 | Ga0265316_100359182 | 94 |
| 53 | 3300031595 | Ga0265313_10222042 | Ga0265313_102220422 | 94 |
| 54 | 3300037068 | Ga0373925_0087137 | Ga0373925_0087137_492_776 | 94 |
| 55 | 3300044712 | Ga0453684_0688373 | Ga0453684_0688373_757_1041 | 94 |
| 56 | 3300045051 | Ga0451576_0073592 | Ga0451576_0073592_3078_3362 | 94 |
| 57 | iso_pu_bacteria | 2524614857 | 2526061043 | 94 |
| 58 | iso_pu_bacteria | 2739367875 | 2740062507 | 94 |
| 59 | 3300005445 | Ga0070708_102124676 | Ga0070708_1021246761 | 95 |
| 60 | 3300005546 | Ga0070696_100457810 | Ga0070696_1004578102 | 95 |
| 61 | 3300007788 | Ga0099795_10000028 | Ga0099795_100000286 | 95 |
| 62 | 3300010159 | Ga0099796_10000091 | Ga0099796_1000009111 | 95 |
| 63 | 3300027512 | Ga0209179_1000002 | Ga0209179_10000026 | 95 |
| 64 | 3300041452 | Ga0451793_0119191 | Ga0451793_0119191_183_479 | 95 |
| 65 | 3300041456 | Ga0451795_0155080 | Ga0451795_0155080_429_725 | 95 |
| 66 | 3300041491 | Ga0451833_0621084 | Ga0451833_0621084_146_442 | 95 |
| 67 | 3300041494 | Ga0451837_0549059 | Ga0451837_0549059_364_660 | 95 |
| 68 | 3300041496 | Ga0451839_0570728 | Ga0451839_0570728_279_575 | 95 |
| 69 | 3300041498 | Ga0451841_0586404 | Ga0451841_0586404_32_328 | 95 |
| 70 | 3300041505 | Ga0451849_1042972 | Ga0451849_1042972_991_1287 | 95 |
| 71 | 3300041509 | Ga0451843_1191470 | Ga0451843_1191470_509_805 | 95 |
| 72 | 3300041511 | Ga0451855_0017499 | Ga0451855_0017499_1030_1326 | 95 |
| 73 | 3300041512 | Ga0451853_0395963 | Ga0451853_0395963_332_628 | 95 |
| 74 | 3300042876 | Ga0451577_0028480 | Ga0451577_0028480_650_937 | 95 |
| 75 | 3300044712 | Ga0453684_0896542 | Ga0453684_0896542_458_751 | 95 |
| 76 | 3300045051 | Ga0451576_0088729 | Ga0451576_0088729_2761_3054 | 95 |
| 77 | 3300045051 | Ga0451576_0863179 | Ga0451576_0863179_43_330 | 95 |
| 78 | 3300046459 | Ga0495629_0562541 | Ga0495629_0562541_170_460 | 95 |
| 79 | 3300046664 | Ga0495659_0508449 | Ga0495659_0508449_199_492 | 95 |
| 80 | 3300046683 | Ga0495658_0767993 | Ga0495658_0767993_54_344 | 95 |
| 81 | 3300047472 | Ga0495686_0002349 | Ga0495686_0002349_11856_12143 | 95 |
| 82 | 3300048921 | Ga0496118_0000271 | Ga0496118_0000271_79405_79692 | 95 |
| 83 | 3300049568 | Ga0501031_0121689 | Ga0501031_0121689_132_425 | 95 |
| 84 | 3300049568 | Ga0501031_0620371 | Ga0501031_0620371_264_557 | 95 |
| 85 | 3300049569 | Ga0501032_0134902 | Ga0501032_0134902_987_1280 | 95 |
| 86 | 3300049570 | Ga0501033_0058188 | Ga0501033_0058188_1151_1444 | 95 |
| 87 | 3300049570 | Ga0501033_0062713 | Ga0501033_0062713_1012_1305 | 95 |
| 88 | 3300049570 | Ga0501033_0412495 | Ga0501033_0412495_133_426 | 95 |
| 89 | 3300049572 | Ga0501036_0008597 | Ga0501036_0008597_6965_7258 | 95 |
| 90 | 3300049572 | Ga0501036_0383168 | Ga0501036_0383168_449_742 | 95 |
| 91 | 3300049573 | Ga0501037_0014426 | Ga0501037_0014426_4281_4574 | 95 |
| 92 | 3300049574 | Ga0501038_0041855 | Ga0501038_0041855_2820_3113 | 95 |
| 93 | 3300049574 | Ga0501038_0334058 | Ga0501038_0334058_45_338 | 95 |
| 94 | 3300049575 | Ga0501039_0002195 | Ga0501039_0002195_13594_13887 | 95 |
| 95 | 3300049575 | Ga0501039_0040894 | Ga0501039_0040894_2679_2972 | 95 |
| 96 | 3300049576 | Ga0501040_0001530 | Ga0501040_0001530_4362_4655 | 95 |
| 97 | 3300049576 | Ga0501040_0062883 | Ga0501040_0062883_2089_2382 | 95 |
| 98 | 3300049576 | Ga0501040_0951840 | Ga0501040_0951840_187_480 | 95 |
| 99 | 3300049577 | Ga0501041_0008134 | Ga0501041_0008134_1166_1459 | 95 |
| 100 | 3300049577 | Ga0501041_0112128 | Ga0501041_0112128_61_354 | 95 |
| 101 | 3300049578 | Ga0501042_0007427 | Ga0501042_0007427_2518_2811 | 95 |
| 102 | 3300049578 | Ga0501042_0461455 | Ga0501042_0461455_513_806 | 95 |
| 103 | 3300049579 | Ga0501043_0229445 | Ga0501043_0229445_234_527 | 95 |
| 104 | 3300049579 | Ga0501043_1137418 | Ga0501043_1137418_99_392 | 95 |
| 105 | 3300049580 | Ga0501046_0142142 | Ga0501046_0142142_960_1253 | 95 |
| 106 | 3300049580 | Ga0501046_0551989 | Ga0501046_0551989_441_734 | 95 |
| 107 | 3300049581 | Ga0501047_0578630 | Ga0501047_0578630_335_628 | 95 |
| 108 | 3300049582 | Ga0501048_0003654 | Ga0501048_0003654_10343_10636 | 95 |
| 109 | 3300049582 | Ga0501048_0186917 | Ga0501048_0186917_52_345 | 95 |
| 110 | 3300049582 | Ga0501048_1165455 | Ga0501048_1165455_217_510 | 95 |
| 111 | 3300049584 | Ga0501068_0150276 | Ga0501068_0150276_78_371 | 95 |
| 112 | 3300049584 | Ga0501068_1117708 | Ga0501068_1117708_213_506 | 95 |
| 113 | 3300049585 | Ga0501069_0147284 | Ga0501069_0147284_138_431 | 95 |
| 114 | 3300049587 | Ga0501071_0004781 | Ga0501071_0004781_5809_6102 | 95 |
| 115 | 3300049587 | Ga0501071_0026788 | Ga0501071_0026788_724_1017 | 95 |
| 116 | 3300049587 | Ga0501071_0760793 | Ga0501071_0760793_434_727 | 95 |
| 117 | 3300049588 | Ga0501072_0003373 | Ga0501072_0003373_9317_9610 | 95 |
| 118 | 3300049588 | Ga0501072_0100967 | Ga0501072_0100967_1155_1448 | 95 |
| 119 | 3300049589 | Ga0501073_0073043 | Ga0501073_0073043_146_439 | 95 |
| 120 | 3300049590 | Ga0501074_0233105 | Ga0501074_0233105_169_462 | 95 |
| 121 | 3300049591 | Ga0501075_0002426 | Ga0501075_0002426_5089_5382 | 95 |
| 122 | 3300049591 | Ga0501075_0014336 | Ga0501075_0014336_5109_5402 | 95 |
| 123 | 3300049592 | Ga0501076_0000414 | Ga0501076_0000414_5610_5903 | 95 |
| 124 | 3300049592 | Ga0501076_0038865 | Ga0501076_0038865_1195_1488 | 95 |
| 125 | 3300049592 | Ga0501076_0202166 | Ga0501076_0202166_1135_1428 | 95 |
| 126 | 3300049592 | Ga0501076_0212989 | Ga0501076_0212989_385_678 | 95 |
| 127 | 3300049593 | Ga0501077_0002757 | Ga0501077_0002757_5455_5748 | 95 |
| 128 | 3300049593 | Ga0501077_0293029 | Ga0501077_0293029_175_468 | 95 |
| 129 | 3300049652 | Ga0501202_206281 | Ga0501202_206281_32_319 | 95 |
| 130 | 3300049675 | Ga0501243_061746 | Ga0501243_061746_231_518 | 95 |
| 131 | 3300049688 | Ga0501259_004053 | Ga0501259_004053_1824_2111 | 95 |
| 132 | 3300049741 | Ga0501079_0007321 | Ga0501079_0007321_3467_3760 | 95 |
| 133 | 3300049741 | Ga0501079_0058033 | Ga0501079_0058033_2364_2657 | 95 |
| 134 | 3300049742 | Ga0501080_0002336 | Ga0501080_0002336_7879_8172 | 95 |
| 135 | 3300049742 | Ga0501080_0230187 | Ga0501080_0230187_112_405 | 95 |
| 136 | 3300049742 | Ga0501080_1152737 | Ga0501080_1152737_225_518 | 95 |
| 137 | 3300049743 | Ga0501081_0001798 | Ga0501081_0001798_5264_5557 | 95 |
| 138 | 3300049743 | Ga0501081_0146423 | Ga0501081_0146423_1116_1409 | 95 |
| 139 | 3300049743 | Ga0501081_0279912 | Ga0501081_0279912_121_414 | 95 |
| 140 | 3300049744 | Ga0501083_0054056 | Ga0501083_0054056_1144_1437 | 95 |
| 141 | 3300049744 | Ga0501083_0670963 | Ga0501083_0670963_202_495 | 95 |
| 142 | 3300049767 | Ga0501270_005551 | Ga0501270_005551_1050_1337 | 95 |
| 143 | 3300049822 | Ga0501035_0009530 | Ga0501035_0009530_2333_2626 | 95 |
| 144 | 3300049822 | Ga0501035_0061135 | Ga0501035_0061135_2655_2948 | 95 |
| 145 | 3300049822 | Ga0501035_0126661 | Ga0501035_0126661_1718_2005 | 95 |
| 146 | 3300049822 | Ga0501035_0964142 | Ga0501035_0964142_369_662 | 95 |
| 147 | 3300049823 | Ga0501044_0490286 | Ga0501044_0490286_575_868 | 95 |
| 148 | 3300049824 | Ga0501045_0000556 | Ga0501045_0000556_10022_10315 | 95 |
| 149 | 3300049824 | Ga0501045_1382265 | Ga0501045_1382265_168_461 | 95 |
| 150 | 3300049851 | Ga0501212_068128 | Ga0501212_068128_19_306 | 95 |
| 151 | 3300054114 | Ga0501084_0075727 | Ga0501084_0075727_1490_1783 | 95 |
| 152 | 3300054114 | Ga0501084_0599812 | Ga0501084_0599812_250_543 | 95 |
| 153 | 3300054114 | Ga0501084_0900349 | Ga0501084_0900349_47_340 | 95 |
| 154 | 3300060353 | Ga0501082_0002635 | Ga0501082_0002635_5169_5462 | 95 |
| 155 | 3300060353 | Ga0501082_0098358 | Ga0501082_0098358_781_1074 | 95 |
| 156 | 3300060353 | Ga0501082_0209944 | Ga0501082_0209944_655_948 | 95 |
| 157 | 3300061734 | Ga0530510_0001474 | Ga0530510_0001474_5214_5507 | 95 |
| 158 | 3300061734 | Ga0530510_0070499 | Ga0530510_0070499_2110_2403 | 95 |
| 159 | iso_pu_bacteria | 2571042365 | 2572254518 | 95 |
| 160 | iso_pu_bacteria | 2747842501 | 2748018881 | 95 |
| 161 | iso_pu_bacteria | 2818991457 | 2819662732 | 95 |
| 162 | iso_pu_bacteria | 2842780639 | 2842781700 | 95 |
| 163 | iso_pu_bacteria | 2852684882 | 2852687529 | 95 |
| 164 | iso_pu_bacteria | 2895395659 | 2895396611 | 95 |
| 165 | iso_pu_bacteria | 2919130084 | 2919134289 | 95 |
| 166 | iso_pu_bacteria | 2929195423 | 2929198967 | 95 |
| 167 | iso_pu_bacteria | 2987605356 | 2987607997 | 95 |
| 168 | iso_pu_bacteria | 8021622325 | 8021625163 | 95 |
| 169 | iso_pu_bacteria | 8021626552 | 8021627183 | 95 |
| 170 | iso_pu_bacteria | 8021648035 | 8021648538 | 95 |
| 171 | 3300005435 | Ga0070714_100328036 | Ga0070714_1003280362 | 96 |
| 172 | 3300005436 | Ga0070713_100455731 | Ga0070713_1004557312 | 96 |
| 173 | 3300005458 | Ga0070681_11997704 | Ga0070681_119977041 | 96 |
| 174 | 3300005563 | Ga0068855_101654046 | Ga0068855_1016540462 | 96 |
| 175 | 3300005840 | Ga0068870_10033093 | Ga0068870_100330932 | 96 |
| 176 | 3300005841 | Ga0068863_100791074 | Ga0068863_1007910742 | 96 |
| 177 | 3300009093 | Ga0105240_10284018 | Ga0105240_102840182 | 96 |
| 178 | 3300009148 | Ga0105243_12411677 | Ga0105243_124116772 | 96 |
| 179 | 3300009174 | Ga0105241_10859476 | Ga0105241_108594762 | 96 |
| 180 | 3300009174 | Ga0105241_12112590 | Ga0105241_121125902 | 96 |
| 181 | 3300009551 | Ga0105238_12959097 | Ga0105238_129590971 | 96 |
| 182 | 3300014326 | Ga0157380_10137030 | Ga0157380_101370303 | 96 |
| 183 | 3300017792 | Ga0163161_11066445 | Ga0163161_110664452 | 96 |
| 184 | 3300025900 | Ga0207710_10030850 | Ga0207710_100308502 | 96 |
| 185 | 3300025903 | Ga0207680_10050019 | Ga0207680_100500193 | 96 |
| 186 | 3300025908 | Ga0207643_10075223 | Ga0207643_100752232 | 96 |
| 187 | 3300025911 | Ga0207654_11373341 | Ga0207654_113733411 | 96 |
| 188 | 3300025913 | Ga0207695_10269854 | Ga0207695_102698542 | 96 |
| 189 | 3300025917 | Ga0207660_10890768 | Ga0207660_108907681 | 96 |
| 190 | 3300025921 | Ga0207652_10263663 | Ga0207652_102636632 | 96 |
| 191 | 3300025924 | Ga0207694_11578018 | Ga0207694_115780182 | 96 |
| 192 | 3300025927 | Ga0207687_10188341 | Ga0207687_101883412 | 96 |
| 193 | 3300025929 | Ga0207664_10110464 | Ga0207664_101104642 | 96 |
| 194 | 3300025931 | Ga0207644_10032965 | Ga0207644_100329652 | 96 |
| 195 | 3300025934 | Ga0207686_11842101 | Ga0207686_118421011 | 96 |
| 196 | 3300025935 | Ga0207709_10745085 | Ga0207709_107450852 | 96 |
| 197 | 3300025938 | Ga0207704_10169850 | Ga0207704_101698502 | 96 |
| 198 | 3300025941 | Ga0207711_10010944 | Ga0207711_100109448 | 96 |
| 199 | 3300025942 | Ga0207689_10062377 | Ga0207689_100623772 | 96 |
| 200 | 3300025960 | Ga0207651_10055569 | Ga0207651_100555692 | 96 |
| 201 | 3300025986 | Ga0207658_10017465 | Ga0207658_100174652 | 96 |
| 202 | 3300026023 | Ga0207677_10040675 | Ga0207677_100406754 | 96 |
| 203 | 3300026035 | Ga0207703_10050377 | Ga0207703_100503772 | 96 |
| 204 | 3300026088 | Ga0207641_10725985 | Ga0207641_107259852 | 96 |
| 205 | 3300026089 | Ga0207648_10801010 | Ga0207648_108010102 | 96 |
| 206 | 3300026095 | Ga0207676_10014743 | Ga0207676_100147436 | 96 |
| 207 | 3300028379 | Ga0268266_10061566 | Ga0268266_100615662 | 96 |
| 208 | 3300028381 | Ga0268264_10133371 | Ga0268264_101333713 | 96 |
| 209 | 3300028573 | Ga0265334_10000007 | Ga0265334_10000007128 | 96 |
| 210 | 3300028800 | Ga0265338_10909258 | Ga0265338_109092582 | 96 |
| 211 | 3300030760 | Ga0265762_1028045 | Ga0265762_10280452 | 96 |
| 212 | 3300031090 | Ga0265760_10011206 | Ga0265760_100112061 | 96 |
| 213 | 3300031240 | Ga0265320_10267748 | Ga0265320_102677482 | 96 |
| 214 | 3300031595 | Ga0265313_10000113 | Ga0265313_1000011389 | 96 |
| 215 | 3300031665 | Ga0316575_10063560 | Ga0316575_100635602 | 96 |
| 216 | 3300031665 | Ga0316575_10139043 | Ga0316575_101390431 | 96 |
| 217 | 3300031691 | Ga0316579_10202242 | Ga0316579_102022422 | 96 |
| 218 | 3300031727 | Ga0316576_10261509 | Ga0316576_102615092 | 96 |
| 219 | 3300031728 | Ga0316578_10094508 | Ga0316578_100945083 | 96 |
| 220 | 3300031733 | Ga0316577_10001489 | Ga0316577_100014897 | 96 |
| 221 | 3300032137 | Ga0316585_10034476 | Ga0316585_100344762 | 96 |
| 222 | 3300032137 | Ga0316585_10188451 | Ga0316585_101884512 | 96 |
| 223 | 3300032139 | Ga0316580_10045982 | Ga0316580_100459822 | 96 |
| 224 | 3300032168 | Ga0316593_10231535 | Ga0316593_102315352 | 96 |
| 225 | 3300035118 | Ga0373954_0277020 | Ga0373954_0277020_335_628 | 96 |
| 226 | 3300035398 | Ga0316574_0003694 | Ga0316574_0003694_5739_6029 | 96 |
| 227 | 3300035398 | Ga0316574_0046262 | Ga0316574_0046262_1568_1858 | 96 |
| 228 | 3300035398 | Ga0316574_0219224 | Ga0316574_0219224_642_932 | 96 |
| 229 | 3300035398 | Ga0316574_0257158 | Ga0316574_0257158_53_343 | 96 |
| 230 | 3300035398 | Ga0316574_0586879 | Ga0316574_0586879_351_641 | 96 |
| 231 | 3300035398 | Ga0316574_0590256 | Ga0316574_0590256_330_620 | 96 |
| 232 | 3300035398 | Ga0316574_0734660 | Ga0316574_0734660_87_377 | 96 |
| 233 | 3300035691 | Ga0373931_0257940 | Ga0373931_0257940_380_676 | 96 |
| 234 | 3300036647 | Ga0316582_0113748 | Ga0316582_0113748_1341_1631 | 96 |
| 235 | 3300036647 | Ga0316582_0158704 | Ga0316582_0158704_999_1289 | 96 |
| 236 | 3300036647 | Ga0316582_0519861 | Ga0316582_0519861_463_753 | 96 |
| 237 | 3300036712 | Ga0316584_0015404 | Ga0316584_0015404_3578_3868 | 96 |
| 238 | 3300036712 | Ga0316584_0156882 | Ga0316584_0156882_1143_1433 | 96 |
| 239 | 3300039437 | Ga0436365_0656847 | Ga0436365_0656847_531_821 | 96 |
| 240 | 3300044673 | Ga0453683_1159975 | Ga0453683_1159975_168_461 | 96 |
| 241 | 3300048903 | Ga0496100_0559713 | Ga0496100_0559713_126_428 | 96 |
| 242 | 3300048907 | Ga0496104_0004860 | Ga0496104_0004860_6690_6992 | 96 |
| 243 | 3300048908 | Ga0496105_0002578 | Ga0496105_0002578_6097_6399 | 96 |
| 244 | 3300048910 | Ga0496107_0209697 | Ga0496107_0209697_870_1172 | 96 |
| 245 | 3300048911 | Ga0496108_0008954 | Ga0496108_0008954_3154_3456 | 96 |
| 246 | 3300048912 | Ga0496109_0012655 | Ga0496109_0012655_6142_6444 | 96 |
| 247 | 3300048913 | Ga0496110_0081072 | Ga0496110_0081072_1171_1473 | 96 |
| 248 | 3300048914 | Ga0496111_0002702 | Ga0496111_0002702_8633_8935 | 96 |
| 249 | 3300048916 | Ga0496113_0860891 | Ga0496113_0860891_298_600 | 96 |
| 250 | 3300048917 | Ga0496114_0083260 | Ga0496114_0083260_1056_1358 | 96 |
| 251 | 3300049571 | Ga0501034_1687466 | Ga0501034_1687466_76_366 | 96 |
| 252 | 3300049684 | Ga0501255_082883 | Ga0501255_082883_76_381 | 96 |
| 253 | 3300005288 | Ga0065714_10433482 | Ga0065714_104334822 | 97 |
| 254 | 3300005289 | Ga0065704_10508426 | Ga0065704_105084262 | 97 |
| 255 | 3300005290 | Ga0065712_10037529 | Ga0065712_100375292 | 97 |
| 256 | 3300005290 | Ga0065712_10270178 | Ga0065712_102701782 | 97 |
| 257 | 3300005293 | Ga0065715_10228295 | Ga0065715_102282952 | 97 |
| 258 | 3300005293 | Ga0065715_10463170 | Ga0065715_104631702 | 97 |
| 259 | 3300005334 | Ga0068869_100125916 | Ga0068869_1001259162 | 97 |
| 260 | 3300005354 | Ga0070675_101883526 | Ga0070675_1018835262 | 97 |
| 261 | 3300005364 | Ga0070673_100013760 | Ga0070673_1000137602 | 97 |
| 262 | 3300005437 | Ga0070710_10722778 | Ga0070710_107227782 | 97 |
| 263 | 3300005438 | Ga0070701_10462021 | Ga0070701_104620211 | 97 |
| 264 | 3300005440 | Ga0070705_101320259 | Ga0070705_1013202592 | 97 |
| 265 | 3300005459 | Ga0068867_101630007 | Ga0068867_1016300072 | 97 |
| 266 | 3300005535 | Ga0070684_101340236 | Ga0070684_1013402362 | 97 |
| 267 | 3300005543 | Ga0070672_100412610 | Ga0070672_1004126102 | 97 |
| 268 | 3300005545 | Ga0070695_100126647 | Ga0070695_1001266472 | 97 |
| 269 | 3300005546 | Ga0070696_100006453 | Ga0070696_1000064532 | 97 |
| 270 | 3300005546 | Ga0070696_100365609 | Ga0070696_1003656092 | 97 |
| 271 | 3300005549 | Ga0070704_100082361 | Ga0070704_1000823611 | 97 |
| 272 | 3300005577 | Ga0068857_101113759 | Ga0068857_1011137592 | 97 |
| 273 | 3300005617 | Ga0068859_100606518 | Ga0068859_1006065182 | 97 |
| 274 | 3300005719 | Ga0068861_100959644 | Ga0068861_1009596442 | 97 |
| 275 | 3300005840 | Ga0068870_10221291 | Ga0068870_102212912 | 97 |
| 276 | 3300005843 | Ga0068860_101369562 | Ga0068860_1013695622 | 97 |
| 277 | 3300005844 | Ga0068862_100717912 | Ga0068862_1007179122 | 97 |
| 278 | 3300006173 | Ga0070716_100045012 | Ga0070716_1000450122 | 97 |
| 279 | 3300006881 | Ga0068865_100376550 | Ga0068865_1003765502 | 97 |
| 280 | 3300006931 | Ga0097620_100606513 | Ga0097620_1006065132 | 97 |
| 281 | 3300007265 | Ga0099794_10062491 | Ga0099794_100624912 | 97 |
| 282 | 3300007788 | Ga0099795_10000378 | Ga0099795_100003784 | 97 |
| 283 | 3300009551 | Ga0105238_10966112 | Ga0105238_109661121 | 97 |
| 284 | 3300009984 | Ga0105029_113209 | Ga0105029_1132092 | 97 |
| 285 | 3300009987 | Ga0105030_100289 | Ga0105030_1002892 | 97 |
| 286 | 3300010159 | Ga0099796_10000149 | Ga0099796_100001496 | 97 |
| 287 | 3300013104 | Ga0157370_10302845 | Ga0157370_103028453 | 97 |
| 288 | 3300013874 | Ga0157514_105533 | Ga0157514_1055332 | 97 |
| 289 | 3300014326 | Ga0157380_10075546 | Ga0157380_100755463 | 97 |
| 290 | 3300014745 | Ga0157377_11321378 | Ga0157377_113213782 | 97 |
| 291 | 3300014968 | Ga0157379_11794745 | Ga0157379_117947452 | 97 |
| 292 | 3300015685 | Ga0183369_1007 | Ga0183369_100792 | 97 |
| 293 | 3300017792 | Ga0163161_11791891 | Ga0163161_117918912 | 97 |
| 294 | 3300021377 | Ga0213874_10031626 | Ga0213874_100316262 | 97 |
| 295 | 3300025711 | Ga0207696_1000159 | Ga0207696_100015989 | 97 |
| 296 | 3300025893 | Ga0207682_10081496 | Ga0207682_100814962 | 97 |
| 297 | 3300025905 | Ga0207685_10156458 | Ga0207685_101564582 | 97 |
| 298 | 3300025907 | Ga0207645_10005481 | Ga0207645_100054817 | 97 |
| 299 | 3300025908 | Ga0207643_10150735 | Ga0207643_101507352 | 97 |
| 300 | 3300025909 | Ga0207705_10638438 | Ga0207705_106384382 | 97 |
| 301 | 3300025916 | Ga0207663_10052499 | Ga0207663_100524992 | 97 |
| 302 | 3300025917 | Ga0207660_10331192 | Ga0207660_103311922 | 97 |
| 303 | 3300025919 | Ga0207657_10203303 | Ga0207657_102033032 | 97 |
| 304 | 3300025923 | Ga0207681_10109885 | Ga0207681_101098852 | 97 |
| 305 | 3300025926 | Ga0207659_10020969 | Ga0207659_100209694 | 97 |
| 306 | 3300025928 | Ga0207700_10096564 | Ga0207700_100965641 | 97 |
| 307 | 3300025929 | Ga0207664_10027618 | Ga0207664_100276185 | 97 |
| 308 | 3300025932 | Ga0207690_11441865 | Ga0207690_114418652 | 97 |
| 309 | 3300025933 | Ga0207706_10001774 | Ga0207706_1000177414 | 97 |
| 310 | 3300025937 | Ga0207669_10008044 | Ga0207669_100080445 | 97 |
| 311 | 3300025937 | Ga0207669_10239972 | Ga0207669_102399722 | 97 |
| 312 | 3300025938 | Ga0207704_10019262 | Ga0207704_100192622 | 97 |
| 313 | 3300025938 | Ga0207704_10174581 | Ga0207704_101745812 | 97 |
| 314 | 3300025939 | Ga0207665_10260663 | Ga0207665_102606632 | 97 |
| 315 | 3300025940 | Ga0207691_10001282 | Ga0207691_1000128219 | 97 |
| 316 | 3300025940 | Ga0207691_10089309 | Ga0207691_100893094 | 97 |
| 317 | 3300025942 | Ga0207689_10174723 | Ga0207689_101747233 | 97 |
| 318 | 3300025960 | Ga0207651_10289076 | Ga0207651_102890762 | 97 |
| 319 | 3300025961 | Ga0207712_10452549 | Ga0207712_104525492 | 97 |
| 320 | 3300025972 | Ga0207668_10057659 | Ga0207668_100576593 | 97 |
| 321 | 3300026041 | Ga0207639_10306005 | Ga0207639_103060051 | 97 |
| 322 | 3300026089 | Ga0207648_10002228 | Ga0207648_100022283 | 97 |
| 323 | 3300026089 | Ga0207648_10523602 | Ga0207648_105236022 | 97 |
| 324 | 3300026095 | Ga0207676_11661801 | Ga0207676_116618011 | 97 |
| 325 | 3300026118 | Ga0207675_100002928 | Ga0207675_10000292812 | 97 |
| 326 | 3300027424 | Ga0209984_1001688 | Ga0209984_10016882 | 97 |
| 327 | 3300027462 | Ga0210000_1047213 | Ga0210000_10472132 | 97 |
| 328 | 3300027512 | Ga0209179_1001261 | Ga0209179_10012612 | 97 |
| 329 | 3300027552 | Ga0209982_1038806 | Ga0209982_10388062 | 97 |
| 330 | 3300027614 | Ga0209970_1000691 | Ga0209970_10006917 | 97 |
| 331 | 3300027614 | Ga0209970_1021002 | Ga0209970_10210022 | 97 |
| 332 | 3300027617 | Ga0210002_1001343 | Ga0210002_10013432 | 97 |
| 333 | 3300027665 | Ga0209983_1001442 | Ga0209983_10014422 | 97 |
| 334 | 3300027665 | Ga0209983_1051649 | Ga0209983_10516493 | 97 |
| 335 | 3300027682 | Ga0209971_1000129 | Ga0209971_10001298 | 97 |
| 336 | 3300027717 | Ga0209998_10000502 | Ga0209998_1000050210 | 97 |
| 337 | 3300027876 | Ga0209974_10002902 | Ga0209974_100029026 | 97 |
| 338 | 3300027876 | Ga0209974_10024493 | Ga0209974_100244932 | 97 |
| 339 | 3300027907 | Ga0207428_10062402 | Ga0207428_100624022 | 97 |
| 340 | 3300028380 | Ga0268265_10010958 | Ga0268265_100109584 | 97 |
| 341 | 3300028381 | Ga0268264_11318084 | Ga0268264_113180842 | 97 |
| 342 | 3300031507 | Ga0307509_10803985 | Ga0307509_108039852 | 97 |
| 343 | 3300031730 | Ga0307516_10026943 | Ga0307516_100269432 | 97 |
| 344 | 3300031824 | Ga0307413_10186342 | Ga0307413_101863422 | 97 |
| 345 | 3300031852 | Ga0307410_10015175 | Ga0307410_100151755 | 97 |
| 346 | 3300031901 | Ga0307406_10263410 | Ga0307406_102634101 | 97 |
| 347 | 3300031995 | Ga0307409_100225859 | Ga0307409_1002258592 | 97 |
| 348 | 3300032002 | Ga0307416_103280123 | Ga0307416_1032801232 | 97 |
| 349 | 3300032004 | Ga0307414_10046240 | Ga0307414_100462401 | 97 |
| 350 | 3300032005 | Ga0307411_10011081 | Ga0307411_100110815 | 97 |
| 351 | 3300035089 | Ga0373944_0213894 | Ga0373944_0213894_386_682 | 97 |
| 352 | 3300035171 | Ga0373946_0079462 | Ga0373946_0079462_245_541 | 97 |
| 353 | 3300035410 | Ga0373924_0054559 | Ga0373924_0054559_142_438 | 97 |
| 354 | 3300035724 | Ga0373933_0313697 | Ga0373933_0313697_142_438 | 97 |
| 355 | 3300036401 | Ga0373937_0138498 | Ga0373937_0138498_738_1034 | 97 |
| 356 | 3300037068 | Ga0373925_1097402 | Ga0373925_1097402_59_355 | 97 |
| 357 | 3300039110 | Ga0400487_26052 | Ga0400487_26052_12633_12926 | 97 |
| 358 | 3300039437 | Ga0436365_0681911 | Ga0436365_0681911_882_1184 | 97 |
| 359 | 3300039438 | Ga0436360_0643048 | Ga0436360_0643048_130_432 | 97 |
| 360 | 3300039438 | Ga0436360_0863835 | Ga0436360_0863835_267_569 | 97 |
| 361 | 3300039450 | Ga0436363_1604190 | Ga0436363_1604190_621_923 | 97 |
| 362 | 3300041408 | Ga0439453_0002338 | Ga0439453_0002338_1522_1821 | 97 |
| 363 | 3300041410 | Ga0439461_0023606 | Ga0439461_0023606_608_907 | 97 |
| 364 | 3300041507 | Ga0451851_1238763 | Ga0451851_1238763_93_386 | 97 |
| 365 | 3300041997 | Ga0439431_0048804 | Ga0439431_0048804_309_608 | 97 |
| 366 | 3300042001 | Ga0439441_057724 | Ga0439441_057724_134_433 | 97 |
| 367 | 3300042002 | Ga0439442_010813 | Ga0439442_010813_980_1279 | 97 |
| 368 | 3300042003 | Ga0439443_000122 | Ga0439443_000122_1851_2150 | 97 |
| 369 | 3300042011 | Ga0439454_046867 | Ga0439454_046867_91_390 | 97 |
| 370 | 3300042013 | Ga0439456_055462 | Ga0439456_055462_217_516 | 97 |
| 371 | 3300042014 | Ga0439457_181280 | Ga0439457_181280_60_359 | 97 |
| 372 | 3300042116 | Ga0450912_000483 | Ga0450912_000483_852_1151 | 97 |
| 373 | 3300042119 | Ga0450915_004233 | Ga0450915_004233_462_761 | 97 |
| 374 | 3300042122 | Ga0450920_003038 | Ga0450920_003038_57_356 | 97 |
| 375 | 3300042123 | Ga0450921_009560 | Ga0450921_009560_146_451 | 97 |
| 376 | 3300042124 | Ga0450922_008479 | Ga0450922_008479_608_907 | 97 |
| 377 | 3300042125 | Ga0450923_000037 | Ga0450923_000037_7927_8229 | 97 |
| 378 | 3300042125 | Ga0450923_003535 | Ga0450923_003535_969_1268 | 97 |
| 379 | 3300042125 | Ga0450923_016062 | Ga0450923_016062_879_1184 | 97 |
| 380 | 3300042126 | Ga0450888_020100 | Ga0450888_020100_464_766 | 97 |
| 381 | 3300042128 | Ga0450897_003390 | Ga0450897_003390_213_512 | 97 |
| 382 | 3300042129 | Ga0450891_014805 | Ga0450891_014805_339_641 | 97 |
| 383 | 3300042131 | Ga0450894_002188 | Ga0450894_002188_1685_1984 | 97 |
| 384 | 3300042133 | Ga0450896_002393 | Ga0450896_002393_1780_2085 | 97 |
| 385 | 3300042146 | Ga0450907_003860 | Ga0450907_003860_1639_1938 | 97 |
| 386 | 3300042156 | Ga0439446_0008710 | Ga0439446_0008710_2141_2440 | 97 |
| 387 | 3300042156 | Ga0439446_0031143 | Ga0439446_0031143_29_328 | 97 |
| 388 | 3300042156 | Ga0439446_0032719 | Ga0439446_0032719_857_1159 | 97 |
| 389 | 3300042184 | Ga0450908_006385 | Ga0450908_006385_690_989 | 97 |
| 390 | 3300042435 | Ga0439434_0004130 | Ga0439434_0004130_1821_2120 | 97 |
| 391 | 3300042436 | Ga0439435_0000050 | Ga0439435_0000050_8473_8772 | 97 |
| 392 | 3300042437 | Ga0439444_0010325 | Ga0439444_0010325_535_834 | 97 |
| 393 | 3300042461 | Ga0439460_0001301 | Ga0439460_0001301_3166_3465 | 97 |
| 394 | 3300042461 | Ga0439460_0283617 | Ga0439460_0283617_138_440 | 97 |
| 395 | 3300042531 | Ga0450918_003009 | Ga0450918_003009_2664_2963 | 97 |
| 396 | 3300042532 | Ga0450893_0059584 | Ga0450893_0059584_340_639 | 97 |
| 397 | 3300046459 | Ga0495629_1100086 | Ga0495629_1100086_14_310 | 97 |
| 398 | 3300046472 | Ga0495580_0120003 | Ga0495580_0120003_447_743 | 97 |
| 399 | 3300046516 | Ga0495628_0567753 | Ga0495628_0567753_408_704 | 97 |
| 400 | 3300046519 | Ga0495632_0070130 | Ga0495632_0070130_90_398 | 97 |
| 401 | 3300046525 | Ga0495663_0200465 | Ga0495663_0200465_240_545 | 97 |
| 402 | 3300046533 | Ga0495640_0598782 | Ga0495640_0598782_203_499 | 97 |
| 403 | 3300048088 | Ga0495602_0941295 | Ga0495602_0941295_217_513 | 97 |
| 404 | 3300048904 | Ga0496101_0151071 | Ga0496101_0151071_988_1284 | 97 |
| 405 | 3300048907 | Ga0496104_0003488 | Ga0496104_0003488_3103_3399 | 97 |
| 406 | 3300048908 | Ga0496105_0004476 | Ga0496105_0004476_7553_7849 | 97 |
| 407 | 3300048910 | Ga0496107_0050755 | Ga0496107_0050755_412_708 | 97 |
| 408 | 3300048914 | Ga0496111_0260524 | Ga0496111_0260524_26_322 | 97 |
| 409 | 3300048917 | Ga0496114_0000823 | Ga0496114_0000823_3173_3469 | 97 |
| 410 | 3300048918 | Ga0496115_0002092 | Ga0496115_0002092_8506_8802 | 97 |
| 411 | 3300049568 | Ga0501031_0042920 | Ga0501031_0042920_1023_1322 | 97 |
| 412 | 3300049569 | Ga0501032_0064237 | Ga0501032_0064237_1276_1584 | 97 |
| 413 | 3300049569 | Ga0501032_0074655 | Ga0501032_0074655_477_776 | 97 |
| 414 | 3300049569 | Ga0501032_0408169 | Ga0501032_0408169_554_853 | 97 |
| 415 | 3300049570 | Ga0501033_0397867 | Ga0501033_0397867_152_445 | 97 |
| 416 | 3300049570 | Ga0501033_0890394 | Ga0501033_0890394_89_388 | 97 |
| 417 | 3300049570 | Ga0501033_1017502 | Ga0501033_1017502_141_440 | 97 |
| 418 | 3300049571 | Ga0501034_0267815 | Ga0501034_0267815_809_1117 | 97 |
| 419 | 3300049571 | Ga0501034_1378498 | Ga0501034_1378498_53_352 | 97 |
| 420 | 3300049572 | Ga0501036_0071911 | Ga0501036_0071911_984_1283 | 97 |
| 421 | 3300049572 | Ga0501036_1672112 | Ga0501036_1672112_127_426 | 97 |
| 422 | 3300049573 | Ga0501037_0134054 | Ga0501037_0134054_1146_1445 | 97 |
| 423 | 3300049573 | Ga0501037_0454785 | Ga0501037_0454785_170_478 | 97 |
| 424 | 3300049573 | Ga0501037_0646240 | Ga0501037_0646240_375_674 | 97 |
| 425 | 3300049574 | Ga0501038_0083088 | Ga0501038_0083088_1843_2142 | 97 |
| 426 | 3300049574 | Ga0501038_0403418 | Ga0501038_0403418_259_558 | 97 |
| 427 | 3300049574 | Ga0501038_0405661 | Ga0501038_0405661_150_449 | 97 |
| 428 | 3300049574 | Ga0501038_0447253 | Ga0501038_0447253_258_566 | 97 |
| 429 | 3300049575 | Ga0501039_0840749 | Ga0501039_0840749_71_370 | 97 |
| 430 | 3300049575 | Ga0501039_0945204 | Ga0501039_0945204_102_401 | 97 |
| 431 | 3300049575 | Ga0501039_1542544 | Ga0501039_1542544_84_386 | 97 |
| 432 | 3300049576 | Ga0501040_0191374 | Ga0501040_0191374_1015_1317 | 97 |
| 433 | 3300049576 | Ga0501040_0200992 | Ga0501040_0200992_785_1084 | 97 |
| 434 | 3300049577 | Ga0501041_0047303 | Ga0501041_0047303_1863_2165 | 97 |
| 435 | 3300049577 | Ga0501041_0748290 | Ga0501041_0748290_58_357 | 97 |
| 436 | 3300049578 | Ga0501042_0035687 | Ga0501042_0035687_171_473 | 97 |
| 437 | 3300049578 | Ga0501042_0071439 | Ga0501042_0071439_1789_2088 | 97 |
| 438 | 3300049578 | Ga0501042_0378854 | Ga0501042_0378854_340_639 | 97 |
| 439 | 3300049579 | Ga0501043_0016518 | Ga0501043_0016518_4697_5005 | 97 |
| 440 | 3300049580 | Ga0501046_0010394 | Ga0501046_0010394_266_574 | 97 |
| 441 | 3300049580 | Ga0501046_0046492 | Ga0501046_0046492_1462_1761 | 97 |
| 442 | 3300049580 | Ga0501046_0544064 | Ga0501046_0544064_113_421 | 97 |
| 443 | 3300049580 | Ga0501046_0557359 | Ga0501046_0557359_308_610 | 97 |
| 444 | 3300049581 | Ga0501047_0139382 | Ga0501047_0139382_1918_2217 | 97 |
| 445 | 3300049581 | Ga0501047_0142335 | Ga0501047_0142335_1849_2157 | 97 |
| 446 | 3300049582 | Ga0501048_0086117 | Ga0501048_0086117_1170_1469 | 97 |
| 447 | 3300049582 | Ga0501048_0415319 | Ga0501048_0415319_374_676 | 97 |
| 448 | 3300049583 | Ga0501067_0012580 | Ga0501067_0012580_1736_2035 | 97 |
| 449 | 3300049584 | Ga0501068_0088193 | Ga0501068_0088193_1415_1714 | 97 |
| 450 | 3300049584 | Ga0501068_1129910 | Ga0501068_1129910_18_320 | 97 |
| 451 | 3300049587 | Ga0501071_0098306 | Ga0501071_0098306_1229_1528 | 97 |
| 452 | 3300049588 | Ga0501072_0105174 | Ga0501072_0105174_156_458 | 97 |
| 453 | 3300049588 | Ga0501072_0127772 | Ga0501072_0127772_941_1240 | 97 |
| 454 | 3300049588 | Ga0501072_0507927 | Ga0501072_0507927_592_891 | 97 |
| 455 | 3300049589 | Ga0501073_0038408 | Ga0501073_0038408_503_802 | 97 |
| 456 | 3300049589 | Ga0501073_0081560 | Ga0501073_0081560_1705_2004 | 97 |
| 457 | 3300049589 | Ga0501073_0201553 | Ga0501073_0201553_144_446 | 97 |
| 458 | 3300049590 | Ga0501074_0078001 | Ga0501074_0078001_265_564 | 97 |
| 459 | 3300049591 | Ga0501075_0008688 | Ga0501075_0008688_98_400 | 97 |
| 460 | 3300049591 | Ga0501075_0032700 | Ga0501075_0032700_1799_2098 | 97 |
| 461 | 3300049591 | Ga0501075_1077063 | Ga0501075_1077063_201_503 | 97 |
| 462 | 3300049592 | Ga0501076_0007397 | Ga0501076_0007397_1641_1943 | 97 |
| 463 | 3300049592 | Ga0501076_0175353 | Ga0501076_0175353_234_533 | 97 |
| 464 | 3300049593 | Ga0501077_0027388 | Ga0501077_0027388_2819_3118 | 97 |
| 465 | 3300049593 | Ga0501077_0094211 | Ga0501077_0094211_1581_1883 | 97 |
| 466 | 3300049741 | Ga0501079_0024369 | Ga0501079_0024369_2059_2358 | 97 |
| 467 | 3300049741 | Ga0501079_0090122 | Ga0501079_0090122_408_710 | 97 |
| 468 | 3300049741 | Ga0501079_0111562 | Ga0501079_0111562_261_560 | 97 |
| 469 | 3300049741 | Ga0501079_0367960 | Ga0501079_0367960_38_340 | 97 |
| 470 | 3300049741 | Ga0501079_1045983 | Ga0501079_1045983_198_497 | 97 |
| 471 | 3300049741 | Ga0501079_1172824 | Ga0501079_1172824_200_499 | 97 |
| 472 | 3300049742 | Ga0501080_0005323 | Ga0501080_0005323_3700_3999 | 97 |
| 473 | 3300049742 | Ga0501080_0083865 | Ga0501080_0083865_1706_2005 | 97 |
| 474 | 3300049742 | Ga0501080_0320490 | Ga0501080_0320490_1083_1382 | 97 |
| 475 | 3300049743 | Ga0501081_0062221 | Ga0501081_0062221_1761_2063 | 97 |
| 476 | 3300049743 | Ga0501081_0095912 | Ga0501081_0095912_619_918 | 97 |
| 477 | 3300049743 | Ga0501081_0347687 | Ga0501081_0347687_621_920 | 97 |
| 478 | 3300049743 | Ga0501081_1230152 | Ga0501081_1230152_38_340 | 97 |
| 479 | 3300049744 | Ga0501083_0071345 | Ga0501083_0071345_978_1280 | 97 |
| 480 | 3300049744 | Ga0501083_0087061 | Ga0501083_0087061_523_822 | 97 |
| 481 | 3300049822 | Ga0501035_0399518 | Ga0501035_0399518_490_789 | 97 |
| 482 | 3300049822 | Ga0501035_0557432 | Ga0501035_0557432_390_689 | 97 |
| 483 | 3300049822 | Ga0501035_0848889 | Ga0501035_0848889_211_510 | 97 |
| 484 | 3300049823 | Ga0501044_0092646 | Ga0501044_0092646_2669_2968 | 97 |
| 485 | 3300049823 | Ga0501044_0635391 | Ga0501044_0635391_440_733 | 97 |
| 486 | 3300049823 | Ga0501044_0745126 | Ga0501044_0745126_493_786 | 97 |
| 487 | 3300049824 | Ga0501045_0017885 | Ga0501045_0017885_1246_1545 | 97 |
| 488 | 3300049824 | Ga0501045_0210001 | Ga0501045_0210001_238_540 | 97 |
| 489 | 3300050507 | nmdc:mga05p37_297991_c1 | nmdc:mga05p37_297991_c1_596_901 | 97 |
| 490 | 3300050509 | nmdc:mga0qj67_47881_c1 | nmdc:mga0qj67_47881_c1_1891_2196 | 97 |
| 491 | 3300050511 | nmdc:mga08y16_59781_c1 | nmdc:mga08y16_59781_c1_1398_1703 | 97 |
| 492 | 3300053085 | Ga0495619_0654708 | Ga0495619_0654708_45_341 | 97 |
| 493 | 3300053092 | Ga0500583_0055241 | Ga0500583_0055241_34_342 | 97 |
| 494 | 3300053108 | Ga0500562_136194 | Ga0500562_136194_58_366 | 97 |
| 495 | 3300053134 | Ga0500658_0307728 | Ga0500658_0307728_100_408 | 97 |
| 496 | 3300053158 | Ga0500627_0415652 | Ga0500627_0415652_58_354 | 97 |
| 497 | 3300053727 | Ga0500611_005184 | Ga0500611_005184_94_402 | 97 |
| 498 | 3300054114 | Ga0501084_0014697 | Ga0501084_0014697_3647_3946 | 97 |
| 499 | 3300054114 | Ga0501084_0021152 | Ga0501084_0021152_3323_3625 | 97 |
| 500 | 3300060353 | Ga0501082_0074001 | Ga0501082_0074001_580_882 | 97 |
| 501 | 3300060353 | Ga0501082_0175118 | Ga0501082_0175118_1198_1497 | 97 |
| 502 | 3300060353 | Ga0501082_0221080 | Ga0501082_0221080_559_858 | 97 |
| 503 | 3300060353 | Ga0501082_1701166 | Ga0501082_1701166_99_401 | 97 |
| 504 | 3300061734 | Ga0530510_0061730 | Ga0530510_0061730_849_1151 | 97 |
| 505 | 3300061734 | Ga0530510_1262518 | Ga0530510_1262518_58_357 | 97 |
| 506 | 3300061734 | Ga0530510_1302092 | Ga0530510_1302092_191_490 | 97 |
| 507 | 3300005440 | Ga0070705_100195860 | Ga0070705_1001958602 | 98 |
| 508 | 3300006846 | Ga0075430_100089700 | Ga0075430_1000897003 | 98 |
| 509 | 3300009978 | Ga0105148_102895 | Ga0105148_1028952 | 98 |
| 510 | 3300012510 | Ga0157316_1060899 | Ga0157316_10608991 | 98 |
| 511 | 3300025937 | Ga0207669_10189023 | Ga0207669_101890232 | 98 |
| 512 | 3300028800 | Ga0265338_10086571 | Ga0265338_100865713 | 98 |
| 513 | 3300031507 | Ga0307509_10511161 | Ga0307509_105111612 | 98 |
| 514 | 3300031665 | Ga0316575_10173400 | Ga0316575_101734002 | 98 |
| 515 | 3300031665 | Ga0316575_10336695 | Ga0316575_103366952 | 98 |
| 516 | 3300031691 | Ga0316579_10005865 | Ga0316579_100058652 | 98 |
| 517 | 3300031691 | Ga0316579_10008512 | Ga0316579_100085122 | 98 |
| 518 | 3300031691 | Ga0316579_10033499 | Ga0316579_100334992 | 98 |
| 519 | 3300031727 | Ga0316576_10029909 | Ga0316576_100299092 | 98 |
| 520 | 3300031727 | Ga0316576_10082102 | Ga0316576_100821023 | 98 |
| 521 | 3300031728 | Ga0316578_10023208 | Ga0316578_100232082 | 98 |
| 522 | 3300031728 | Ga0316578_10665469 | Ga0316578_106654692 | 98 |
| 523 | 3300031733 | Ga0316577_10017794 | Ga0316577_100177942 | 98 |
| 524 | 3300031733 | Ga0316577_10034105 | Ga0316577_100341053 | 98 |
| 525 | 3300031733 | Ga0316577_10052630 | Ga0316577_100526302 | 98 |
| 526 | 3300031733 | Ga0316577_10058605 | Ga0316577_100586052 | 98 |
| 527 | 3300031733 | Ga0316577_10546988 | Ga0316577_105469882 | 98 |
| 528 | 3300032002 | Ga0307416_100778340 | Ga0307416_1007783402 | 98 |
| 529 | 3300032126 | Ga0307415_100180168 | Ga0307415_1001801682 | 98 |
| 530 | 3300032133 | Ga0316583_10040516 | Ga0316583_100405161 | 98 |
| 531 | 3300032137 | Ga0316585_10021463 | Ga0316585_100214632 | 98 |
| 532 | 3300032137 | Ga0316585_10160774 | Ga0316585_101607742 | 98 |
| 533 | 3300032139 | Ga0316580_10027668 | Ga0316580_100276682 | 98 |
| 534 | 3300032168 | Ga0316593_10008121 | Ga0316593_100081212 | 98 |
| 535 | 3300033529 | Ga0316587_1014395 | Ga0316587_10143952 | 98 |
| 536 | 3300035398 | Ga0316574_0009003 | Ga0316574_0009003_3489_3785 | 98 |
| 537 | 3300035398 | Ga0316574_0161201 | Ga0316574_0161201_818_1114 | 98 |
| 538 | 3300035398 | Ga0316574_0201990 | Ga0316574_0201990_331_627 | 98 |
| 539 | 3300035398 | Ga0316574_0533480 | Ga0316574_0533480_256_552 | 98 |
| 540 | 3300036647 | Ga0316582_0006517 | Ga0316582_0006517_4625_4921 | 98 |
| 541 | 3300036647 | Ga0316582_0019885 | Ga0316582_0019885_2010_2306 | 98 |
| 542 | 3300036647 | Ga0316582_0033134 | Ga0316582_0033134_328_624 | 98 |
| 543 | 3300036647 | Ga0316582_0200058 | Ga0316582_0200058_762_1058 | 98 |
| 544 | 3300036712 | Ga0316584_0333176 | Ga0316584_0333176_230_526 | 98 |
| 545 | 3300036712 | Ga0316584_0338734 | Ga0316584_0338734_240_536 | 98 |
| 546 | 3300036712 | Ga0316584_0349718 | Ga0316584_0349718_344_640 | 98 |
| 547 | 3300037588 | Ga0316581_0022497 | Ga0316581_0022497_648_944 | 98 |
| 548 | 3300037588 | Ga0316581_0024365 | Ga0316581_0024365_1151_1447 | 98 |
| 549 | 3300044673 | Ga0453683_0150554 | Ga0453683_0150554_257_565 | 98 |
| 550 | 3300044712 | Ga0453684_0008869 | Ga0453684_0008869_8263_8565 | 98 |
| 551 | 3300045051 | Ga0451576_0942091 | Ga0451576_0942091_535_837 | 98 |
| 552 | 3300046694 | Ga0495649_0183867 | Ga0495649_0183867_543_845 | 98 |
| 553 | 3300049572 | Ga0501036_1171042 | Ga0501036_1171042_39_344 | 98 |
| 554 | 3300049587 | Ga0501071_0688194 | Ga0501071_0688194_110_415 | 98 |
| 555 | 3300050509 | nmdc:mga0qj67_475138_c1 | nmdc:mga0qj67_475138_c1_12_317 | 98 |
| 556 | 2162886007 | SwRhRL2b_contig_3396017 | SwRhRL2b_0276.00007290 | 99 |
| 557 | 3300003856 | Ga0058692_1000032 | Ga0058692_1000032140 | 99 |
| 558 | 3300005289 | Ga0065704_10071825 | Ga0065704_100718251 | 99 |
| 559 | 3300005331 | Ga0070670_100011189 | Ga0070670_1000111897 | 99 |
| 560 | 3300005331 | Ga0070670_100440567 | Ga0070670_1004405672 | 99 |
| 561 | 3300005345 | Ga0070692_10446391 | Ga0070692_104463912 | 99 |
| 562 | 3300005347 | Ga0070668_100257185 | Ga0070668_1002571852 | 99 |
| 563 | 3300005353 | Ga0070669_100006914 | Ga0070669_1000069147 | 99 |
| 564 | 3300005353 | Ga0070669_101412992 | Ga0070669_1014129922 | 99 |
| 565 | 3300005355 | Ga0070671_100568056 | Ga0070671_1005680562 | 99 |
| 566 | 3300005444 | Ga0070694_101031481 | Ga0070694_1010314812 | 99 |
| 567 | 3300005459 | Ga0068867_100263053 | Ga0068867_1002630533 | 99 |
| 568 | 3300005543 | Ga0070672_100006730 | Ga0070672_1000067306 | 99 |
| 569 | 3300005564 | Ga0070664_100778683 | Ga0070664_1007786832 | 99 |
| 570 | 3300005564 | Ga0070664_101149351 | Ga0070664_1011493512 | 99 |
| 571 | 3300006852 | Ga0075433_10000063 | Ga0075433_1000006339 | 99 |
| 572 | 3300006914 | Ga0075436_100001594 | Ga0075436_10000159411 | 99 |
| 573 | 3300006914 | Ga0075436_100007279 | Ga0075436_1000072795 | 99 |
| 574 | 3300007076 | Ga0075435_100000215 | Ga0075435_10000021518 | 99 |
| 575 | 3300009011 | Ga0105251_10000509 | Ga0105251_1000050912 | 99 |
| 576 | 3300009148 | Ga0105243_10021218 | Ga0105243_100212186 | 99 |
| 577 | 3300009148 | Ga0105243_10349256 | Ga0105243_103492562 | 99 |
| 578 | 3300009177 | Ga0105248_12176294 | Ga0105248_121762942 | 99 |
| 579 | 3300009177 | Ga0105248_13022903 | Ga0105248_130229031 | 99 |
| 580 | 3300012485 | Ga0157325_1014751 | Ga0157325_10147512 | 99 |
| 581 | 3300013306 | Ga0163162_11124643 | Ga0163162_111246433 | 99 |
| 582 | 3300015265 | Ga0182005_1008069 | Ga0182005_10080694 | 99 |
| 583 | 3300017792 | Ga0163161_11465808 | Ga0163161_114658082 | 99 |
| 584 | 3300025735 | Ga0207713_1000856 | Ga0207713_100085626 | 99 |
| 585 | 3300025917 | Ga0207660_10184838 | Ga0207660_101848382 | 99 |
| 586 | 3300025917 | Ga0207660_11327407 | Ga0207660_113274071 | 99 |
| 587 | 3300025919 | Ga0207657_10287143 | Ga0207657_102871431 | 99 |
| 588 | 3300025923 | Ga0207681_10012758 | Ga0207681_100127586 | 99 |
| 589 | 3300025925 | Ga0207650_10001502 | Ga0207650_1000150211 | 99 |
| 590 | 3300025932 | Ga0207690_10888030 | Ga0207690_108880302 | 99 |
| 591 | 3300025935 | Ga0207709_10011282 | Ga0207709_100112826 | 99 |
| 592 | 3300025940 | Ga0207691_10005952 | Ga0207691_100059525 | 99 |
| 593 | 3300025941 | Ga0207711_11637724 | Ga0207711_116377241 | 99 |
| 594 | 3300025945 | Ga0207679_10168633 | Ga0207679_101686332 | 99 |
| 595 | 3300025945 | Ga0207679_10242950 | Ga0207679_102429502 | 99 |
| 596 | 3300025986 | Ga0207658_10203106 | Ga0207658_102031061 | 99 |
| 597 | 3300026089 | Ga0207648_10191417 | Ga0207648_101914172 | 99 |
| 598 | 3300027312 | Ga0209371_1000055 | Ga0209371_100005534 | 99 |
| 599 | 3300030500 | Ga0268256_1000054 | Ga0268256_1000054200 | 99 |
| 600 | 3300031235 | Ga0265330_10000073 | Ga0265330_1000007370 | 99 |
| 601 | 3300031235 | Ga0265330_10122665 | Ga0265330_101226652 | 99 |
| 602 | 3300031238 | Ga0265332_10041853 | Ga0265332_100418532 | 99 |
| 603 | 3300031247 | Ga0265340_10152366 | Ga0265340_101523661 | 99 |
| 604 | 3300031249 | Ga0265339_10083048 | Ga0265339_100830482 | 99 |
| 605 | 3300031344 | Ga0265316_10011568 | Ga0265316_100115688 | 99 |
| 606 | 3300031344 | Ga0265316_10542015 | Ga0265316_105420151 | 99 |
| 607 | 3300031344 | Ga0265316_10607998 | Ga0265316_106079981 | 99 |
| 608 | 3300031344 | Ga0265316_10879067 | Ga0265316_108790672 | 99 |
| 609 | 3300031712 | Ga0265342_10000056 | Ga0265342_1000005684 | 99 |
| 610 | 3300031731 | Ga0307405_10582531 | Ga0307405_105825312 | 99 |
| 611 | 3300031852 | Ga0307410_10457387 | Ga0307410_104573872 | 99 |
| 612 | 3300031901 | Ga0307406_11006726 | Ga0307406_110067262 | 99 |
| 613 | 3300031903 | Ga0307407_10116983 | Ga0307407_101169832 | 99 |
| 614 | 3300031911 | Ga0307412_10144353 | Ga0307412_101443532 | 99 |
| 615 | 3300032004 | Ga0307414_10057493 | Ga0307414_100574932 | 99 |
| 616 | 3300032004 | Ga0307414_10973912 | Ga0307414_109739122 | 99 |
| 617 | 3300032005 | Ga0307411_10159906 | Ga0307411_101599062 | 99 |
| 618 | 3300037312 | Ga0395899_0043235 | Ga0395899_0043235_1282_1584 | 99 |
| 619 | 3300037312 | Ga0395899_0959672 | Ga0395899_0959672_88_387 | 99 |
| 620 | 3300037418 | Ga0395900_0019454 | Ga0395900_0019454_6283_6585 | 99 |
| 621 | 3300037418 | Ga0395900_0036109 | Ga0395900_0036109_4579_4896 | 99 |
| 622 | 3300037418 | Ga0395900_0175846 | Ga0395900_0175846_367_669 | 99 |
| 623 | 3300037466 | Ga0395898_0005586 | Ga0395898_0005586_8858_9160 | 99 |
| 624 | 3300037471 | Ga0395905_0963302 | Ga0395905_0963302_102_404 | 99 |
| 625 | 3300037471 | Ga0395905_1068518 | Ga0395905_1068518_238_537 | 99 |
| 626 | 3300038443 | Ga0395901_0000161 | Ga0395901_0000161_54317_54619 | 99 |
| 627 | 3300038443 | Ga0395901_0377700 | Ga0395901_0377700_540_842 | 99 |
| 628 | 3300038443 | Ga0395901_0412795 | Ga0395901_0412795_16_333 | 99 |
| 629 | 3300041404 | Ga0439436_0045616 | Ga0439436_0045616_240_554 | 99 |
| 630 | 3300041411 | Ga0439466_0127793 | Ga0439466_0127793_306_620 | 99 |
| 631 | 3300041456 | Ga0451795_0478428 | Ga0451795_0478428_169_468 | 99 |
| 632 | 3300041491 | Ga0451833_0858295 | Ga0451833_0858295_49_348 | 99 |
| 633 | 3300041494 | Ga0451837_1251020 | Ga0451837_1251020_135_449 | 99 |
| 634 | 3300042006 | Ga0439432_003922 | Ga0439432_003922_103_417 | 99 |
| 635 | 3300042015 | Ga0439462_0012111 | Ga0439462_0012111_1092_1406 | 99 |
| 636 | 3300044656 | Ga0466969_0032744 | Ga0466969_0032744_1152_1454 | 99 |
| 637 | 3300044658 | Ga0466972_0045778 | Ga0466972_0045778_559_861 | 99 |
| 638 | 3300044672 | Ga0466982_0000005 | Ga0466982_0000005_145859_146161 | 99 |
| 639 | 3300044684 | Ga0466966_0013932 | Ga0466966_0013932_4310_4612 | 99 |
| 640 | 3300044693 | Ga0466961_0114757 | Ga0466961_0114757_360_662 | 99 |
| 641 | 3300044706 | Ga0466964_0006458 | Ga0466964_0006458_888_1190 | 99 |
| 642 | 3300044712 | Ga0453684_0048951 | Ga0453684_0048951_66_377 | 99 |
| 643 | 3300044719 | Ga0466971_0039519 | Ga0466971_0039519_1804_2106 | 99 |
| 644 | 3300044735 | Ga0466968_0009985 | Ga0466968_0009985_2333_2635 | 99 |
| 645 | 3300044765 | Ga0466970_0035286 | Ga0466970_0035286_1700_2002 | 99 |
| 646 | 3300044901 | Ga0466960_0022968 | Ga0466960_0022968_1072_1374 | 99 |
| 647 | 3300046474 | Ga0495605_0261682 | Ga0495605_0261682_186_485 | 99 |
| 648 | 3300046507 | Ga0495606_0007588 | Ga0495606_0007588_5972_6271 | 99 |
| 649 | 3300046512 | Ga0495610_0071454 | Ga0495610_0071454_593_892 | 99 |
| 650 | 3300046513 | Ga0495616_0451314 | Ga0495616_0451314_23_322 | 99 |
| 651 | 3300046518 | Ga0495631_0529368 | Ga0495631_0529368_117_416 | 99 |
| 652 | 3300046519 | Ga0495632_0086898 | Ga0495632_0086898_136_435 | 99 |
| 653 | 3300046537 | Ga0495598_0016212 | Ga0495598_0016212_957_1286 | 99 |
| 654 | 3300046539 | Ga0495621_0009256 | Ga0495621_0009256_2063_2392 | 99 |
| 655 | 3300046558 | Ga0495633_0073065 | Ga0495633_0073065_871_1170 | 99 |
| 656 | 3300046615 | Ga0495656_0122175 | Ga0495656_0122175_602_952 | 99 |
| 657 | 3300046615 | Ga0495656_0674888 | Ga0495656_0674888_96_425 | 99 |
| 658 | 3300046810 | Ga0495660_0244694 | Ga0495660_0244694_161_460 | 99 |
| 659 | 3300047318 | Ga0495636_0047655 | Ga0495636_0047655_796_1110 | 99 |
| 660 | 3300047318 | Ga0495636_0391878 | Ga0495636_0391878_277_591 | 99 |
| 661 | 3300047447 | Ga0495685_071561 | Ga0495685_071561_528_842 | 99 |
| 662 | 3300047470 | Ga0495681_0061985 | Ga0495681_0061985_1288_1587 | 99 |
| 663 | 3300048904 | Ga0496101_0303429 | Ga0496101_0303429_509_853 | 99 |
| 664 | 3300048911 | Ga0496108_0045283 | Ga0496108_0045283_2055_2399 | 99 |
| 665 | 3300048912 | Ga0496109_0309782 | Ga0496109_0309782_542_886 | 99 |
| 666 | 3300048912 | Ga0496109_1144552 | Ga0496109_1144552_367_690 | 99 |
| 667 | 3300048917 | Ga0496114_0178701 | Ga0496114_0178701_85_384 | 99 |
| 668 | 3300048920 | Ga0496117_0020667 | Ga0496117_0020667_1541_1840 | 99 |
| 669 | 3300048921 | Ga0496118_0028666 | Ga0496118_0028666_230_529 | 99 |
| 670 | 3300048921 | Ga0496118_0106945 | Ga0496118_0106945_1496_1795 | 99 |
| 671 | 3300048922 | Ga0496119_0001083 | Ga0496119_0001083_3263_3562 | 99 |
| 672 | 3300048923 | Ga0496120_0000537 | Ga0496120_0000537_30995_31294 | 99 |
| 673 | 3300048925 | Ga0496122_0000859 | Ga0496122_0000859_31293_31592 | 99 |
| 674 | 3300048925 | Ga0496122_0023840 | Ga0496122_0023840_606_905 | 99 |
| 675 | 3300048926 | Ga0496123_0000417 | Ga0496123_0000417_51420_51719 | 99 |
| 676 | 3300048926 | Ga0496123_0023536 | Ga0496123_0023536_536_835 | 99 |
| 677 | 3300048927 | Ga0496124_0000653 | Ga0496124_0000653_31062_31361 | 99 |
| 678 | 3300048928 | Ga0496125_0056897 | Ga0496125_0056897_1446_1748 | 99 |
| 679 | 3300048929 | Ga0496126_0032297 | Ga0496126_0032297_4404_4703 | 99 |
| 680 | 3300048929 | Ga0496126_0065023 | Ga0496126_0065023_1249_1548 | 99 |
| 681 | 3300049568 | Ga0501031_0434042 | Ga0501031_0434042_351_653 | 99 |
| 682 | 3300049569 | Ga0501032_0325077 | Ga0501032_0325077_303_605 | 99 |
| 683 | 3300049570 | Ga0501033_0051782 | Ga0501033_0051782_835_1137 | 99 |
| 684 | 3300049572 | Ga0501036_0079609 | Ga0501036_0079609_810_1112 | 99 |
| 685 | 3300049574 | Ga0501038_0150833 | Ga0501038_0150833_647_949 | 99 |
| 686 | 3300049579 | Ga0501043_0057717 | Ga0501043_0057717_363_665 | 99 |
| 687 | 3300049581 | Ga0501047_0007616 | Ga0501047_0007616_8680_8982 | 99 |
| 688 | 3300049581 | Ga0501047_0045804 | Ga0501047_0045804_872_1174 | 99 |
| 689 | 3300049586 | Ga0501070_0352624 | Ga0501070_0352624_352_654 | 99 |
| 690 | 3300049661 | Ga0501217_199869 | Ga0501217_199869_84_383 | 99 |
| 691 | 3300049663 | Ga0501223_065141 | Ga0501223_065141_29_328 | 99 |
| 692 | 3300049763 | Ga0501266_004938 | Ga0501266_004938_669_968 | 99 |
| 693 | 3300049822 | Ga0501035_0195086 | Ga0501035_0195086_551_853 | 99 |
| 694 | 3300049823 | Ga0501044_0321657 | Ga0501044_0321657_730_1032 | 99 |
| 695 | 3300049823 | Ga0501044_0351838 | Ga0501044_0351838_872_1174 | 99 |
| 696 | 3300050512 | nmdc:mga0n895_60522_c1 | nmdc:mga0n895_60522_c1_2639_2941 | 99 |
| 697 | 3300050513 | nmdc:mga0rr50_1842_c1 | nmdc:mga0rr50_1842_c1_3385_3687 | 99 |
| 698 | 3300050514 | nmdc:mga08x19_1092_c1 | nmdc:mga08x19_1092_c1_3661_3972 | 99 |
| 699 | 3300050514 | nmdc:mga08x19_3101_c1 | nmdc:mga08x19_3101_c1_7669_7971 | 99 |
| 700 | 3300050515 | nmdc:mga0a205_237_c1 | nmdc:mga0a205_237_c1_38260_38562 | 99 |
| 701 | 3300053151 | Ga0500604_0232804 | Ga0500604_0232804_173_472 | 99 |
| 702 | 3300061719 | Ga0466962_0000490 | Ga0466962_0000490_12104_12406 | 99 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6tt7-assembly1.cif.gz_H | ovine atp synthase 1a state | 0.966 | 41 | 77 |
| 3i9w-assembly1.cif.gz_A | crystal structure of the e. coli histidine kinase sensor tors sensor domain | 0.919 | 31 | 85 |
| 7n0e-assembly1.cif.gz_B | co-complex of the histidine kinase region of rets and the dimerization and histidine phosphotransfer domain of gacs | 0.8967 | 31 | 83 |
| 3na7-assembly1.cif.gz_A | 2.2 angstrom structure of the hp0958 protein from helicobacter pylori ccug 17874 | 0.8927 | 29 | 91 |
| 1jku-assembly1.cif.gz_C | crystal structure of manganese catalase from lactobacillus plantarum | 0.8909 | 31 | 88 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2v7qH02 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain | 0.9572 | 38 | 77 | 1.20.5.440 |
| 4yxwH02 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain | 0.9372 | 38 | 77 | 1.20.5.440 |
| af_P39453_47_320_1.20.58.920 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.9354 | 31 | 85 | 1.20.58.920 |
| af_P0A6E6_91_134_1.20.5.440 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain | 0.9271 | 38 | 76 | 1.20.5.440 |
| af_Q9JK48_27_264_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.9242 | 31 | 91 | 1.20.1270.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535J467-F1-model_v4 | HlyD family efflux transporter periplasmic adaptor subunit | 0.9473 | 30 | 92 |
GO:0030313
|
| AF-A0A2V4WZU4-F1-model_v4 | deleted | 0.943 | 31 | 91 |
|
| AF-A0A7Y5CUJ4-F1-model_v4 | C4-type zinc ribbon domain-containing protein | 0.9422 | 30 | 91 |
|
| AF-A0A3M1S4T8-F1-model_v4 | TolC family protein | 0.9382 | 31 | 91 |
GO:0015562
|
| AF-A0A839PW81-F1-model_v4 | Uncharacterized protein | 0.9377 | 25 | 83 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar