F476234

General Info

Members Datasets Scaffolds Average Seq Length
702 391 675 99

Family's Representative Sequence

Representative Sequence 3300046615|Ga0495656_0122175|Ga0495656_0122175_602_952
Length 116
Sequence MMGTNAILGAKRMTDGLVALYIFMLAAIAGNVIISRVPVILHTPLMSGSNFIHGIVLIGAMVVLGHADTTLEKVIGFLAVLLGAGNAAGGYVVTERMLEMFKPSQKKSVGSDGSKA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
4 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
5 2547132512 Azospira oryzae 6a3 Isolate Unclassified
6 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
7 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
8 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
9 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
10 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
11 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
12 2739367700 Dyella sp. YR388 Isolate Unclassified
13 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
14 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
15 2818991457 Xanthomonas translucens 569 Isolate Unclassified
16 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
17 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
18 2884411467 Dyella sp. AD56 Isolate Rhizosphere
19 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
20 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
21 2928963466 Dyella japonica 1073 Isolate Unclassified
22 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
23 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
24 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
80 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
81 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
86 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
95 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
160 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
163 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
164 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
169 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
170 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
175 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
176 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
177 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
178 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
193 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
194 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
195 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
198 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
207 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
218 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
221 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
222 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
223 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
224 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
225 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
226 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
227 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
228 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
229 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
230 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
231 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
232 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
233 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
234 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
235 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
236 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
237 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
238 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
239 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
240 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
241 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
242 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
243 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
244 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
245 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
246 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
247 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
248 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
249 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
250 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
251 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
252 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
253 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
254 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
255 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
256 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
257 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
258 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
259 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
260 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
261 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
262 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
263 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
264 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
265 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
266 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
267 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
268 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
269 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
270 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
271 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
272 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
273 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
274 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
275 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
276 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
277 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
278 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
281 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
282 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
283 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
284 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
285 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
286 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
287 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
288 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
289 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
290 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
291 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
292 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
293 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
294 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
295 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
296 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
297 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
298 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
299 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
300 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
301 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
302 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
303 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
304 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
305 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
306 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
307 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
308 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
309 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
310 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
311 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
312 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
317 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
318 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
319 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
320 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
321 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
322 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
323 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
324 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
325 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
341 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
342 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
343 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
344 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
345 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
346 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
347 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
348 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
349 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
350 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
351 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
352 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
353 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
354 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
355 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
356 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
357 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
358 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
359 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
360 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
361 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
362 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
367 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
368 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
369 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
370 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
371 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
372 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
373 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
374 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
375 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
376 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
377 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
378 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
379 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
380 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
381 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
382 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
383 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
384 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
385 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
386 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
387 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
388 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
389 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
390 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
391 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.44
Metatranscriptomes 0.71
Isolates 3.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0
Rhizoplane 3.85
Rhizosphere 87.75
Stem 0
Stem Tuber 0
Unclassified 7.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3396017 2162886007 Bacteria 1159
2 Ga0058692_1000032 3300003856 Bacteria 179581
3 Ga0065714_10433482 3300005288 Bacteria 547
4 Ga0065704_10071825 3300005289 Bacteria 9819
5 Ga0065704_10508426 3300005289 Bacteria 638
6 Ga0065712_10037529 3300005290 Bacteria 1278
7 Ga0065712_10270178 3300005290 Bacteria 917
8 Ga0065715_10228295 3300005293 Bacteria 1244
9 Ga0065715_10463170 3300005293 Bacteria 814
10 Ga0070670_100011189 3300005331 Bacteria 7668
11 Ga0070670_100440567 3300005331 Bacteria 1154
12 Ga0068869_100125916 3300005334 Bacteria 1964
13 Ga0070692_10446391 3300005345 Bacteria 827
14 Ga0070668_100257185 3300005347 Bacteria 1451
15 Ga0070669_100006914 3300005353 Bacteria 8155
16 Ga0070669_101412992 3300005353 Bacteria 604
17 Ga0070675_101883526 3300005354 Bacteria 552
18 Ga0070671_100568056 3300005355 Bacteria 979
19 Ga0070673_100013760 3300005364 Bacteria 5612
20 Ga0070714_100328036 3300005435 Bacteria 1433
21 Ga0070713_100455731 3300005436 Bacteria 1202
22 Ga0070710_10722778 3300005437 Bacteria 705
23 Ga0070701_10462021 3300005438 Bacteria 817
24 Ga0070705_100195860 3300005440 Bacteria 1381
25 Ga0070705_101320259 3300005440 Bacteria 599
26 Ga0070694_101031481 3300005444 Bacteria 684
27 Ga0070708_102124676 3300005445 Bacteria 519
28 Ga0070681_11997704 3300005458 Bacteria 508
29 Ga0068867_100263053 3300005459 Bacteria 1407
30 Ga0068867_101630007 3300005459 Bacteria 604
31 Ga0070684_101340236 3300005535 Bacteria 674
32 Ga0070672_100006730 3300005543 Bacteria 7752
33 Ga0070672_100412610 3300005543 Bacteria 1159
34 Ga0070695_100126647 3300005545 Bacteria 1755
35 Ga0070696_100006453 3300005546 Bacteria 7844
36 Ga0070696_100365609 3300005546 Bacteria 1121
37 Ga0070696_100457810 3300005546 Bacteria 1008
38 Ga0070704_100082361 3300005549 Bacteria 2373
39 Ga0068855_101654046 3300005563 Bacteria 654
40 Ga0070664_100778683 3300005564 Bacteria 894
41 Ga0070664_101149351 3300005564 Bacteria 732
42 Ga0068857_101113759 3300005577 Bacteria 763
43 Ga0068859_100606518 3300005617 Bacteria 1187
44 Ga0068864_101349831 3300005618 Bacteria 714
45 Ga0068861_100959644 3300005719 Bacteria 814
46 Ga0068870_10033093 3300005840 Bacteria 2635
47 Ga0068870_10221291 3300005840 Bacteria 1159
48 Ga0068870_11247610 3300005840 Bacteria 540
49 Ga0068863_100750246 3300005841 Bacteria 972
50 Ga0068863_100791074 3300005841 Bacteria 946
51 Ga0068860_101369562 3300005843 Bacteria 729
52 Ga0068862_100442183 3300005844 Bacteria 1224
53 Ga0068862_100717912 3300005844 Bacteria 970
54 Ga0070716_100045012 3300006173 Bacteria 2475
55 Ga0068871_100237851 3300006358 Bacteria 1582
56 Ga0075430_100089700 3300006846 Bacteria 2572
57 Ga0075433_10000063 3300006852 Bacteria 46869
58 Ga0068865_100376550 3300006881 Bacteria 1157
59 Ga0075436_100001594 3300006914 Bacteria 15499
60 Ga0075436_100007279 3300006914 Bacteria 7569
61 Ga0097620_100606513 3300006931 Bacteria 1187
62 Ga0075435_100000215 3300007076 Bacteria 35478
63 Ga0099794_10062491 3300007265 Bacteria 1811
64 Ga0099795_10000028 3300007788 Bacteria 41981
65 Ga0099795_10000378 3300007788 Bacteria 8054
66 Ga0105251_10000509 3300009011 Bacteria 36783
67 Ga0105250_10000010 3300009092 Bacteria 298384
68 Ga0105240_10022420 3300009093 Bacteria 8371
69 Ga0105240_10284018 3300009093 Bacteria 1900
70 Ga0105243_10021218 3300009148 Bacteria 4929
71 Ga0105243_10349256 3300009148 Bacteria 1358
72 Ga0105243_12411677 3300009148 Bacteria 564
73 Ga0105241_10859476 3300009174 Bacteria 840
74 Ga0105241_12112590 3300009174 Bacteria 557
75 Ga0105248_12176294 3300009177 Bacteria 631
76 Ga0105248_13022903 3300009177 Bacteria 536
77 Ga0105238_10966112 3300009551 Bacteria 872
78 Ga0105238_12959097 3300009551 Bacteria 511
79 Ga0105148_102895 3300009978 Bacteria 1212
80 Ga0105029_113209 3300009984 Bacteria 647
81 Ga0105030_100289 3300009987 Bacteria 4386
82 Ga0099796_10000091 3300010159 Bacteria 15012
83 Ga0099796_10000149 3300010159 Bacteria 10399
84 Ga0105239_10101110 3300010375 Bacteria 3189
85 Ga0105246_10656841 3300011119 Bacteria 914
86 Ga0157325_1014751 3300012485 Bacteria 631
87 Ga0157316_1060899 3300012510 Bacteria 546
88 Ga0157370_10302845 3300013104 Bacteria 1475
89 Ga0163162_11124643 3300013306 Bacteria 890
90 Ga0157375_10007013 3300013308 Bacteria 9840
91 Ga0157514_105533 3300013874 Bacteria 1995
92 Ga0157380_10075546 3300014326 Bacteria 2739
93 Ga0157380_10137030 3300014326 Bacteria 2097
94 Ga0157377_11321378 3300014745 Bacteria 565
95 Ga0157379_10000022 3300014968 Bacteria 90949
96 Ga0157379_11794745 3300014968 Bacteria 603
97 Ga0182005_1008069 3300015265 Bacteria 3122
98 Ga0183369_1007 3300015685 Bacteria 414878
99 Ga0163161_11066445 3300017792 Bacteria 693
100 Ga0163161_11465808 3300017792 Bacteria 598
101 Ga0163161_11791891 3300017792 Bacteria 546
102 Ga0213874_10031626 3300021377 Bacteria 1532
103 Ga0207696_1000159 3300025711 Bacteria 111473
104 Ga0207713_1000856 3300025735 Bacteria 27912
105 Ga0207682_10081496 3300025893 Bacteria 1388
106 Ga0207710_10030850 3300025900 Bacteria 2340
107 Ga0207680_10050019 3300025903 Bacteria 2492
108 Ga0207680_10224420 3300025903 Bacteria 1289
109 Ga0207685_10156458 3300025905 Bacteria 1036
110 Ga0207645_10005481 3300025907 Bacteria 9188
111 Ga0207645_10091903 3300025907 Bacteria 1952
112 Ga0207643_10075223 3300025908 Bacteria 1949
113 Ga0207643_10150735 3300025908 Bacteria 1394
114 Ga0207705_10638438 3300025909 Bacteria 828
115 Ga0207654_11373341 3300025911 Bacteria 515
116 Ga0207695_10269854 3300025913 Bacteria 1597
117 Ga0207663_10052499 3300025916 Bacteria 2543
118 Ga0207660_10184838 3300025917 Bacteria 1620
119 Ga0207660_10331192 3300025917 Bacteria 1217
120 Ga0207660_10890768 3300025917 Bacteria 726
121 Ga0207660_11327407 3300025917 Bacteria 584
122 Ga0207657_10203303 3300025919 Bacteria 1592
123 Ga0207657_10287143 3300025919 Bacteria 1305
124 Ga0207652_10263663 3300025921 Bacteria 1554
125 Ga0207681_10012758 3300025923 Bacteria 5191
126 Ga0207681_10109885 3300025923 Bacteria 2003
127 Ga0207694_11578018 3300025924 Bacteria 553
128 Ga0207650_10001502 3300025925 Bacteria 16694
129 Ga0207659_10020969 3300025926 Bacteria 4329
130 Ga0207659_10640832 3300025926 Bacteria 908
131 Ga0207687_10188341 3300025927 Bacteria 1604
132 Ga0207700_10096564 3300025928 Bacteria 2347
133 Ga0207664_10027618 3300025929 Bacteria 4305
134 Ga0207664_10110464 3300025929 Bacteria 2286
135 Ga0207644_10032965 3300025931 Bacteria 3617
136 Ga0207690_10888030 3300025932 Bacteria 739
137 Ga0207690_11441865 3300025932 Bacteria 576
138 Ga0207706_10001774 3300025933 Bacteria 21187
139 Ga0207706_10153036 3300025933 Bacteria 2029
140 Ga0207686_11842101 3300025934 Bacteria 501
141 Ga0207709_10011282 3300025935 Bacteria 4928
142 Ga0207709_10745085 3300025935 Bacteria 787
143 Ga0207669_10008044 3300025937 Bacteria 4929
144 Ga0207669_10189023 3300025937 Bacteria 1484
145 Ga0207669_10239972 3300025937 Bacteria 1343
146 Ga0207704_10019262 3300025938 Bacteria 3580
147 Ga0207704_10169850 3300025938 Bacteria 1563
148 Ga0207704_10174581 3300025938 Bacteria 1546
149 Ga0207665_10260663 3300025939 Bacteria 1284
150 Ga0207691_10001282 3300025940 Bacteria 25090
151 Ga0207691_10005952 3300025940 Bacteria 11780
152 Ga0207691_10089309 3300025940 Bacteria 2764
153 Ga0207711_10010944 3300025941 Bacteria 7539
154 Ga0207711_11637724 3300025941 Bacteria 587
155 Ga0207689_10062377 3300025942 Bacteria 3065
156 Ga0207689_10174723 3300025942 Bacteria 1771
157 Ga0207679_10011450 3300025945 Bacteria 5748
158 Ga0207679_10168633 3300025945 Bacteria 1800
159 Ga0207679_10242950 3300025945 Bacteria 1527
160 Ga0207651_10055569 3300025960 Bacteria 2720
161 Ga0207651_10289076 3300025960 Bacteria 1358
162 Ga0207712_10452549 3300025961 Bacteria 1089
163 Ga0207668_10057659 3300025972 Bacteria 2710
164 Ga0207640_10646428 3300025981 Bacteria 901
165 Ga0207658_10017465 3300025986 Bacteria 4944
166 Ga0207658_10203106 3300025986 Bacteria 1656
167 Ga0207677_10040675 3300026023 Bacteria 3067
168 Ga0207677_10541009 3300026023 Bacteria 1013
169 Ga0207703_10050377 3300026035 Bacteria 3370
170 Ga0207639_10306005 3300026041 Bacteria 1406
171 Ga0207639_10991217 3300026041 Bacteria 787
172 Ga0207641_10648449 3300026088 Bacteria 1037
173 Ga0207641_10725985 3300026088 Bacteria 979
174 Ga0207648_10002228 3300026089 Bacteria 20997
175 Ga0207648_10191417 3300026089 Bacteria 1813
176 Ga0207648_10523602 3300026089 Bacteria 1087
177 Ga0207648_10801010 3300026089 Bacteria 877
178 Ga0207676_10014743 3300026095 Bacteria 5630
179 Ga0207676_11661801 3300026095 Bacteria 637
180 Ga0207676_11675609 3300026095 Bacteria 634
181 Ga0207675_100002928 3300026118 Bacteria 16791
182 Ga0209371_1000055 3300027312 Bacteria 257599
183 Ga0209984_1001688 3300027424 Bacteria 2411
184 Ga0210000_1047213 3300027462 Bacteria 689
185 Ga0209179_1000002 3300027512 Bacteria 124932
186 Ga0209179_1001261 3300027512 Bacteria 3034
187 Ga0209982_1038806 3300027552 Bacteria 758
188 Ga0209970_1000691 3300027614 Bacteria 5860
189 Ga0209970_1021002 3300027614 Bacteria 1105
190 Ga0210002_1001343 3300027617 Bacteria 3441
191 Ga0209983_1001442 3300027665 Bacteria 5283
192 Ga0209983_1051649 3300027665 Bacteria 900
193 Ga0209971_1000129 3300027682 Bacteria 22542
194 Ga0209998_10000502 3300027717 Bacteria 10732
195 Ga0209974_10002902 3300027876 Bacteria 6216
196 Ga0209974_10024493 3300027876 Bacteria 1997
197 Ga0207428_10062402 3300027907 Bacteria 2947
198 Ga0268266_10061566 3300028379 Bacteria 3237
199 Ga0268265_10010958 3300028380 Bacteria 6122
200 Ga0268264_10133371 3300028381 Bacteria 2205
201 Ga0268264_11318084 3300028381 Bacteria 732
202 Ga0265334_10000007 3300028573 Bacteria 217454
203 Ga0265323_10231957 3300028653 Bacteria 576
204 Ga0265338_10086571 3300028800 Bacteria 2607
205 Ga0265338_10909258 3300028800 Bacteria 599
206 Ga0265324_10021632 3300029957 Bacteria 2305
207 Ga0268256_1000054 3300030500 Bacteria 257599
208 Ga0265762_1028045 3300030760 Bacteria 1059
209 Ga0265760_10011206 3300031090 Bacteria 2563
210 Ga0265330_10000073 3300031235 Archaea 87378
211 Ga0265330_10122665 3300031235 Archaea 1107
212 Ga0265332_10007289 3300031238 Bacteria 5002
213 Ga0265332_10041853 3300031238 Archaea 1981
214 Ga0265320_10267748 3300031240 Bacteria 757
215 Ga0265340_10152366 3300031247 Archaea 1053
216 Ga0265339_10083048 3300031249 Unclassified 1691
217 Ga0265316_10008749 3300031344 Bacteria 9360
218 Ga0265316_10011568 3300031344 Archaea 7947
219 Ga0265316_10035918 3300031344 Bacteria 4010
220 Ga0265316_10542015 3300031344 Archaea 829
221 Ga0265316_10607998 3300031344 Archaea 775
222 Ga0265316_10879067 3300031344 Archaea 627
223 Ga0307509_10511161 3300031507 Bacteria 884
224 Ga0307509_10803985 3300031507 Bacteria 605
225 Ga0265313_10000113 3300031595 Bacteria 81921
226 Ga0265313_10222042 3300031595 Bacteria 779
227 Ga0316575_10063560 3300031665 Bacteria 1477
228 Ga0316575_10139043 3300031665 Bacteria 999
229 Ga0316575_10173400 3300031665 Bacteria 894
230 Ga0316575_10336695 3300031665 Bacteria 641
231 Ga0316579_10005865 3300031691 Bacteria 4979
232 Ga0316579_10008512 3300031691 Bacteria 4280
233 Ga0316579_10033499 3300031691 Bacteria 2359
234 Ga0316579_10202242 3300031691 Bacteria 960
235 Ga0265342_10000056 3300031712 Archaea 120731
236 Ga0316576_10029909 3300031727 Bacteria 3853
237 Ga0316576_10082102 3300031727 Bacteria 2392
238 Ga0316576_10261509 3300031727 Bacteria 1298
239 Ga0316578_10023208 3300031728 Bacteria 3470
240 Ga0316578_10094508 3300031728 Bacteria 1788
241 Ga0316578_10665469 3300031728 Bacteria 607
242 Ga0307516_10026943 3300031730 Bacteria 5833
243 Ga0307405_10582531 3300031731 Bacteria 910
244 Ga0316577_10001489 3300031733 Bacteria 11097
245 Ga0316577_10017794 3300031733 Bacteria 3928
246 Ga0316577_10034105 3300031733 Bacteria 2844
247 Ga0316577_10052630 3300031733 Bacteria 2272
248 Ga0316577_10058605 3300031733 Bacteria 2150
249 Ga0316577_10546988 3300031733 Bacteria 658
250 Ga0307413_10186342 3300031824 Bacteria 1485
251 Ga0307410_10015175 3300031852 Bacteria 4561
252 Ga0307410_10457387 3300031852 Bacteria 1042
253 Ga0307406_10263410 3300031901 Bacteria 1305
254 Ga0307406_11006726 3300031901 Bacteria 715
255 Ga0307407_10116983 3300031903 Bacteria 1683
256 Ga0307412_10144353 3300031911 Bacteria 1747
257 Ga0307409_100225859 3300031995 Bacteria 1693
258 Ga0307416_100778340 3300032002 Bacteria 1051
259 Ga0307416_103280123 3300032002 Bacteria 541
260 Ga0307414_10046240 3300032004 Bacteria 2986
261 Ga0307414_10057493 3300032004 Bacteria 2734
262 Ga0307414_10973912 3300032004 Bacteria 780
263 Ga0307411_10011081 3300032005 Bacteria 4843
264 Ga0307411_10159906 3300032005 Bacteria 1685
265 Ga0307415_100180168 3300032126 Bacteria 1657
266 Ga0316583_10040516 3300032133 Bacteria 1649
267 Ga0316585_10021463 3300032137 Bacteria 1983
268 Ga0316585_10034476 3300032137 Bacteria 1600
269 Ga0316585_10160774 3300032137 Bacteria 742
270 Ga0316585_10188451 3300032137 Bacteria 681
271 Ga0316580_10027668 3300032139 Bacteria 1752
272 Ga0316580_10045982 3300032139 Bacteria 1346
273 Ga0316593_10008121 3300032168 Bacteria 2914
274 Ga0316593_10231535 3300032168 Bacteria 688
275 Ga0316587_1014395 3300033529 Bacteria 1304
276 Ga0373944_0213894 3300035089 Bacteria 702
277 Ga0373951_0021974 3300035091 Bacteria 1467
278 Ga0373954_0277020 3300035118 Bacteria 827
279 Ga0373946_0079462 3300035171 Bacteria 1433
280 Ga0316574_0003694 3300035398 Bacteria 7927
281 Ga0316574_0009003 3300035398 Bacteria 5576
282 Ga0316574_0046262 3300035398 Bacteria 2698
283 Ga0316574_0161201 3300035398 Bacteria 1444
284 Ga0316574_0201990 3300035398 Bacteria 1276
285 Ga0316574_0219224 3300035398 Bacteria 1219
286 Ga0316574_0257158 3300035398 Bacteria 1115
287 Ga0316574_0533480 3300035398 Bacteria 730
288 Ga0316574_0586879 3300035398 Bacteria 689
289 Ga0316574_0590256 3300035398 Bacteria 687
290 Ga0316574_0734660 3300035398 Bacteria 604
291 Ga0373924_0054559 3300035410 Bacteria 1662
292 Ga0373931_0257940 3300035691 Bacteria 1063
293 Ga0373933_0313697 3300035724 Bacteria 1016
294 Ga0373937_0138498 3300036401 Bacteria 2276
295 Ga0316582_0006517 3300036647 Bacteria 6138
296 Ga0316582_0019885 3300036647 Bacteria 3938
297 Ga0316582_0033134 3300036647 Bacteria 3170
298 Ga0316582_0113748 3300036647 Bacteria 1804
299 Ga0316582_0158704 3300036647 Bacteria 1531
300 Ga0316582_0200058 3300036647 Bacteria 1363
301 Ga0316582_0519861 3300036647 Bacteria 820
302 Ga0316584_0015404 3300036712 Bacteria 5468
303 Ga0316584_0156882 3300036712 Bacteria 1692
304 Ga0316584_0333176 3300036712 Bacteria 1092
305 Ga0316584_0338734 3300036712 Bacteria 1081
306 Ga0316584_0349718 3300036712 Bacteria 1061
307 Ga0373925_0087137 3300037068 Bacteria 2383
308 Ga0373925_1097402 3300037068 Bacteria 655
309 Ga0395899_0043235 3300037312 Bacteria 3361
310 Ga0395899_0959672 3300037312 Bacteria 518
311 Ga0395900_0019454 3300037418 Bacteria 6922
312 Ga0395900_0036109 3300037418 Bacteria 5094
313 Ga0395900_0175846 3300037418 Bacteria 2177
314 Ga0395898_0005586 3300037466 Bacteria 13561
315 Ga0395905_0963302 3300037471 Bacteria 756
316 Ga0395905_1068518 3300037471 Bacteria 710
317 Ga0316581_0022497 3300037588 Bacteria 1859
318 Ga0316581_0024365 3300037588 Bacteria 1794
319 Ga0395901_0000161 3300038443 Bacteria 87191
320 Ga0395901_0377700 3300038443 Bacteria 1459
321 Ga0395901_0412795 3300038443 Bacteria 1386
322 Ga0400487_26052 3300039110 Bacteria 21189
323 Ga0436365_0656847 3300039437 Bacteria 879
324 Ga0436365_0681911 3300039437 Bacteria 2025
325 Ga0436360_0643048 3300039438 Bacteria 796
326 Ga0436360_0702009 3300039438 Bacteria 14257
327 Ga0436360_0863835 3300039438 Bacteria 622
328 Ga0436361_0748250 3300039447 Bacteria 2328
329 Ga0436363_1604190 3300039450 Bacteria 1516
330 Ga0439436_0045616 3300041404 Bacteria 1247
331 Ga0439453_0002338 3300041408 Bacteria 2602
332 Ga0439461_0023606 3300041410 Bacteria 1238
333 Ga0439466_0127793 3300041411 Bacteria 783
334 Ga0451793_0119191 3300041452 Bacteria 523
335 Ga0451797_0247884 3300041453 Bacteria 955
336 Ga0451795_0155080 3300041456 Bacteria 809
337 Ga0451795_0478428 3300041456 Bacteria 909
338 Ga0451833_0621084 3300041491 Bacteria 891
339 Ga0451833_0858295 3300041491 Bacteria 756
340 Ga0451837_0549059 3300041494 Bacteria 899
341 Ga0451837_1251020 3300041494 Bacteria 801
342 Ga0451839_0570728 3300041496 Bacteria 1376
343 Ga0451841_0586404 3300041498 Bacteria 1691
344 Ga0451849_1042972 3300041505 Bacteria 1611
345 Ga0451851_1238763 3300041507 Bacteria 609
346 Ga0451843_1191470 3300041509 Bacteria 1270
347 Ga0451855_0017499 3300041511 Bacteria 1533
348 Ga0451853_0395963 3300041512 Bacteria 1535
349 Ga0439431_0048804 3300041997 Bacteria 1094
350 Ga0439441_057724 3300042001 Bacteria 811
351 Ga0439442_010813 3300042002 Bacteria 1854
352 Ga0439443_000122 3300042003 Bacteria 5083
353 Ga0439432_003922 3300042006 Bacteria 5475
354 Ga0439454_046867 3300042011 Bacteria 721
355 Ga0439456_055462 3300042013 Bacteria 868
356 Ga0439457_181280 3300042014 Bacteria 514
357 Ga0439462_0012111 3300042015 Bacteria 2201
358 Ga0450912_000483 3300042116 Bacteria 1990
359 Ga0450915_004233 3300042119 Bacteria 843
360 Ga0450920_003038 3300042122 Bacteria 2894
361 Ga0450921_009560 3300042123 Bacteria 803
362 Ga0450922_008479 3300042124 Bacteria 970
363 Ga0450923_000037 3300042125 Bacteria 9892
364 Ga0450923_003535 3300042125 Bacteria 2371
365 Ga0450923_016062 3300042125 Bacteria 1406
366 Ga0450888_020100 3300042126 Bacteria 846
367 Ga0450897_003390 3300042128 Bacteria 1275
368 Ga0450891_014805 3300042129 Bacteria 737
369 Ga0450894_002188 3300042131 Bacteria 2658
370 Ga0450896_002393 3300042133 Bacteria 2416
371 Ga0450907_003860 3300042146 Bacteria 2623
372 Ga0439446_0008710 3300042156 Bacteria 2702
373 Ga0439446_0031143 3300042156 Bacteria 1543
374 Ga0439446_0032719 3300042156 Bacteria 1509
375 Ga0450908_006385 3300042184 Bacteria 2242
376 Ga0439434_0004130 3300042435 Bacteria 4240
377 Ga0439435_0000050 3300042436 Bacteria 13331
378 Ga0439444_0010325 3300042437 Bacteria 1490
379 Ga0439460_0001301 3300042461 Bacteria 5864
380 Ga0439460_0283617 3300042461 Bacteria 577
381 Ga0450918_003009 3300042531 Bacteria 3154
382 Ga0450893_0059584 3300042532 Bacteria 727
383 Ga0451577_0028480 3300042876 Bacteria 5052
384 Ga0466969_0032744 3300044656 Bacteria 2642
385 Ga0466972_0045778 3300044658 Bacteria 2119
386 Ga0466982_0000005 3300044672 Bacteria 364340
387 Ga0453683_0086742 3300044673 Bacteria 1961
388 Ga0453683_0150554 3300044673 Bacteria 1470
389 Ga0453683_1159975 3300044673 Bacteria 516
390 Ga0466966_0013932 3300044684 Bacteria 5323
391 Ga0466961_0114757 3300044693 Bacteria 1693
392 Ga0466964_0006458 3300044706 Bacteria 4369
393 Ga0453684_0008869 3300044712 Bacteria 17818
394 Ga0453684_0019458 3300044712 Bacteria 10335
395 Ga0453684_0048951 3300044712 Archaea 5580
396 Ga0453684_0055336 3300044712 Bacteria 5159
397 Ga0453684_0688373 3300044712 Bacteria 1112
398 Ga0453684_0896542 3300044712 Bacteria 950
399 Ga0466971_0039519 3300044719 Bacteria 2117
400 Ga0466968_0009985 3300044735 Bacteria 3666
401 Ga0466970_0035286 3300044765 Bacteria 2649
402 Ga0466960_0022968 3300044901 Bacteria 2794
403 Ga0451576_0073592 3300045051 Bacteria 3555
404 Ga0451576_0088729 3300045051 Bacteria 3216
405 Ga0451576_0863179 3300045051 Bacteria 950
406 Ga0451576_0942091 3300045051 Bacteria 906
407 Ga0495629_0562541 3300046459 Bacteria 765
408 Ga0495629_1100086 3300046459 Bacteria 514
409 Ga0495580_0120003 3300046472 Bacteria 1826
410 Ga0495605_0261682 3300046474 Bacteria 738
411 Ga0495606_0007588 3300046507 Bacteria 9657
412 Ga0495610_0071454 3300046512 Bacteria 1618
413 Ga0495616_0451314 3300046513 Bacteria 521
414 Ga0495628_0567753 3300046516 Bacteria 813
415 Ga0495631_0529368 3300046518 Bacteria 502
416 Ga0495632_0070130 3300046519 Bacteria 1686
417 Ga0495632_0086898 3300046519 Bacteria 1487
418 Ga0495663_0200465 3300046525 Bacteria 696
419 Ga0495640_0598782 3300046533 Bacteria 666
420 Ga0495598_0016212 3300046537 Bacteria 1897
421 Ga0495621_0009256 3300046539 Bacteria 2986
422 Ga0495633_0073065 3300046558 Bacteria 1599
423 Ga0495656_0122175 3300046615 Bacteria 1230
424 Ga0495656_0674888 3300046615 Bacteria 555
425 Ga0495659_0508449 3300046664 Bacteria 528
426 Ga0495658_0767993 3300046683 Bacteria 617
427 Ga0495649_0183867 3300046694 Bacteria 1090
428 Ga0495660_0244694 3300046810 Bacteria 835
429 Ga0495636_0047655 3300047318 Bacteria 1789
430 Ga0495636_0391878 3300047318 Bacteria 660
431 Ga0495685_071561 3300047447 Bacteria 1161
432 Ga0495681_0061985 3300047470 Bacteria 1721
433 Ga0495686_0002349 3300047472 Bacteria 18053
434 Ga0495602_0941295 3300048088 Bacteria 573
435 Ga0496100_0559713 3300048903 Bacteria 885
436 Ga0496101_0151071 3300048904 Bacteria 1776
437 Ga0496101_0303429 3300048904 Bacteria 1251
438 Ga0496104_0003488 3300048907 Bacteria 13566
439 Ga0496104_0004860 3300048907 Bacteria 11708
440 Ga0496105_0002578 3300048908 Bacteria 13176
441 Ga0496105_0004476 3300048908 Bacteria 10520
442 Ga0496106_1472656 3300048909 Bacteria 524
443 Ga0496107_0050755 3300048910 Bacteria 2991
444 Ga0496107_0209697 3300048910 Bacteria 1449
445 Ga0496108_0008954 3300048911 Bacteria 8110
446 Ga0496108_0045283 3300048911 Bacteria 3675
447 Ga0496109_0012655 3300048912 Bacteria 7288
448 Ga0496109_0309782 3300048912 Bacteria 1489
449 Ga0496109_1144552 3300048912 Bacteria 715
450 Ga0496110_0081072 3300048913 Bacteria 2892
451 Ga0496111_0002702 3300048914 Bacteria 10773
452 Ga0496111_0260524 3300048914 Bacteria 1287
453 Ga0496113_0860891 3300048916 Bacteria 718
454 Ga0496114_0000823 3300048917 Bacteria 23290
455 Ga0496114_0083260 3300048917 Bacteria 2706
456 Ga0496114_0178701 3300048917 Bacteria 1852
457 Ga0496115_0002092 3300048918 Bacteria 14291
458 Ga0496117_0020667 3300048920 Bacteria 5358
459 Ga0496118_0000271 3300048921 Bacteria 91025
460 Ga0496118_0028666 3300048921 Bacteria 4683
461 Ga0496118_0106945 3300048921 Bacteria 1869
462 Ga0496119_0001083 3300048922 Bacteria 34389
463 Ga0496120_0000537 3300048923 Bacteria 58209
464 Ga0496122_0000859 3300048925 Bacteria 57207
465 Ga0496122_0023840 3300048925 Bacteria 5375
466 Ga0496123_0000417 3300048926 Bacteria 77334
467 Ga0496123_0023536 3300048926 Bacteria 4712
468 Ga0496124_0000653 3300048927 Bacteria 57229
469 Ga0496125_0056897 3300048928 Bacteria 3172
470 Ga0496126_0032297 3300048929 Bacteria 4933
471 Ga0496126_0065023 3300048929 Bacteria 3265
472 Ga0501031_0042920 3300049568 Bacteria 2952
473 Ga0501031_0121689 3300049568 Bacteria 1705
474 Ga0501031_0434042 3300049568 Bacteria 849
475 Ga0501031_0620371 3300049568 Bacteria 695
476 Ga0501032_0064237 3300049569 Bacteria 2457
477 Ga0501032_0074655 3300049569 Bacteria 2259
478 Ga0501032_0134902 3300049569 Bacteria 1627
479 Ga0501032_0325077 3300049569 Bacteria 992
480 Ga0501032_0408169 3300049569 Bacteria 872
481 Ga0501033_0051782 3300049570 Bacteria 3043
482 Ga0501033_0058188 3300049570 Bacteria 2856
483 Ga0501033_0062713 3300049570 Bacteria 2737
484 Ga0501033_0397867 3300049570 Bacteria 961
485 Ga0501033_0412495 3300049570 Bacteria 941
486 Ga0501033_0890394 3300049570 Bacteria 598
487 Ga0501033_1017502 3300049570 Bacteria 553
488 Ga0501034_0267815 3300049571 Bacteria 1650
489 Ga0501034_1378498 3300049571 Bacteria 580
490 Ga0501034_1687466 3300049571 Bacteria 506
491 Ga0501036_0008597 3300049572 Bacteria 8375
492 Ga0501036_0071911 3300049572 Bacteria 2924
493 Ga0501036_0079609 3300049572 Bacteria 2771
494 Ga0501036_0383168 3300049572 Bacteria 1173
495 Ga0501036_1171042 3300049572 Bacteria 627
496 Ga0501036_1672112 3300049572 Bacteria 513
497 Ga0501037_0014426 3300049573 Bacteria 5817
498 Ga0501037_0134054 3300049573 Bacteria 1774
499 Ga0501037_0454785 3300049573 Bacteria 873
500 Ga0501037_0646240 3300049573 Bacteria 707
501 Ga0501038_0041855 3300049574 Bacteria 3993
502 Ga0501038_0083088 3300049574 Bacteria 2696
503 Ga0501038_0150833 3300049574 Bacteria 1895
504 Ga0501038_0334058 3300049574 Bacteria 1183
505 Ga0501038_0403418 3300049574 Bacteria 1057
506 Ga0501038_0405661 3300049574 Bacteria 1054
507 Ga0501038_0447253 3300049574 Bacteria 994
508 Ga0501039_0002195 3300049575 Bacteria 14437
509 Ga0501039_0040894 3300049575 Bacteria 3579
510 Ga0501039_0840749 3300049575 Bacteria 715
511 Ga0501039_0945204 3300049575 Bacteria 670
512 Ga0501039_1542544 3300049575 Bacteria 510
513 Ga0501040_0001530 3300049576 Bacteria 14701
514 Ga0501040_0062883 3300049576 Bacteria 2553
515 Ga0501040_0191374 3300049576 Bacteria 1452
516 Ga0501040_0200992 3300049576 Bacteria 1415
517 Ga0501040_0951840 3300049576 Bacteria 622
518 Ga0501041_0008134 3300049577 Bacteria 6172
519 Ga0501041_0047303 3300049577 Bacteria 2618
520 Ga0501041_0112128 3300049577 Bacteria 1692
521 Ga0501041_0748290 3300049577 Bacteria 626
522 Ga0501042_0007427 3300049578 Bacteria 7178
523 Ga0501042_0035687 3300049578 Bacteria 3527
524 Ga0501042_0071439 3300049578 Bacteria 2483
525 Ga0501042_0378854 3300049578 Bacteria 1024
526 Ga0501042_0461455 3300049578 Bacteria 921
527 Ga0501043_0016518 3300049579 Bacteria 5786
528 Ga0501043_0057717 3300049579 Bacteria 3047
529 Ga0501043_0229445 3300049579 Bacteria 1434
530 Ga0501043_1137418 3300049579 Bacteria 550
531 Ga0501046_0010394 3300049580 Bacteria 7995
532 Ga0501046_0046492 3300049580 Bacteria 3444
533 Ga0501046_0142142 3300049580 Bacteria 1815
534 Ga0501046_0544064 3300049580 Bacteria 828
535 Ga0501046_0551989 3300049580 Bacteria 821
536 Ga0501046_0557359 3300049580 Bacteria 816
537 Ga0501047_0007616 3300049581 Bacteria 10191
538 Ga0501047_0045804 3300049581 Bacteria 4228
539 Ga0501047_0139382 3300049581 Bacteria 2304
540 Ga0501047_0142335 3300049581 Bacteria 2276
541 Ga0501047_0578630 3300049581 Bacteria 946
542 Ga0501048_0003654 3300049582 Bacteria 11717
543 Ga0501048_0086117 3300049582 Bacteria 2216
544 Ga0501048_0186917 3300049582 Bacteria 1468
545 Ga0501048_0415319 3300049582 Bacteria 962
546 Ga0501048_1165455 3300049582 Bacteria 554
547 Ga0501067_0012580 3300049583 Bacteria 4696
548 Ga0501068_0088193 3300049584 Bacteria 1911
549 Ga0501068_0150276 3300049584 Bacteria 1463
550 Ga0501068_1117708 3300049584 Bacteria 521
551 Ga0501068_1129910 3300049584 Bacteria 518
552 Ga0501069_0147284 3300049585 Bacteria 1352
553 Ga0501070_0352624 3300049586 Bacteria 1194
554 Ga0501071_0004781 3300049587 Bacteria 8624
555 Ga0501071_0026788 3300049587 Bacteria 4049
556 Ga0501071_0098306 3300049587 Bacteria 2156
557 Ga0501071_0688194 3300049587 Bacteria 787
558 Ga0501071_0760793 3300049587 Bacteria 746
559 Ga0501072_0003373 3300049588 Bacteria 12011
560 Ga0501072_0100967 3300049588 Bacteria 2293
561 Ga0501072_0105174 3300049588 Bacteria 2244
562 Ga0501072_0127772 3300049588 Bacteria 2025
563 Ga0501072_0507927 3300049588 Bacteria 953
564 Ga0501072_1577159 3300049588 Bacteria 506
565 Ga0501073_0038408 3300049589 Bacteria 3395
566 Ga0501073_0073043 3300049589 Bacteria 2389
567 Ga0501073_0081560 3300049589 Bacteria 2250
568 Ga0501073_0201553 3300049589 Bacteria 1376
569 Ga0501074_0078001 3300049590 Bacteria 2377
570 Ga0501074_0233105 3300049590 Bacteria 1310
571 Ga0501075_0002426 3300049591 Bacteria 12405
572 Ga0501075_0008688 3300049591 Bacteria 7084
573 Ga0501075_0014336 3300049591 Bacteria 5679
574 Ga0501075_0032700 3300049591 Bacteria 3866
575 Ga0501075_1077063 3300049591 Bacteria 610
576 Ga0501076_0000414 3300049592 Bacteria 26787
577 Ga0501076_0007397 3300049592 Bacteria 7991
578 Ga0501076_0038865 3300049592 Bacteria 3735
579 Ga0501076_0175353 3300049592 Bacteria 1747
580 Ga0501076_0202166 3300049592 Bacteria 1622
581 Ga0501076_0212989 3300049592 Bacteria 1579
582 Ga0501077_0002757 3300049593 Bacteria 10533
583 Ga0501077_0027388 3300049593 Bacteria 3619
584 Ga0501077_0094211 3300049593 Bacteria 1898
585 Ga0501077_0293029 3300049593 Bacteria 1036
586 Ga0501202_206281 3300049652 Bacteria 540
587 Ga0501217_199869 3300049661 Bacteria 622
588 Ga0501223_065141 3300049663 Bacteria 715
589 Ga0501243_061746 3300049675 Bacteria 696
590 Ga0501255_082883 3300049684 Bacteria 541
591 Ga0501259_004053 3300049688 Bacteria 2330
592 Ga0501079_0007321 3300049741 Bacteria 8340
593 Ga0501079_0024369 3300049741 Bacteria 4642
594 Ga0501079_0058033 3300049741 Bacteria 2986
595 Ga0501079_0090122 3300049741 Bacteria 2375
596 Ga0501079_0111562 3300049741 Bacteria 2125
597 Ga0501079_0367960 3300049741 Bacteria 1127
598 Ga0501079_1045983 3300049741 Bacteria 643
599 Ga0501079_1172824 3300049741 Bacteria 605
600 Ga0501080_0002336 3300049742 Bacteria 16547
601 Ga0501080_0005323 3300049742 Bacteria 11467
602 Ga0501080_0083865 3300049742 Bacteria 2961
603 Ga0501080_0230187 3300049742 Bacteria 1694
604 Ga0501080_0320490 3300049742 Bacteria 1403
605 Ga0501080_1152737 3300049742 Bacteria 668
606 Ga0501081_0001798 3300049743 Bacteria 13296
607 Ga0501081_0062221 3300049743 Bacteria 2588
608 Ga0501081_0095912 3300049743 Bacteria 2091
609 Ga0501081_0146423 3300049743 Bacteria 1695
610 Ga0501081_0279912 3300049743 Bacteria 1221
611 Ga0501081_0347687 3300049743 Bacteria 1092
612 Ga0501081_1230152 3300049743 Bacteria 567
613 Ga0501083_0054056 3300049744 Bacteria 2695
614 Ga0501083_0071345 3300049744 Bacteria 2309
615 Ga0501083_0087061 3300049744 Bacteria 2066
616 Ga0501083_0670963 3300049744 Bacteria 674
617 Ga0501266_004938 3300049763 Bacteria 1661
618 Ga0501270_005551 3300049767 Bacteria 1471
619 Ga0501035_0009530 3300049822 Bacteria 9031
620 Ga0501035_0061135 3300049822 Bacteria 3353
621 Ga0501035_0126661 3300049822 Bacteria 2229
622 Ga0501035_0195086 3300049822 Bacteria 1739
623 Ga0501035_0399518 3300049822 Bacteria 1144
624 Ga0501035_0557432 3300049822 Bacteria 938
625 Ga0501035_0848889 3300049822 Bacteria 726
626 Ga0501035_0964142 3300049822 Bacteria 672
627 Ga0501044_0092646 3300049823 Bacteria 3047
628 Ga0501044_0321657 3300049823 Bacteria 1471
629 Ga0501044_0342895 3300049823 Bacteria 1415
630 Ga0501044_0351838 3300049823 Bacteria 1392
631 Ga0501044_0490286 3300049823 Bacteria 1131
632 Ga0501044_0635391 3300049823 Bacteria 958
633 Ga0501044_0745126 3300049823 Bacteria 862
634 Ga0501045_0000556 3300049824 Bacteria 23439
635 Ga0501045_0017885 3300049824 Bacteria 5034
636 Ga0501045_0210001 3300049824 Bacteria 1450
637 Ga0501045_1382265 3300049824 Bacteria 511
638 Ga0501212_068128 3300049851 Bacteria 626
639 nmdc:mga05p37_297991_c1 3300050507 Bacteria 1917
640 nmdc:mga0qj67_475138_c1 3300050509 Bacteria 1006
641 nmdc:mga0qj67_47881_c1 3300050509 Bacteria 3378
642 nmdc:mga08y16_59781_c1 3300050511 Bacteria 3981
643 nmdc:mga0n895_60522_c1 3300050512 Bacteria 3737
644 nmdc:mga0rr50_1842_c1 3300050513 Bacteria 11736
645 nmdc:mga08x19_1092_c1 3300050514 Bacteria 16911
646 nmdc:mga08x19_3101_c1 3300050514 Bacteria 9989
647 nmdc:mga0a205_237_c1 3300050515 Bacteria 38953
648 Ga0495619_0654708 3300053085 Bacteria 716
649 Ga0500644_0250730 3300053088 Bacteria 746
650 Ga0500646_0079921 3300053090 Bacteria 996
651 Ga0500583_0055241 3300053092 Bacteria 1856
652 Ga0500562_136194 3300053108 Bacteria 669
653 Ga0500658_0307728 3300053134 Bacteria 728
654 Ga0500604_0232804 3300053151 Bacteria 636
655 Ga0500622_0002211 3300053156 Bacteria 14349
656 Ga0500627_0415652 3300053158 Bacteria 571
657 Ga0500611_005184 3300053727 Bacteria 1817
658 Ga0501084_0014697 3300054114 Bacteria 6492
659 Ga0501084_0021152 3300054114 Bacteria 5425
660 Ga0501084_0075727 3300054114 Bacteria 2819
661 Ga0501084_0599812 3300054114 Bacteria 930
662 Ga0501084_0900349 3300054114 Bacteria 744
663 Ga0501082_0002635 3300060353 Bacteria 15686
664 Ga0501082_0074001 3300060353 Bacteria 2933
665 Ga0501082_0098358 3300060353 Bacteria 2530
666 Ga0501082_0175118 3300060353 Bacteria 1865
667 Ga0501082_0209944 3300060353 Bacteria 1694
668 Ga0501082_0221080 3300060353 Bacteria 1648
669 Ga0501082_1701166 3300060353 Bacteria 550
670 Ga0466962_0000490 3300061719 Bacteria 17174
671 Ga0530510_0001474 3300061734 Bacteria 15795
672 Ga0530510_0061730 3300061734 Bacteria 2713
673 Ga0530510_0070499 3300061734 Bacteria 2537
674 Ga0530510_1262518 3300061734 Bacteria 566
675 Ga0530510_1302092 3300061734 Bacteria 557

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005844 Ga0068862_100442183 Ga0068862_1004421832 87
2 3300013308 Ga0157375_10007013 Ga0157375_100070132 87
3 3300048909 Ga0496106_1472656 Ga0496106_1472656_230_511 87
4 3300049588 Ga0501072_1577159 Ga0501072_1577159_26_307 88
5 3300006358 Ga0068871_100237851 Ga0068871_1002378512 89
6 3300053088 Ga0500644_0250730 Ga0500644_0250730_131_439 89
7 3300053090 Ga0500646_0079921 Ga0500646_0079921_315_623 89
8 3300053156 Ga0500622_0002211 Ga0500622_0002211_8605_8913 89
9 3300039438 Ga0436360_0702009 Ga0436360_0702009_1037_1348 91
10 3300039447 Ga0436361_0748250 Ga0436361_0748250_1094_1405 91
11 iso_pu_bacteria 2547132512 2548848639 91
12 iso_pu_bacteria 2524614729 2525556188 92
13 iso_pu_bacteria 2627854209 2630649418 92
14 iso_pu_bacteria 2739367700 2739732178 92
15 3300028653 Ga0265323_10231957 Ga0265323_102319572 93
16 3300031344 Ga0265316_10008749 Ga0265316_1000874911 93
17 3300035091 Ga0373951_0021974 Ga0373951_0021974_871_1152 93
18 3300041453 Ga0451797_0247884 Ga0451797_0247884_243_524 93
19 3300044673 Ga0453683_0086742 Ga0453683_0086742_223_504 93
20 3300044712 Ga0453684_0019458 Ga0453684_0019458_9693_9974 93
21 3300044712 Ga0453684_0055336 Ga0453684_0055336_4196_4477 93
22 3300049823 Ga0501044_0342895 Ga0501044_0342895_586_867 93
23 iso_pu_bacteria 2537561836 2538834829 93
24 iso_pu_bacteria 2643221562 2643829481 93
25 iso_pu_bacteria 2643221577 2643893750 93
26 iso_pu_bacteria 2643221685 2644475975 93
27 iso_pu_bacteria 2687453130 2687584087 93
28 iso_pu_bacteria 2884411467 2884413682 93
29 iso_pu_bacteria 2928963466 2928964865 93
30 iso_pu_bacteria 2939611941 2939612789 93
31 iso_pu_bacteria 8057160832 8057160929 93
32 3300005618 Ga0068864_101349831 Ga0068864_1013498312 94
33 3300005840 Ga0068870_11247610 Ga0068870_112476101 94
34 3300005841 Ga0068863_100750246 Ga0068863_1007502462 94
35 3300009092 Ga0105250_10000010 Ga0105250_10000010133 94
36 3300009093 Ga0105240_10022420 Ga0105240_100224202 94
37 3300010375 Ga0105239_10101110 Ga0105239_101011103 94
38 3300011119 Ga0105246_10656841 Ga0105246_106568412 94
39 3300014968 Ga0157379_10000022 Ga0157379_1000002236 94
40 3300025903 Ga0207680_10224420 Ga0207680_102244202 94
41 3300025907 Ga0207645_10091903 Ga0207645_100919031 94
42 3300025926 Ga0207659_10640832 Ga0207659_106408322 94
43 3300025933 Ga0207706_10153036 Ga0207706_101530362 94
44 3300025945 Ga0207679_10011450 Ga0207679_100114505 94
45 3300025981 Ga0207640_10646428 Ga0207640_106464281 94
46 3300026023 Ga0207677_10541009 Ga0207677_105410092 94
47 3300026041 Ga0207639_10991217 Ga0207639_109912171 94
48 3300026088 Ga0207641_10648449 Ga0207641_106484492 94
49 3300026095 Ga0207676_11675609 Ga0207676_116756092 94
50 3300029957 Ga0265324_10021632 Ga0265324_100216322 94
51 3300031238 Ga0265332_10007289 Ga0265332_100072895 94
52 3300031344 Ga0265316_10035918 Ga0265316_100359182 94
53 3300031595 Ga0265313_10222042 Ga0265313_102220422 94
54 3300037068 Ga0373925_0087137 Ga0373925_0087137_492_776 94
55 3300044712 Ga0453684_0688373 Ga0453684_0688373_757_1041 94
56 3300045051 Ga0451576_0073592 Ga0451576_0073592_3078_3362 94
57 iso_pu_bacteria 2524614857 2526061043 94
58 iso_pu_bacteria 2739367875 2740062507 94
59 3300005445 Ga0070708_102124676 Ga0070708_1021246761 95
60 3300005546 Ga0070696_100457810 Ga0070696_1004578102 95
61 3300007788 Ga0099795_10000028 Ga0099795_100000286 95
62 3300010159 Ga0099796_10000091 Ga0099796_1000009111 95
63 3300027512 Ga0209179_1000002 Ga0209179_10000026 95
64 3300041452 Ga0451793_0119191 Ga0451793_0119191_183_479 95
65 3300041456 Ga0451795_0155080 Ga0451795_0155080_429_725 95
66 3300041491 Ga0451833_0621084 Ga0451833_0621084_146_442 95
67 3300041494 Ga0451837_0549059 Ga0451837_0549059_364_660 95
68 3300041496 Ga0451839_0570728 Ga0451839_0570728_279_575 95
69 3300041498 Ga0451841_0586404 Ga0451841_0586404_32_328 95
70 3300041505 Ga0451849_1042972 Ga0451849_1042972_991_1287 95
71 3300041509 Ga0451843_1191470 Ga0451843_1191470_509_805 95
72 3300041511 Ga0451855_0017499 Ga0451855_0017499_1030_1326 95
73 3300041512 Ga0451853_0395963 Ga0451853_0395963_332_628 95
74 3300042876 Ga0451577_0028480 Ga0451577_0028480_650_937 95
75 3300044712 Ga0453684_0896542 Ga0453684_0896542_458_751 95
76 3300045051 Ga0451576_0088729 Ga0451576_0088729_2761_3054 95
77 3300045051 Ga0451576_0863179 Ga0451576_0863179_43_330 95
78 3300046459 Ga0495629_0562541 Ga0495629_0562541_170_460 95
79 3300046664 Ga0495659_0508449 Ga0495659_0508449_199_492 95
80 3300046683 Ga0495658_0767993 Ga0495658_0767993_54_344 95
81 3300047472 Ga0495686_0002349 Ga0495686_0002349_11856_12143 95
82 3300048921 Ga0496118_0000271 Ga0496118_0000271_79405_79692 95
83 3300049568 Ga0501031_0121689 Ga0501031_0121689_132_425 95
84 3300049568 Ga0501031_0620371 Ga0501031_0620371_264_557 95
85 3300049569 Ga0501032_0134902 Ga0501032_0134902_987_1280 95
86 3300049570 Ga0501033_0058188 Ga0501033_0058188_1151_1444 95
87 3300049570 Ga0501033_0062713 Ga0501033_0062713_1012_1305 95
88 3300049570 Ga0501033_0412495 Ga0501033_0412495_133_426 95
89 3300049572 Ga0501036_0008597 Ga0501036_0008597_6965_7258 95
90 3300049572 Ga0501036_0383168 Ga0501036_0383168_449_742 95
91 3300049573 Ga0501037_0014426 Ga0501037_0014426_4281_4574 95
92 3300049574 Ga0501038_0041855 Ga0501038_0041855_2820_3113 95
93 3300049574 Ga0501038_0334058 Ga0501038_0334058_45_338 95
94 3300049575 Ga0501039_0002195 Ga0501039_0002195_13594_13887 95
95 3300049575 Ga0501039_0040894 Ga0501039_0040894_2679_2972 95
96 3300049576 Ga0501040_0001530 Ga0501040_0001530_4362_4655 95
97 3300049576 Ga0501040_0062883 Ga0501040_0062883_2089_2382 95
98 3300049576 Ga0501040_0951840 Ga0501040_0951840_187_480 95
99 3300049577 Ga0501041_0008134 Ga0501041_0008134_1166_1459 95
100 3300049577 Ga0501041_0112128 Ga0501041_0112128_61_354 95
101 3300049578 Ga0501042_0007427 Ga0501042_0007427_2518_2811 95
102 3300049578 Ga0501042_0461455 Ga0501042_0461455_513_806 95
103 3300049579 Ga0501043_0229445 Ga0501043_0229445_234_527 95
104 3300049579 Ga0501043_1137418 Ga0501043_1137418_99_392 95
105 3300049580 Ga0501046_0142142 Ga0501046_0142142_960_1253 95
106 3300049580 Ga0501046_0551989 Ga0501046_0551989_441_734 95
107 3300049581 Ga0501047_0578630 Ga0501047_0578630_335_628 95
108 3300049582 Ga0501048_0003654 Ga0501048_0003654_10343_10636 95
109 3300049582 Ga0501048_0186917 Ga0501048_0186917_52_345 95
110 3300049582 Ga0501048_1165455 Ga0501048_1165455_217_510 95
111 3300049584 Ga0501068_0150276 Ga0501068_0150276_78_371 95
112 3300049584 Ga0501068_1117708 Ga0501068_1117708_213_506 95
113 3300049585 Ga0501069_0147284 Ga0501069_0147284_138_431 95
114 3300049587 Ga0501071_0004781 Ga0501071_0004781_5809_6102 95
115 3300049587 Ga0501071_0026788 Ga0501071_0026788_724_1017 95
116 3300049587 Ga0501071_0760793 Ga0501071_0760793_434_727 95
117 3300049588 Ga0501072_0003373 Ga0501072_0003373_9317_9610 95
118 3300049588 Ga0501072_0100967 Ga0501072_0100967_1155_1448 95
119 3300049589 Ga0501073_0073043 Ga0501073_0073043_146_439 95
120 3300049590 Ga0501074_0233105 Ga0501074_0233105_169_462 95
121 3300049591 Ga0501075_0002426 Ga0501075_0002426_5089_5382 95
122 3300049591 Ga0501075_0014336 Ga0501075_0014336_5109_5402 95
123 3300049592 Ga0501076_0000414 Ga0501076_0000414_5610_5903 95
124 3300049592 Ga0501076_0038865 Ga0501076_0038865_1195_1488 95
125 3300049592 Ga0501076_0202166 Ga0501076_0202166_1135_1428 95
126 3300049592 Ga0501076_0212989 Ga0501076_0212989_385_678 95
127 3300049593 Ga0501077_0002757 Ga0501077_0002757_5455_5748 95
128 3300049593 Ga0501077_0293029 Ga0501077_0293029_175_468 95
129 3300049652 Ga0501202_206281 Ga0501202_206281_32_319 95
130 3300049675 Ga0501243_061746 Ga0501243_061746_231_518 95
131 3300049688 Ga0501259_004053 Ga0501259_004053_1824_2111 95
132 3300049741 Ga0501079_0007321 Ga0501079_0007321_3467_3760 95
133 3300049741 Ga0501079_0058033 Ga0501079_0058033_2364_2657 95
134 3300049742 Ga0501080_0002336 Ga0501080_0002336_7879_8172 95
135 3300049742 Ga0501080_0230187 Ga0501080_0230187_112_405 95
136 3300049742 Ga0501080_1152737 Ga0501080_1152737_225_518 95
137 3300049743 Ga0501081_0001798 Ga0501081_0001798_5264_5557 95
138 3300049743 Ga0501081_0146423 Ga0501081_0146423_1116_1409 95
139 3300049743 Ga0501081_0279912 Ga0501081_0279912_121_414 95
140 3300049744 Ga0501083_0054056 Ga0501083_0054056_1144_1437 95
141 3300049744 Ga0501083_0670963 Ga0501083_0670963_202_495 95
142 3300049767 Ga0501270_005551 Ga0501270_005551_1050_1337 95
143 3300049822 Ga0501035_0009530 Ga0501035_0009530_2333_2626 95
144 3300049822 Ga0501035_0061135 Ga0501035_0061135_2655_2948 95
145 3300049822 Ga0501035_0126661 Ga0501035_0126661_1718_2005 95
146 3300049822 Ga0501035_0964142 Ga0501035_0964142_369_662 95
147 3300049823 Ga0501044_0490286 Ga0501044_0490286_575_868 95
148 3300049824 Ga0501045_0000556 Ga0501045_0000556_10022_10315 95
149 3300049824 Ga0501045_1382265 Ga0501045_1382265_168_461 95
150 3300049851 Ga0501212_068128 Ga0501212_068128_19_306 95
151 3300054114 Ga0501084_0075727 Ga0501084_0075727_1490_1783 95
152 3300054114 Ga0501084_0599812 Ga0501084_0599812_250_543 95
153 3300054114 Ga0501084_0900349 Ga0501084_0900349_47_340 95
154 3300060353 Ga0501082_0002635 Ga0501082_0002635_5169_5462 95
155 3300060353 Ga0501082_0098358 Ga0501082_0098358_781_1074 95
156 3300060353 Ga0501082_0209944 Ga0501082_0209944_655_948 95
157 3300061734 Ga0530510_0001474 Ga0530510_0001474_5214_5507 95
158 3300061734 Ga0530510_0070499 Ga0530510_0070499_2110_2403 95
159 iso_pu_bacteria 2571042365 2572254518 95
160 iso_pu_bacteria 2747842501 2748018881 95
161 iso_pu_bacteria 2818991457 2819662732 95
162 iso_pu_bacteria 2842780639 2842781700 95
163 iso_pu_bacteria 2852684882 2852687529 95
164 iso_pu_bacteria 2895395659 2895396611 95
165 iso_pu_bacteria 2919130084 2919134289 95
166 iso_pu_bacteria 2929195423 2929198967 95
167 iso_pu_bacteria 2987605356 2987607997 95
168 iso_pu_bacteria 8021622325 8021625163 95
169 iso_pu_bacteria 8021626552 8021627183 95
170 iso_pu_bacteria 8021648035 8021648538 95
171 3300005435 Ga0070714_100328036 Ga0070714_1003280362 96
172 3300005436 Ga0070713_100455731 Ga0070713_1004557312 96
173 3300005458 Ga0070681_11997704 Ga0070681_119977041 96
174 3300005563 Ga0068855_101654046 Ga0068855_1016540462 96
175 3300005840 Ga0068870_10033093 Ga0068870_100330932 96
176 3300005841 Ga0068863_100791074 Ga0068863_1007910742 96
177 3300009093 Ga0105240_10284018 Ga0105240_102840182 96
178 3300009148 Ga0105243_12411677 Ga0105243_124116772 96
179 3300009174 Ga0105241_10859476 Ga0105241_108594762 96
180 3300009174 Ga0105241_12112590 Ga0105241_121125902 96
181 3300009551 Ga0105238_12959097 Ga0105238_129590971 96
182 3300014326 Ga0157380_10137030 Ga0157380_101370303 96
183 3300017792 Ga0163161_11066445 Ga0163161_110664452 96
184 3300025900 Ga0207710_10030850 Ga0207710_100308502 96
185 3300025903 Ga0207680_10050019 Ga0207680_100500193 96
186 3300025908 Ga0207643_10075223 Ga0207643_100752232 96
187 3300025911 Ga0207654_11373341 Ga0207654_113733411 96
188 3300025913 Ga0207695_10269854 Ga0207695_102698542 96
189 3300025917 Ga0207660_10890768 Ga0207660_108907681 96
190 3300025921 Ga0207652_10263663 Ga0207652_102636632 96
191 3300025924 Ga0207694_11578018 Ga0207694_115780182 96
192 3300025927 Ga0207687_10188341 Ga0207687_101883412 96
193 3300025929 Ga0207664_10110464 Ga0207664_101104642 96
194 3300025931 Ga0207644_10032965 Ga0207644_100329652 96
195 3300025934 Ga0207686_11842101 Ga0207686_118421011 96
196 3300025935 Ga0207709_10745085 Ga0207709_107450852 96
197 3300025938 Ga0207704_10169850 Ga0207704_101698502 96
198 3300025941 Ga0207711_10010944 Ga0207711_100109448 96
199 3300025942 Ga0207689_10062377 Ga0207689_100623772 96
200 3300025960 Ga0207651_10055569 Ga0207651_100555692 96
201 3300025986 Ga0207658_10017465 Ga0207658_100174652 96
202 3300026023 Ga0207677_10040675 Ga0207677_100406754 96
203 3300026035 Ga0207703_10050377 Ga0207703_100503772 96
204 3300026088 Ga0207641_10725985 Ga0207641_107259852 96
205 3300026089 Ga0207648_10801010 Ga0207648_108010102 96
206 3300026095 Ga0207676_10014743 Ga0207676_100147436 96
207 3300028379 Ga0268266_10061566 Ga0268266_100615662 96
208 3300028381 Ga0268264_10133371 Ga0268264_101333713 96
209 3300028573 Ga0265334_10000007 Ga0265334_10000007128 96
210 3300028800 Ga0265338_10909258 Ga0265338_109092582 96
211 3300030760 Ga0265762_1028045 Ga0265762_10280452 96
212 3300031090 Ga0265760_10011206 Ga0265760_100112061 96
213 3300031240 Ga0265320_10267748 Ga0265320_102677482 96
214 3300031595 Ga0265313_10000113 Ga0265313_1000011389 96
215 3300031665 Ga0316575_10063560 Ga0316575_100635602 96
216 3300031665 Ga0316575_10139043 Ga0316575_101390431 96
217 3300031691 Ga0316579_10202242 Ga0316579_102022422 96
218 3300031727 Ga0316576_10261509 Ga0316576_102615092 96
219 3300031728 Ga0316578_10094508 Ga0316578_100945083 96
220 3300031733 Ga0316577_10001489 Ga0316577_100014897 96
221 3300032137 Ga0316585_10034476 Ga0316585_100344762 96
222 3300032137 Ga0316585_10188451 Ga0316585_101884512 96
223 3300032139 Ga0316580_10045982 Ga0316580_100459822 96
224 3300032168 Ga0316593_10231535 Ga0316593_102315352 96
225 3300035118 Ga0373954_0277020 Ga0373954_0277020_335_628 96
226 3300035398 Ga0316574_0003694 Ga0316574_0003694_5739_6029 96
227 3300035398 Ga0316574_0046262 Ga0316574_0046262_1568_1858 96
228 3300035398 Ga0316574_0219224 Ga0316574_0219224_642_932 96
229 3300035398 Ga0316574_0257158 Ga0316574_0257158_53_343 96
230 3300035398 Ga0316574_0586879 Ga0316574_0586879_351_641 96
231 3300035398 Ga0316574_0590256 Ga0316574_0590256_330_620 96
232 3300035398 Ga0316574_0734660 Ga0316574_0734660_87_377 96
233 3300035691 Ga0373931_0257940 Ga0373931_0257940_380_676 96
234 3300036647 Ga0316582_0113748 Ga0316582_0113748_1341_1631 96
235 3300036647 Ga0316582_0158704 Ga0316582_0158704_999_1289 96
236 3300036647 Ga0316582_0519861 Ga0316582_0519861_463_753 96
237 3300036712 Ga0316584_0015404 Ga0316584_0015404_3578_3868 96
238 3300036712 Ga0316584_0156882 Ga0316584_0156882_1143_1433 96
239 3300039437 Ga0436365_0656847 Ga0436365_0656847_531_821 96
240 3300044673 Ga0453683_1159975 Ga0453683_1159975_168_461 96
241 3300048903 Ga0496100_0559713 Ga0496100_0559713_126_428 96
242 3300048907 Ga0496104_0004860 Ga0496104_0004860_6690_6992 96
243 3300048908 Ga0496105_0002578 Ga0496105_0002578_6097_6399 96
244 3300048910 Ga0496107_0209697 Ga0496107_0209697_870_1172 96
245 3300048911 Ga0496108_0008954 Ga0496108_0008954_3154_3456 96
246 3300048912 Ga0496109_0012655 Ga0496109_0012655_6142_6444 96
247 3300048913 Ga0496110_0081072 Ga0496110_0081072_1171_1473 96
248 3300048914 Ga0496111_0002702 Ga0496111_0002702_8633_8935 96
249 3300048916 Ga0496113_0860891 Ga0496113_0860891_298_600 96
250 3300048917 Ga0496114_0083260 Ga0496114_0083260_1056_1358 96
251 3300049571 Ga0501034_1687466 Ga0501034_1687466_76_366 96
252 3300049684 Ga0501255_082883 Ga0501255_082883_76_381 96
253 3300005288 Ga0065714_10433482 Ga0065714_104334822 97
254 3300005289 Ga0065704_10508426 Ga0065704_105084262 97
255 3300005290 Ga0065712_10037529 Ga0065712_100375292 97
256 3300005290 Ga0065712_10270178 Ga0065712_102701782 97
257 3300005293 Ga0065715_10228295 Ga0065715_102282952 97
258 3300005293 Ga0065715_10463170 Ga0065715_104631702 97
259 3300005334 Ga0068869_100125916 Ga0068869_1001259162 97
260 3300005354 Ga0070675_101883526 Ga0070675_1018835262 97
261 3300005364 Ga0070673_100013760 Ga0070673_1000137602 97
262 3300005437 Ga0070710_10722778 Ga0070710_107227782 97
263 3300005438 Ga0070701_10462021 Ga0070701_104620211 97
264 3300005440 Ga0070705_101320259 Ga0070705_1013202592 97
265 3300005459 Ga0068867_101630007 Ga0068867_1016300072 97
266 3300005535 Ga0070684_101340236 Ga0070684_1013402362 97
267 3300005543 Ga0070672_100412610 Ga0070672_1004126102 97
268 3300005545 Ga0070695_100126647 Ga0070695_1001266472 97
269 3300005546 Ga0070696_100006453 Ga0070696_1000064532 97
270 3300005546 Ga0070696_100365609 Ga0070696_1003656092 97
271 3300005549 Ga0070704_100082361 Ga0070704_1000823611 97
272 3300005577 Ga0068857_101113759 Ga0068857_1011137592 97
273 3300005617 Ga0068859_100606518 Ga0068859_1006065182 97
274 3300005719 Ga0068861_100959644 Ga0068861_1009596442 97
275 3300005840 Ga0068870_10221291 Ga0068870_102212912 97
276 3300005843 Ga0068860_101369562 Ga0068860_1013695622 97
277 3300005844 Ga0068862_100717912 Ga0068862_1007179122 97
278 3300006173 Ga0070716_100045012 Ga0070716_1000450122 97
279 3300006881 Ga0068865_100376550 Ga0068865_1003765502 97
280 3300006931 Ga0097620_100606513 Ga0097620_1006065132 97
281 3300007265 Ga0099794_10062491 Ga0099794_100624912 97
282 3300007788 Ga0099795_10000378 Ga0099795_100003784 97
283 3300009551 Ga0105238_10966112 Ga0105238_109661121 97
284 3300009984 Ga0105029_113209 Ga0105029_1132092 97
285 3300009987 Ga0105030_100289 Ga0105030_1002892 97
286 3300010159 Ga0099796_10000149 Ga0099796_100001496 97
287 3300013104 Ga0157370_10302845 Ga0157370_103028453 97
288 3300013874 Ga0157514_105533 Ga0157514_1055332 97
289 3300014326 Ga0157380_10075546 Ga0157380_100755463 97
290 3300014745 Ga0157377_11321378 Ga0157377_113213782 97
291 3300014968 Ga0157379_11794745 Ga0157379_117947452 97
292 3300015685 Ga0183369_1007 Ga0183369_100792 97
293 3300017792 Ga0163161_11791891 Ga0163161_117918912 97
294 3300021377 Ga0213874_10031626 Ga0213874_100316262 97
295 3300025711 Ga0207696_1000159 Ga0207696_100015989 97
296 3300025893 Ga0207682_10081496 Ga0207682_100814962 97
297 3300025905 Ga0207685_10156458 Ga0207685_101564582 97
298 3300025907 Ga0207645_10005481 Ga0207645_100054817 97
299 3300025908 Ga0207643_10150735 Ga0207643_101507352 97
300 3300025909 Ga0207705_10638438 Ga0207705_106384382 97
301 3300025916 Ga0207663_10052499 Ga0207663_100524992 97
302 3300025917 Ga0207660_10331192 Ga0207660_103311922 97
303 3300025919 Ga0207657_10203303 Ga0207657_102033032 97
304 3300025923 Ga0207681_10109885 Ga0207681_101098852 97
305 3300025926 Ga0207659_10020969 Ga0207659_100209694 97
306 3300025928 Ga0207700_10096564 Ga0207700_100965641 97
307 3300025929 Ga0207664_10027618 Ga0207664_100276185 97
308 3300025932 Ga0207690_11441865 Ga0207690_114418652 97
309 3300025933 Ga0207706_10001774 Ga0207706_1000177414 97
310 3300025937 Ga0207669_10008044 Ga0207669_100080445 97
311 3300025937 Ga0207669_10239972 Ga0207669_102399722 97
312 3300025938 Ga0207704_10019262 Ga0207704_100192622 97
313 3300025938 Ga0207704_10174581 Ga0207704_101745812 97
314 3300025939 Ga0207665_10260663 Ga0207665_102606632 97
315 3300025940 Ga0207691_10001282 Ga0207691_1000128219 97
316 3300025940 Ga0207691_10089309 Ga0207691_100893094 97
317 3300025942 Ga0207689_10174723 Ga0207689_101747233 97
318 3300025960 Ga0207651_10289076 Ga0207651_102890762 97
319 3300025961 Ga0207712_10452549 Ga0207712_104525492 97
320 3300025972 Ga0207668_10057659 Ga0207668_100576593 97
321 3300026041 Ga0207639_10306005 Ga0207639_103060051 97
322 3300026089 Ga0207648_10002228 Ga0207648_100022283 97
323 3300026089 Ga0207648_10523602 Ga0207648_105236022 97
324 3300026095 Ga0207676_11661801 Ga0207676_116618011 97
325 3300026118 Ga0207675_100002928 Ga0207675_10000292812 97
326 3300027424 Ga0209984_1001688 Ga0209984_10016882 97
327 3300027462 Ga0210000_1047213 Ga0210000_10472132 97
328 3300027512 Ga0209179_1001261 Ga0209179_10012612 97
329 3300027552 Ga0209982_1038806 Ga0209982_10388062 97
330 3300027614 Ga0209970_1000691 Ga0209970_10006917 97
331 3300027614 Ga0209970_1021002 Ga0209970_10210022 97
332 3300027617 Ga0210002_1001343 Ga0210002_10013432 97
333 3300027665 Ga0209983_1001442 Ga0209983_10014422 97
334 3300027665 Ga0209983_1051649 Ga0209983_10516493 97
335 3300027682 Ga0209971_1000129 Ga0209971_10001298 97
336 3300027717 Ga0209998_10000502 Ga0209998_1000050210 97
337 3300027876 Ga0209974_10002902 Ga0209974_100029026 97
338 3300027876 Ga0209974_10024493 Ga0209974_100244932 97
339 3300027907 Ga0207428_10062402 Ga0207428_100624022 97
340 3300028380 Ga0268265_10010958 Ga0268265_100109584 97
341 3300028381 Ga0268264_11318084 Ga0268264_113180842 97
342 3300031507 Ga0307509_10803985 Ga0307509_108039852 97
343 3300031730 Ga0307516_10026943 Ga0307516_100269432 97
344 3300031824 Ga0307413_10186342 Ga0307413_101863422 97
345 3300031852 Ga0307410_10015175 Ga0307410_100151755 97
346 3300031901 Ga0307406_10263410 Ga0307406_102634101 97
347 3300031995 Ga0307409_100225859 Ga0307409_1002258592 97
348 3300032002 Ga0307416_103280123 Ga0307416_1032801232 97
349 3300032004 Ga0307414_10046240 Ga0307414_100462401 97
350 3300032005 Ga0307411_10011081 Ga0307411_100110815 97
351 3300035089 Ga0373944_0213894 Ga0373944_0213894_386_682 97
352 3300035171 Ga0373946_0079462 Ga0373946_0079462_245_541 97
353 3300035410 Ga0373924_0054559 Ga0373924_0054559_142_438 97
354 3300035724 Ga0373933_0313697 Ga0373933_0313697_142_438 97
355 3300036401 Ga0373937_0138498 Ga0373937_0138498_738_1034 97
356 3300037068 Ga0373925_1097402 Ga0373925_1097402_59_355 97
357 3300039110 Ga0400487_26052 Ga0400487_26052_12633_12926 97
358 3300039437 Ga0436365_0681911 Ga0436365_0681911_882_1184 97
359 3300039438 Ga0436360_0643048 Ga0436360_0643048_130_432 97
360 3300039438 Ga0436360_0863835 Ga0436360_0863835_267_569 97
361 3300039450 Ga0436363_1604190 Ga0436363_1604190_621_923 97
362 3300041408 Ga0439453_0002338 Ga0439453_0002338_1522_1821 97
363 3300041410 Ga0439461_0023606 Ga0439461_0023606_608_907 97
364 3300041507 Ga0451851_1238763 Ga0451851_1238763_93_386 97
365 3300041997 Ga0439431_0048804 Ga0439431_0048804_309_608 97
366 3300042001 Ga0439441_057724 Ga0439441_057724_134_433 97
367 3300042002 Ga0439442_010813 Ga0439442_010813_980_1279 97
368 3300042003 Ga0439443_000122 Ga0439443_000122_1851_2150 97
369 3300042011 Ga0439454_046867 Ga0439454_046867_91_390 97
370 3300042013 Ga0439456_055462 Ga0439456_055462_217_516 97
371 3300042014 Ga0439457_181280 Ga0439457_181280_60_359 97
372 3300042116 Ga0450912_000483 Ga0450912_000483_852_1151 97
373 3300042119 Ga0450915_004233 Ga0450915_004233_462_761 97
374 3300042122 Ga0450920_003038 Ga0450920_003038_57_356 97
375 3300042123 Ga0450921_009560 Ga0450921_009560_146_451 97
376 3300042124 Ga0450922_008479 Ga0450922_008479_608_907 97
377 3300042125 Ga0450923_000037 Ga0450923_000037_7927_8229 97
378 3300042125 Ga0450923_003535 Ga0450923_003535_969_1268 97
379 3300042125 Ga0450923_016062 Ga0450923_016062_879_1184 97
380 3300042126 Ga0450888_020100 Ga0450888_020100_464_766 97
381 3300042128 Ga0450897_003390 Ga0450897_003390_213_512 97
382 3300042129 Ga0450891_014805 Ga0450891_014805_339_641 97
383 3300042131 Ga0450894_002188 Ga0450894_002188_1685_1984 97
384 3300042133 Ga0450896_002393 Ga0450896_002393_1780_2085 97
385 3300042146 Ga0450907_003860 Ga0450907_003860_1639_1938 97
386 3300042156 Ga0439446_0008710 Ga0439446_0008710_2141_2440 97
387 3300042156 Ga0439446_0031143 Ga0439446_0031143_29_328 97
388 3300042156 Ga0439446_0032719 Ga0439446_0032719_857_1159 97
389 3300042184 Ga0450908_006385 Ga0450908_006385_690_989 97
390 3300042435 Ga0439434_0004130 Ga0439434_0004130_1821_2120 97
391 3300042436 Ga0439435_0000050 Ga0439435_0000050_8473_8772 97
392 3300042437 Ga0439444_0010325 Ga0439444_0010325_535_834 97
393 3300042461 Ga0439460_0001301 Ga0439460_0001301_3166_3465 97
394 3300042461 Ga0439460_0283617 Ga0439460_0283617_138_440 97
395 3300042531 Ga0450918_003009 Ga0450918_003009_2664_2963 97
396 3300042532 Ga0450893_0059584 Ga0450893_0059584_340_639 97
397 3300046459 Ga0495629_1100086 Ga0495629_1100086_14_310 97
398 3300046472 Ga0495580_0120003 Ga0495580_0120003_447_743 97
399 3300046516 Ga0495628_0567753 Ga0495628_0567753_408_704 97
400 3300046519 Ga0495632_0070130 Ga0495632_0070130_90_398 97
401 3300046525 Ga0495663_0200465 Ga0495663_0200465_240_545 97
402 3300046533 Ga0495640_0598782 Ga0495640_0598782_203_499 97
403 3300048088 Ga0495602_0941295 Ga0495602_0941295_217_513 97
404 3300048904 Ga0496101_0151071 Ga0496101_0151071_988_1284 97
405 3300048907 Ga0496104_0003488 Ga0496104_0003488_3103_3399 97
406 3300048908 Ga0496105_0004476 Ga0496105_0004476_7553_7849 97
407 3300048910 Ga0496107_0050755 Ga0496107_0050755_412_708 97
408 3300048914 Ga0496111_0260524 Ga0496111_0260524_26_322 97
409 3300048917 Ga0496114_0000823 Ga0496114_0000823_3173_3469 97
410 3300048918 Ga0496115_0002092 Ga0496115_0002092_8506_8802 97
411 3300049568 Ga0501031_0042920 Ga0501031_0042920_1023_1322 97
412 3300049569 Ga0501032_0064237 Ga0501032_0064237_1276_1584 97
413 3300049569 Ga0501032_0074655 Ga0501032_0074655_477_776 97
414 3300049569 Ga0501032_0408169 Ga0501032_0408169_554_853 97
415 3300049570 Ga0501033_0397867 Ga0501033_0397867_152_445 97
416 3300049570 Ga0501033_0890394 Ga0501033_0890394_89_388 97
417 3300049570 Ga0501033_1017502 Ga0501033_1017502_141_440 97
418 3300049571 Ga0501034_0267815 Ga0501034_0267815_809_1117 97
419 3300049571 Ga0501034_1378498 Ga0501034_1378498_53_352 97
420 3300049572 Ga0501036_0071911 Ga0501036_0071911_984_1283 97
421 3300049572 Ga0501036_1672112 Ga0501036_1672112_127_426 97
422 3300049573 Ga0501037_0134054 Ga0501037_0134054_1146_1445 97
423 3300049573 Ga0501037_0454785 Ga0501037_0454785_170_478 97
424 3300049573 Ga0501037_0646240 Ga0501037_0646240_375_674 97
425 3300049574 Ga0501038_0083088 Ga0501038_0083088_1843_2142 97
426 3300049574 Ga0501038_0403418 Ga0501038_0403418_259_558 97
427 3300049574 Ga0501038_0405661 Ga0501038_0405661_150_449 97
428 3300049574 Ga0501038_0447253 Ga0501038_0447253_258_566 97
429 3300049575 Ga0501039_0840749 Ga0501039_0840749_71_370 97
430 3300049575 Ga0501039_0945204 Ga0501039_0945204_102_401 97
431 3300049575 Ga0501039_1542544 Ga0501039_1542544_84_386 97
432 3300049576 Ga0501040_0191374 Ga0501040_0191374_1015_1317 97
433 3300049576 Ga0501040_0200992 Ga0501040_0200992_785_1084 97
434 3300049577 Ga0501041_0047303 Ga0501041_0047303_1863_2165 97
435 3300049577 Ga0501041_0748290 Ga0501041_0748290_58_357 97
436 3300049578 Ga0501042_0035687 Ga0501042_0035687_171_473 97
437 3300049578 Ga0501042_0071439 Ga0501042_0071439_1789_2088 97
438 3300049578 Ga0501042_0378854 Ga0501042_0378854_340_639 97
439 3300049579 Ga0501043_0016518 Ga0501043_0016518_4697_5005 97
440 3300049580 Ga0501046_0010394 Ga0501046_0010394_266_574 97
441 3300049580 Ga0501046_0046492 Ga0501046_0046492_1462_1761 97
442 3300049580 Ga0501046_0544064 Ga0501046_0544064_113_421 97
443 3300049580 Ga0501046_0557359 Ga0501046_0557359_308_610 97
444 3300049581 Ga0501047_0139382 Ga0501047_0139382_1918_2217 97
445 3300049581 Ga0501047_0142335 Ga0501047_0142335_1849_2157 97
446 3300049582 Ga0501048_0086117 Ga0501048_0086117_1170_1469 97
447 3300049582 Ga0501048_0415319 Ga0501048_0415319_374_676 97
448 3300049583 Ga0501067_0012580 Ga0501067_0012580_1736_2035 97
449 3300049584 Ga0501068_0088193 Ga0501068_0088193_1415_1714 97
450 3300049584 Ga0501068_1129910 Ga0501068_1129910_18_320 97
451 3300049587 Ga0501071_0098306 Ga0501071_0098306_1229_1528 97
452 3300049588 Ga0501072_0105174 Ga0501072_0105174_156_458 97
453 3300049588 Ga0501072_0127772 Ga0501072_0127772_941_1240 97
454 3300049588 Ga0501072_0507927 Ga0501072_0507927_592_891 97
455 3300049589 Ga0501073_0038408 Ga0501073_0038408_503_802 97
456 3300049589 Ga0501073_0081560 Ga0501073_0081560_1705_2004 97
457 3300049589 Ga0501073_0201553 Ga0501073_0201553_144_446 97
458 3300049590 Ga0501074_0078001 Ga0501074_0078001_265_564 97
459 3300049591 Ga0501075_0008688 Ga0501075_0008688_98_400 97
460 3300049591 Ga0501075_0032700 Ga0501075_0032700_1799_2098 97
461 3300049591 Ga0501075_1077063 Ga0501075_1077063_201_503 97
462 3300049592 Ga0501076_0007397 Ga0501076_0007397_1641_1943 97
463 3300049592 Ga0501076_0175353 Ga0501076_0175353_234_533 97
464 3300049593 Ga0501077_0027388 Ga0501077_0027388_2819_3118 97
465 3300049593 Ga0501077_0094211 Ga0501077_0094211_1581_1883 97
466 3300049741 Ga0501079_0024369 Ga0501079_0024369_2059_2358 97
467 3300049741 Ga0501079_0090122 Ga0501079_0090122_408_710 97
468 3300049741 Ga0501079_0111562 Ga0501079_0111562_261_560 97
469 3300049741 Ga0501079_0367960 Ga0501079_0367960_38_340 97
470 3300049741 Ga0501079_1045983 Ga0501079_1045983_198_497 97
471 3300049741 Ga0501079_1172824 Ga0501079_1172824_200_499 97
472 3300049742 Ga0501080_0005323 Ga0501080_0005323_3700_3999 97
473 3300049742 Ga0501080_0083865 Ga0501080_0083865_1706_2005 97
474 3300049742 Ga0501080_0320490 Ga0501080_0320490_1083_1382 97
475 3300049743 Ga0501081_0062221 Ga0501081_0062221_1761_2063 97
476 3300049743 Ga0501081_0095912 Ga0501081_0095912_619_918 97
477 3300049743 Ga0501081_0347687 Ga0501081_0347687_621_920 97
478 3300049743 Ga0501081_1230152 Ga0501081_1230152_38_340 97
479 3300049744 Ga0501083_0071345 Ga0501083_0071345_978_1280 97
480 3300049744 Ga0501083_0087061 Ga0501083_0087061_523_822 97
481 3300049822 Ga0501035_0399518 Ga0501035_0399518_490_789 97
482 3300049822 Ga0501035_0557432 Ga0501035_0557432_390_689 97
483 3300049822 Ga0501035_0848889 Ga0501035_0848889_211_510 97
484 3300049823 Ga0501044_0092646 Ga0501044_0092646_2669_2968 97
485 3300049823 Ga0501044_0635391 Ga0501044_0635391_440_733 97
486 3300049823 Ga0501044_0745126 Ga0501044_0745126_493_786 97
487 3300049824 Ga0501045_0017885 Ga0501045_0017885_1246_1545 97
488 3300049824 Ga0501045_0210001 Ga0501045_0210001_238_540 97
489 3300050507 nmdc:mga05p37_297991_c1 nmdc:mga05p37_297991_c1_596_901 97
490 3300050509 nmdc:mga0qj67_47881_c1 nmdc:mga0qj67_47881_c1_1891_2196 97
491 3300050511 nmdc:mga08y16_59781_c1 nmdc:mga08y16_59781_c1_1398_1703 97
492 3300053085 Ga0495619_0654708 Ga0495619_0654708_45_341 97
493 3300053092 Ga0500583_0055241 Ga0500583_0055241_34_342 97
494 3300053108 Ga0500562_136194 Ga0500562_136194_58_366 97
495 3300053134 Ga0500658_0307728 Ga0500658_0307728_100_408 97
496 3300053158 Ga0500627_0415652 Ga0500627_0415652_58_354 97
497 3300053727 Ga0500611_005184 Ga0500611_005184_94_402 97
498 3300054114 Ga0501084_0014697 Ga0501084_0014697_3647_3946 97
499 3300054114 Ga0501084_0021152 Ga0501084_0021152_3323_3625 97
500 3300060353 Ga0501082_0074001 Ga0501082_0074001_580_882 97
501 3300060353 Ga0501082_0175118 Ga0501082_0175118_1198_1497 97
502 3300060353 Ga0501082_0221080 Ga0501082_0221080_559_858 97
503 3300060353 Ga0501082_1701166 Ga0501082_1701166_99_401 97
504 3300061734 Ga0530510_0061730 Ga0530510_0061730_849_1151 97
505 3300061734 Ga0530510_1262518 Ga0530510_1262518_58_357 97
506 3300061734 Ga0530510_1302092 Ga0530510_1302092_191_490 97
507 3300005440 Ga0070705_100195860 Ga0070705_1001958602 98
508 3300006846 Ga0075430_100089700 Ga0075430_1000897003 98
509 3300009978 Ga0105148_102895 Ga0105148_1028952 98
510 3300012510 Ga0157316_1060899 Ga0157316_10608991 98
511 3300025937 Ga0207669_10189023 Ga0207669_101890232 98
512 3300028800 Ga0265338_10086571 Ga0265338_100865713 98
513 3300031507 Ga0307509_10511161 Ga0307509_105111612 98
514 3300031665 Ga0316575_10173400 Ga0316575_101734002 98
515 3300031665 Ga0316575_10336695 Ga0316575_103366952 98
516 3300031691 Ga0316579_10005865 Ga0316579_100058652 98
517 3300031691 Ga0316579_10008512 Ga0316579_100085122 98
518 3300031691 Ga0316579_10033499 Ga0316579_100334992 98
519 3300031727 Ga0316576_10029909 Ga0316576_100299092 98
520 3300031727 Ga0316576_10082102 Ga0316576_100821023 98
521 3300031728 Ga0316578_10023208 Ga0316578_100232082 98
522 3300031728 Ga0316578_10665469 Ga0316578_106654692 98
523 3300031733 Ga0316577_10017794 Ga0316577_100177942 98
524 3300031733 Ga0316577_10034105 Ga0316577_100341053 98
525 3300031733 Ga0316577_10052630 Ga0316577_100526302 98
526 3300031733 Ga0316577_10058605 Ga0316577_100586052 98
527 3300031733 Ga0316577_10546988 Ga0316577_105469882 98
528 3300032002 Ga0307416_100778340 Ga0307416_1007783402 98
529 3300032126 Ga0307415_100180168 Ga0307415_1001801682 98
530 3300032133 Ga0316583_10040516 Ga0316583_100405161 98
531 3300032137 Ga0316585_10021463 Ga0316585_100214632 98
532 3300032137 Ga0316585_10160774 Ga0316585_101607742 98
533 3300032139 Ga0316580_10027668 Ga0316580_100276682 98
534 3300032168 Ga0316593_10008121 Ga0316593_100081212 98
535 3300033529 Ga0316587_1014395 Ga0316587_10143952 98
536 3300035398 Ga0316574_0009003 Ga0316574_0009003_3489_3785 98
537 3300035398 Ga0316574_0161201 Ga0316574_0161201_818_1114 98
538 3300035398 Ga0316574_0201990 Ga0316574_0201990_331_627 98
539 3300035398 Ga0316574_0533480 Ga0316574_0533480_256_552 98
540 3300036647 Ga0316582_0006517 Ga0316582_0006517_4625_4921 98
541 3300036647 Ga0316582_0019885 Ga0316582_0019885_2010_2306 98
542 3300036647 Ga0316582_0033134 Ga0316582_0033134_328_624 98
543 3300036647 Ga0316582_0200058 Ga0316582_0200058_762_1058 98
544 3300036712 Ga0316584_0333176 Ga0316584_0333176_230_526 98
545 3300036712 Ga0316584_0338734 Ga0316584_0338734_240_536 98
546 3300036712 Ga0316584_0349718 Ga0316584_0349718_344_640 98
547 3300037588 Ga0316581_0022497 Ga0316581_0022497_648_944 98
548 3300037588 Ga0316581_0024365 Ga0316581_0024365_1151_1447 98
549 3300044673 Ga0453683_0150554 Ga0453683_0150554_257_565 98
550 3300044712 Ga0453684_0008869 Ga0453684_0008869_8263_8565 98
551 3300045051 Ga0451576_0942091 Ga0451576_0942091_535_837 98
552 3300046694 Ga0495649_0183867 Ga0495649_0183867_543_845 98
553 3300049572 Ga0501036_1171042 Ga0501036_1171042_39_344 98
554 3300049587 Ga0501071_0688194 Ga0501071_0688194_110_415 98
555 3300050509 nmdc:mga0qj67_475138_c1 nmdc:mga0qj67_475138_c1_12_317 98
556 2162886007 SwRhRL2b_contig_3396017 SwRhRL2b_0276.00007290 99
557 3300003856 Ga0058692_1000032 Ga0058692_1000032140 99
558 3300005289 Ga0065704_10071825 Ga0065704_100718251 99
559 3300005331 Ga0070670_100011189 Ga0070670_1000111897 99
560 3300005331 Ga0070670_100440567 Ga0070670_1004405672 99
561 3300005345 Ga0070692_10446391 Ga0070692_104463912 99
562 3300005347 Ga0070668_100257185 Ga0070668_1002571852 99
563 3300005353 Ga0070669_100006914 Ga0070669_1000069147 99
564 3300005353 Ga0070669_101412992 Ga0070669_1014129922 99
565 3300005355 Ga0070671_100568056 Ga0070671_1005680562 99
566 3300005444 Ga0070694_101031481 Ga0070694_1010314812 99
567 3300005459 Ga0068867_100263053 Ga0068867_1002630533 99
568 3300005543 Ga0070672_100006730 Ga0070672_1000067306 99
569 3300005564 Ga0070664_100778683 Ga0070664_1007786832 99
570 3300005564 Ga0070664_101149351 Ga0070664_1011493512 99
571 3300006852 Ga0075433_10000063 Ga0075433_1000006339 99
572 3300006914 Ga0075436_100001594 Ga0075436_10000159411 99
573 3300006914 Ga0075436_100007279 Ga0075436_1000072795 99
574 3300007076 Ga0075435_100000215 Ga0075435_10000021518 99
575 3300009011 Ga0105251_10000509 Ga0105251_1000050912 99
576 3300009148 Ga0105243_10021218 Ga0105243_100212186 99
577 3300009148 Ga0105243_10349256 Ga0105243_103492562 99
578 3300009177 Ga0105248_12176294 Ga0105248_121762942 99
579 3300009177 Ga0105248_13022903 Ga0105248_130229031 99
580 3300012485 Ga0157325_1014751 Ga0157325_10147512 99
581 3300013306 Ga0163162_11124643 Ga0163162_111246433 99
582 3300015265 Ga0182005_1008069 Ga0182005_10080694 99
583 3300017792 Ga0163161_11465808 Ga0163161_114658082 99
584 3300025735 Ga0207713_1000856 Ga0207713_100085626 99
585 3300025917 Ga0207660_10184838 Ga0207660_101848382 99
586 3300025917 Ga0207660_11327407 Ga0207660_113274071 99
587 3300025919 Ga0207657_10287143 Ga0207657_102871431 99
588 3300025923 Ga0207681_10012758 Ga0207681_100127586 99
589 3300025925 Ga0207650_10001502 Ga0207650_1000150211 99
590 3300025932 Ga0207690_10888030 Ga0207690_108880302 99
591 3300025935 Ga0207709_10011282 Ga0207709_100112826 99
592 3300025940 Ga0207691_10005952 Ga0207691_100059525 99
593 3300025941 Ga0207711_11637724 Ga0207711_116377241 99
594 3300025945 Ga0207679_10168633 Ga0207679_101686332 99
595 3300025945 Ga0207679_10242950 Ga0207679_102429502 99
596 3300025986 Ga0207658_10203106 Ga0207658_102031061 99
597 3300026089 Ga0207648_10191417 Ga0207648_101914172 99
598 3300027312 Ga0209371_1000055 Ga0209371_100005534 99
599 3300030500 Ga0268256_1000054 Ga0268256_1000054200 99
600 3300031235 Ga0265330_10000073 Ga0265330_1000007370 99
601 3300031235 Ga0265330_10122665 Ga0265330_101226652 99
602 3300031238 Ga0265332_10041853 Ga0265332_100418532 99
603 3300031247 Ga0265340_10152366 Ga0265340_101523661 99
604 3300031249 Ga0265339_10083048 Ga0265339_100830482 99
605 3300031344 Ga0265316_10011568 Ga0265316_100115688 99
606 3300031344 Ga0265316_10542015 Ga0265316_105420151 99
607 3300031344 Ga0265316_10607998 Ga0265316_106079981 99
608 3300031344 Ga0265316_10879067 Ga0265316_108790672 99
609 3300031712 Ga0265342_10000056 Ga0265342_1000005684 99
610 3300031731 Ga0307405_10582531 Ga0307405_105825312 99
611 3300031852 Ga0307410_10457387 Ga0307410_104573872 99
612 3300031901 Ga0307406_11006726 Ga0307406_110067262 99
613 3300031903 Ga0307407_10116983 Ga0307407_101169832 99
614 3300031911 Ga0307412_10144353 Ga0307412_101443532 99
615 3300032004 Ga0307414_10057493 Ga0307414_100574932 99
616 3300032004 Ga0307414_10973912 Ga0307414_109739122 99
617 3300032005 Ga0307411_10159906 Ga0307411_101599062 99
618 3300037312 Ga0395899_0043235 Ga0395899_0043235_1282_1584 99
619 3300037312 Ga0395899_0959672 Ga0395899_0959672_88_387 99
620 3300037418 Ga0395900_0019454 Ga0395900_0019454_6283_6585 99
621 3300037418 Ga0395900_0036109 Ga0395900_0036109_4579_4896 99
622 3300037418 Ga0395900_0175846 Ga0395900_0175846_367_669 99
623 3300037466 Ga0395898_0005586 Ga0395898_0005586_8858_9160 99
624 3300037471 Ga0395905_0963302 Ga0395905_0963302_102_404 99
625 3300037471 Ga0395905_1068518 Ga0395905_1068518_238_537 99
626 3300038443 Ga0395901_0000161 Ga0395901_0000161_54317_54619 99
627 3300038443 Ga0395901_0377700 Ga0395901_0377700_540_842 99
628 3300038443 Ga0395901_0412795 Ga0395901_0412795_16_333 99
629 3300041404 Ga0439436_0045616 Ga0439436_0045616_240_554 99
630 3300041411 Ga0439466_0127793 Ga0439466_0127793_306_620 99
631 3300041456 Ga0451795_0478428 Ga0451795_0478428_169_468 99
632 3300041491 Ga0451833_0858295 Ga0451833_0858295_49_348 99
633 3300041494 Ga0451837_1251020 Ga0451837_1251020_135_449 99
634 3300042006 Ga0439432_003922 Ga0439432_003922_103_417 99
635 3300042015 Ga0439462_0012111 Ga0439462_0012111_1092_1406 99
636 3300044656 Ga0466969_0032744 Ga0466969_0032744_1152_1454 99
637 3300044658 Ga0466972_0045778 Ga0466972_0045778_559_861 99
638 3300044672 Ga0466982_0000005 Ga0466982_0000005_145859_146161 99
639 3300044684 Ga0466966_0013932 Ga0466966_0013932_4310_4612 99
640 3300044693 Ga0466961_0114757 Ga0466961_0114757_360_662 99
641 3300044706 Ga0466964_0006458 Ga0466964_0006458_888_1190 99
642 3300044712 Ga0453684_0048951 Ga0453684_0048951_66_377 99
643 3300044719 Ga0466971_0039519 Ga0466971_0039519_1804_2106 99
644 3300044735 Ga0466968_0009985 Ga0466968_0009985_2333_2635 99
645 3300044765 Ga0466970_0035286 Ga0466970_0035286_1700_2002 99
646 3300044901 Ga0466960_0022968 Ga0466960_0022968_1072_1374 99
647 3300046474 Ga0495605_0261682 Ga0495605_0261682_186_485 99
648 3300046507 Ga0495606_0007588 Ga0495606_0007588_5972_6271 99
649 3300046512 Ga0495610_0071454 Ga0495610_0071454_593_892 99
650 3300046513 Ga0495616_0451314 Ga0495616_0451314_23_322 99
651 3300046518 Ga0495631_0529368 Ga0495631_0529368_117_416 99
652 3300046519 Ga0495632_0086898 Ga0495632_0086898_136_435 99
653 3300046537 Ga0495598_0016212 Ga0495598_0016212_957_1286 99
654 3300046539 Ga0495621_0009256 Ga0495621_0009256_2063_2392 99
655 3300046558 Ga0495633_0073065 Ga0495633_0073065_871_1170 99
656 3300046615 Ga0495656_0122175 Ga0495656_0122175_602_952 99
657 3300046615 Ga0495656_0674888 Ga0495656_0674888_96_425 99
658 3300046810 Ga0495660_0244694 Ga0495660_0244694_161_460 99
659 3300047318 Ga0495636_0047655 Ga0495636_0047655_796_1110 99
660 3300047318 Ga0495636_0391878 Ga0495636_0391878_277_591 99
661 3300047447 Ga0495685_071561 Ga0495685_071561_528_842 99
662 3300047470 Ga0495681_0061985 Ga0495681_0061985_1288_1587 99
663 3300048904 Ga0496101_0303429 Ga0496101_0303429_509_853 99
664 3300048911 Ga0496108_0045283 Ga0496108_0045283_2055_2399 99
665 3300048912 Ga0496109_0309782 Ga0496109_0309782_542_886 99
666 3300048912 Ga0496109_1144552 Ga0496109_1144552_367_690 99
667 3300048917 Ga0496114_0178701 Ga0496114_0178701_85_384 99
668 3300048920 Ga0496117_0020667 Ga0496117_0020667_1541_1840 99
669 3300048921 Ga0496118_0028666 Ga0496118_0028666_230_529 99
670 3300048921 Ga0496118_0106945 Ga0496118_0106945_1496_1795 99
671 3300048922 Ga0496119_0001083 Ga0496119_0001083_3263_3562 99
672 3300048923 Ga0496120_0000537 Ga0496120_0000537_30995_31294 99
673 3300048925 Ga0496122_0000859 Ga0496122_0000859_31293_31592 99
674 3300048925 Ga0496122_0023840 Ga0496122_0023840_606_905 99
675 3300048926 Ga0496123_0000417 Ga0496123_0000417_51420_51719 99
676 3300048926 Ga0496123_0023536 Ga0496123_0023536_536_835 99
677 3300048927 Ga0496124_0000653 Ga0496124_0000653_31062_31361 99
678 3300048928 Ga0496125_0056897 Ga0496125_0056897_1446_1748 99
679 3300048929 Ga0496126_0032297 Ga0496126_0032297_4404_4703 99
680 3300048929 Ga0496126_0065023 Ga0496126_0065023_1249_1548 99
681 3300049568 Ga0501031_0434042 Ga0501031_0434042_351_653 99
682 3300049569 Ga0501032_0325077 Ga0501032_0325077_303_605 99
683 3300049570 Ga0501033_0051782 Ga0501033_0051782_835_1137 99
684 3300049572 Ga0501036_0079609 Ga0501036_0079609_810_1112 99
685 3300049574 Ga0501038_0150833 Ga0501038_0150833_647_949 99
686 3300049579 Ga0501043_0057717 Ga0501043_0057717_363_665 99
687 3300049581 Ga0501047_0007616 Ga0501047_0007616_8680_8982 99
688 3300049581 Ga0501047_0045804 Ga0501047_0045804_872_1174 99
689 3300049586 Ga0501070_0352624 Ga0501070_0352624_352_654 99
690 3300049661 Ga0501217_199869 Ga0501217_199869_84_383 99
691 3300049663 Ga0501223_065141 Ga0501223_065141_29_328 99
692 3300049763 Ga0501266_004938 Ga0501266_004938_669_968 99
693 3300049822 Ga0501035_0195086 Ga0501035_0195086_551_853 99
694 3300049823 Ga0501044_0321657 Ga0501044_0321657_730_1032 99
695 3300049823 Ga0501044_0351838 Ga0501044_0351838_872_1174 99
696 3300050512 nmdc:mga0n895_60522_c1 nmdc:mga0n895_60522_c1_2639_2941 99
697 3300050513 nmdc:mga0rr50_1842_c1 nmdc:mga0rr50_1842_c1_3385_3687 99
698 3300050514 nmdc:mga08x19_1092_c1 nmdc:mga08x19_1092_c1_3661_3972 99
699 3300050514 nmdc:mga08x19_3101_c1 nmdc:mga08x19_3101_c1_7669_7971 99
700 3300050515 nmdc:mga0a205_237_c1 nmdc:mga0a205_237_c1_38260_38562 99
701 3300053151 Ga0500604_0232804 Ga0500604_0232804_173_472 99
702 3300061719 Ga0466962_0000490 Ga0466962_0000490_12104_12406 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12769

PNTB_4TM

4TM region of pyridine nucleotide transhydrogenase, mitoch

19

103

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tt7-assembly1.cif.gz_H ovine atp synthase 1a state 0.966 41 77
3i9w-assembly1.cif.gz_A crystal structure of the e. coli histidine kinase sensor tors sensor domain 0.919 31 85
7n0e-assembly1.cif.gz_B co-complex of the histidine kinase region of rets and the dimerization and histidine phosphotransfer domain of gacs 0.8967 31 83
3na7-assembly1.cif.gz_A 2.2 angstrom structure of the hp0958 protein from helicobacter pylori ccug 17874 0.8927 29 91
1jku-assembly1.cif.gz_C crystal structure of manganese catalase from lactobacillus plantarum 0.8909 31 88
ID Description Score Start End Superfamily
2v7qH02 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain 0.9572 38 77 1.20.5.440
4yxwH02 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain 0.9372 38 77 1.20.5.440
af_P39453_47_320_1.20.58.920 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9354 31 85 1.20.58.920
af_P0A6E6_91_134_1.20.5.440 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain 0.9271 38 76 1.20.5.440
af_Q9JK48_27_264_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9242 31 91 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A535J467-F1-model_v4 HlyD family efflux transporter periplasmic adaptor subunit 0.9473 30 92 GO:0030313
AF-A0A2V4WZU4-F1-model_v4 deleted 0.943 31 91
AF-A0A7Y5CUJ4-F1-model_v4 C4-type zinc ribbon domain-containing protein 0.9422 30 91
AF-A0A3M1S4T8-F1-model_v4 TolC family protein 0.9382 31 91 GO:0015562
AF-A0A839PW81-F1-model_v4 Uncharacterized protein 0.9377 25 83

Feature Viewer

pLDDT pTM Quality
87.46 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map