F470498

General Info

Members Datasets Scaffolds Average Seq Length
626 354 624 158

Family's Representative Sequence

Representative Sequence 3300048088|Ga0495602_0492528|Ga0495602_0492528_25_537
Length 170
Sequence LAPHPALSRIDYHRRQPRGIARLVRAMKTYVATPADRERNWLIVDASGQTLGRLATQIADALRGKRKPTYTPHVDTGDFVIVINAEKISVTGNKLADKRYYRHSGYPGGLRSRTLAEMLERRPEEVIRRAVKGMLPRNRLARRQITKLKVYAGPEHPHAAQQPQPMEIKS

Samples

Sample ID Description Type Environment
1 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
144 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
178 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
191 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
192 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
193 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
194 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
195 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
196 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
197 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
198 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
199 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
200 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
201 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
202 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
203 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
204 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
205 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
206 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
207 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
208 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
209 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
210 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
215 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
216 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
234 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
235 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
246 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
266 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
267 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
268 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
269 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
274 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
275 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
276 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
300 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
301 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
304 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
305 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
306 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
307 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
308 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
309 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
310 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
314 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
315 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
316 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
317 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
318 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
323 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
324 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
325 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
329 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
330 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
331 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
332 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
333 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
334 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
335 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
336 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
337 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
338 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
339 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
340 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
341 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
342 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
343 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
344 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
345 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
352 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
353 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
354 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.01
Metatranscriptomes 3.67
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.95
Nodule 0.32
Rhizoplane 1.92
Rhizosphere 85.94
Stem 0
Stem Tuber 0
Unclassified 2.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c002575 3300000041 Bacteria 1667
2 ARcpr5yngRDRAFT_c003782 3300000043 Bacteria 1463
3 JGI24752J21851_1012587 3300001976 Bacteria 1106
4 JGI24740J21852_10080762 3300001979 Bacteria 852
5 JGI24738J21930_10015392 3300002075 Bacteria 1628
6 JGI24738J21930_10063437 3300002075 Bacteria 760
7 Ga0055524_1001548 3300003775 Bacteria 12967
8 Ga0055536_1007886 3300003781 Bacteria 4678
9 Ga0055534_1022403 3300003784 Bacteria 1044
10 Ga0055528_1032619 3300003790 Bacteria 1324
11 Ga0055530_10000439 3300003791 Bacteria 36986
12 Ga0055530_10000594 3300003791 Bacteria 31300
13 Ga0055530_10049682 3300003791 Bacteria 980
14 Ga0055530_10092330 3300003791 Bacteria 619
15 Ga0055531_10000116 3300003794 Bacteria 88368
16 Ga0065714_10098719 3300005288 Bacteria 1703
17 Ga0065704_10473974 3300005289 Bacteria 687
18 Ga0065707_10151999 3300005295 Bacteria 1648
19 Ga0070658_10133788 3300005327 Bacteria 2067
20 Ga0070658_10173047 3300005327 Bacteria 1814
21 Ga0070658_11004630 3300005327 Bacteria 725
22 Ga0070670_100000621 3300005331 Bacteria 27756
23 Ga0068869_100624033 3300005334 Bacteria 913
24 Ga0070680_100004270 3300005336 Bacteria 10731
25 Ga0070680_100080285 3300005336 Bacteria 2690
26 Ga0070680_100284449 3300005336 Bacteria 1401
27 Ga0070660_100030281 3300005339 Bacteria 4060
28 Ga0070660_101884377 3300005339 Bacteria 510
29 Ga0070691_10353165 3300005341 Bacteria 817
30 Ga0070661_100235648 3300005344 Bacteria 1408
31 Ga0070661_100355996 3300005344 Bacteria 1149
32 Ga0070661_101158502 3300005344 Bacteria 646
33 Ga0070668_100018490 3300005347 Bacteria 5232
34 Ga0070671_100032911 3300005355 Bacteria 4285
35 Ga0070671_100265926 3300005355 Bacteria 1458
36 Ga0070673_100781783 3300005364 Bacteria 880
37 Ga0070673_101111543 3300005364 Bacteria 738
38 Ga0070659_100008286 3300005366 Bacteria 7588
39 Ga0070659_100059354 3300005366 Bacteria 3020
40 Ga0070659_100068905 3300005366 Bacteria 2807
41 Ga0070667_100000322 3300005367 Bacteria 53499
42 Ga0070667_100636027 3300005367 Bacteria 985
43 Ga0070714_100055463 3300005435 Bacteria 3387
44 Ga0070714_100344830 3300005435 Bacteria 1398
45 Ga0070694_100210727 3300005444 Bacteria 1453
46 Ga0070663_100000837 3300005455 Bacteria 16655
47 Ga0070663_100077637 3300005455 Bacteria 2432
48 Ga0070663_100947889 3300005455 Bacteria 746
49 Ga0070662_100051566 3300005457 Bacteria 2972
50 Ga0070681_10303593 3300005458 Bacteria 1506
51 Ga0070681_11173269 3300005458 Bacteria 690
52 Ga0070679_100000112 3300005530 Bacteria 63894
53 Ga0070679_100101300 3300005530 Bacteria 2867
54 Ga0070679_101435375 3300005530 Bacteria 637
55 Ga0070697_100417442 3300005536 Bacteria 1166
56 Ga0068853_100003533 3300005539 Bacteria 11957
57 Ga0068853_100008993 3300005539 Bacteria 8044
58 Ga0068853_100027584 3300005539 Bacteria 4771
59 Ga0068853_100066850 3300005539 Bacteria 3122
60 Ga0068853_100208277 3300005539 Bacteria 1781
61 Ga0070672_100349859 3300005543 Bacteria 1259
62 Ga0070686_100362150 3300005544 Bacteria 1093
63 Ga0070695_100055567 3300005545 Bacteria 2552
64 Ga0070695_100064915 3300005545 Bacteria 2376
65 Ga0070696_100010028 3300005546 Bacteria 6337
66 Ga0070665_100000021 3300005548 Bacteria 389668
67 Ga0070665_100000105 3300005548 Bacteria 157734
68 Ga0070665_100442521 3300005548 Bacteria 1309
69 Ga0068855_100000305 3300005563 Bacteria 61038
70 Ga0068855_100001252 3300005563 Bacteria 31534
71 Ga0068855_100147047 3300005563 Bacteria 2682
72 Ga0068855_100264548 3300005563 Bacteria 1915
73 Ga0068855_102249757 3300005563 Bacteria 546
74 Ga0070664_100037446 3300005564 Bacteria 4079
75 Ga0070664_100689999 3300005564 Bacteria 951
76 Ga0068857_100025650 3300005577 Bacteria 5189
77 Ga0068857_100033719 3300005577 Bacteria 4528
78 Ga0068857_100053877 3300005577 Bacteria 3568
79 Ga0068854_100099837 3300005578 Bacteria 2174
80 Ga0068854_100134783 3300005578 Bacteria 1890
81 Ga0068854_100143017 3300005578 Bacteria 1837
82 Ga0068854_100193606 3300005578 Bacteria 1594
83 Ga0068854_100356389 3300005578 Bacteria 1199
84 Ga0068856_100017890 3300005614 Bacteria 6875
85 Ga0068856_100020880 3300005614 Bacteria 6366
86 Ga0068856_100077633 3300005614 Bacteria 3291
87 Ga0068852_100037222 3300005616 Bacteria 4077
88 Ga0068852_100497437 3300005616 Bacteria 1213
89 Ga0068859_100007709 3300005617 Bacteria 10931
90 Ga0068859_100043963 3300005617 Bacteria 4489
91 Ga0068859_100237966 3300005617 Bacteria 1909
92 Ga0068859_100488477 3300005617 Bacteria 1327
93 Ga0068864_100000004 3300005618 Bacteria 489341
94 Ga0068866_10451198 3300005718 Bacteria 841
95 Ga0068861_100000107 3300005719 Bacteria 41725
96 Ga0068861_100261908 3300005719 Bacteria 1481
97 Ga0068863_100000002 3300005841 Bacteria 489510
98 Ga0068863_100058424 3300005841 Bacteria 3650
99 Ga0068858_100024125 3300005842 Bacteria 5668
100 Ga0068858_100298676 3300005842 Bacteria 1536
101 Ga0068860_100047940 3300005843 Bacteria 4072
102 Ga0068860_100050021 3300005843 Bacteria 3980
103 Ga0068862_100000002 3300005844 Bacteria 489341
104 Ga0068862_100000127 3300005844 Bacteria 88720
105 Ga0068862_100012350 3300005844 Bacteria 7061
106 Ga0081539_10016957 3300005985 Bacteria 5158
107 Ga0081539_10030696 3300005985 Bacteria 3330
108 Ga0075365_10035368 3300006038 Bacteria 3231
109 Ga0075363_100372762 3300006048 Bacteria 836
110 Ga0070715_10198194 3300006163 Bacteria 1018
111 Ga0075366_10116659 3300006195 Bacteria 1608
112 Ga0097621_100001517 3300006237 Bacteria 15906
113 Ga0068871_100034759 3300006358 Bacteria 4002
114 Ga0075428_101155132 3300006844 Bacteria 817
115 Ga0097620_100007709 3300006931 Bacteria 10931
116 Ga0097620_100043963 3300006931 Bacteria 4489
117 Ga0097620_100237977 3300006931 Bacteria 1909
118 Ga0097620_100488467 3300006931 Bacteria 1327
119 Ga0099826_10180708 3300006948 Bacteria 1174
120 Ga0105251_10002072 3300009011 Bacteria 16178
121 Ga0105240_10285343 3300009093 Bacteria 1895
122 Ga0105240_10334979 3300009093 Bacteria 1720
123 Ga0105240_10516549 3300009093 Bacteria 1326
124 Ga0111539_10030040 3300009094 Bacteria 6612
125 Ga0105247_10017235 3300009101 Bacteria 4335
126 Ga0114129_10097171 3300009147 Bacteria 4077
127 Ga0114129_10855580 3300009147 Bacteria 1156
128 Ga0105243_10092362 3300009148 Bacteria 2495
129 Ga0105243_10405376 3300009148 Bacteria 1268
130 Ga0105243_10837138 3300009148 Bacteria 910
131 Ga0105241_10031069 3300009174 Bacteria 3996
132 Ga0105241_10865551 3300009174 Bacteria 837
133 Ga0105242_10091926 3300009176 Bacteria 2555
134 Ga0105242_11342761 3300009176 Bacteria 740
135 Ga0105248_10000016 3300009177 Bacteria 308151
136 Ga0105248_10001313 3300009177 Bacteria 27695
137 Ga0105248_10400887 3300009177 Bacteria 1545
138 Ga0105238_10022206 3300009551 Bacteria 6470
139 Ga0105238_10145820 3300009551 Bacteria 2344
140 Ga0105249_10000149 3300009553 Bacteria 88337
141 Ga0105249_10002669 3300009553 Bacteria 15422
142 Ga0105239_10675382 3300010375 Bacteria 1180
143 Ga0157373_10387539 3300013100 Bacteria 1000
144 Ga0157370_10114710 3300013104 Bacteria 2517
145 Ga0157374_10598723 3300013296 Bacteria 1112
146 Ga0163162_10187148 3300013306 Bacteria 2197
147 Ga0163162_10308126 3300013306 Bacteria 1716
148 Ga0157372_10613374 3300013307 Bacteria 1268
149 Ga0157375_10006743 3300013308 Bacteria 9999
150 Ga0157380_10487206 3300014326 Bacteria 1194
151 Ga0157380_10887684 3300014326 Bacteria 917
152 Ga0157380_13000674 3300014326 Bacteria 538
153 Ga0163161_10026502 3300017792 Bacteria 4105
154 Ga0163161_10145799 3300017792 Bacteria 1796
155 Ga0163161_10703080 3300017792 Bacteria 842
156 Ga0163161_10758648 3300017792 Bacteria 812
157 Ga0163161_11102181 3300017792 Bacteria 682
158 Ga0206356_10680400 3300020070 Bacteria 1475
159 Ga0206353_10860786 3300020082 Bacteria 1402
160 Ga0209436_122295 3300025208 Bacteria 819
161 Ga0209437_120019 3300025233 Bacteria 830
162 Ga0207425_1015748 3300025245 Bacteria 1690
163 Ga0209233_1000052 3300025261 Bacteria 445813
164 Ga0209565_1000007 3300025263 Bacteria 784361
165 Ga0209673_1001603 3300025273 Bacteria 19868
166 Ga0209675_1000075 3300025291 Bacteria 161623
167 Ga0209675_1040054 3300025291 Bacteria 1033
168 Ga0209676_1000457 3300025292 Bacteria 68913
169 Ga0209676_1000554 3300025292 Bacteria 56925
170 Ga0209025_1018162 3300025294 Bacteria 4011
171 Ga0209050_1000017 3300025298 Bacteria 728928
172 Ga0209050_1000196 3300025298 Bacteria 135678
173 Ga0209050_1008963 3300025298 Bacteria 5219
174 Ga0209050_1023424 3300025298 Bacteria 2173
175 Ga0209050_1055100 3300025298 Bacteria 977
176 Ga0209256_1000009 3300025299 Bacteria 922071
177 Ga0209256_1000010 3300025299 Bacteria 912110
178 Ga0209257_1000206 3300025304 Bacteria 142184
179 Ga0209257_1000228 3300025304 Bacteria 133390
180 Ga0209257_1000456 3300025304 Bacteria 75804
181 Ga0209257_1003373 3300025304 Bacteria 13795
182 Ga0209257_1003588 3300025304 Bacteria 13113
183 Ga0209257_1009860 3300025304 Bacteria 4989
184 Ga0207656_10225270 3300025321 Bacteria 912
185 Ga0207713_1005825 3300025735 Bacteria 7626
186 Ga0207710_10009393 3300025900 Bacteria 4116
187 Ga0207710_10014488 3300025900 Bacteria 3326
188 Ga0207705_10111353 3300025909 Bacteria 2023
189 Ga0207705_10132887 3300025909 Bacteria 1853
190 Ga0207705_10954933 3300025909 Bacteria 663
191 Ga0207684_10308750 3300025910 Bacteria 1364
192 Ga0207707_10038563 3300025912 Bacteria 4174
193 Ga0207707_10196038 3300025912 Bacteria 1762
194 Ga0207707_11076108 3300025912 Bacteria 656
195 Ga0207695_10521279 3300025913 Bacteria 1070
196 Ga0207660_10000218 3300025917 Bacteria 36989
197 Ga0207657_10016201 3300025919 Bacteria 7195
198 Ga0207657_10030743 3300025919 Bacteria 4870
199 Ga0207657_10906562 3300025919 Bacteria 679
200 Ga0207649_10058668 3300025920 Bacteria 2411
201 Ga0207649_10344177 3300025920 Bacteria 1102
202 Ga0207652_10000001 3300025921 Bacteria 1006643
203 Ga0207652_10936671 3300025921 Bacteria 764
204 Ga0207694_10079449 3300025924 Bacteria 2572
205 Ga0207694_10647951 3300025924 Bacteria 890
206 Ga0207650_10000643 3300025925 Bacteria 27774
207 Ga0207650_10584424 3300025925 Bacteria 938
208 Ga0207659_11009103 3300025926 Bacteria 716
209 Ga0207664_10041175 3300025929 Bacteria 3598
210 Ga0207664_10372572 3300025929 Bacteria 1266
211 Ga0207644_10247829 3300025931 Bacteria 1420
212 Ga0207644_10622150 3300025931 Bacteria 897
213 Ga0207690_10090242 3300025932 Bacteria 2163
214 Ga0207706_10048755 3300025933 Bacteria 3745
215 Ga0207686_10729720 3300025934 Bacteria 790
216 Ga0207709_11193086 3300025935 Bacteria 627
217 Ga0207669_11240076 3300025937 Bacteria 632
218 Ga0207711_10000022 3300025941 Bacteria 340441
219 Ga0207711_10000956 3300025941 Bacteria 27669
220 Ga0207711_10006787 3300025941 Bacteria 9616
221 Ga0207661_10001385 3300025944 Bacteria 16276
222 Ga0207679_10112459 3300025945 Bacteria 2152
223 Ga0207667_10000035 3300025949 Bacteria 301056
224 Ga0207667_10002213 3300025949 Bacteria 24415
225 Ga0207667_10293890 3300025949 Bacteria 1660
226 Ga0207667_10401981 3300025949 Bacteria 1395
227 Ga0207712_10000111 3300025961 Bacteria 89223
228 Ga0207712_10005353 3300025961 Bacteria 8103
229 Ga0207712_11321897 3300025961 Bacteria 644
230 Ga0207668_10001243 3300025972 Bacteria 15180
231 Ga0207668_10012621 3300025972 Bacteria 5178
232 Ga0207668_10295261 3300025972 Bacteria 1335
233 Ga0207668_10626718 3300025972 Bacteria 939
234 Ga0207640_10000085 3300025981 Bacteria 73838
235 Ga0207640_10111622 3300025981 Bacteria 1939
236 Ga0207640_10322787 3300025981 Bacteria 1230
237 Ga0207640_11182351 3300025981 Bacteria 679
238 Ga0207658_10000589 3300025986 Bacteria 32594
239 Ga0207703_10000510 3300026035 Bacteria 40276
240 Ga0207703_10072971 3300026035 Bacteria 2838
241 Ga0207703_10592700 3300026035 Bacteria 1048
242 Ga0207703_11263858 3300026035 Bacteria 710
243 Ga0207639_10012952 3300026041 Bacteria 5819
244 Ga0207639_10048127 3300026041 Bacteria 3225
245 Ga0207678_10005202 3300026067 Bacteria 11660
246 Ga0207678_10099206 3300026067 Bacteria 2488
247 Ga0207702_10031113 3300026078 Bacteria 4448
248 Ga0207702_10574549 3300026078 Bacteria 1104
249 Ga0207641_10000002 3300026088 Bacteria 981004
250 Ga0207641_10055125 3300026088 Bacteria 3375
251 Ga0207648_10271929 3300026089 Bacteria 1514
252 Ga0207676_10000040 3300026095 Bacteria 167947
253 Ga0207674_10011562 3300026116 Bacteria 9913
254 Ga0207674_10015944 3300026116 Bacteria 8232
255 Ga0207674_10037608 3300026116 Bacteria 5031
256 Ga0207674_10206109 3300026116 Bacteria 1915
257 Ga0207675_100000317 3300026118 Bacteria 45991
258 Ga0207675_100303528 3300026118 Bacteria 1555
259 Ga0207698_10279055 3300026142 Bacteria 1544
260 Ga0207698_10279145 3300026142 Bacteria 1544
261 Ga0209282_1166632 3300027666 Bacteria 1047
262 Ga0209974_10143705 3300027876 Bacteria 857
263 Ga0268266_10000015 3300028379 Bacteria 630629
264 Ga0268266_10000055 3300028379 Bacteria 291630
265 Ga0268265_10000003 3300028380 Bacteria 949201
266 Ga0268265_10000385 3300028380 Bacteria 47093
267 Ga0268265_10115292 3300028380 Bacteria 2202
268 Ga0268264_10009236 3300028381 Bacteria 8165
269 Ga0268264_10080903 3300028381 Bacteria 2775
270 Ga0307512_10209745 3300030522 Bacteria 1038
271 Ga0316182_1432900 3300030745 Bacteria 702
272 Ga0265331_10000005 3300031250 Bacteria 465192
273 Ga0307513_10095479 3300031456 Bacteria 3014
274 Ga0307513_10154019 3300031456 Bacteria 2201
275 Ga0307408_100019783 3300031548 Bacteria 4535
276 Ga0307408_100085229 3300031548 Bacteria 2372
277 Ga0307408_100096460 3300031548 Bacteria 2244
278 Ga0307408_100422366 3300031548 Bacteria 1150
279 Ga0307408_100671021 3300031548 Bacteria 929
280 Ga0307408_100886971 3300031548 Bacteria 815
281 Ga0307508_10004215 3300031616 Bacteria 14135
282 Ga0307405_10177100 3300031731 Bacteria 1527
283 Ga0307405_10802798 3300031731 Bacteria 788
284 Ga0307413_10291379 3300031824 Bacteria 1233
285 Ga0307413_10298467 3300031824 Bacteria 1220
286 Ga0307410_10071133 3300031852 Bacteria 2412
287 Ga0307410_10082360 3300031852 Bacteria 2264
288 Ga0307410_10369168 3300031852 Bacteria 1152
289 Ga0307406_10042953 3300031901 Bacteria 2825
290 Ga0307406_10044506 3300031901 Bacteria 2782
291 Ga0307406_10060279 3300031901 Bacteria 2446
292 Ga0307406_10115111 3300031901 Bacteria 1858
293 Ga0307406_10138152 3300031901 Bacteria 1721
294 Ga0307406_10785034 3300031901 Bacteria 802
295 Ga0307407_10274665 3300031903 Bacteria 1165
296 Ga0307407_10408881 3300031903 Bacteria 975
297 Ga0307412_10005529 3300031911 Bacteria 7097
298 Ga0307412_10007833 3300031911 Bacteria 6081
299 Ga0307412_10009359 3300031911 Bacteria 5619
300 Ga0307412_10251859 3300031911 Bacteria 1371
301 Ga0307412_10329095 3300031911 Bacteria 1219
302 Ga0307412_10410544 3300031911 Bacteria 1105
303 Ga0307412_10543575 3300031911 Bacteria 974
304 Ga0307412_10764066 3300031911 Bacteria 835
305 Ga0307409_100681128 3300031995 Bacteria 1025
306 Ga0307409_100844442 3300031995 Bacteria 926
307 Ga0307416_100014892 3300032002 Bacteria 5349
308 Ga0307416_100024239 3300032002 Bacteria 4423
309 Ga0307416_100039249 3300032002 Bacteria 3663
310 Ga0307416_100310481 3300032002 Bacteria 1573
311 Ga0307414_10000070 3300032004 Bacteria 96231
312 Ga0307414_10000908 3300032004 Bacteria 15185
313 Ga0307414_10021947 3300032004 Bacteria 4018
314 Ga0307414_10034425 3300032004 Bacteria 3358
315 Ga0307414_10067246 3300032004 Bacteria 2566
316 Ga0307414_10637974 3300032004 Bacteria 959
317 Ga0307414_10895295 3300032004 Bacteria 813
318 Ga0307414_11249117 3300032004 Bacteria 688
319 Ga0307411_10048286 3300032005 Bacteria 2758
320 Ga0307411_10140883 3300032005 Bacteria 1778
321 Ga0307411_10561176 3300032005 Bacteria 976
322 Ga0307411_10582318 3300032005 Bacteria 959
323 Ga0307411_10849728 3300032005 Bacteria 807
324 Ga0307411_11971721 3300032005 Bacteria 544
325 Ga0307415_100082053 3300032126 Bacteria 2305
326 Ga0307415_100117025 3300032126 Bacteria 1990
327 Ga0307415_100157314 3300032126 Bacteria 1756
328 Ga0307415_100199808 3300032126 Bacteria 1585
329 Ga0307415_100507489 3300032126 Bacteria 1056
330 Ga0307510_10021872 3300033180 Bacteria 7440
331 Ga0373926_0011226 3300035083 Bacteria 3012
332 Ga0373926_0083920 3300035083 Bacteria 1180
333 Ga0373923_0032798 3300035111 Bacteria 2100
334 Ga0373936_0005536 3300035113 Bacteria 4769
335 Ga0373945_0001813 3300035116 Bacteria 6601
336 Ga0373953_0178203 3300035117 Bacteria 916
337 Ga0373954_0140379 3300035118 Bacteria 1178
338 Ga0373956_0081265 3300035119 Bacteria 1487
339 Ga0373957_0116690 3300035120 Bacteria 1078
340 Ga0373943_0000987 3300035170 Bacteria 12632
341 Ga0373943_0004063 3300035170 Bacteria 6645
342 Ga0373946_0000390 3300035171 Bacteria 14299
343 Ga0373955_0002343 3300035172 Bacteria 8255
344 Ga0373955_0707851 3300035172 Bacteria 618
345 Ga0373924_0272831 3300035410 Bacteria 750
346 Ga0373935_0021138 3300035692 Bacteria 3983
347 Ga0373935_0210574 3300035692 Bacteria 1347
348 Ga0373927_0001694 3300035695 Bacteria 16465
349 Ga0373947_0001559 3300035725 Bacteria 14033
350 Ga0373947_0041452 3300035725 Bacteria 2745
351 Ga0373947_0396628 3300035725 Bacteria 930
352 Ga0373937_0013140 3300036401 Bacteria 7291
353 Ga0316582_0000396 3300036647 Bacteria 15815
354 Ga0316584_0020794 3300036712 Bacteria 4765
355 Ga0316584_0312609 3300036712 Bacteria 1135
356 Ga0373925_0002714 3300037068 Bacteria 14017
357 Ga0373925_0033233 3300037068 Bacteria 3802
358 Ga0395899_0001872 3300037312 Bacteria 17372
359 Ga0395899_0014790 3300037312 Bacteria 5957
360 Ga0395899_0154353 3300037312 Bacteria 1625
361 Ga0395899_0335232 3300037312 Bacteria 1015
362 Ga0395899_0451793 3300037312 Bacteria 841
363 Ga0395900_0000084 3300037418 Bacteria 172593
364 Ga0395900_0009014 3300037418 Bacteria 10230
365 Ga0395900_0131251 3300037418 Bacteria 2567
366 Ga0395900_0148125 3300037418 Bacteria 2400
367 Ga0395900_0367779 3300037418 Bacteria 1408
368 Ga0395900_0424270 3300037418 Bacteria 1290
369 Ga0395898_0000021 3300037466 Bacteria 393971
370 Ga0395898_0003569 3300037466 Bacteria 17341
371 Ga0395898_0134484 3300037466 Bacteria 2367
372 Ga0395898_0152050 3300037466 Bacteria 2214
373 Ga0395898_0155205 3300037466 Bacteria 2189
374 Ga0395905_0000006 3300037471 Bacteria 549428
375 Ga0395905_0006269 3300037471 Bacteria 12004
376 Ga0395905_0008304 3300037471 Bacteria 10244
377 Ga0395905_0019553 3300037471 Bacteria 6419
378 Ga0395905_0087484 3300037471 Bacteria 2921
379 Ga0395905_0298168 3300037471 Bacteria 1499
380 Ga0395905_0305467 3300037471 Bacteria 1479
381 Ga0395905_0403724 3300037471 Bacteria 1261
382 Ga0436364_0416603 3300037853 Bacteria 1338
383 Ga0436364_1141745 3300037853 Bacteria 920
384 Ga0395901_0001581 3300038443 Bacteria 23545
385 Ga0395901_0004950 3300038443 Bacteria 13443
386 Ga0395901_0032271 3300038443 Bacteria 5403
387 Ga0395901_0145215 3300038443 Bacteria 2494
388 Ga0395901_0409938 3300038443 Bacteria 1391
389 Ga0237819_02700 3300038705 Bacteria 3428
390 Ga0436365_0930005 3300039437 Bacteria 1139
391 Ga0436363_1425761 3300039450 Bacteria 2668
392 Ga0436362_0746519 3300039453 Bacteria 644
393 Ga0436362_1101242 3300039453 Bacteria 676
394 Ga0439436_0062191 3300041404 Bacteria 1044
395 Ga0439438_062014 3300041405 Bacteria 935
396 Ga0439439_0017369 3300041406 Bacteria 1769
397 Ga0439447_096548 3300041407 Bacteria 679
398 Ga0439461_0000237 3300041410 Bacteria 7796
399 Ga0439465_0001413 3300041413 Bacteria 7765
400 Ga0439465_0003226 3300041413 Bacteria 5320
401 Ga0451793_1016855 3300041452 Bacteria 947
402 Ga0451793_1315180 3300041452 Bacteria 1095
403 Ga0451805_038860 3300041461 Bacteria 550
404 Ga0451805_107206 3300041461 Bacteria 581
405 Ga0439431_0000173 3300041997 Bacteria 12361
406 Ga0439431_0004664 3300041997 Bacteria 3013
407 Ga0439442_004433 3300042002 Bacteria 2789
408 Ga0439445_0000812 3300042004 Bacteria 6582
409 Ga0439445_0003186 3300042004 Bacteria 3678
410 Ga0439445_0032828 3300042004 Bacteria 1354
411 Ga0439445_0164879 3300042004 Bacteria 648
412 Ga0439432_019352 3300042006 Bacteria 2268
413 Ga0439432_032722 3300042006 Bacteria 1675
414 Ga0439457_053736 3300042014 Bacteria 906
415 Ga0439462_0000167 3300042015 Bacteria 10984
416 Ga0450905_009047 3300042142 Bacteria 1367
417 Ga0450889_000888 3300042144 Bacteria 3212
418 Ga0439446_0050764 3300042156 Bacteria 1238
419 Ga0439434_0002832 3300042435 Bacteria 5059
420 Ga0439464_0191058 3300042439 Bacteria 651
421 Ga0439440_0179958 3300042993 Bacteria 619
422 Ga0466969_0027621 3300044656 Bacteria 2905
423 Ga0466969_0323831 3300044656 Bacteria 697
424 Ga0466966_0029739 3300044684 Bacteria 3552
425 Ga0466966_0105672 3300044684 Bacteria 1738
426 Ga0466961_0005961 3300044693 Bacteria 7721
427 Ga0466961_0211685 3300044693 Bacteria 1196
428 Ga0466963_0025116 3300044694 Bacteria 3797
429 Ga0466971_0158746 3300044719 Bacteria 1058
430 Ga0466971_0450653 3300044719 Bacteria 631
431 Ga0466968_0505422 3300044735 Bacteria 603
432 Ga0466970_0091618 3300044765 Bacteria 1650
433 Ga0466970_0253774 3300044765 Bacteria 986
434 Ga0466970_0293614 3300044765 Bacteria 916
435 Ga0466957_0278994 3300044842 Bacteria 1118
436 Ga0466959_0218568 3300045049 Bacteria 1322
437 Ga0466959_0299536 3300045049 Bacteria 1101
438 Ga0466959_0400199 3300045049 Bacteria 933
439 Ga0466958_0039452 3300045836 Bacteria 2838
440 Ga0466958_0078077 3300045836 Bacteria 2034
441 Ga0466958_0188814 3300045836 Bacteria 1309
442 Ga0466958_0534752 3300045836 Bacteria 761
443 Ga0466967_0023474 3300045976 Bacteria 5055
444 Ga0466967_0509192 3300045976 Bacteria 1182
445 Ga0495603_0237457 3300046455 Bacteria 1050
446 Ga0495638_0000714 3300046460 Bacteria 35808
447 Ga0495641_0108705 3300046461 Bacteria 1237
448 Ga0495653_0075647 3300046463 Bacteria 2505
449 Ga0495580_0219911 3300046472 Bacteria 1305
450 Ga0495639_0120193 3300046475 Bacteria 1253
451 Ga0495662_0001418 3300046476 Bacteria 11879
452 Ga0495664_0021295 3300046477 Bacteria 3745
453 Ga0495585_0027193 3300046492 Bacteria 3265
454 Ga0495594_0386130 3300046499 Bacteria 797
455 Ga0495618_0040344 3300046514 Bacteria 2937
456 Ga0495630_0024514 3300046517 Bacteria 4459
457 Ga0495643_0051033 3300046522 Bacteria 2226
458 Ga0495644_0138609 3300046523 Bacteria 929
459 Ga0495666_0024475 3300046526 Bacteria 2982
460 Ga0495665_0031480 3300046531 Bacteria 2839
461 Ga0495665_0174910 3300046531 Bacteria 1117
462 Ga0495640_0003310 3300046533 Bacteria 12966
463 Ga0495586_0052287 3300046535 Bacteria 2212
464 Ga0495645_0011928 3300046543 Bacteria 6123
465 Ga0495668_0000076 3300046616 Bacteria 161826
466 Ga0495668_0115150 3300046616 Bacteria 1470
467 Ga0495668_0542498 3300046616 Bacteria 642
468 Ga0495634_0003281 3300046642 Bacteria 13051
469 Ga0495625_0000936 3300046660 Bacteria 39185
470 Ga0495625_0001409 3300046660 Bacteria 29392
471 Ga0495625_0042798 3300046660 Bacteria 3288
472 Ga0495635_0001339 3300046663 Bacteria 16395
473 Ga0495635_0126315 3300046663 Bacteria 1744
474 Ga0495657_0527350 3300046675 Bacteria 687
475 Ga0495623_0257708 3300046679 Bacteria 978
476 Ga0495647_0010613 3300046681 Bacteria 3140
477 Ga0495647_0508259 3300046681 Bacteria 561
478 Ga0495658_0123238 3300046683 Bacteria 1570
479 Ga0495658_0513112 3300046683 Bacteria 767
480 Ga0495613_0492747 3300046689 Bacteria 826
481 Ga0495624_0002621 3300046690 Bacteria 13583
482 Ga0495670_0000003 3300046691 Bacteria 326779
483 Ga0495600_0276110 3300046809 Bacteria 1065
484 Ga0495581_0020558 3300047315 Bacteria 3830
485 Ga0495581_0359400 3300047315 Bacteria 850
486 Ga0495604_0792826 3300047317 Bacteria 597
487 Ga0495674_0006927 3300047319 Bacteria 10844
488 Ga0495684_0004391 3300047471 Bacteria 11017
489 Ga0495684_0005099 3300047471 Bacteria 10244
490 Ga0495686_0000082 3300047472 Bacteria 200115
491 Ga0495686_0045625 3300047472 Bacteria 2772
492 Ga0495602_0492528 3300048088 Bacteria 858
493 Ga0495614_0292170 3300048089 Bacteria 752
494 Ga0496103_0064131 3300048906 Bacteria 2290
495 Ga0496109_0157652 3300048912 Bacteria 2126
496 Ga0496109_0310766 3300048912 Bacteria 1487
497 Ga0496111_0086926 3300048914 Bacteria 2288
498 Ga0496112_0003706 3300048915 Bacteria 12752
499 Ga0496112_0035620 3300048915 Bacteria 4850
500 Ga0496113_0002272 3300048916 Bacteria 11086
501 Ga0496115_0292471 3300048918 Bacteria 1336
502 Ga0496117_0003086 3300048920 Bacteria 19943
503 Ga0496118_0072196 3300048921 Bacteria 2480
504 Ga0496119_0049487 3300048922 Bacteria 2598
505 Ga0496122_0001177 3300048925 Bacteria 44728
506 Ga0496123_0000754 3300048926 Bacteria 52403
507 Ga0496124_0049520 3300048927 Bacteria 3584
508 Ga0501310_052323 3300049130 Bacteria 593
509 Ga0501304_031661 3300049160 Bacteria 565
510 Ga0501290_000076 3300049513 Bacteria 13968
511 Ga0501292_000037 3300049515 Bacteria 31889
512 Ga0501294_000020 3300049517 Bacteria 16601
513 Ga0501313_051858 3300049529 Bacteria 568
514 Ga0501313_058902 3300049529 Bacteria 542
515 Ga0501314_002904 3300049530 Bacteria 1354
516 Ga0501315_004097 3300049531 Bacteria 1502
517 Ga0501317_013270 3300049533 Bacteria 1028
518 Ga0501320_036411 3300049536 Bacteria 631
519 Ga0501320_049645 3300049536 Bacteria 569
520 Ga0501323_022668 3300049539 Bacteria 838
521 Ga0501335_036996 3300049551 Bacteria 567
522 Ga0501338_06694 3300049554 Bacteria 732
523 Ga0501031_0100697 3300049568 Bacteria 1885
524 Ga0501031_0116554 3300049568 Bacteria 1745
525 Ga0501032_0007617 3300049569 Bacteria 7897
526 Ga0501032_0162364 3300049569 Bacteria 1467
527 Ga0501033_0011285 3300049570 Bacteria 6840
528 Ga0501034_0124569 3300049571 Bacteria 2562
529 Ga0501034_0169927 3300049571 Bacteria 2148
530 Ga0501036_0050051 3300049572 Bacteria 3539
531 Ga0501036_0052934 3300049572 Bacteria 3437
532 Ga0501037_0022098 3300049573 Bacteria 4707
533 Ga0501038_0221942 3300049574 Bacteria 1507
534 Ga0501039_0108807 3300049575 Bacteria 2166
535 Ga0501040_0133047 3300049576 Bacteria 1749
536 Ga0501040_0407080 3300049576 Bacteria 977
537 Ga0501041_0114653 3300049577 Bacteria 1673
538 Ga0501042_0230522 3300049578 Bacteria 1336
539 Ga0501043_0087084 3300049579 Bacteria 2454
540 Ga0501046_0204306 3300049580 Bacteria 1469
541 Ga0501047_0180019 3300049581 Bacteria 1980
542 Ga0501047_0340756 3300049581 Bacteria 1337
543 Ga0501047_0392506 3300049581 Bacteria 1221
544 Ga0501047_0403264 3300049581 Bacteria 1200
545 Ga0501047_0693140 3300049581 Bacteria 836
546 Ga0501048_0211609 3300049582 Bacteria 1375
547 Ga0501048_0331950 3300049582 Bacteria 1084
548 Ga0501071_0178766 3300049587 Bacteria 1589
549 Ga0501072_0064198 3300049588 Bacteria 2896
550 Ga0501072_1181105 3300049588 Bacteria 595
551 Ga0501074_0039773 3300049590 Bacteria 3406
552 Ga0501074_0956433 3300049590 Bacteria 602
553 Ga0501076_0139095 3300049592 Bacteria 1972
554 Ga0501076_1065584 3300049592 Bacteria 666
555 Ga0501077_0033357 3300049593 Bacteria 3277
556 Ga0501077_0344413 3300049593 Bacteria 951
557 Ga0501223_000755 3300049663 Bacteria 7691
558 Ga0501224_000016 3300049664 Bacteria 86205
559 Ga0501233_009888 3300049668 Bacteria 1869
560 Ga0501249_041261 3300049679 Bacteria 1047
561 Ga0501257_000240 3300049686 Bacteria 10802
562 Ga0501221_030695 3300049704 Bacteria 1119
563 Ga0501225_0000016 3300049705 Bacteria 64948
564 Ga0501225_0006759 3300049705 Bacteria 3343
565 Ga0501079_0564404 3300049741 Bacteria 895
566 Ga0501080_0104794 3300049742 Bacteria 2623
567 Ga0501080_0699047 3300049742 Bacteria 894
568 Ga0501081_0752259 3300049743 Bacteria 732
569 Ga0501267_007509 3300049764 Bacteria 1062
570 Ga0501279_000008 3300049775 Bacteria 125267
571 Ga0501280_000013 3300049776 Bacteria 59205
572 Ga0501280_001260 3300049776 Bacteria 4892
573 Ga0501281_00107 3300049777 Bacteria 10078
574 Ga0501282_000282 3300049778 Bacteria 6150
575 Ga0501035_0005503 3300049822 Bacteria 11965
576 Ga0501035_0420154 3300049822 Bacteria 1110
577 Ga0501035_0692300 3300049822 Bacteria 823
578 Ga0501035_0888428 3300049822 Bacteria 706
579 Ga0501044_0006511 3300049823 Bacteria 12903
580 Ga0501044_0059423 3300049823 Bacteria 3917
581 Ga0501044_0160044 3300049823 Bacteria 2229
582 Ga0501045_0565073 3300049824 Bacteria 843
583 Ga0501045_1135641 3300049824 Bacteria 571
584 Ga0501226_000020 3300049853 Bacteria 141193
585 nmdc:mga03n38_431336_c1 3300050490 Bacteria 730
586 nmdc:mga00v17_682111_c1 3300050491 Bacteria 659
587 nmdc:mga0yw44_675737_c1 3300050492 Bacteria 702
588 nmdc:mga05p37_614359_c1 3300050507 Bacteria 1224
589 nmdc:mga05p37_78565_c1 3300050507 Bacteria 4063
590 nmdc:mga09592_222938_c1 3300050508 Bacteria 1633
591 nmdc:mga06r32_1267375_c1 3300050510 Bacteria 682
592 nmdc:mga08y16_50996_c1 3300050511 Bacteria 4329
593 nmdc:mga0n895_420277_c1 3300050512 Bacteria 1351
594 Ga0495612_0000187 3300053078 Bacteria 26308
595 Ga0500643_000005 3300053087 Bacteria 539775
596 Ga0500643_000139 3300053087 Bacteria 73348
597 Ga0500643_002899 3300053087 Bacteria 8527
598 Ga0500643_006988 3300053087 Bacteria 4630
599 Ga0500643_045751 3300053087 Bacteria 1266
600 Ga0500646_0126254 3300053090 Bacteria 827
601 Ga0500566_0015418 3300053094 Bacteria 4484
602 Ga0500594_0148399 3300053118 Bacteria 752
603 Ga0500608_017499 3300053122 Bacteria 3256
604 Ga0500642_0000001 3300053130 Bacteria 1468402
605 Ga0500559_0028545 3300053136 Bacteria 2384
606 Ga0500568_0000942 3300053139 Bacteria 20047
607 Ga0500568_0001466 3300053139 Bacteria 15125
608 Ga0500604_0000043 3300053151 Bacteria 48703
609 Ga0500616_0000293 3300053153 Bacteria 72597
610 Ga0500616_0017603 3300053153 Bacteria 4053
611 Ga0500624_000205 3300053157 Bacteria 22830
612 Ga0590075_135422 3300059424 Bacteria 647
613 Ga0590077_100922 3300059426 Bacteria 675
614 Ga0587077_188167 3300059493 Bacteria 564
615 Ga0587082_136199 3300059504 Bacteria 569
616 Ga0587082_140545 3300059504 Bacteria 563
617 Ga0587086_028513 3300059507 Bacteria 807
618 Ga0587128_024646 3300059630 Bacteria 952
619 Ga0587076_077902 3300059645 Bacteria 702
620 Ga0587124_033839 3300059660 Bacteria 575
621 Ga0501082_0635687 3300060353 Bacteria 934
622 Ga0466962_0053902 3300061719 Bacteria 1922
623 Ga0466962_0232925 3300061719 Bacteria 903
624 Ga0530510_0004519 3300061734 Bacteria 9633

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005545 Ga0070695_100064915 Ga0070695_1000649152 138
2 3300009148 Ga0105243_10092362 Ga0105243_100923622 142
3 3300009176 Ga0105242_10091926 Ga0105242_100919262 142
4 3300014326 Ga0157380_10887684 Ga0157380_108876842 142
5 3300046523 Ga0495644_0138609 Ga0495644_0138609_365_823 143
6 3300005327 Ga0070658_10133788 Ga0070658_101337881 144
7 3300005341 Ga0070691_10353165 Ga0070691_103531651 144
8 3300005536 Ga0070697_100417442 Ga0070697_1004174421 144
9 3300005614 Ga0068856_100017890 Ga0068856_1000178901 144
10 3300006038 Ga0075365_10035368 Ga0075365_100353682 144
11 3300006048 Ga0075363_100372762 Ga0075363_1003727622 144
12 3300006163 Ga0070715_10198194 Ga0070715_101981942 144
13 3300006844 Ga0075428_101155132 Ga0075428_1011551322 144
14 3300009147 Ga0114129_10097171 Ga0114129_100971714 144
15 3300009147 Ga0114129_10855580 Ga0114129_108555802 144
16 3300009174 Ga0105241_10865551 Ga0105241_108655511 144
17 3300014326 Ga0157380_13000674 Ga0157380_130006742 144
18 3300025909 Ga0207705_10111353 Ga0207705_101113532 144
19 3300025910 Ga0207684_10308750 Ga0207684_103087502 144
20 3300025926 Ga0207659_11009103 Ga0207659_110091031 144
21 3300031852 Ga0307410_10082360 Ga0307410_100823602 144
22 3300031901 Ga0307406_10042953 Ga0307406_100429531 144
23 3300032002 Ga0307416_100014892 Ga0307416_1000148924 144
24 3300032126 Ga0307415_100117025 Ga0307415_1001170252 144
25 3300037418 Ga0395900_0009014 Ga0395900_0009014_6714_7148 144
26 3300037466 Ga0395898_0134484 Ga0395898_0134484_312_746 144
27 3300037853 Ga0436364_1141745 Ga0436364_1141745_129_563 144
28 3300039437 Ga0436365_0930005 Ga0436365_0930005_26_466 144
29 3300039450 Ga0436363_1425761 Ga0436363_1425761_1128_1562 144
30 3300039453 Ga0436362_0746519 Ga0436362_0746519_87_521 144
31 3300042993 Ga0439440_0179958 Ga0439440_0179958_107_541 144
32 3300044656 Ga0466969_0027621 Ga0466969_0027621_2211_2645 144
33 3300044656 Ga0466969_0323831 Ga0466969_0323831_101_535 144
34 3300044684 Ga0466966_0029739 Ga0466966_0029739_24_458 144
35 3300044684 Ga0466966_0105672 Ga0466966_0105672_876_1331 144
36 3300044693 Ga0466961_0005961 Ga0466961_0005961_1755_2210 144
37 3300044719 Ga0466971_0158746 Ga0466971_0158746_382_816 144
38 3300044765 Ga0466970_0253774 Ga0466970_0253774_541_975 144
39 3300044765 Ga0466970_0293614 Ga0466970_0293614_303_758 144
40 3300045049 Ga0466959_0218568 Ga0466959_0218568_53_487 144
41 3300045049 Ga0466959_0299536 Ga0466959_0299536_154_609 144
42 3300045836 Ga0466958_0039452 Ga0466958_0039452_263_697 144
43 3300046455 Ga0495603_0237457 Ga0495603_0237457_231_692 144
44 3300046461 Ga0495641_0108705 Ga0495641_0108705_684_1145 144
45 3300046499 Ga0495594_0386130 Ga0495594_0386130_184_645 144
46 3300046531 Ga0495665_0174910 Ga0495665_0174910_245_706 144
47 3300046675 Ga0495657_0527350 Ga0495657_0527350_194_628 144
48 3300046681 Ga0495647_0508259 Ga0495647_0508259_49_483 144
49 3300046683 Ga0495658_0513112 Ga0495658_0513112_317_751 144
50 3300046689 Ga0495613_0492747 Ga0495613_0492747_27_461 144
51 3300047315 Ga0495581_0359400 Ga0495581_0359400_99_560 144
52 3300047317 Ga0495604_0792826 Ga0495604_0792826_26_580 144
53 3300048088 Ga0495602_0492528 Ga0495602_0492528_25_537 144
54 3300048089 Ga0495614_0292170 Ga0495614_0292170_174_635 144
55 3300049568 Ga0501031_0116554 Ga0501031_0116554_110_544 144
56 3300049569 Ga0501032_0162364 Ga0501032_0162364_887_1321 144
57 3300049572 Ga0501036_0050051 Ga0501036_0050051_2223_2657 144
58 3300049576 Ga0501040_0133047 Ga0501040_0133047_1292_1726 144
59 3300049576 Ga0501040_0407080 Ga0501040_0407080_409_843 144
60 3300049577 Ga0501041_0114653 Ga0501041_0114653_127_561 144
61 3300049578 Ga0501042_0230522 Ga0501042_0230522_512_946 144
62 3300049580 Ga0501046_0204306 Ga0501046_0204306_783_1217 144
63 3300049582 Ga0501048_0211609 Ga0501048_0211609_206_640 144
64 3300049582 Ga0501048_0331950 Ga0501048_0331950_71_505 144
65 3300049587 Ga0501071_0178766 Ga0501071_0178766_168_602 144
66 3300049588 Ga0501072_0064198 Ga0501072_0064198_904_1338 144
67 3300049588 Ga0501072_1181105 Ga0501072_1181105_17_451 144
68 3300049590 Ga0501074_0039773 Ga0501074_0039773_87_521 144
69 3300049592 Ga0501076_0139095 Ga0501076_0139095_394_828 144
70 3300049593 Ga0501077_0033357 Ga0501077_0033357_920_1354 144
71 3300049593 Ga0501077_0344413 Ga0501077_0344413_452_886 144
72 3300049741 Ga0501079_0564404 Ga0501079_0564404_442_876 144
73 3300049742 Ga0501080_0699047 Ga0501080_0699047_325_759 144
74 3300049743 Ga0501081_0752259 Ga0501081_0752259_119_553 144
75 3300049822 Ga0501035_0420154 Ga0501035_0420154_606_1040 144
76 3300049824 Ga0501045_0565073 Ga0501045_0565073_385_819 144
77 3300049824 Ga0501045_1135641 Ga0501045_1135641_42_476 144
78 3300050490 nmdc:mga03n38_431336_c1 nmdc:mga03n38_431336_c1_231_665 144
79 3300050491 nmdc:mga00v17_682111_c1 nmdc:mga00v17_682111_c1_69_503 144
80 3300050492 nmdc:mga0yw44_675737_c1 nmdc:mga0yw44_675737_c1_218_652 144
81 3300050507 nmdc:mga05p37_614359_c1 nmdc:mga05p37_614359_c1_687_1121 144
82 3300050507 nmdc:mga05p37_78565_c1 nmdc:mga05p37_78565_c1_3424_3858 144
83 3300050510 nmdc:mga06r32_1267375_c1 nmdc:mga06r32_1267375_c1_25_459 144
84 3300060353 Ga0501082_0635687 Ga0501082_0635687_217_651 144
85 3300061719 Ga0466962_0053902 Ga0466962_0053902_225_680 144
86 3300061734 Ga0530510_0004519 Ga0530510_0004519_8377_8811 144
87 3300049581 Ga0501047_0693140 Ga0501047_0693140_231_668 145
88 3300049823 Ga0501044_0160044 Ga0501044_0160044_204_641 145
89 3300050512 nmdc:mga0n895_420277_c1 nmdc:mga0n895_420277_c1_70_543 145
90 iso_pu_bacteria 8054563764 8054564341 157
91 3300035083 Ga0373926_0011226 Ga0373926_0011226_2411_2887 158
92 3300035083 Ga0373926_0083920 Ga0373926_0083920_566_1042 158
93 3300035111 Ga0373923_0032798 Ga0373923_0032798_41_517 158
94 3300035113 Ga0373936_0005536 Ga0373936_0005536_1834_2310 158
95 3300035116 Ga0373945_0001813 Ga0373945_0001813_644_1120 158
96 3300035170 Ga0373943_0000987 Ga0373943_0000987_6790_7266 158
97 3300035171 Ga0373946_0000390 Ga0373946_0000390_935_1411 158
98 3300035172 Ga0373955_0707851 Ga0373955_0707851_11_487 158
99 3300035410 Ga0373924_0272831 Ga0373924_0272831_20_496 158
100 3300035692 Ga0373935_0021138 Ga0373935_0021138_333_809 158
101 3300035695 Ga0373927_0001694 Ga0373927_0001694_8136_8612 158
102 3300035725 Ga0373947_0001559 Ga0373947_0001559_10305_10781 158
103 3300035725 Ga0373947_0041452 Ga0373947_0041452_1990_2466 158
104 3300037068 Ga0373925_0002714 Ga0373925_0002714_10292_10768 158
105 3300046463 Ga0495653_0075647 Ga0495653_0075647_1924_2400 158
106 3300046472 Ga0495580_0219911 Ga0495580_0219911_480_956 158
107 3300046475 Ga0495639_0120193 Ga0495639_0120193_103_579 158
108 3300046476 Ga0495662_0001418 Ga0495662_0001418_4372_4848 158
109 3300046477 Ga0495664_0021295 Ga0495664_0021295_620_1096 158
110 3300046514 Ga0495618_0040344 Ga0495618_0040344_816_1292 158
111 3300046517 Ga0495630_0024514 Ga0495630_0024514_1685_2161 158
112 3300046526 Ga0495666_0024475 Ga0495666_0024475_347_823 158
113 3300046531 Ga0495665_0031480 Ga0495665_0031480_2351_2827 158
114 3300046533 Ga0495640_0003310 Ga0495640_0003310_10489_10965 158
115 3300046535 Ga0495586_0052287 Ga0495586_0052287_168_644 158
116 3300046543 Ga0495645_0011928 Ga0495645_0011928_2338_2814 158
117 3300046642 Ga0495634_0003281 Ga0495634_0003281_7664_8140 158
118 3300046663 Ga0495635_0001339 Ga0495635_0001339_13660_14136 158
119 3300046663 Ga0495635_0126315 Ga0495635_0126315_531_1007 158
120 3300046681 Ga0495647_0010613 Ga0495647_0010613_1242_1718 158
121 3300046683 Ga0495658_0123238 Ga0495658_0123238_714_1190 158
122 3300046690 Ga0495624_0002621 Ga0495624_0002621_11881_12357 158
123 3300046809 Ga0495600_0276110 Ga0495600_0276110_427_903 158
124 3300047315 Ga0495581_0020558 Ga0495581_0020558_1580_2056 158
125 3300047319 Ga0495674_0006927 Ga0495674_0006927_9061_9537 158
126 3300047471 Ga0495684_0004391 Ga0495684_0004391_29_505 158
127 3300047471 Ga0495684_0005099 Ga0495684_0005099_7841_8317 158
128 3300053078 Ga0495612_0000187 Ga0495612_0000187_24059_24535 158
129 3300000041 ARcpr5oldR_c002575 ARcpr5oldR_0025752 159
130 3300000043 ARcpr5yngRDRAFT_c003782 ARcpr5yngRDRAFT_0037822 159
131 3300001976 JGI24752J21851_1012587 JGI24752J21851_10125872 159
132 3300001979 JGI24740J21852_10080762 JGI24740J21852_100807622 159
133 3300002075 JGI24738J21930_10015392 JGI24738J21930_100153922 159
134 3300002075 JGI24738J21930_10063437 JGI24738J21930_100634371 159
135 3300003775 Ga0055524_1001548 Ga0055524_100154814 159
136 3300003781 Ga0055536_1007886 Ga0055536_10078864 159
137 3300003784 Ga0055534_1022403 Ga0055534_10224032 159
138 3300003790 Ga0055528_1032619 Ga0055528_10326192 159
139 3300003791 Ga0055530_10000439 Ga0055530_1000043925 159
140 3300003791 Ga0055530_10000594 Ga0055530_1000059432 159
141 3300003791 Ga0055530_10049682 Ga0055530_100496822 159
142 3300003791 Ga0055530_10092330 Ga0055530_100923301 159
143 3300003794 Ga0055531_10000116 Ga0055531_1000011633 159
144 3300005288 Ga0065714_10098719 Ga0065714_100987193 159
145 3300005289 Ga0065704_10473974 Ga0065704_104739741 159
146 3300005295 Ga0065707_10151999 Ga0065707_101519992 159
147 3300005327 Ga0070658_10173047 Ga0070658_101730474 159
148 3300005327 Ga0070658_11004630 Ga0070658_110046301 159
149 3300005331 Ga0070670_100000621 Ga0070670_10000062125 159
150 3300005334 Ga0068869_100624033 Ga0068869_1006240331 159
151 3300005336 Ga0070680_100004270 Ga0070680_1000042703 159
152 3300005336 Ga0070680_100080285 Ga0070680_1000802852 159
153 3300005336 Ga0070680_100284449 Ga0070680_1002844492 159
154 3300005339 Ga0070660_100030281 Ga0070660_1000302813 159
155 3300005339 Ga0070660_101884377 Ga0070660_1018843771 159
156 3300005344 Ga0070661_100235648 Ga0070661_1002356482 159
157 3300005344 Ga0070661_100355996 Ga0070661_1003559961 159
158 3300005344 Ga0070661_101158502 Ga0070661_1011585022 159
159 3300005347 Ga0070668_100018490 Ga0070668_1000184902 159
160 3300005355 Ga0070671_100032911 Ga0070671_1000329115 159
161 3300005355 Ga0070671_100265926 Ga0070671_1002659263 159
162 3300005364 Ga0070673_100781783 Ga0070673_1007817832 159
163 3300005364 Ga0070673_101111543 Ga0070673_1011115431 159
164 3300005366 Ga0070659_100008286 Ga0070659_1000082861 159
165 3300005366 Ga0070659_100059354 Ga0070659_1000593543 159
166 3300005366 Ga0070659_100068905 Ga0070659_1000689052 159
167 3300005367 Ga0070667_100000322 Ga0070667_10000032229 159
168 3300005367 Ga0070667_100636027 Ga0070667_1006360272 159
169 3300005435 Ga0070714_100055463 Ga0070714_1000554633 159
170 3300005435 Ga0070714_100344830 Ga0070714_1003448302 159
171 3300005444 Ga0070694_100210727 Ga0070694_1002107273 159
172 3300005455 Ga0070663_100000837 Ga0070663_1000008375 159
173 3300005455 Ga0070663_100077637 Ga0070663_1000776374 159
174 3300005455 Ga0070663_100947889 Ga0070663_1009478892 159
175 3300005457 Ga0070662_100051566 Ga0070662_1000515665 159
176 3300005458 Ga0070681_10303593 Ga0070681_103035931 159
177 3300005458 Ga0070681_11173269 Ga0070681_111732691 159
178 3300005530 Ga0070679_100000112 Ga0070679_1000001127 159
179 3300005530 Ga0070679_100101300 Ga0070679_1001013003 159
180 3300005530 Ga0070679_101435375 Ga0070679_1014353751 159
181 3300005539 Ga0068853_100003533 Ga0068853_1000035336 159
182 3300005539 Ga0068853_100008993 Ga0068853_1000089937 159
183 3300005539 Ga0068853_100027584 Ga0068853_1000275848 159
184 3300005539 Ga0068853_100066850 Ga0068853_1000668503 159
185 3300005539 Ga0068853_100208277 Ga0068853_1002082772 159
186 3300005543 Ga0070672_100349859 Ga0070672_1003498592 159
187 3300005544 Ga0070686_100362150 Ga0070686_1003621502 159
188 3300005545 Ga0070695_100055567 Ga0070695_1000555672 159
189 3300005546 Ga0070696_100010028 Ga0070696_1000100283 159
190 3300005548 Ga0070665_100000021 Ga0070665_100000021219 159
191 3300005548 Ga0070665_100000105 Ga0070665_10000010514 159
192 3300005548 Ga0070665_100442521 Ga0070665_1004425212 159
193 3300005563 Ga0068855_100000305 Ga0068855_10000030524 159
194 3300005563 Ga0068855_100001252 Ga0068855_10000125217 159
195 3300005563 Ga0068855_100147047 Ga0068855_1001470472 159
196 3300005563 Ga0068855_100264548 Ga0068855_1002645483 159
197 3300005563 Ga0068855_102249757 Ga0068855_1022497571 159
198 3300005564 Ga0070664_100037446 Ga0070664_1000374462 159
199 3300005564 Ga0070664_100689999 Ga0070664_1006899992 159
200 3300005577 Ga0068857_100025650 Ga0068857_1000256506 159
201 3300005577 Ga0068857_100033719 Ga0068857_1000337194 159
202 3300005577 Ga0068857_100053877 Ga0068857_1000538772 159
203 3300005578 Ga0068854_100099837 Ga0068854_1000998372 159
204 3300005578 Ga0068854_100134783 Ga0068854_1001347833 159
205 3300005578 Ga0068854_100143017 Ga0068854_1001430173 159
206 3300005578 Ga0068854_100193606 Ga0068854_1001936062 159
207 3300005578 Ga0068854_100356389 Ga0068854_1003563892 159
208 3300005614 Ga0068856_100020880 Ga0068856_1000208804 159
209 3300005614 Ga0068856_100077633 Ga0068856_1000776334 159
210 3300005616 Ga0068852_100037222 Ga0068852_1000372224 159
211 3300005616 Ga0068852_100497437 Ga0068852_1004974372 159
212 3300005617 Ga0068859_100007709 Ga0068859_1000077093 159
213 3300005617 Ga0068859_100043963 Ga0068859_1000439636 159
214 3300005617 Ga0068859_100237966 Ga0068859_1002379662 159
215 3300005617 Ga0068859_100488477 Ga0068859_1004884772 159
216 3300005618 Ga0068864_100000004 Ga0068864_100000004378 159
217 3300005718 Ga0068866_10451198 Ga0068866_104511982 159
218 3300005719 Ga0068861_100000107 Ga0068861_10000010728 159
219 3300005719 Ga0068861_100261908 Ga0068861_1002619082 159
220 3300005841 Ga0068863_100000002 Ga0068863_100000002379 159
221 3300005841 Ga0068863_100058424 Ga0068863_1000584242 159
222 3300005842 Ga0068858_100024125 Ga0068858_1000241254 159
223 3300005842 Ga0068858_100298676 Ga0068858_1002986762 159
224 3300005843 Ga0068860_100047940 Ga0068860_1000479401 159
225 3300005843 Ga0068860_100050021 Ga0068860_1000500212 159
226 3300005844 Ga0068862_100000002 Ga0068862_100000002123 159
227 3300005844 Ga0068862_100000127 Ga0068862_10000012759 159
228 3300005844 Ga0068862_100012350 Ga0068862_1000123506 159
229 3300005985 Ga0081539_10016957 Ga0081539_100169575 159
230 3300005985 Ga0081539_10030696 Ga0081539_100306963 159
231 3300006195 Ga0075366_10116659 Ga0075366_101166592 159
232 3300006237 Ga0097621_100001517 Ga0097621_1000015176 159
233 3300006358 Ga0068871_100034759 Ga0068871_1000347592 159
234 3300006931 Ga0097620_100007709 Ga0097620_1000077093 159
235 3300006931 Ga0097620_100043963 Ga0097620_1000439636 159
236 3300006931 Ga0097620_100237977 Ga0097620_1002379772 159
237 3300006931 Ga0097620_100488467 Ga0097620_1004884672 159
238 3300006948 Ga0099826_10180708 Ga0099826_101807082 159
239 3300009011 Ga0105251_10002072 Ga0105251_100020727 159
240 3300009093 Ga0105240_10285343 Ga0105240_102853432 159
241 3300009093 Ga0105240_10334979 Ga0105240_103349792 159
242 3300009093 Ga0105240_10516549 Ga0105240_105165491 159
243 3300009094 Ga0111539_10030040 Ga0111539_100300408 159
244 3300009101 Ga0105247_10017235 Ga0105247_100172353 159
245 3300009148 Ga0105243_10405376 Ga0105243_104053762 159
246 3300009148 Ga0105243_10837138 Ga0105243_108371382 159
247 3300009174 Ga0105241_10031069 Ga0105241_100310694 159
248 3300009176 Ga0105242_11342761 Ga0105242_113427611 159
249 3300009177 Ga0105248_10000016 Ga0105248_1000001635 159
250 3300009177 Ga0105248_10001313 Ga0105248_1000131320 159
251 3300009177 Ga0105248_10400887 Ga0105248_104008872 159
252 3300009551 Ga0105238_10022206 Ga0105238_100222068 159
253 3300009551 Ga0105238_10145820 Ga0105238_101458204 159
254 3300009553 Ga0105249_10000149 Ga0105249_1000014923 159
255 3300009553 Ga0105249_10002669 Ga0105249_1000266918 159
256 3300010375 Ga0105239_10675382 Ga0105239_106753823 159
257 3300013100 Ga0157373_10387539 Ga0157373_103875392 159
258 3300013104 Ga0157370_10114710 Ga0157370_101147102 159
259 3300013296 Ga0157374_10598723 Ga0157374_105987232 159
260 3300013306 Ga0163162_10187148 Ga0163162_101871483 159
261 3300013306 Ga0163162_10308126 Ga0163162_103081263 159
262 3300013307 Ga0157372_10613374 Ga0157372_106133742 159
263 3300013308 Ga0157375_10006743 Ga0157375_100067438 159
264 3300014326 Ga0157380_10487206 Ga0157380_104872062 159
265 3300017792 Ga0163161_10026502 Ga0163161_100265025 159
266 3300017792 Ga0163161_10145799 Ga0163161_101457992 159
267 3300017792 Ga0163161_10703080 Ga0163161_107030802 159
268 3300017792 Ga0163161_10758648 Ga0163161_107586481 159
269 3300017792 Ga0163161_11102181 Ga0163161_111021811 159
270 3300020070 Ga0206356_10680400 Ga0206356_106804001 159
271 3300020082 Ga0206353_10860786 Ga0206353_108607861 159
272 3300025208 Ga0209436_122295 Ga0209436_1222951 159
273 3300025233 Ga0209437_120019 Ga0209437_1200192 159
274 3300025245 Ga0207425_1015748 Ga0207425_10157482 159
275 3300025261 Ga0209233_1000052 Ga0209233_10000526 159
276 3300025263 Ga0209565_1000007 Ga0209565_100000763 159
277 3300025273 Ga0209673_1001603 Ga0209673_100160318 159
278 3300025291 Ga0209675_1000075 Ga0209675_1000075111 159
279 3300025291 Ga0209675_1040054 Ga0209675_10400542 159
280 3300025292 Ga0209676_1000457 Ga0209676_100045755 159
281 3300025292 Ga0209676_1000554 Ga0209676_100055420 159
282 3300025294 Ga0209025_1018162 Ga0209025_10181625 159
283 3300025298 Ga0209050_1000017 Ga0209050_1000017123 159
284 3300025298 Ga0209050_1000196 Ga0209050_100019681 159
285 3300025298 Ga0209050_1008963 Ga0209050_10089636 159
286 3300025298 Ga0209050_1023424 Ga0209050_10234241 159
287 3300025298 Ga0209050_1055100 Ga0209050_10551001 159
288 3300025299 Ga0209256_1000009 Ga0209256_100000995 159
289 3300025299 Ga0209256_1000010 Ga0209256_100001019 159
290 3300025304 Ga0209257_1000206 Ga0209257_1000206123 159
291 3300025304 Ga0209257_1000228 Ga0209257_100022881 159
292 3300025304 Ga0209257_1000456 Ga0209257_100045623 159
293 3300025304 Ga0209257_1003373 Ga0209257_10033739 159
294 3300025304 Ga0209257_1003588 Ga0209257_100358810 159
295 3300025304 Ga0209257_1009860 Ga0209257_10098602 159
296 3300025321 Ga0207656_10225270 Ga0207656_102252702 159
297 3300025735 Ga0207713_1005825 Ga0207713_10058258 159
298 3300025900 Ga0207710_10009393 Ga0207710_100093933 159
299 3300025900 Ga0207710_10014488 Ga0207710_100144883 159
300 3300025909 Ga0207705_10132887 Ga0207705_101328873 159
301 3300025909 Ga0207705_10954933 Ga0207705_109549331 159
302 3300025912 Ga0207707_10038563 Ga0207707_100385634 159
303 3300025912 Ga0207707_10196038 Ga0207707_101960382 159
304 3300025912 Ga0207707_11076108 Ga0207707_110761082 159
305 3300025913 Ga0207695_10521279 Ga0207695_105212791 159
306 3300025917 Ga0207660_10000218 Ga0207660_100002183 159
307 3300025919 Ga0207657_10016201 Ga0207657_100162012 159
308 3300025919 Ga0207657_10030743 Ga0207657_100307434 159
309 3300025919 Ga0207657_10906562 Ga0207657_109065621 159
310 3300025920 Ga0207649_10058668 Ga0207649_100586685 159
311 3300025920 Ga0207649_10344177 Ga0207649_103441772 159
312 3300025921 Ga0207652_10000001 Ga0207652_1000000136 159
313 3300025921 Ga0207652_10936671 Ga0207652_109366711 159
314 3300025924 Ga0207694_10079449 Ga0207694_100794492 159
315 3300025924 Ga0207694_10647951 Ga0207694_106479512 159
316 3300025925 Ga0207650_10000643 Ga0207650_1000064325 159
317 3300025925 Ga0207650_10584424 Ga0207650_105844242 159
318 3300025929 Ga0207664_10041175 Ga0207664_100411754 159
319 3300025929 Ga0207664_10372572 Ga0207664_103725722 159
320 3300025931 Ga0207644_10247829 Ga0207644_102478292 159
321 3300025931 Ga0207644_10622150 Ga0207644_106221502 159
322 3300025932 Ga0207690_10090242 Ga0207690_100902422 159
323 3300025933 Ga0207706_10048755 Ga0207706_100487556 159
324 3300025934 Ga0207686_10729720 Ga0207686_107297202 159
325 3300025935 Ga0207709_11193086 Ga0207709_111930861 159
326 3300025937 Ga0207669_11240076 Ga0207669_112400761 159
327 3300025941 Ga0207711_10000022 Ga0207711_1000002235 159
328 3300025941 Ga0207711_10000956 Ga0207711_1000095620 159
329 3300025941 Ga0207711_10006787 Ga0207711_1000678713 159
330 3300025944 Ga0207661_10001385 Ga0207661_100013859 159
331 3300025945 Ga0207679_10112459 Ga0207679_101124592 159
332 3300025949 Ga0207667_10000035 Ga0207667_1000003537 159
333 3300025949 Ga0207667_10002213 Ga0207667_100022138 159
334 3300025949 Ga0207667_10293890 Ga0207667_102938902 159
335 3300025949 Ga0207667_10401981 Ga0207667_104019812 159
336 3300025961 Ga0207712_10000111 Ga0207712_1000011123 159
337 3300025961 Ga0207712_10005353 Ga0207712_100053531 159
338 3300025961 Ga0207712_11321897 Ga0207712_113218971 159
339 3300025972 Ga0207668_10001243 Ga0207668_1000124311 159
340 3300025972 Ga0207668_10012621 Ga0207668_100126212 159
341 3300025972 Ga0207668_10295261 Ga0207668_102952612 159
342 3300025972 Ga0207668_10626718 Ga0207668_106267181 159
343 3300025981 Ga0207640_10000085 Ga0207640_1000008574 159
344 3300025981 Ga0207640_10111622 Ga0207640_101116222 159
345 3300025981 Ga0207640_10322787 Ga0207640_103227872 159
346 3300025981 Ga0207640_11182351 Ga0207640_111823512 159
347 3300025986 Ga0207658_10000589 Ga0207658_100005897 159
348 3300026035 Ga0207703_10000510 Ga0207703_1000051045 159
349 3300026035 Ga0207703_10072971 Ga0207703_100729713 159
350 3300026035 Ga0207703_10592700 Ga0207703_105927002 159
351 3300026035 Ga0207703_11263858 Ga0207703_112638581 159
352 3300026041 Ga0207639_10012952 Ga0207639_100129525 159
353 3300026041 Ga0207639_10048127 Ga0207639_100481273 159
354 3300026067 Ga0207678_10005202 Ga0207678_1000520211 159
355 3300026067 Ga0207678_10099206 Ga0207678_100992062 159
356 3300026078 Ga0207702_10031113 Ga0207702_100311137 159
357 3300026078 Ga0207702_10574549 Ga0207702_105745492 159
358 3300026088 Ga0207641_10000002 Ga0207641_10000002859 159
359 3300026088 Ga0207641_10055125 Ga0207641_100551254 159
360 3300026089 Ga0207648_10271929 Ga0207648_102719292 159
361 3300026095 Ga0207676_10000040 Ga0207676_1000004054 159
362 3300026116 Ga0207674_10011562 Ga0207674_100115626 159
363 3300026116 Ga0207674_10015944 Ga0207674_100159443 159
364 3300026116 Ga0207674_10037608 Ga0207674_100376084 159
365 3300026116 Ga0207674_10206109 Ga0207674_102061091 159
366 3300026118 Ga0207675_100000317 Ga0207675_10000031714 159
367 3300026118 Ga0207675_100303528 Ga0207675_1003035283 159
368 3300026142 Ga0207698_10279055 Ga0207698_102790552 159
369 3300026142 Ga0207698_10279145 Ga0207698_102791452 159
370 3300027666 Ga0209282_1166632 Ga0209282_11666322 159
371 3300027876 Ga0209974_10143705 Ga0209974_101437052 159
372 3300028379 Ga0268266_10000015 Ga0268266_10000015234 159
373 3300028379 Ga0268266_10000055 Ga0268266_10000055217 159
374 3300028380 Ga0268265_10000003 Ga0268265_10000003131 159
375 3300028380 Ga0268265_10000385 Ga0268265_100003857 159
376 3300028380 Ga0268265_10115292 Ga0268265_101152924 159
377 3300028381 Ga0268264_10009236 Ga0268264_100092362 159
378 3300028381 Ga0268264_10080903 Ga0268264_100809032 159
379 3300030522 Ga0307512_10209745 Ga0307512_102097452 159
380 3300030745 Ga0316182_1432900 Ga0316182_14329001 159
381 3300031250 Ga0265331_10000005 Ga0265331_10000005405 159
382 3300031456 Ga0307513_10095479 Ga0307513_100954793 159
383 3300031456 Ga0307513_10154019 Ga0307513_101540193 159
384 3300031548 Ga0307408_100019783 Ga0307408_1000197836 159
385 3300031548 Ga0307408_100085229 Ga0307408_1000852292 159
386 3300031548 Ga0307408_100096460 Ga0307408_1000964602 159
387 3300031548 Ga0307408_100422366 Ga0307408_1004223662 159
388 3300031548 Ga0307408_100671021 Ga0307408_1006710212 159
389 3300031548 Ga0307408_100886971 Ga0307408_1008869711 159
390 3300031616 Ga0307508_10004215 Ga0307508_100042156 159
391 3300031731 Ga0307405_10177100 Ga0307405_101771001 159
392 3300031731 Ga0307405_10802798 Ga0307405_108027982 159
393 3300031824 Ga0307413_10291379 Ga0307413_102913792 159
394 3300031824 Ga0307413_10298467 Ga0307413_102984673 159
395 3300031852 Ga0307410_10071133 Ga0307410_100711335 159
396 3300031852 Ga0307410_10369168 Ga0307410_103691681 159
397 3300031901 Ga0307406_10044506 Ga0307406_100445064 159
398 3300031901 Ga0307406_10060279 Ga0307406_100602791 159
399 3300031901 Ga0307406_10115111 Ga0307406_101151113 159
400 3300031901 Ga0307406_10138152 Ga0307406_101381522 159
401 3300031901 Ga0307406_10785034 Ga0307406_107850342 159
402 3300031903 Ga0307407_10274665 Ga0307407_102746651 159
403 3300031903 Ga0307407_10408881 Ga0307407_104088812 159
404 3300031911 Ga0307412_10005529 Ga0307412_100055291 159
405 3300031911 Ga0307412_10007833 Ga0307412_100078334 159
406 3300031911 Ga0307412_10009359 Ga0307412_100093596 159
407 3300031911 Ga0307412_10251859 Ga0307412_102518593 159
408 3300031911 Ga0307412_10329095 Ga0307412_103290952 159
409 3300031911 Ga0307412_10410544 Ga0307412_104105442 159
410 3300031911 Ga0307412_10543575 Ga0307412_105435752 159
411 3300031911 Ga0307412_10764066 Ga0307412_107640662 159
412 3300031995 Ga0307409_100681128 Ga0307409_1006811282 159
413 3300031995 Ga0307409_100844442 Ga0307409_1008444422 159
414 3300032002 Ga0307416_100024239 Ga0307416_1000242393 159
415 3300032002 Ga0307416_100039249 Ga0307416_1000392494 159
416 3300032002 Ga0307416_100310481 Ga0307416_1003104812 159
417 3300032004 Ga0307414_10000070 Ga0307414_1000007076 159
418 3300032004 Ga0307414_10000908 Ga0307414_100009089 159
419 3300032004 Ga0307414_10021947 Ga0307414_100219472 159
420 3300032004 Ga0307414_10034425 Ga0307414_100344253 159
421 3300032004 Ga0307414_10067246 Ga0307414_100672462 159
422 3300032004 Ga0307414_10637974 Ga0307414_106379742 159
423 3300032004 Ga0307414_10895295 Ga0307414_108952951 159
424 3300032004 Ga0307414_11249117 Ga0307414_112491171 159
425 3300032005 Ga0307411_10048286 Ga0307411_100482861 159
426 3300032005 Ga0307411_10140883 Ga0307411_101408832 159
427 3300032005 Ga0307411_10561176 Ga0307411_105611762 159
428 3300032005 Ga0307411_10582318 Ga0307411_105823182 159
429 3300032005 Ga0307411_10849728 Ga0307411_108497282 159
430 3300032005 Ga0307411_11971721 Ga0307411_119717211 159
431 3300032126 Ga0307415_100082053 Ga0307415_1000820534 159
432 3300032126 Ga0307415_100157314 Ga0307415_1001573143 159
433 3300032126 Ga0307415_100199808 Ga0307415_1001998082 159
434 3300032126 Ga0307415_100507489 Ga0307415_1005074892 159
435 3300033180 Ga0307510_10021872 Ga0307510_100218727 159
436 3300035117 Ga0373953_0178203 Ga0373953_0178203_96_575 159
437 3300035118 Ga0373954_0140379 Ga0373954_0140379_31_510 159
438 3300035119 Ga0373956_0081265 Ga0373956_0081265_634_1113 159
439 3300035120 Ga0373957_0116690 Ga0373957_0116690_372_851 159
440 3300035170 Ga0373943_0004063 Ga0373943_0004063_6140_6619 159
441 3300035172 Ga0373955_0002343 Ga0373955_0002343_6279_6758 159
442 3300035692 Ga0373935_0210574 Ga0373935_0210574_265_744 159
443 3300035725 Ga0373947_0396628 Ga0373947_0396628_225_704 159
444 3300036401 Ga0373937_0013140 Ga0373937_0013140_3339_3818 159
445 3300036647 Ga0316582_0000396 Ga0316582_0000396_7845_8324 159
446 3300036712 Ga0316584_0020794 Ga0316584_0020794_935_1414 159
447 3300036712 Ga0316584_0312609 Ga0316584_0312609_360_839 159
448 3300037068 Ga0373925_0033233 Ga0373925_0033233_2333_2812 159
449 3300037312 Ga0395899_0001872 Ga0395899_0001872_2856_3335 159
450 3300037312 Ga0395899_0014790 Ga0395899_0014790_2449_2928 159
451 3300037312 Ga0395899_0154353 Ga0395899_0154353_170_649 159
452 3300037312 Ga0395899_0335232 Ga0395899_0335232_21_500 159
453 3300037312 Ga0395899_0451793 Ga0395899_0451793_141_620 159
454 3300037418 Ga0395900_0000084 Ga0395900_0000084_58182_58661 159
455 3300037418 Ga0395900_0131251 Ga0395900_0131251_2026_2505 159
456 3300037418 Ga0395900_0148125 Ga0395900_0148125_205_684 159
457 3300037418 Ga0395900_0367779 Ga0395900_0367779_404_883 159
458 3300037418 Ga0395900_0424270 Ga0395900_0424270_291_770 159
459 3300037466 Ga0395898_0000021 Ga0395898_0000021_274644_275123 159
460 3300037466 Ga0395898_0003569 Ga0395898_0003569_11672_12151 159
461 3300037466 Ga0395898_0152050 Ga0395898_0152050_142_621 159
462 3300037466 Ga0395898_0155205 Ga0395898_0155205_1203_1682 159
463 3300037471 Ga0395905_0000006 Ga0395905_0000006_490896_491375 159
464 3300037471 Ga0395905_0006269 Ga0395905_0006269_926_1405 159
465 3300037471 Ga0395905_0008304 Ga0395905_0008304_384_863 159
466 3300037471 Ga0395905_0019553 Ga0395905_0019553_4810_5289 159
467 3300037471 Ga0395905_0087484 Ga0395905_0087484_1273_1752 159
468 3300037471 Ga0395905_0298168 Ga0395905_0298168_984_1463 159
469 3300037471 Ga0395905_0305467 Ga0395905_0305467_415_894 159
470 3300037471 Ga0395905_0403724 Ga0395905_0403724_741_1220 159
471 3300037853 Ga0436364_0416603 Ga0436364_0416603_655_1134 159
472 3300038443 Ga0395901_0001581 Ga0395901_0001581_10728_11207 159
473 3300038443 Ga0395901_0004950 Ga0395901_0004950_951_1430 159
474 3300038443 Ga0395901_0032271 Ga0395901_0032271_1843_2322 159
475 3300038443 Ga0395901_0145215 Ga0395901_0145215_1704_2183 159
476 3300038443 Ga0395901_0409938 Ga0395901_0409938_413_892 159
477 3300038705 Ga0237819_02700 Ga0237819_02700_2076_2555 159
478 3300039453 Ga0436362_1101242 Ga0436362_1101242_97_576 159
479 3300041404 Ga0439436_0062191 Ga0439436_0062191_124_603 159
480 3300041405 Ga0439438_062014 Ga0439438_062014_162_641 159
481 3300041406 Ga0439439_0017369 Ga0439439_0017369_1152_1631 159
482 3300041407 Ga0439447_096548 Ga0439447_096548_183_662 159
483 3300041410 Ga0439461_0000237 Ga0439461_0000237_7295_7774 159
484 3300041413 Ga0439465_0001413 Ga0439465_0001413_1998_2477 159
485 3300041413 Ga0439465_0003226 Ga0439465_0003226_1549_2028 159
486 3300041452 Ga0451793_1016855 Ga0451793_1016855_176_655 159
487 3300041452 Ga0451793_1315180 Ga0451793_1315180_306_785 159
488 3300041461 Ga0451805_038860 Ga0451805_038860_39_521 159
489 3300041461 Ga0451805_107206 Ga0451805_107206_35_517 159
490 3300041997 Ga0439431_0000173 Ga0439431_0000173_4587_5066 159
491 3300041997 Ga0439431_0004664 Ga0439431_0004664_1085_1564 159
492 3300042002 Ga0439442_004433 Ga0439442_004433_1731_2210 159
493 3300042004 Ga0439445_0000812 Ga0439445_0000812_3475_3954 159
494 3300042004 Ga0439445_0003186 Ga0439445_0003186_2666_3145 159
495 3300042004 Ga0439445_0032828 Ga0439445_0032828_827_1306 159
496 3300042004 Ga0439445_0164879 Ga0439445_0164879_88_567 159
497 3300042006 Ga0439432_019352 Ga0439432_019352_585_1064 159
498 3300042006 Ga0439432_032722 Ga0439432_032722_238_717 159
499 3300042014 Ga0439457_053736 Ga0439457_053736_116_595 159
500 3300042015 Ga0439462_0000167 Ga0439462_0000167_890_1369 159
501 3300042142 Ga0450905_009047 Ga0450905_009047_171_650 159
502 3300042144 Ga0450889_000888 Ga0450889_000888_2127_2606 159
503 3300042156 Ga0439446_0050764 Ga0439446_0050764_10_489 159
504 3300042435 Ga0439434_0002832 Ga0439434_0002832_155_634 159
505 3300042439 Ga0439464_0191058 Ga0439464_0191058_83_562 159
506 3300044693 Ga0466961_0211685 Ga0466961_0211685_216_695 159
507 3300044694 Ga0466963_0025116 Ga0466963_0025116_262_741 159
508 3300044719 Ga0466971_0450653 Ga0466971_0450653_93_572 159
509 3300044735 Ga0466968_0505422 Ga0466968_0505422_34_513 159
510 3300044765 Ga0466970_0091618 Ga0466970_0091618_955_1434 159
511 3300044842 Ga0466957_0278994 Ga0466957_0278994_110_589 159
512 3300045049 Ga0466959_0400199 Ga0466959_0400199_46_525 159
513 3300045836 Ga0466958_0078077 Ga0466958_0078077_29_508 159
514 3300045836 Ga0466958_0188814 Ga0466958_0188814_311_790 159
515 3300045836 Ga0466958_0534752 Ga0466958_0534752_77_556 159
516 3300045976 Ga0466967_0023474 Ga0466967_0023474_1226_1705 159
517 3300045976 Ga0466967_0509192 Ga0466967_0509192_227_706 159
518 3300046460 Ga0495638_0000714 Ga0495638_0000714_31799_32278 159
519 3300046492 Ga0495585_0027193 Ga0495585_0027193_2578_3057 159
520 3300046522 Ga0495643_0051033 Ga0495643_0051033_559_1038 159
521 3300046616 Ga0495668_0000076 Ga0495668_0000076_135886_136368 159
522 3300046616 Ga0495668_0115150 Ga0495668_0115150_672_1151 159
523 3300046616 Ga0495668_0542498 Ga0495668_0542498_105_584 159
524 3300046660 Ga0495625_0000936 Ga0495625_0000936_19570_20052 159
525 3300046660 Ga0495625_0001409 Ga0495625_0001409_24258_24737 159
526 3300046660 Ga0495625_0042798 Ga0495625_0042798_91_570 159
527 3300046679 Ga0495623_0257708 Ga0495623_0257708_440_919 159
528 3300046691 Ga0495670_0000003 Ga0495670_0000003_289832_290311 159
529 3300047472 Ga0495686_0000082 Ga0495686_0000082_45930_46409 159
530 3300047472 Ga0495686_0045625 Ga0495686_0045625_1744_2223 159
531 3300048906 Ga0496103_0064131 Ga0496103_0064131_1286_1765 159
532 3300048912 Ga0496109_0157652 Ga0496109_0157652_1275_1754 159
533 3300048912 Ga0496109_0310766 Ga0496109_0310766_309_788 159
534 3300048914 Ga0496111_0086926 Ga0496111_0086926_1638_2117 159
535 3300048915 Ga0496112_0003706 Ga0496112_0003706_12069_12548 159
536 3300048915 Ga0496112_0035620 Ga0496112_0035620_1479_2060 159
537 3300048916 Ga0496113_0002272 Ga0496113_0002272_2726_3205 159
538 3300048918 Ga0496115_0292471 Ga0496115_0292471_340_819 159
539 3300048920 Ga0496117_0003086 Ga0496117_0003086_15092_15571 159
540 3300048921 Ga0496118_0072196 Ga0496118_0072196_779_1258 159
541 3300048922 Ga0496119_0049487 Ga0496119_0049487_1926_2405 159
542 3300048925 Ga0496122_0001177 Ga0496122_0001177_9743_10222 159
543 3300048926 Ga0496123_0000754 Ga0496123_0000754_17370_17849 159
544 3300048927 Ga0496124_0049520 Ga0496124_0049520_2903_3382 159
545 3300049130 Ga0501310_052323 Ga0501310_052323_34_513 159
546 3300049160 Ga0501304_031661 Ga0501304_031661_73_552 159
547 3300049513 Ga0501290_000076 Ga0501290_000076_6989_7468 159
548 3300049515 Ga0501292_000037 Ga0501292_000037_22736_23215 159
549 3300049517 Ga0501294_000020 Ga0501294_000020_463_942 159
550 3300049529 Ga0501313_051858 Ga0501313_051858_45_524 159
551 3300049529 Ga0501313_058902 Ga0501313_058902_26_505 159
552 3300049530 Ga0501314_002904 Ga0501314_002904_299_778 159
553 3300049531 Ga0501315_004097 Ga0501315_004097_529_1008 159
554 3300049533 Ga0501317_013270 Ga0501317_013270_474_953 159
555 3300049536 Ga0501320_036411 Ga0501320_036411_112_591 159
556 3300049536 Ga0501320_049645 Ga0501320_049645_46_525 159
557 3300049539 Ga0501323_022668 Ga0501323_022668_57_536 159
558 3300049551 Ga0501335_036996 Ga0501335_036996_28_507 159
559 3300049554 Ga0501338_06694 Ga0501338_06694_78_557 159
560 3300049568 Ga0501031_0100697 Ga0501031_0100697_843_1436 159
561 3300049569 Ga0501032_0007617 Ga0501032_0007617_4943_5536 159
562 3300049570 Ga0501033_0011285 Ga0501033_0011285_450_1043 159
563 3300049571 Ga0501034_0124569 Ga0501034_0124569_30_623 159
564 3300049571 Ga0501034_0169927 Ga0501034_0169927_1556_2035 159
565 3300049572 Ga0501036_0052934 Ga0501036_0052934_1561_2154 159
566 3300049573 Ga0501037_0022098 Ga0501037_0022098_687_1280 159
567 3300049574 Ga0501038_0221942 Ga0501038_0221942_450_1043 159
568 3300049575 Ga0501039_0108807 Ga0501039_0108807_987_1580 159
569 3300049579 Ga0501043_0087084 Ga0501043_0087084_577_1170 159
570 3300049581 Ga0501047_0180019 Ga0501047_0180019_196_789 159
571 3300049581 Ga0501047_0340756 Ga0501047_0340756_367_846 159
572 3300049581 Ga0501047_0392506 Ga0501047_0392506_641_1120 159
573 3300049581 Ga0501047_0403264 Ga0501047_0403264_711_1190 159
574 3300049590 Ga0501074_0956433 Ga0501074_0956433_71_550 159
575 3300049592 Ga0501076_1065584 Ga0501076_1065584_149_628 159
576 3300049663 Ga0501223_000755 Ga0501223_000755_4971_5450 159
577 3300049664 Ga0501224_000016 Ga0501224_000016_79773_80252 159
578 3300049668 Ga0501233_009888 Ga0501233_009888_650_1129 159
579 3300049679 Ga0501249_041261 Ga0501249_041261_519_998 159
580 3300049686 Ga0501257_000240 Ga0501257_000240_5854_6333 159
581 3300049704 Ga0501221_030695 Ga0501221_030695_369_848 159
582 3300049705 Ga0501225_0000016 Ga0501225_0000016_5874_6353 159
583 3300049705 Ga0501225_0006759 Ga0501225_0006759_2537_3016 159
584 3300049742 Ga0501080_0104794 Ga0501080_0104794_1519_1998 159
585 3300049764 Ga0501267_007509 Ga0501267_007509_193_672 159
586 3300049775 Ga0501279_000008 Ga0501279_000008_11911_12390 159
587 3300049776 Ga0501280_000013 Ga0501280_000013_19488_19967 159
588 3300049776 Ga0501280_001260 Ga0501280_001260_559_1038 159
589 3300049777 Ga0501281_00107 Ga0501281_00107_8339_8818 159
590 3300049778 Ga0501282_000282 Ga0501282_000282_5634_6113 159
591 3300049822 Ga0501035_0005503 Ga0501035_0005503_10582_11175 159
592 3300049822 Ga0501035_0692300 Ga0501035_0692300_317_796 159
593 3300049822 Ga0501035_0888428 Ga0501035_0888428_106_585 159
594 3300049823 Ga0501044_0006511 Ga0501044_0006511_566_1159 159
595 3300049823 Ga0501044_0059423 Ga0501044_0059423_1049_1549 159
596 3300049853 Ga0501226_000020 Ga0501226_000020_134847_135326 159
597 3300050508 nmdc:mga09592_222938_c1 nmdc:mga09592_222938_c1_652_1131 159
598 3300050511 nmdc:mga08y16_50996_c1 nmdc:mga08y16_50996_c1_1256_1735 159
599 3300053087 Ga0500643_000005 Ga0500643_000005_315898_316377 159
600 3300053087 Ga0500643_000139 Ga0500643_000139_4685_5164 159
601 3300053087 Ga0500643_002899 Ga0500643_002899_6466_6945 159
602 3300053087 Ga0500643_006988 Ga0500643_006988_173_652 159
603 3300053087 Ga0500643_045751 Ga0500643_045751_255_734 159
604 3300053090 Ga0500646_0126254 Ga0500646_0126254_156_635 159
605 3300053094 Ga0500566_0015418 Ga0500566_0015418_3660_4139 159
606 3300053118 Ga0500594_0148399 Ga0500594_0148399_128_607 159
607 3300053122 Ga0500608_017499 Ga0500608_017499_2749_3234 159
608 3300053130 Ga0500642_0000001 Ga0500642_0000001_589143_589628 159
609 3300053136 Ga0500559_0028545 Ga0500559_0028545_1319_1798 159
610 3300053139 Ga0500568_0000942 Ga0500568_0000942_11865_12344 159
611 3300053139 Ga0500568_0001466 Ga0500568_0001466_2176_2658 159
612 3300053151 Ga0500604_0000043 Ga0500604_0000043_12070_12549 159
613 3300053153 Ga0500616_0000293 Ga0500616_0000293_39400_39879 159
614 3300053153 Ga0500616_0017603 Ga0500616_0017603_461_940 159
615 3300053157 Ga0500624_000205 Ga0500624_000205_11771_12250 159
616 3300059424 Ga0590075_135422 Ga0590075_135422_92_571 159
617 3300059426 Ga0590077_100922 Ga0590077_100922_28_507 159
618 3300059493 Ga0587077_188167 Ga0587077_188167_42_521 159
619 3300059504 Ga0587082_136199 Ga0587082_136199_40_519 159
620 3300059504 Ga0587082_140545 Ga0587082_140545_36_515 159
621 3300059507 Ga0587086_028513 Ga0587086_028513_285_764 159
622 3300059630 Ga0587128_024646 Ga0587128_024646_58_537 159
623 3300059645 Ga0587076_077902 Ga0587076_077902_87_566 159
624 3300059660 Ga0587124_033839 Ga0587124_033839_50_529 159
625 3300061719 Ga0466962_0232925 Ga0466962_0232925_74_553 159
626 iso_pu_bacteria 2895880812 2895881071 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00572

Ribosomal_L13

Ribosomal protein L13

39

157

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7asn-assembly1.cif.gz_H staphylococcus aureus 50s after 30 minutes incubation a 37c 0.9437 14 147
7ood-assembly1.cif.gz_i mycoplasma pneumoniae 50s subunit of ribosomes in chloramphenicol-treated cells 0.9435 12 146
4ce4-assembly1.cif.gz_N 39s large subunit of the porcine mitochondrial ribosome 0.9419 17 146
6ppk-assembly1.cif.gz_J rbga+45srbga complex 0.9413 12 146
6ysi-assembly1.cif.gz_F acinetobacter baumannii ribosome-tigecycline complex - 50s subunit 0.94 8 147
ID Description Score Start End Superfamily
af_C6SWN9_25_183_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9437 17 148 3.90.1180.10
af_A0A0R0E7H3_25_163_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9424 17 148 3.90.1180.10
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9229 8 147 3.90.1180.10
af_Q9VJ38_1_177_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9186 16 147 3.90.1180.10
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9104 8 147 3.90.1180.10
ID Description Score Start End GO Terms
AF-A0A258RNK1-F1-model_v4 Large ribosomal subunit protein uL13 0.9742 23 159 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A1Q7BZ54-F1-model_v4 50S ribosomal protein L13 0.9688 20 159 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A1Y2K1C2-F1-model_v4 Large ribosomal subunit protein uL13 0.9686 11 147 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-C6XKJ9-F1-model_v4 Large ribosomal subunit protein uL13 0.9669 8 159 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A1E5QAR2-F1-model_v4 Large ribosomal subunit protein uL13 0.9664 8 159 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625

Feature Viewer

pLDDT pTM Quality
90.14 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map