F470498
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 626 | 354 | 624 | 158 |
Family's Representative Sequence
| Representative Sequence | 3300048088|Ga0495602_0492528|Ga0495602_0492528_25_537 |
| Length | 170 |
| Sequence | LAPHPALSRIDYHRRQPRGIARLVRAMKTYVATPADRERNWLIVDASGQTLGRLATQIADALRGKRKPTYTPHVDTGDFVIVINAEKISVTGNKLADKRYYRHSGYPGGLRSRTLAEMLERRPEEVIRRAVKGMLPRNRLARRQITKLKVYAGPEHPHAAQQPQPMEIKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 65 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 139 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 144 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 145 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 146 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 147 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 148 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 149 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 150 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 151 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 152 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 153 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 154 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 156 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 157 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 158 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 159 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 160 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 161 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 162 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 164 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 166 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 167 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 169 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 170 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 173 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 175 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 176 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 178 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 179 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 181 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 182 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 183 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 184 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 185 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 186 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 189 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 190 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 191 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 192 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 193 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 194 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 195 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 196 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 198 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 199 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 200 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 201 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 202 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 203 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 204 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 205 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 206 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 207 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 208 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 209 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 210 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 211 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 212 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 213 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 214 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 215 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 216 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 262 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 263 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 264 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 265 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 266 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 267 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 268 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 269 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 270 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 271 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 274 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 275 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 276 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 305 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 306 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 307 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 308 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 309 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 310 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 311 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 315 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 316 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 317 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 318 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 319 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 323 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 324 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 325 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 326 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 333 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 334 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 335 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 336 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 337 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 338 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 339 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 340 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 341 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 342 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 343 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 344 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 345 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 353 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 354 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.01 |
| Metatranscriptomes | 3.67 |
| Isolates | 0.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.95 |
| Nodule | 0.32 |
| Rhizoplane | 1.92 |
| Rhizosphere | 85.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c002575 | 3300000041 | Bacteria | 1667 |
| 2 | ARcpr5yngRDRAFT_c003782 | 3300000043 | Bacteria | 1463 |
| 3 | JGI24752J21851_1012587 | 3300001976 | Bacteria | 1106 |
| 4 | JGI24740J21852_10080762 | 3300001979 | Bacteria | 852 |
| 5 | JGI24738J21930_10015392 | 3300002075 | Bacteria | 1628 |
| 6 | JGI24738J21930_10063437 | 3300002075 | Bacteria | 760 |
| 7 | Ga0055524_1001548 | 3300003775 | Bacteria | 12967 |
| 8 | Ga0055536_1007886 | 3300003781 | Bacteria | 4678 |
| 9 | Ga0055534_1022403 | 3300003784 | Bacteria | 1044 |
| 10 | Ga0055528_1032619 | 3300003790 | Bacteria | 1324 |
| 11 | Ga0055530_10000439 | 3300003791 | Bacteria | 36986 |
| 12 | Ga0055530_10000594 | 3300003791 | Bacteria | 31300 |
| 13 | Ga0055530_10049682 | 3300003791 | Bacteria | 980 |
| 14 | Ga0055530_10092330 | 3300003791 | Bacteria | 619 |
| 15 | Ga0055531_10000116 | 3300003794 | Bacteria | 88368 |
| 16 | Ga0065714_10098719 | 3300005288 | Bacteria | 1703 |
| 17 | Ga0065704_10473974 | 3300005289 | Bacteria | 687 |
| 18 | Ga0065707_10151999 | 3300005295 | Bacteria | 1648 |
| 19 | Ga0070658_10133788 | 3300005327 | Bacteria | 2067 |
| 20 | Ga0070658_10173047 | 3300005327 | Bacteria | 1814 |
| 21 | Ga0070658_11004630 | 3300005327 | Bacteria | 725 |
| 22 | Ga0070670_100000621 | 3300005331 | Bacteria | 27756 |
| 23 | Ga0068869_100624033 | 3300005334 | Bacteria | 913 |
| 24 | Ga0070680_100004270 | 3300005336 | Bacteria | 10731 |
| 25 | Ga0070680_100080285 | 3300005336 | Bacteria | 2690 |
| 26 | Ga0070680_100284449 | 3300005336 | Bacteria | 1401 |
| 27 | Ga0070660_100030281 | 3300005339 | Bacteria | 4060 |
| 28 | Ga0070660_101884377 | 3300005339 | Bacteria | 510 |
| 29 | Ga0070691_10353165 | 3300005341 | Bacteria | 817 |
| 30 | Ga0070661_100235648 | 3300005344 | Bacteria | 1408 |
| 31 | Ga0070661_100355996 | 3300005344 | Bacteria | 1149 |
| 32 | Ga0070661_101158502 | 3300005344 | Bacteria | 646 |
| 33 | Ga0070668_100018490 | 3300005347 | Bacteria | 5232 |
| 34 | Ga0070671_100032911 | 3300005355 | Bacteria | 4285 |
| 35 | Ga0070671_100265926 | 3300005355 | Bacteria | 1458 |
| 36 | Ga0070673_100781783 | 3300005364 | Bacteria | 880 |
| 37 | Ga0070673_101111543 | 3300005364 | Bacteria | 738 |
| 38 | Ga0070659_100008286 | 3300005366 | Bacteria | 7588 |
| 39 | Ga0070659_100059354 | 3300005366 | Bacteria | 3020 |
| 40 | Ga0070659_100068905 | 3300005366 | Bacteria | 2807 |
| 41 | Ga0070667_100000322 | 3300005367 | Bacteria | 53499 |
| 42 | Ga0070667_100636027 | 3300005367 | Bacteria | 985 |
| 43 | Ga0070714_100055463 | 3300005435 | Bacteria | 3387 |
| 44 | Ga0070714_100344830 | 3300005435 | Bacteria | 1398 |
| 45 | Ga0070694_100210727 | 3300005444 | Bacteria | 1453 |
| 46 | Ga0070663_100000837 | 3300005455 | Bacteria | 16655 |
| 47 | Ga0070663_100077637 | 3300005455 | Bacteria | 2432 |
| 48 | Ga0070663_100947889 | 3300005455 | Bacteria | 746 |
| 49 | Ga0070662_100051566 | 3300005457 | Bacteria | 2972 |
| 50 | Ga0070681_10303593 | 3300005458 | Bacteria | 1506 |
| 51 | Ga0070681_11173269 | 3300005458 | Bacteria | 690 |
| 52 | Ga0070679_100000112 | 3300005530 | Bacteria | 63894 |
| 53 | Ga0070679_100101300 | 3300005530 | Bacteria | 2867 |
| 54 | Ga0070679_101435375 | 3300005530 | Bacteria | 637 |
| 55 | Ga0070697_100417442 | 3300005536 | Bacteria | 1166 |
| 56 | Ga0068853_100003533 | 3300005539 | Bacteria | 11957 |
| 57 | Ga0068853_100008993 | 3300005539 | Bacteria | 8044 |
| 58 | Ga0068853_100027584 | 3300005539 | Bacteria | 4771 |
| 59 | Ga0068853_100066850 | 3300005539 | Bacteria | 3122 |
| 60 | Ga0068853_100208277 | 3300005539 | Bacteria | 1781 |
| 61 | Ga0070672_100349859 | 3300005543 | Bacteria | 1259 |
| 62 | Ga0070686_100362150 | 3300005544 | Bacteria | 1093 |
| 63 | Ga0070695_100055567 | 3300005545 | Bacteria | 2552 |
| 64 | Ga0070695_100064915 | 3300005545 | Bacteria | 2376 |
| 65 | Ga0070696_100010028 | 3300005546 | Bacteria | 6337 |
| 66 | Ga0070665_100000021 | 3300005548 | Bacteria | 389668 |
| 67 | Ga0070665_100000105 | 3300005548 | Bacteria | 157734 |
| 68 | Ga0070665_100442521 | 3300005548 | Bacteria | 1309 |
| 69 | Ga0068855_100000305 | 3300005563 | Bacteria | 61038 |
| 70 | Ga0068855_100001252 | 3300005563 | Bacteria | 31534 |
| 71 | Ga0068855_100147047 | 3300005563 | Bacteria | 2682 |
| 72 | Ga0068855_100264548 | 3300005563 | Bacteria | 1915 |
| 73 | Ga0068855_102249757 | 3300005563 | Bacteria | 546 |
| 74 | Ga0070664_100037446 | 3300005564 | Bacteria | 4079 |
| 75 | Ga0070664_100689999 | 3300005564 | Bacteria | 951 |
| 76 | Ga0068857_100025650 | 3300005577 | Bacteria | 5189 |
| 77 | Ga0068857_100033719 | 3300005577 | Bacteria | 4528 |
| 78 | Ga0068857_100053877 | 3300005577 | Bacteria | 3568 |
| 79 | Ga0068854_100099837 | 3300005578 | Bacteria | 2174 |
| 80 | Ga0068854_100134783 | 3300005578 | Bacteria | 1890 |
| 81 | Ga0068854_100143017 | 3300005578 | Bacteria | 1837 |
| 82 | Ga0068854_100193606 | 3300005578 | Bacteria | 1594 |
| 83 | Ga0068854_100356389 | 3300005578 | Bacteria | 1199 |
| 84 | Ga0068856_100017890 | 3300005614 | Bacteria | 6875 |
| 85 | Ga0068856_100020880 | 3300005614 | Bacteria | 6366 |
| 86 | Ga0068856_100077633 | 3300005614 | Bacteria | 3291 |
| 87 | Ga0068852_100037222 | 3300005616 | Bacteria | 4077 |
| 88 | Ga0068852_100497437 | 3300005616 | Bacteria | 1213 |
| 89 | Ga0068859_100007709 | 3300005617 | Bacteria | 10931 |
| 90 | Ga0068859_100043963 | 3300005617 | Bacteria | 4489 |
| 91 | Ga0068859_100237966 | 3300005617 | Bacteria | 1909 |
| 92 | Ga0068859_100488477 | 3300005617 | Bacteria | 1327 |
| 93 | Ga0068864_100000004 | 3300005618 | Bacteria | 489341 |
| 94 | Ga0068866_10451198 | 3300005718 | Bacteria | 841 |
| 95 | Ga0068861_100000107 | 3300005719 | Bacteria | 41725 |
| 96 | Ga0068861_100261908 | 3300005719 | Bacteria | 1481 |
| 97 | Ga0068863_100000002 | 3300005841 | Bacteria | 489510 |
| 98 | Ga0068863_100058424 | 3300005841 | Bacteria | 3650 |
| 99 | Ga0068858_100024125 | 3300005842 | Bacteria | 5668 |
| 100 | Ga0068858_100298676 | 3300005842 | Bacteria | 1536 |
| 101 | Ga0068860_100047940 | 3300005843 | Bacteria | 4072 |
| 102 | Ga0068860_100050021 | 3300005843 | Bacteria | 3980 |
| 103 | Ga0068862_100000002 | 3300005844 | Bacteria | 489341 |
| 104 | Ga0068862_100000127 | 3300005844 | Bacteria | 88720 |
| 105 | Ga0068862_100012350 | 3300005844 | Bacteria | 7061 |
| 106 | Ga0081539_10016957 | 3300005985 | Bacteria | 5158 |
| 107 | Ga0081539_10030696 | 3300005985 | Bacteria | 3330 |
| 108 | Ga0075365_10035368 | 3300006038 | Bacteria | 3231 |
| 109 | Ga0075363_100372762 | 3300006048 | Bacteria | 836 |
| 110 | Ga0070715_10198194 | 3300006163 | Bacteria | 1018 |
| 111 | Ga0075366_10116659 | 3300006195 | Bacteria | 1608 |
| 112 | Ga0097621_100001517 | 3300006237 | Bacteria | 15906 |
| 113 | Ga0068871_100034759 | 3300006358 | Bacteria | 4002 |
| 114 | Ga0075428_101155132 | 3300006844 | Bacteria | 817 |
| 115 | Ga0097620_100007709 | 3300006931 | Bacteria | 10931 |
| 116 | Ga0097620_100043963 | 3300006931 | Bacteria | 4489 |
| 117 | Ga0097620_100237977 | 3300006931 | Bacteria | 1909 |
| 118 | Ga0097620_100488467 | 3300006931 | Bacteria | 1327 |
| 119 | Ga0099826_10180708 | 3300006948 | Bacteria | 1174 |
| 120 | Ga0105251_10002072 | 3300009011 | Bacteria | 16178 |
| 121 | Ga0105240_10285343 | 3300009093 | Bacteria | 1895 |
| 122 | Ga0105240_10334979 | 3300009093 | Bacteria | 1720 |
| 123 | Ga0105240_10516549 | 3300009093 | Bacteria | 1326 |
| 124 | Ga0111539_10030040 | 3300009094 | Bacteria | 6612 |
| 125 | Ga0105247_10017235 | 3300009101 | Bacteria | 4335 |
| 126 | Ga0114129_10097171 | 3300009147 | Bacteria | 4077 |
| 127 | Ga0114129_10855580 | 3300009147 | Bacteria | 1156 |
| 128 | Ga0105243_10092362 | 3300009148 | Bacteria | 2495 |
| 129 | Ga0105243_10405376 | 3300009148 | Bacteria | 1268 |
| 130 | Ga0105243_10837138 | 3300009148 | Bacteria | 910 |
| 131 | Ga0105241_10031069 | 3300009174 | Bacteria | 3996 |
| 132 | Ga0105241_10865551 | 3300009174 | Bacteria | 837 |
| 133 | Ga0105242_10091926 | 3300009176 | Bacteria | 2555 |
| 134 | Ga0105242_11342761 | 3300009176 | Bacteria | 740 |
| 135 | Ga0105248_10000016 | 3300009177 | Bacteria | 308151 |
| 136 | Ga0105248_10001313 | 3300009177 | Bacteria | 27695 |
| 137 | Ga0105248_10400887 | 3300009177 | Bacteria | 1545 |
| 138 | Ga0105238_10022206 | 3300009551 | Bacteria | 6470 |
| 139 | Ga0105238_10145820 | 3300009551 | Bacteria | 2344 |
| 140 | Ga0105249_10000149 | 3300009553 | Bacteria | 88337 |
| 141 | Ga0105249_10002669 | 3300009553 | Bacteria | 15422 |
| 142 | Ga0105239_10675382 | 3300010375 | Bacteria | 1180 |
| 143 | Ga0157373_10387539 | 3300013100 | Bacteria | 1000 |
| 144 | Ga0157370_10114710 | 3300013104 | Bacteria | 2517 |
| 145 | Ga0157374_10598723 | 3300013296 | Bacteria | 1112 |
| 146 | Ga0163162_10187148 | 3300013306 | Bacteria | 2197 |
| 147 | Ga0163162_10308126 | 3300013306 | Bacteria | 1716 |
| 148 | Ga0157372_10613374 | 3300013307 | Bacteria | 1268 |
| 149 | Ga0157375_10006743 | 3300013308 | Bacteria | 9999 |
| 150 | Ga0157380_10487206 | 3300014326 | Bacteria | 1194 |
| 151 | Ga0157380_10887684 | 3300014326 | Bacteria | 917 |
| 152 | Ga0157380_13000674 | 3300014326 | Bacteria | 538 |
| 153 | Ga0163161_10026502 | 3300017792 | Bacteria | 4105 |
| 154 | Ga0163161_10145799 | 3300017792 | Bacteria | 1796 |
| 155 | Ga0163161_10703080 | 3300017792 | Bacteria | 842 |
| 156 | Ga0163161_10758648 | 3300017792 | Bacteria | 812 |
| 157 | Ga0163161_11102181 | 3300017792 | Bacteria | 682 |
| 158 | Ga0206356_10680400 | 3300020070 | Bacteria | 1475 |
| 159 | Ga0206353_10860786 | 3300020082 | Bacteria | 1402 |
| 160 | Ga0209436_122295 | 3300025208 | Bacteria | 819 |
| 161 | Ga0209437_120019 | 3300025233 | Bacteria | 830 |
| 162 | Ga0207425_1015748 | 3300025245 | Bacteria | 1690 |
| 163 | Ga0209233_1000052 | 3300025261 | Bacteria | 445813 |
| 164 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 165 | Ga0209673_1001603 | 3300025273 | Bacteria | 19868 |
| 166 | Ga0209675_1000075 | 3300025291 | Bacteria | 161623 |
| 167 | Ga0209675_1040054 | 3300025291 | Bacteria | 1033 |
| 168 | Ga0209676_1000457 | 3300025292 | Bacteria | 68913 |
| 169 | Ga0209676_1000554 | 3300025292 | Bacteria | 56925 |
| 170 | Ga0209025_1018162 | 3300025294 | Bacteria | 4011 |
| 171 | Ga0209050_1000017 | 3300025298 | Bacteria | 728928 |
| 172 | Ga0209050_1000196 | 3300025298 | Bacteria | 135678 |
| 173 | Ga0209050_1008963 | 3300025298 | Bacteria | 5219 |
| 174 | Ga0209050_1023424 | 3300025298 | Bacteria | 2173 |
| 175 | Ga0209050_1055100 | 3300025298 | Bacteria | 977 |
| 176 | Ga0209256_1000009 | 3300025299 | Bacteria | 922071 |
| 177 | Ga0209256_1000010 | 3300025299 | Bacteria | 912110 |
| 178 | Ga0209257_1000206 | 3300025304 | Bacteria | 142184 |
| 179 | Ga0209257_1000228 | 3300025304 | Bacteria | 133390 |
| 180 | Ga0209257_1000456 | 3300025304 | Bacteria | 75804 |
| 181 | Ga0209257_1003373 | 3300025304 | Bacteria | 13795 |
| 182 | Ga0209257_1003588 | 3300025304 | Bacteria | 13113 |
| 183 | Ga0209257_1009860 | 3300025304 | Bacteria | 4989 |
| 184 | Ga0207656_10225270 | 3300025321 | Bacteria | 912 |
| 185 | Ga0207713_1005825 | 3300025735 | Bacteria | 7626 |
| 186 | Ga0207710_10009393 | 3300025900 | Bacteria | 4116 |
| 187 | Ga0207710_10014488 | 3300025900 | Bacteria | 3326 |
| 188 | Ga0207705_10111353 | 3300025909 | Bacteria | 2023 |
| 189 | Ga0207705_10132887 | 3300025909 | Bacteria | 1853 |
| 190 | Ga0207705_10954933 | 3300025909 | Bacteria | 663 |
| 191 | Ga0207684_10308750 | 3300025910 | Bacteria | 1364 |
| 192 | Ga0207707_10038563 | 3300025912 | Bacteria | 4174 |
| 193 | Ga0207707_10196038 | 3300025912 | Bacteria | 1762 |
| 194 | Ga0207707_11076108 | 3300025912 | Bacteria | 656 |
| 195 | Ga0207695_10521279 | 3300025913 | Bacteria | 1070 |
| 196 | Ga0207660_10000218 | 3300025917 | Bacteria | 36989 |
| 197 | Ga0207657_10016201 | 3300025919 | Bacteria | 7195 |
| 198 | Ga0207657_10030743 | 3300025919 | Bacteria | 4870 |
| 199 | Ga0207657_10906562 | 3300025919 | Bacteria | 679 |
| 200 | Ga0207649_10058668 | 3300025920 | Bacteria | 2411 |
| 201 | Ga0207649_10344177 | 3300025920 | Bacteria | 1102 |
| 202 | Ga0207652_10000001 | 3300025921 | Bacteria | 1006643 |
| 203 | Ga0207652_10936671 | 3300025921 | Bacteria | 764 |
| 204 | Ga0207694_10079449 | 3300025924 | Bacteria | 2572 |
| 205 | Ga0207694_10647951 | 3300025924 | Bacteria | 890 |
| 206 | Ga0207650_10000643 | 3300025925 | Bacteria | 27774 |
| 207 | Ga0207650_10584424 | 3300025925 | Bacteria | 938 |
| 208 | Ga0207659_11009103 | 3300025926 | Bacteria | 716 |
| 209 | Ga0207664_10041175 | 3300025929 | Bacteria | 3598 |
| 210 | Ga0207664_10372572 | 3300025929 | Bacteria | 1266 |
| 211 | Ga0207644_10247829 | 3300025931 | Bacteria | 1420 |
| 212 | Ga0207644_10622150 | 3300025931 | Bacteria | 897 |
| 213 | Ga0207690_10090242 | 3300025932 | Bacteria | 2163 |
| 214 | Ga0207706_10048755 | 3300025933 | Bacteria | 3745 |
| 215 | Ga0207686_10729720 | 3300025934 | Bacteria | 790 |
| 216 | Ga0207709_11193086 | 3300025935 | Bacteria | 627 |
| 217 | Ga0207669_11240076 | 3300025937 | Bacteria | 632 |
| 218 | Ga0207711_10000022 | 3300025941 | Bacteria | 340441 |
| 219 | Ga0207711_10000956 | 3300025941 | Bacteria | 27669 |
| 220 | Ga0207711_10006787 | 3300025941 | Bacteria | 9616 |
| 221 | Ga0207661_10001385 | 3300025944 | Bacteria | 16276 |
| 222 | Ga0207679_10112459 | 3300025945 | Bacteria | 2152 |
| 223 | Ga0207667_10000035 | 3300025949 | Bacteria | 301056 |
| 224 | Ga0207667_10002213 | 3300025949 | Bacteria | 24415 |
| 225 | Ga0207667_10293890 | 3300025949 | Bacteria | 1660 |
| 226 | Ga0207667_10401981 | 3300025949 | Bacteria | 1395 |
| 227 | Ga0207712_10000111 | 3300025961 | Bacteria | 89223 |
| 228 | Ga0207712_10005353 | 3300025961 | Bacteria | 8103 |
| 229 | Ga0207712_11321897 | 3300025961 | Bacteria | 644 |
| 230 | Ga0207668_10001243 | 3300025972 | Bacteria | 15180 |
| 231 | Ga0207668_10012621 | 3300025972 | Bacteria | 5178 |
| 232 | Ga0207668_10295261 | 3300025972 | Bacteria | 1335 |
| 233 | Ga0207668_10626718 | 3300025972 | Bacteria | 939 |
| 234 | Ga0207640_10000085 | 3300025981 | Bacteria | 73838 |
| 235 | Ga0207640_10111622 | 3300025981 | Bacteria | 1939 |
| 236 | Ga0207640_10322787 | 3300025981 | Bacteria | 1230 |
| 237 | Ga0207640_11182351 | 3300025981 | Bacteria | 679 |
| 238 | Ga0207658_10000589 | 3300025986 | Bacteria | 32594 |
| 239 | Ga0207703_10000510 | 3300026035 | Bacteria | 40276 |
| 240 | Ga0207703_10072971 | 3300026035 | Bacteria | 2838 |
| 241 | Ga0207703_10592700 | 3300026035 | Bacteria | 1048 |
| 242 | Ga0207703_11263858 | 3300026035 | Bacteria | 710 |
| 243 | Ga0207639_10012952 | 3300026041 | Bacteria | 5819 |
| 244 | Ga0207639_10048127 | 3300026041 | Bacteria | 3225 |
| 245 | Ga0207678_10005202 | 3300026067 | Bacteria | 11660 |
| 246 | Ga0207678_10099206 | 3300026067 | Bacteria | 2488 |
| 247 | Ga0207702_10031113 | 3300026078 | Bacteria | 4448 |
| 248 | Ga0207702_10574549 | 3300026078 | Bacteria | 1104 |
| 249 | Ga0207641_10000002 | 3300026088 | Bacteria | 981004 |
| 250 | Ga0207641_10055125 | 3300026088 | Bacteria | 3375 |
| 251 | Ga0207648_10271929 | 3300026089 | Bacteria | 1514 |
| 252 | Ga0207676_10000040 | 3300026095 | Bacteria | 167947 |
| 253 | Ga0207674_10011562 | 3300026116 | Bacteria | 9913 |
| 254 | Ga0207674_10015944 | 3300026116 | Bacteria | 8232 |
| 255 | Ga0207674_10037608 | 3300026116 | Bacteria | 5031 |
| 256 | Ga0207674_10206109 | 3300026116 | Bacteria | 1915 |
| 257 | Ga0207675_100000317 | 3300026118 | Bacteria | 45991 |
| 258 | Ga0207675_100303528 | 3300026118 | Bacteria | 1555 |
| 259 | Ga0207698_10279055 | 3300026142 | Bacteria | 1544 |
| 260 | Ga0207698_10279145 | 3300026142 | Bacteria | 1544 |
| 261 | Ga0209282_1166632 | 3300027666 | Bacteria | 1047 |
| 262 | Ga0209974_10143705 | 3300027876 | Bacteria | 857 |
| 263 | Ga0268266_10000015 | 3300028379 | Bacteria | 630629 |
| 264 | Ga0268266_10000055 | 3300028379 | Bacteria | 291630 |
| 265 | Ga0268265_10000003 | 3300028380 | Bacteria | 949201 |
| 266 | Ga0268265_10000385 | 3300028380 | Bacteria | 47093 |
| 267 | Ga0268265_10115292 | 3300028380 | Bacteria | 2202 |
| 268 | Ga0268264_10009236 | 3300028381 | Bacteria | 8165 |
| 269 | Ga0268264_10080903 | 3300028381 | Bacteria | 2775 |
| 270 | Ga0307512_10209745 | 3300030522 | Bacteria | 1038 |
| 271 | Ga0316182_1432900 | 3300030745 | Bacteria | 702 |
| 272 | Ga0265331_10000005 | 3300031250 | Bacteria | 465192 |
| 273 | Ga0307513_10095479 | 3300031456 | Bacteria | 3014 |
| 274 | Ga0307513_10154019 | 3300031456 | Bacteria | 2201 |
| 275 | Ga0307408_100019783 | 3300031548 | Bacteria | 4535 |
| 276 | Ga0307408_100085229 | 3300031548 | Bacteria | 2372 |
| 277 | Ga0307408_100096460 | 3300031548 | Bacteria | 2244 |
| 278 | Ga0307408_100422366 | 3300031548 | Bacteria | 1150 |
| 279 | Ga0307408_100671021 | 3300031548 | Bacteria | 929 |
| 280 | Ga0307408_100886971 | 3300031548 | Bacteria | 815 |
| 281 | Ga0307508_10004215 | 3300031616 | Bacteria | 14135 |
| 282 | Ga0307405_10177100 | 3300031731 | Bacteria | 1527 |
| 283 | Ga0307405_10802798 | 3300031731 | Bacteria | 788 |
| 284 | Ga0307413_10291379 | 3300031824 | Bacteria | 1233 |
| 285 | Ga0307413_10298467 | 3300031824 | Bacteria | 1220 |
| 286 | Ga0307410_10071133 | 3300031852 | Bacteria | 2412 |
| 287 | Ga0307410_10082360 | 3300031852 | Bacteria | 2264 |
| 288 | Ga0307410_10369168 | 3300031852 | Bacteria | 1152 |
| 289 | Ga0307406_10042953 | 3300031901 | Bacteria | 2825 |
| 290 | Ga0307406_10044506 | 3300031901 | Bacteria | 2782 |
| 291 | Ga0307406_10060279 | 3300031901 | Bacteria | 2446 |
| 292 | Ga0307406_10115111 | 3300031901 | Bacteria | 1858 |
| 293 | Ga0307406_10138152 | 3300031901 | Bacteria | 1721 |
| 294 | Ga0307406_10785034 | 3300031901 | Bacteria | 802 |
| 295 | Ga0307407_10274665 | 3300031903 | Bacteria | 1165 |
| 296 | Ga0307407_10408881 | 3300031903 | Bacteria | 975 |
| 297 | Ga0307412_10005529 | 3300031911 | Bacteria | 7097 |
| 298 | Ga0307412_10007833 | 3300031911 | Bacteria | 6081 |
| 299 | Ga0307412_10009359 | 3300031911 | Bacteria | 5619 |
| 300 | Ga0307412_10251859 | 3300031911 | Bacteria | 1371 |
| 301 | Ga0307412_10329095 | 3300031911 | Bacteria | 1219 |
| 302 | Ga0307412_10410544 | 3300031911 | Bacteria | 1105 |
| 303 | Ga0307412_10543575 | 3300031911 | Bacteria | 974 |
| 304 | Ga0307412_10764066 | 3300031911 | Bacteria | 835 |
| 305 | Ga0307409_100681128 | 3300031995 | Bacteria | 1025 |
| 306 | Ga0307409_100844442 | 3300031995 | Bacteria | 926 |
| 307 | Ga0307416_100014892 | 3300032002 | Bacteria | 5349 |
| 308 | Ga0307416_100024239 | 3300032002 | Bacteria | 4423 |
| 309 | Ga0307416_100039249 | 3300032002 | Bacteria | 3663 |
| 310 | Ga0307416_100310481 | 3300032002 | Bacteria | 1573 |
| 311 | Ga0307414_10000070 | 3300032004 | Bacteria | 96231 |
| 312 | Ga0307414_10000908 | 3300032004 | Bacteria | 15185 |
| 313 | Ga0307414_10021947 | 3300032004 | Bacteria | 4018 |
| 314 | Ga0307414_10034425 | 3300032004 | Bacteria | 3358 |
| 315 | Ga0307414_10067246 | 3300032004 | Bacteria | 2566 |
| 316 | Ga0307414_10637974 | 3300032004 | Bacteria | 959 |
| 317 | Ga0307414_10895295 | 3300032004 | Bacteria | 813 |
| 318 | Ga0307414_11249117 | 3300032004 | Bacteria | 688 |
| 319 | Ga0307411_10048286 | 3300032005 | Bacteria | 2758 |
| 320 | Ga0307411_10140883 | 3300032005 | Bacteria | 1778 |
| 321 | Ga0307411_10561176 | 3300032005 | Bacteria | 976 |
| 322 | Ga0307411_10582318 | 3300032005 | Bacteria | 959 |
| 323 | Ga0307411_10849728 | 3300032005 | Bacteria | 807 |
| 324 | Ga0307411_11971721 | 3300032005 | Bacteria | 544 |
| 325 | Ga0307415_100082053 | 3300032126 | Bacteria | 2305 |
| 326 | Ga0307415_100117025 | 3300032126 | Bacteria | 1990 |
| 327 | Ga0307415_100157314 | 3300032126 | Bacteria | 1756 |
| 328 | Ga0307415_100199808 | 3300032126 | Bacteria | 1585 |
| 329 | Ga0307415_100507489 | 3300032126 | Bacteria | 1056 |
| 330 | Ga0307510_10021872 | 3300033180 | Bacteria | 7440 |
| 331 | Ga0373926_0011226 | 3300035083 | Bacteria | 3012 |
| 332 | Ga0373926_0083920 | 3300035083 | Bacteria | 1180 |
| 333 | Ga0373923_0032798 | 3300035111 | Bacteria | 2100 |
| 334 | Ga0373936_0005536 | 3300035113 | Bacteria | 4769 |
| 335 | Ga0373945_0001813 | 3300035116 | Bacteria | 6601 |
| 336 | Ga0373953_0178203 | 3300035117 | Bacteria | 916 |
| 337 | Ga0373954_0140379 | 3300035118 | Bacteria | 1178 |
| 338 | Ga0373956_0081265 | 3300035119 | Bacteria | 1487 |
| 339 | Ga0373957_0116690 | 3300035120 | Bacteria | 1078 |
| 340 | Ga0373943_0000987 | 3300035170 | Bacteria | 12632 |
| 341 | Ga0373943_0004063 | 3300035170 | Bacteria | 6645 |
| 342 | Ga0373946_0000390 | 3300035171 | Bacteria | 14299 |
| 343 | Ga0373955_0002343 | 3300035172 | Bacteria | 8255 |
| 344 | Ga0373955_0707851 | 3300035172 | Bacteria | 618 |
| 345 | Ga0373924_0272831 | 3300035410 | Bacteria | 750 |
| 346 | Ga0373935_0021138 | 3300035692 | Bacteria | 3983 |
| 347 | Ga0373935_0210574 | 3300035692 | Bacteria | 1347 |
| 348 | Ga0373927_0001694 | 3300035695 | Bacteria | 16465 |
| 349 | Ga0373947_0001559 | 3300035725 | Bacteria | 14033 |
| 350 | Ga0373947_0041452 | 3300035725 | Bacteria | 2745 |
| 351 | Ga0373947_0396628 | 3300035725 | Bacteria | 930 |
| 352 | Ga0373937_0013140 | 3300036401 | Bacteria | 7291 |
| 353 | Ga0316582_0000396 | 3300036647 | Bacteria | 15815 |
| 354 | Ga0316584_0020794 | 3300036712 | Bacteria | 4765 |
| 355 | Ga0316584_0312609 | 3300036712 | Bacteria | 1135 |
| 356 | Ga0373925_0002714 | 3300037068 | Bacteria | 14017 |
| 357 | Ga0373925_0033233 | 3300037068 | Bacteria | 3802 |
| 358 | Ga0395899_0001872 | 3300037312 | Bacteria | 17372 |
| 359 | Ga0395899_0014790 | 3300037312 | Bacteria | 5957 |
| 360 | Ga0395899_0154353 | 3300037312 | Bacteria | 1625 |
| 361 | Ga0395899_0335232 | 3300037312 | Bacteria | 1015 |
| 362 | Ga0395899_0451793 | 3300037312 | Bacteria | 841 |
| 363 | Ga0395900_0000084 | 3300037418 | Bacteria | 172593 |
| 364 | Ga0395900_0009014 | 3300037418 | Bacteria | 10230 |
| 365 | Ga0395900_0131251 | 3300037418 | Bacteria | 2567 |
| 366 | Ga0395900_0148125 | 3300037418 | Bacteria | 2400 |
| 367 | Ga0395900_0367779 | 3300037418 | Bacteria | 1408 |
| 368 | Ga0395900_0424270 | 3300037418 | Bacteria | 1290 |
| 369 | Ga0395898_0000021 | 3300037466 | Bacteria | 393971 |
| 370 | Ga0395898_0003569 | 3300037466 | Bacteria | 17341 |
| 371 | Ga0395898_0134484 | 3300037466 | Bacteria | 2367 |
| 372 | Ga0395898_0152050 | 3300037466 | Bacteria | 2214 |
| 373 | Ga0395898_0155205 | 3300037466 | Bacteria | 2189 |
| 374 | Ga0395905_0000006 | 3300037471 | Bacteria | 549428 |
| 375 | Ga0395905_0006269 | 3300037471 | Bacteria | 12004 |
| 376 | Ga0395905_0008304 | 3300037471 | Bacteria | 10244 |
| 377 | Ga0395905_0019553 | 3300037471 | Bacteria | 6419 |
| 378 | Ga0395905_0087484 | 3300037471 | Bacteria | 2921 |
| 379 | Ga0395905_0298168 | 3300037471 | Bacteria | 1499 |
| 380 | Ga0395905_0305467 | 3300037471 | Bacteria | 1479 |
| 381 | Ga0395905_0403724 | 3300037471 | Bacteria | 1261 |
| 382 | Ga0436364_0416603 | 3300037853 | Bacteria | 1338 |
| 383 | Ga0436364_1141745 | 3300037853 | Bacteria | 920 |
| 384 | Ga0395901_0001581 | 3300038443 | Bacteria | 23545 |
| 385 | Ga0395901_0004950 | 3300038443 | Bacteria | 13443 |
| 386 | Ga0395901_0032271 | 3300038443 | Bacteria | 5403 |
| 387 | Ga0395901_0145215 | 3300038443 | Bacteria | 2494 |
| 388 | Ga0395901_0409938 | 3300038443 | Bacteria | 1391 |
| 389 | Ga0237819_02700 | 3300038705 | Bacteria | 3428 |
| 390 | Ga0436365_0930005 | 3300039437 | Bacteria | 1139 |
| 391 | Ga0436363_1425761 | 3300039450 | Bacteria | 2668 |
| 392 | Ga0436362_0746519 | 3300039453 | Bacteria | 644 |
| 393 | Ga0436362_1101242 | 3300039453 | Bacteria | 676 |
| 394 | Ga0439436_0062191 | 3300041404 | Bacteria | 1044 |
| 395 | Ga0439438_062014 | 3300041405 | Bacteria | 935 |
| 396 | Ga0439439_0017369 | 3300041406 | Bacteria | 1769 |
| 397 | Ga0439447_096548 | 3300041407 | Bacteria | 679 |
| 398 | Ga0439461_0000237 | 3300041410 | Bacteria | 7796 |
| 399 | Ga0439465_0001413 | 3300041413 | Bacteria | 7765 |
| 400 | Ga0439465_0003226 | 3300041413 | Bacteria | 5320 |
| 401 | Ga0451793_1016855 | 3300041452 | Bacteria | 947 |
| 402 | Ga0451793_1315180 | 3300041452 | Bacteria | 1095 |
| 403 | Ga0451805_038860 | 3300041461 | Bacteria | 550 |
| 404 | Ga0451805_107206 | 3300041461 | Bacteria | 581 |
| 405 | Ga0439431_0000173 | 3300041997 | Bacteria | 12361 |
| 406 | Ga0439431_0004664 | 3300041997 | Bacteria | 3013 |
| 407 | Ga0439442_004433 | 3300042002 | Bacteria | 2789 |
| 408 | Ga0439445_0000812 | 3300042004 | Bacteria | 6582 |
| 409 | Ga0439445_0003186 | 3300042004 | Bacteria | 3678 |
| 410 | Ga0439445_0032828 | 3300042004 | Bacteria | 1354 |
| 411 | Ga0439445_0164879 | 3300042004 | Bacteria | 648 |
| 412 | Ga0439432_019352 | 3300042006 | Bacteria | 2268 |
| 413 | Ga0439432_032722 | 3300042006 | Bacteria | 1675 |
| 414 | Ga0439457_053736 | 3300042014 | Bacteria | 906 |
| 415 | Ga0439462_0000167 | 3300042015 | Bacteria | 10984 |
| 416 | Ga0450905_009047 | 3300042142 | Bacteria | 1367 |
| 417 | Ga0450889_000888 | 3300042144 | Bacteria | 3212 |
| 418 | Ga0439446_0050764 | 3300042156 | Bacteria | 1238 |
| 419 | Ga0439434_0002832 | 3300042435 | Bacteria | 5059 |
| 420 | Ga0439464_0191058 | 3300042439 | Bacteria | 651 |
| 421 | Ga0439440_0179958 | 3300042993 | Bacteria | 619 |
| 422 | Ga0466969_0027621 | 3300044656 | Bacteria | 2905 |
| 423 | Ga0466969_0323831 | 3300044656 | Bacteria | 697 |
| 424 | Ga0466966_0029739 | 3300044684 | Bacteria | 3552 |
| 425 | Ga0466966_0105672 | 3300044684 | Bacteria | 1738 |
| 426 | Ga0466961_0005961 | 3300044693 | Bacteria | 7721 |
| 427 | Ga0466961_0211685 | 3300044693 | Bacteria | 1196 |
| 428 | Ga0466963_0025116 | 3300044694 | Bacteria | 3797 |
| 429 | Ga0466971_0158746 | 3300044719 | Bacteria | 1058 |
| 430 | Ga0466971_0450653 | 3300044719 | Bacteria | 631 |
| 431 | Ga0466968_0505422 | 3300044735 | Bacteria | 603 |
| 432 | Ga0466970_0091618 | 3300044765 | Bacteria | 1650 |
| 433 | Ga0466970_0253774 | 3300044765 | Bacteria | 986 |
| 434 | Ga0466970_0293614 | 3300044765 | Bacteria | 916 |
| 435 | Ga0466957_0278994 | 3300044842 | Bacteria | 1118 |
| 436 | Ga0466959_0218568 | 3300045049 | Bacteria | 1322 |
| 437 | Ga0466959_0299536 | 3300045049 | Bacteria | 1101 |
| 438 | Ga0466959_0400199 | 3300045049 | Bacteria | 933 |
| 439 | Ga0466958_0039452 | 3300045836 | Bacteria | 2838 |
| 440 | Ga0466958_0078077 | 3300045836 | Bacteria | 2034 |
| 441 | Ga0466958_0188814 | 3300045836 | Bacteria | 1309 |
| 442 | Ga0466958_0534752 | 3300045836 | Bacteria | 761 |
| 443 | Ga0466967_0023474 | 3300045976 | Bacteria | 5055 |
| 444 | Ga0466967_0509192 | 3300045976 | Bacteria | 1182 |
| 445 | Ga0495603_0237457 | 3300046455 | Bacteria | 1050 |
| 446 | Ga0495638_0000714 | 3300046460 | Bacteria | 35808 |
| 447 | Ga0495641_0108705 | 3300046461 | Bacteria | 1237 |
| 448 | Ga0495653_0075647 | 3300046463 | Bacteria | 2505 |
| 449 | Ga0495580_0219911 | 3300046472 | Bacteria | 1305 |
| 450 | Ga0495639_0120193 | 3300046475 | Bacteria | 1253 |
| 451 | Ga0495662_0001418 | 3300046476 | Bacteria | 11879 |
| 452 | Ga0495664_0021295 | 3300046477 | Bacteria | 3745 |
| 453 | Ga0495585_0027193 | 3300046492 | Bacteria | 3265 |
| 454 | Ga0495594_0386130 | 3300046499 | Bacteria | 797 |
| 455 | Ga0495618_0040344 | 3300046514 | Bacteria | 2937 |
| 456 | Ga0495630_0024514 | 3300046517 | Bacteria | 4459 |
| 457 | Ga0495643_0051033 | 3300046522 | Bacteria | 2226 |
| 458 | Ga0495644_0138609 | 3300046523 | Bacteria | 929 |
| 459 | Ga0495666_0024475 | 3300046526 | Bacteria | 2982 |
| 460 | Ga0495665_0031480 | 3300046531 | Bacteria | 2839 |
| 461 | Ga0495665_0174910 | 3300046531 | Bacteria | 1117 |
| 462 | Ga0495640_0003310 | 3300046533 | Bacteria | 12966 |
| 463 | Ga0495586_0052287 | 3300046535 | Bacteria | 2212 |
| 464 | Ga0495645_0011928 | 3300046543 | Bacteria | 6123 |
| 465 | Ga0495668_0000076 | 3300046616 | Bacteria | 161826 |
| 466 | Ga0495668_0115150 | 3300046616 | Bacteria | 1470 |
| 467 | Ga0495668_0542498 | 3300046616 | Bacteria | 642 |
| 468 | Ga0495634_0003281 | 3300046642 | Bacteria | 13051 |
| 469 | Ga0495625_0000936 | 3300046660 | Bacteria | 39185 |
| 470 | Ga0495625_0001409 | 3300046660 | Bacteria | 29392 |
| 471 | Ga0495625_0042798 | 3300046660 | Bacteria | 3288 |
| 472 | Ga0495635_0001339 | 3300046663 | Bacteria | 16395 |
| 473 | Ga0495635_0126315 | 3300046663 | Bacteria | 1744 |
| 474 | Ga0495657_0527350 | 3300046675 | Bacteria | 687 |
| 475 | Ga0495623_0257708 | 3300046679 | Bacteria | 978 |
| 476 | Ga0495647_0010613 | 3300046681 | Bacteria | 3140 |
| 477 | Ga0495647_0508259 | 3300046681 | Bacteria | 561 |
| 478 | Ga0495658_0123238 | 3300046683 | Bacteria | 1570 |
| 479 | Ga0495658_0513112 | 3300046683 | Bacteria | 767 |
| 480 | Ga0495613_0492747 | 3300046689 | Bacteria | 826 |
| 481 | Ga0495624_0002621 | 3300046690 | Bacteria | 13583 |
| 482 | Ga0495670_0000003 | 3300046691 | Bacteria | 326779 |
| 483 | Ga0495600_0276110 | 3300046809 | Bacteria | 1065 |
| 484 | Ga0495581_0020558 | 3300047315 | Bacteria | 3830 |
| 485 | Ga0495581_0359400 | 3300047315 | Bacteria | 850 |
| 486 | Ga0495604_0792826 | 3300047317 | Bacteria | 597 |
| 487 | Ga0495674_0006927 | 3300047319 | Bacteria | 10844 |
| 488 | Ga0495684_0004391 | 3300047471 | Bacteria | 11017 |
| 489 | Ga0495684_0005099 | 3300047471 | Bacteria | 10244 |
| 490 | Ga0495686_0000082 | 3300047472 | Bacteria | 200115 |
| 491 | Ga0495686_0045625 | 3300047472 | Bacteria | 2772 |
| 492 | Ga0495602_0492528 | 3300048088 | Bacteria | 858 |
| 493 | Ga0495614_0292170 | 3300048089 | Bacteria | 752 |
| 494 | Ga0496103_0064131 | 3300048906 | Bacteria | 2290 |
| 495 | Ga0496109_0157652 | 3300048912 | Bacteria | 2126 |
| 496 | Ga0496109_0310766 | 3300048912 | Bacteria | 1487 |
| 497 | Ga0496111_0086926 | 3300048914 | Bacteria | 2288 |
| 498 | Ga0496112_0003706 | 3300048915 | Bacteria | 12752 |
| 499 | Ga0496112_0035620 | 3300048915 | Bacteria | 4850 |
| 500 | Ga0496113_0002272 | 3300048916 | Bacteria | 11086 |
| 501 | Ga0496115_0292471 | 3300048918 | Bacteria | 1336 |
| 502 | Ga0496117_0003086 | 3300048920 | Bacteria | 19943 |
| 503 | Ga0496118_0072196 | 3300048921 | Bacteria | 2480 |
| 504 | Ga0496119_0049487 | 3300048922 | Bacteria | 2598 |
| 505 | Ga0496122_0001177 | 3300048925 | Bacteria | 44728 |
| 506 | Ga0496123_0000754 | 3300048926 | Bacteria | 52403 |
| 507 | Ga0496124_0049520 | 3300048927 | Bacteria | 3584 |
| 508 | Ga0501310_052323 | 3300049130 | Bacteria | 593 |
| 509 | Ga0501304_031661 | 3300049160 | Bacteria | 565 |
| 510 | Ga0501290_000076 | 3300049513 | Bacteria | 13968 |
| 511 | Ga0501292_000037 | 3300049515 | Bacteria | 31889 |
| 512 | Ga0501294_000020 | 3300049517 | Bacteria | 16601 |
| 513 | Ga0501313_051858 | 3300049529 | Bacteria | 568 |
| 514 | Ga0501313_058902 | 3300049529 | Bacteria | 542 |
| 515 | Ga0501314_002904 | 3300049530 | Bacteria | 1354 |
| 516 | Ga0501315_004097 | 3300049531 | Bacteria | 1502 |
| 517 | Ga0501317_013270 | 3300049533 | Bacteria | 1028 |
| 518 | Ga0501320_036411 | 3300049536 | Bacteria | 631 |
| 519 | Ga0501320_049645 | 3300049536 | Bacteria | 569 |
| 520 | Ga0501323_022668 | 3300049539 | Bacteria | 838 |
| 521 | Ga0501335_036996 | 3300049551 | Bacteria | 567 |
| 522 | Ga0501338_06694 | 3300049554 | Bacteria | 732 |
| 523 | Ga0501031_0100697 | 3300049568 | Bacteria | 1885 |
| 524 | Ga0501031_0116554 | 3300049568 | Bacteria | 1745 |
| 525 | Ga0501032_0007617 | 3300049569 | Bacteria | 7897 |
| 526 | Ga0501032_0162364 | 3300049569 | Bacteria | 1467 |
| 527 | Ga0501033_0011285 | 3300049570 | Bacteria | 6840 |
| 528 | Ga0501034_0124569 | 3300049571 | Bacteria | 2562 |
| 529 | Ga0501034_0169927 | 3300049571 | Bacteria | 2148 |
| 530 | Ga0501036_0050051 | 3300049572 | Bacteria | 3539 |
| 531 | Ga0501036_0052934 | 3300049572 | Bacteria | 3437 |
| 532 | Ga0501037_0022098 | 3300049573 | Bacteria | 4707 |
| 533 | Ga0501038_0221942 | 3300049574 | Bacteria | 1507 |
| 534 | Ga0501039_0108807 | 3300049575 | Bacteria | 2166 |
| 535 | Ga0501040_0133047 | 3300049576 | Bacteria | 1749 |
| 536 | Ga0501040_0407080 | 3300049576 | Bacteria | 977 |
| 537 | Ga0501041_0114653 | 3300049577 | Bacteria | 1673 |
| 538 | Ga0501042_0230522 | 3300049578 | Bacteria | 1336 |
| 539 | Ga0501043_0087084 | 3300049579 | Bacteria | 2454 |
| 540 | Ga0501046_0204306 | 3300049580 | Bacteria | 1469 |
| 541 | Ga0501047_0180019 | 3300049581 | Bacteria | 1980 |
| 542 | Ga0501047_0340756 | 3300049581 | Bacteria | 1337 |
| 543 | Ga0501047_0392506 | 3300049581 | Bacteria | 1221 |
| 544 | Ga0501047_0403264 | 3300049581 | Bacteria | 1200 |
| 545 | Ga0501047_0693140 | 3300049581 | Bacteria | 836 |
| 546 | Ga0501048_0211609 | 3300049582 | Bacteria | 1375 |
| 547 | Ga0501048_0331950 | 3300049582 | Bacteria | 1084 |
| 548 | Ga0501071_0178766 | 3300049587 | Bacteria | 1589 |
| 549 | Ga0501072_0064198 | 3300049588 | Bacteria | 2896 |
| 550 | Ga0501072_1181105 | 3300049588 | Bacteria | 595 |
| 551 | Ga0501074_0039773 | 3300049590 | Bacteria | 3406 |
| 552 | Ga0501074_0956433 | 3300049590 | Bacteria | 602 |
| 553 | Ga0501076_0139095 | 3300049592 | Bacteria | 1972 |
| 554 | Ga0501076_1065584 | 3300049592 | Bacteria | 666 |
| 555 | Ga0501077_0033357 | 3300049593 | Bacteria | 3277 |
| 556 | Ga0501077_0344413 | 3300049593 | Bacteria | 951 |
| 557 | Ga0501223_000755 | 3300049663 | Bacteria | 7691 |
| 558 | Ga0501224_000016 | 3300049664 | Bacteria | 86205 |
| 559 | Ga0501233_009888 | 3300049668 | Bacteria | 1869 |
| 560 | Ga0501249_041261 | 3300049679 | Bacteria | 1047 |
| 561 | Ga0501257_000240 | 3300049686 | Bacteria | 10802 |
| 562 | Ga0501221_030695 | 3300049704 | Bacteria | 1119 |
| 563 | Ga0501225_0000016 | 3300049705 | Bacteria | 64948 |
| 564 | Ga0501225_0006759 | 3300049705 | Bacteria | 3343 |
| 565 | Ga0501079_0564404 | 3300049741 | Bacteria | 895 |
| 566 | Ga0501080_0104794 | 3300049742 | Bacteria | 2623 |
| 567 | Ga0501080_0699047 | 3300049742 | Bacteria | 894 |
| 568 | Ga0501081_0752259 | 3300049743 | Bacteria | 732 |
| 569 | Ga0501267_007509 | 3300049764 | Bacteria | 1062 |
| 570 | Ga0501279_000008 | 3300049775 | Bacteria | 125267 |
| 571 | Ga0501280_000013 | 3300049776 | Bacteria | 59205 |
| 572 | Ga0501280_001260 | 3300049776 | Bacteria | 4892 |
| 573 | Ga0501281_00107 | 3300049777 | Bacteria | 10078 |
| 574 | Ga0501282_000282 | 3300049778 | Bacteria | 6150 |
| 575 | Ga0501035_0005503 | 3300049822 | Bacteria | 11965 |
| 576 | Ga0501035_0420154 | 3300049822 | Bacteria | 1110 |
| 577 | Ga0501035_0692300 | 3300049822 | Bacteria | 823 |
| 578 | Ga0501035_0888428 | 3300049822 | Bacteria | 706 |
| 579 | Ga0501044_0006511 | 3300049823 | Bacteria | 12903 |
| 580 | Ga0501044_0059423 | 3300049823 | Bacteria | 3917 |
| 581 | Ga0501044_0160044 | 3300049823 | Bacteria | 2229 |
| 582 | Ga0501045_0565073 | 3300049824 | Bacteria | 843 |
| 583 | Ga0501045_1135641 | 3300049824 | Bacteria | 571 |
| 584 | Ga0501226_000020 | 3300049853 | Bacteria | 141193 |
| 585 | nmdc:mga03n38_431336_c1 | 3300050490 | Bacteria | 730 |
| 586 | nmdc:mga00v17_682111_c1 | 3300050491 | Bacteria | 659 |
| 587 | nmdc:mga0yw44_675737_c1 | 3300050492 | Bacteria | 702 |
| 588 | nmdc:mga05p37_614359_c1 | 3300050507 | Bacteria | 1224 |
| 589 | nmdc:mga05p37_78565_c1 | 3300050507 | Bacteria | 4063 |
| 590 | nmdc:mga09592_222938_c1 | 3300050508 | Bacteria | 1633 |
| 591 | nmdc:mga06r32_1267375_c1 | 3300050510 | Bacteria | 682 |
| 592 | nmdc:mga08y16_50996_c1 | 3300050511 | Bacteria | 4329 |
| 593 | nmdc:mga0n895_420277_c1 | 3300050512 | Bacteria | 1351 |
| 594 | Ga0495612_0000187 | 3300053078 | Bacteria | 26308 |
| 595 | Ga0500643_000005 | 3300053087 | Bacteria | 539775 |
| 596 | Ga0500643_000139 | 3300053087 | Bacteria | 73348 |
| 597 | Ga0500643_002899 | 3300053087 | Bacteria | 8527 |
| 598 | Ga0500643_006988 | 3300053087 | Bacteria | 4630 |
| 599 | Ga0500643_045751 | 3300053087 | Bacteria | 1266 |
| 600 | Ga0500646_0126254 | 3300053090 | Bacteria | 827 |
| 601 | Ga0500566_0015418 | 3300053094 | Bacteria | 4484 |
| 602 | Ga0500594_0148399 | 3300053118 | Bacteria | 752 |
| 603 | Ga0500608_017499 | 3300053122 | Bacteria | 3256 |
| 604 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 605 | Ga0500559_0028545 | 3300053136 | Bacteria | 2384 |
| 606 | Ga0500568_0000942 | 3300053139 | Bacteria | 20047 |
| 607 | Ga0500568_0001466 | 3300053139 | Bacteria | 15125 |
| 608 | Ga0500604_0000043 | 3300053151 | Bacteria | 48703 |
| 609 | Ga0500616_0000293 | 3300053153 | Bacteria | 72597 |
| 610 | Ga0500616_0017603 | 3300053153 | Bacteria | 4053 |
| 611 | Ga0500624_000205 | 3300053157 | Bacteria | 22830 |
| 612 | Ga0590075_135422 | 3300059424 | Bacteria | 647 |
| 613 | Ga0590077_100922 | 3300059426 | Bacteria | 675 |
| 614 | Ga0587077_188167 | 3300059493 | Bacteria | 564 |
| 615 | Ga0587082_136199 | 3300059504 | Bacteria | 569 |
| 616 | Ga0587082_140545 | 3300059504 | Bacteria | 563 |
| 617 | Ga0587086_028513 | 3300059507 | Bacteria | 807 |
| 618 | Ga0587128_024646 | 3300059630 | Bacteria | 952 |
| 619 | Ga0587076_077902 | 3300059645 | Bacteria | 702 |
| 620 | Ga0587124_033839 | 3300059660 | Bacteria | 575 |
| 621 | Ga0501082_0635687 | 3300060353 | Bacteria | 934 |
| 622 | Ga0466962_0053902 | 3300061719 | Bacteria | 1922 |
| 623 | Ga0466962_0232925 | 3300061719 | Bacteria | 903 |
| 624 | Ga0530510_0004519 | 3300061734 | Bacteria | 9633 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005545 | Ga0070695_100064915 | Ga0070695_1000649152 | 138 |
| 2 | 3300009148 | Ga0105243_10092362 | Ga0105243_100923622 | 142 |
| 3 | 3300009176 | Ga0105242_10091926 | Ga0105242_100919262 | 142 |
| 4 | 3300014326 | Ga0157380_10887684 | Ga0157380_108876842 | 142 |
| 5 | 3300046523 | Ga0495644_0138609 | Ga0495644_0138609_365_823 | 143 |
| 6 | 3300005327 | Ga0070658_10133788 | Ga0070658_101337881 | 144 |
| 7 | 3300005341 | Ga0070691_10353165 | Ga0070691_103531651 | 144 |
| 8 | 3300005536 | Ga0070697_100417442 | Ga0070697_1004174421 | 144 |
| 9 | 3300005614 | Ga0068856_100017890 | Ga0068856_1000178901 | 144 |
| 10 | 3300006038 | Ga0075365_10035368 | Ga0075365_100353682 | 144 |
| 11 | 3300006048 | Ga0075363_100372762 | Ga0075363_1003727622 | 144 |
| 12 | 3300006163 | Ga0070715_10198194 | Ga0070715_101981942 | 144 |
| 13 | 3300006844 | Ga0075428_101155132 | Ga0075428_1011551322 | 144 |
| 14 | 3300009147 | Ga0114129_10097171 | Ga0114129_100971714 | 144 |
| 15 | 3300009147 | Ga0114129_10855580 | Ga0114129_108555802 | 144 |
| 16 | 3300009174 | Ga0105241_10865551 | Ga0105241_108655511 | 144 |
| 17 | 3300014326 | Ga0157380_13000674 | Ga0157380_130006742 | 144 |
| 18 | 3300025909 | Ga0207705_10111353 | Ga0207705_101113532 | 144 |
| 19 | 3300025910 | Ga0207684_10308750 | Ga0207684_103087502 | 144 |
| 20 | 3300025926 | Ga0207659_11009103 | Ga0207659_110091031 | 144 |
| 21 | 3300031852 | Ga0307410_10082360 | Ga0307410_100823602 | 144 |
| 22 | 3300031901 | Ga0307406_10042953 | Ga0307406_100429531 | 144 |
| 23 | 3300032002 | Ga0307416_100014892 | Ga0307416_1000148924 | 144 |
| 24 | 3300032126 | Ga0307415_100117025 | Ga0307415_1001170252 | 144 |
| 25 | 3300037418 | Ga0395900_0009014 | Ga0395900_0009014_6714_7148 | 144 |
| 26 | 3300037466 | Ga0395898_0134484 | Ga0395898_0134484_312_746 | 144 |
| 27 | 3300037853 | Ga0436364_1141745 | Ga0436364_1141745_129_563 | 144 |
| 28 | 3300039437 | Ga0436365_0930005 | Ga0436365_0930005_26_466 | 144 |
| 29 | 3300039450 | Ga0436363_1425761 | Ga0436363_1425761_1128_1562 | 144 |
| 30 | 3300039453 | Ga0436362_0746519 | Ga0436362_0746519_87_521 | 144 |
| 31 | 3300042993 | Ga0439440_0179958 | Ga0439440_0179958_107_541 | 144 |
| 32 | 3300044656 | Ga0466969_0027621 | Ga0466969_0027621_2211_2645 | 144 |
| 33 | 3300044656 | Ga0466969_0323831 | Ga0466969_0323831_101_535 | 144 |
| 34 | 3300044684 | Ga0466966_0029739 | Ga0466966_0029739_24_458 | 144 |
| 35 | 3300044684 | Ga0466966_0105672 | Ga0466966_0105672_876_1331 | 144 |
| 36 | 3300044693 | Ga0466961_0005961 | Ga0466961_0005961_1755_2210 | 144 |
| 37 | 3300044719 | Ga0466971_0158746 | Ga0466971_0158746_382_816 | 144 |
| 38 | 3300044765 | Ga0466970_0253774 | Ga0466970_0253774_541_975 | 144 |
| 39 | 3300044765 | Ga0466970_0293614 | Ga0466970_0293614_303_758 | 144 |
| 40 | 3300045049 | Ga0466959_0218568 | Ga0466959_0218568_53_487 | 144 |
| 41 | 3300045049 | Ga0466959_0299536 | Ga0466959_0299536_154_609 | 144 |
| 42 | 3300045836 | Ga0466958_0039452 | Ga0466958_0039452_263_697 | 144 |
| 43 | 3300046455 | Ga0495603_0237457 | Ga0495603_0237457_231_692 | 144 |
| 44 | 3300046461 | Ga0495641_0108705 | Ga0495641_0108705_684_1145 | 144 |
| 45 | 3300046499 | Ga0495594_0386130 | Ga0495594_0386130_184_645 | 144 |
| 46 | 3300046531 | Ga0495665_0174910 | Ga0495665_0174910_245_706 | 144 |
| 47 | 3300046675 | Ga0495657_0527350 | Ga0495657_0527350_194_628 | 144 |
| 48 | 3300046681 | Ga0495647_0508259 | Ga0495647_0508259_49_483 | 144 |
| 49 | 3300046683 | Ga0495658_0513112 | Ga0495658_0513112_317_751 | 144 |
| 50 | 3300046689 | Ga0495613_0492747 | Ga0495613_0492747_27_461 | 144 |
| 51 | 3300047315 | Ga0495581_0359400 | Ga0495581_0359400_99_560 | 144 |
| 52 | 3300047317 | Ga0495604_0792826 | Ga0495604_0792826_26_580 | 144 |
| 53 | 3300048088 | Ga0495602_0492528 | Ga0495602_0492528_25_537 | 144 |
| 54 | 3300048089 | Ga0495614_0292170 | Ga0495614_0292170_174_635 | 144 |
| 55 | 3300049568 | Ga0501031_0116554 | Ga0501031_0116554_110_544 | 144 |
| 56 | 3300049569 | Ga0501032_0162364 | Ga0501032_0162364_887_1321 | 144 |
| 57 | 3300049572 | Ga0501036_0050051 | Ga0501036_0050051_2223_2657 | 144 |
| 58 | 3300049576 | Ga0501040_0133047 | Ga0501040_0133047_1292_1726 | 144 |
| 59 | 3300049576 | Ga0501040_0407080 | Ga0501040_0407080_409_843 | 144 |
| 60 | 3300049577 | Ga0501041_0114653 | Ga0501041_0114653_127_561 | 144 |
| 61 | 3300049578 | Ga0501042_0230522 | Ga0501042_0230522_512_946 | 144 |
| 62 | 3300049580 | Ga0501046_0204306 | Ga0501046_0204306_783_1217 | 144 |
| 63 | 3300049582 | Ga0501048_0211609 | Ga0501048_0211609_206_640 | 144 |
| 64 | 3300049582 | Ga0501048_0331950 | Ga0501048_0331950_71_505 | 144 |
| 65 | 3300049587 | Ga0501071_0178766 | Ga0501071_0178766_168_602 | 144 |
| 66 | 3300049588 | Ga0501072_0064198 | Ga0501072_0064198_904_1338 | 144 |
| 67 | 3300049588 | Ga0501072_1181105 | Ga0501072_1181105_17_451 | 144 |
| 68 | 3300049590 | Ga0501074_0039773 | Ga0501074_0039773_87_521 | 144 |
| 69 | 3300049592 | Ga0501076_0139095 | Ga0501076_0139095_394_828 | 144 |
| 70 | 3300049593 | Ga0501077_0033357 | Ga0501077_0033357_920_1354 | 144 |
| 71 | 3300049593 | Ga0501077_0344413 | Ga0501077_0344413_452_886 | 144 |
| 72 | 3300049741 | Ga0501079_0564404 | Ga0501079_0564404_442_876 | 144 |
| 73 | 3300049742 | Ga0501080_0699047 | Ga0501080_0699047_325_759 | 144 |
| 74 | 3300049743 | Ga0501081_0752259 | Ga0501081_0752259_119_553 | 144 |
| 75 | 3300049822 | Ga0501035_0420154 | Ga0501035_0420154_606_1040 | 144 |
| 76 | 3300049824 | Ga0501045_0565073 | Ga0501045_0565073_385_819 | 144 |
| 77 | 3300049824 | Ga0501045_1135641 | Ga0501045_1135641_42_476 | 144 |
| 78 | 3300050490 | nmdc:mga03n38_431336_c1 | nmdc:mga03n38_431336_c1_231_665 | 144 |
| 79 | 3300050491 | nmdc:mga00v17_682111_c1 | nmdc:mga00v17_682111_c1_69_503 | 144 |
| 80 | 3300050492 | nmdc:mga0yw44_675737_c1 | nmdc:mga0yw44_675737_c1_218_652 | 144 |
| 81 | 3300050507 | nmdc:mga05p37_614359_c1 | nmdc:mga05p37_614359_c1_687_1121 | 144 |
| 82 | 3300050507 | nmdc:mga05p37_78565_c1 | nmdc:mga05p37_78565_c1_3424_3858 | 144 |
| 83 | 3300050510 | nmdc:mga06r32_1267375_c1 | nmdc:mga06r32_1267375_c1_25_459 | 144 |
| 84 | 3300060353 | Ga0501082_0635687 | Ga0501082_0635687_217_651 | 144 |
| 85 | 3300061719 | Ga0466962_0053902 | Ga0466962_0053902_225_680 | 144 |
| 86 | 3300061734 | Ga0530510_0004519 | Ga0530510_0004519_8377_8811 | 144 |
| 87 | 3300049581 | Ga0501047_0693140 | Ga0501047_0693140_231_668 | 145 |
| 88 | 3300049823 | Ga0501044_0160044 | Ga0501044_0160044_204_641 | 145 |
| 89 | 3300050512 | nmdc:mga0n895_420277_c1 | nmdc:mga0n895_420277_c1_70_543 | 145 |
| 90 | iso_pu_bacteria | 8054563764 | 8054564341 | 157 |
| 91 | 3300035083 | Ga0373926_0011226 | Ga0373926_0011226_2411_2887 | 158 |
| 92 | 3300035083 | Ga0373926_0083920 | Ga0373926_0083920_566_1042 | 158 |
| 93 | 3300035111 | Ga0373923_0032798 | Ga0373923_0032798_41_517 | 158 |
| 94 | 3300035113 | Ga0373936_0005536 | Ga0373936_0005536_1834_2310 | 158 |
| 95 | 3300035116 | Ga0373945_0001813 | Ga0373945_0001813_644_1120 | 158 |
| 96 | 3300035170 | Ga0373943_0000987 | Ga0373943_0000987_6790_7266 | 158 |
| 97 | 3300035171 | Ga0373946_0000390 | Ga0373946_0000390_935_1411 | 158 |
| 98 | 3300035172 | Ga0373955_0707851 | Ga0373955_0707851_11_487 | 158 |
| 99 | 3300035410 | Ga0373924_0272831 | Ga0373924_0272831_20_496 | 158 |
| 100 | 3300035692 | Ga0373935_0021138 | Ga0373935_0021138_333_809 | 158 |
| 101 | 3300035695 | Ga0373927_0001694 | Ga0373927_0001694_8136_8612 | 158 |
| 102 | 3300035725 | Ga0373947_0001559 | Ga0373947_0001559_10305_10781 | 158 |
| 103 | 3300035725 | Ga0373947_0041452 | Ga0373947_0041452_1990_2466 | 158 |
| 104 | 3300037068 | Ga0373925_0002714 | Ga0373925_0002714_10292_10768 | 158 |
| 105 | 3300046463 | Ga0495653_0075647 | Ga0495653_0075647_1924_2400 | 158 |
| 106 | 3300046472 | Ga0495580_0219911 | Ga0495580_0219911_480_956 | 158 |
| 107 | 3300046475 | Ga0495639_0120193 | Ga0495639_0120193_103_579 | 158 |
| 108 | 3300046476 | Ga0495662_0001418 | Ga0495662_0001418_4372_4848 | 158 |
| 109 | 3300046477 | Ga0495664_0021295 | Ga0495664_0021295_620_1096 | 158 |
| 110 | 3300046514 | Ga0495618_0040344 | Ga0495618_0040344_816_1292 | 158 |
| 111 | 3300046517 | Ga0495630_0024514 | Ga0495630_0024514_1685_2161 | 158 |
| 112 | 3300046526 | Ga0495666_0024475 | Ga0495666_0024475_347_823 | 158 |
| 113 | 3300046531 | Ga0495665_0031480 | Ga0495665_0031480_2351_2827 | 158 |
| 114 | 3300046533 | Ga0495640_0003310 | Ga0495640_0003310_10489_10965 | 158 |
| 115 | 3300046535 | Ga0495586_0052287 | Ga0495586_0052287_168_644 | 158 |
| 116 | 3300046543 | Ga0495645_0011928 | Ga0495645_0011928_2338_2814 | 158 |
| 117 | 3300046642 | Ga0495634_0003281 | Ga0495634_0003281_7664_8140 | 158 |
| 118 | 3300046663 | Ga0495635_0001339 | Ga0495635_0001339_13660_14136 | 158 |
| 119 | 3300046663 | Ga0495635_0126315 | Ga0495635_0126315_531_1007 | 158 |
| 120 | 3300046681 | Ga0495647_0010613 | Ga0495647_0010613_1242_1718 | 158 |
| 121 | 3300046683 | Ga0495658_0123238 | Ga0495658_0123238_714_1190 | 158 |
| 122 | 3300046690 | Ga0495624_0002621 | Ga0495624_0002621_11881_12357 | 158 |
| 123 | 3300046809 | Ga0495600_0276110 | Ga0495600_0276110_427_903 | 158 |
| 124 | 3300047315 | Ga0495581_0020558 | Ga0495581_0020558_1580_2056 | 158 |
| 125 | 3300047319 | Ga0495674_0006927 | Ga0495674_0006927_9061_9537 | 158 |
| 126 | 3300047471 | Ga0495684_0004391 | Ga0495684_0004391_29_505 | 158 |
| 127 | 3300047471 | Ga0495684_0005099 | Ga0495684_0005099_7841_8317 | 158 |
| 128 | 3300053078 | Ga0495612_0000187 | Ga0495612_0000187_24059_24535 | 158 |
| 129 | 3300000041 | ARcpr5oldR_c002575 | ARcpr5oldR_0025752 | 159 |
| 130 | 3300000043 | ARcpr5yngRDRAFT_c003782 | ARcpr5yngRDRAFT_0037822 | 159 |
| 131 | 3300001976 | JGI24752J21851_1012587 | JGI24752J21851_10125872 | 159 |
| 132 | 3300001979 | JGI24740J21852_10080762 | JGI24740J21852_100807622 | 159 |
| 133 | 3300002075 | JGI24738J21930_10015392 | JGI24738J21930_100153922 | 159 |
| 134 | 3300002075 | JGI24738J21930_10063437 | JGI24738J21930_100634371 | 159 |
| 135 | 3300003775 | Ga0055524_1001548 | Ga0055524_100154814 | 159 |
| 136 | 3300003781 | Ga0055536_1007886 | Ga0055536_10078864 | 159 |
| 137 | 3300003784 | Ga0055534_1022403 | Ga0055534_10224032 | 159 |
| 138 | 3300003790 | Ga0055528_1032619 | Ga0055528_10326192 | 159 |
| 139 | 3300003791 | Ga0055530_10000439 | Ga0055530_1000043925 | 159 |
| 140 | 3300003791 | Ga0055530_10000594 | Ga0055530_1000059432 | 159 |
| 141 | 3300003791 | Ga0055530_10049682 | Ga0055530_100496822 | 159 |
| 142 | 3300003791 | Ga0055530_10092330 | Ga0055530_100923301 | 159 |
| 143 | 3300003794 | Ga0055531_10000116 | Ga0055531_1000011633 | 159 |
| 144 | 3300005288 | Ga0065714_10098719 | Ga0065714_100987193 | 159 |
| 145 | 3300005289 | Ga0065704_10473974 | Ga0065704_104739741 | 159 |
| 146 | 3300005295 | Ga0065707_10151999 | Ga0065707_101519992 | 159 |
| 147 | 3300005327 | Ga0070658_10173047 | Ga0070658_101730474 | 159 |
| 148 | 3300005327 | Ga0070658_11004630 | Ga0070658_110046301 | 159 |
| 149 | 3300005331 | Ga0070670_100000621 | Ga0070670_10000062125 | 159 |
| 150 | 3300005334 | Ga0068869_100624033 | Ga0068869_1006240331 | 159 |
| 151 | 3300005336 | Ga0070680_100004270 | Ga0070680_1000042703 | 159 |
| 152 | 3300005336 | Ga0070680_100080285 | Ga0070680_1000802852 | 159 |
| 153 | 3300005336 | Ga0070680_100284449 | Ga0070680_1002844492 | 159 |
| 154 | 3300005339 | Ga0070660_100030281 | Ga0070660_1000302813 | 159 |
| 155 | 3300005339 | Ga0070660_101884377 | Ga0070660_1018843771 | 159 |
| 156 | 3300005344 | Ga0070661_100235648 | Ga0070661_1002356482 | 159 |
| 157 | 3300005344 | Ga0070661_100355996 | Ga0070661_1003559961 | 159 |
| 158 | 3300005344 | Ga0070661_101158502 | Ga0070661_1011585022 | 159 |
| 159 | 3300005347 | Ga0070668_100018490 | Ga0070668_1000184902 | 159 |
| 160 | 3300005355 | Ga0070671_100032911 | Ga0070671_1000329115 | 159 |
| 161 | 3300005355 | Ga0070671_100265926 | Ga0070671_1002659263 | 159 |
| 162 | 3300005364 | Ga0070673_100781783 | Ga0070673_1007817832 | 159 |
| 163 | 3300005364 | Ga0070673_101111543 | Ga0070673_1011115431 | 159 |
| 164 | 3300005366 | Ga0070659_100008286 | Ga0070659_1000082861 | 159 |
| 165 | 3300005366 | Ga0070659_100059354 | Ga0070659_1000593543 | 159 |
| 166 | 3300005366 | Ga0070659_100068905 | Ga0070659_1000689052 | 159 |
| 167 | 3300005367 | Ga0070667_100000322 | Ga0070667_10000032229 | 159 |
| 168 | 3300005367 | Ga0070667_100636027 | Ga0070667_1006360272 | 159 |
| 169 | 3300005435 | Ga0070714_100055463 | Ga0070714_1000554633 | 159 |
| 170 | 3300005435 | Ga0070714_100344830 | Ga0070714_1003448302 | 159 |
| 171 | 3300005444 | Ga0070694_100210727 | Ga0070694_1002107273 | 159 |
| 172 | 3300005455 | Ga0070663_100000837 | Ga0070663_1000008375 | 159 |
| 173 | 3300005455 | Ga0070663_100077637 | Ga0070663_1000776374 | 159 |
| 174 | 3300005455 | Ga0070663_100947889 | Ga0070663_1009478892 | 159 |
| 175 | 3300005457 | Ga0070662_100051566 | Ga0070662_1000515665 | 159 |
| 176 | 3300005458 | Ga0070681_10303593 | Ga0070681_103035931 | 159 |
| 177 | 3300005458 | Ga0070681_11173269 | Ga0070681_111732691 | 159 |
| 178 | 3300005530 | Ga0070679_100000112 | Ga0070679_1000001127 | 159 |
| 179 | 3300005530 | Ga0070679_100101300 | Ga0070679_1001013003 | 159 |
| 180 | 3300005530 | Ga0070679_101435375 | Ga0070679_1014353751 | 159 |
| 181 | 3300005539 | Ga0068853_100003533 | Ga0068853_1000035336 | 159 |
| 182 | 3300005539 | Ga0068853_100008993 | Ga0068853_1000089937 | 159 |
| 183 | 3300005539 | Ga0068853_100027584 | Ga0068853_1000275848 | 159 |
| 184 | 3300005539 | Ga0068853_100066850 | Ga0068853_1000668503 | 159 |
| 185 | 3300005539 | Ga0068853_100208277 | Ga0068853_1002082772 | 159 |
| 186 | 3300005543 | Ga0070672_100349859 | Ga0070672_1003498592 | 159 |
| 187 | 3300005544 | Ga0070686_100362150 | Ga0070686_1003621502 | 159 |
| 188 | 3300005545 | Ga0070695_100055567 | Ga0070695_1000555672 | 159 |
| 189 | 3300005546 | Ga0070696_100010028 | Ga0070696_1000100283 | 159 |
| 190 | 3300005548 | Ga0070665_100000021 | Ga0070665_100000021219 | 159 |
| 191 | 3300005548 | Ga0070665_100000105 | Ga0070665_10000010514 | 159 |
| 192 | 3300005548 | Ga0070665_100442521 | Ga0070665_1004425212 | 159 |
| 193 | 3300005563 | Ga0068855_100000305 | Ga0068855_10000030524 | 159 |
| 194 | 3300005563 | Ga0068855_100001252 | Ga0068855_10000125217 | 159 |
| 195 | 3300005563 | Ga0068855_100147047 | Ga0068855_1001470472 | 159 |
| 196 | 3300005563 | Ga0068855_100264548 | Ga0068855_1002645483 | 159 |
| 197 | 3300005563 | Ga0068855_102249757 | Ga0068855_1022497571 | 159 |
| 198 | 3300005564 | Ga0070664_100037446 | Ga0070664_1000374462 | 159 |
| 199 | 3300005564 | Ga0070664_100689999 | Ga0070664_1006899992 | 159 |
| 200 | 3300005577 | Ga0068857_100025650 | Ga0068857_1000256506 | 159 |
| 201 | 3300005577 | Ga0068857_100033719 | Ga0068857_1000337194 | 159 |
| 202 | 3300005577 | Ga0068857_100053877 | Ga0068857_1000538772 | 159 |
| 203 | 3300005578 | Ga0068854_100099837 | Ga0068854_1000998372 | 159 |
| 204 | 3300005578 | Ga0068854_100134783 | Ga0068854_1001347833 | 159 |
| 205 | 3300005578 | Ga0068854_100143017 | Ga0068854_1001430173 | 159 |
| 206 | 3300005578 | Ga0068854_100193606 | Ga0068854_1001936062 | 159 |
| 207 | 3300005578 | Ga0068854_100356389 | Ga0068854_1003563892 | 159 |
| 208 | 3300005614 | Ga0068856_100020880 | Ga0068856_1000208804 | 159 |
| 209 | 3300005614 | Ga0068856_100077633 | Ga0068856_1000776334 | 159 |
| 210 | 3300005616 | Ga0068852_100037222 | Ga0068852_1000372224 | 159 |
| 211 | 3300005616 | Ga0068852_100497437 | Ga0068852_1004974372 | 159 |
| 212 | 3300005617 | Ga0068859_100007709 | Ga0068859_1000077093 | 159 |
| 213 | 3300005617 | Ga0068859_100043963 | Ga0068859_1000439636 | 159 |
| 214 | 3300005617 | Ga0068859_100237966 | Ga0068859_1002379662 | 159 |
| 215 | 3300005617 | Ga0068859_100488477 | Ga0068859_1004884772 | 159 |
| 216 | 3300005618 | Ga0068864_100000004 | Ga0068864_100000004378 | 159 |
| 217 | 3300005718 | Ga0068866_10451198 | Ga0068866_104511982 | 159 |
| 218 | 3300005719 | Ga0068861_100000107 | Ga0068861_10000010728 | 159 |
| 219 | 3300005719 | Ga0068861_100261908 | Ga0068861_1002619082 | 159 |
| 220 | 3300005841 | Ga0068863_100000002 | Ga0068863_100000002379 | 159 |
| 221 | 3300005841 | Ga0068863_100058424 | Ga0068863_1000584242 | 159 |
| 222 | 3300005842 | Ga0068858_100024125 | Ga0068858_1000241254 | 159 |
| 223 | 3300005842 | Ga0068858_100298676 | Ga0068858_1002986762 | 159 |
| 224 | 3300005843 | Ga0068860_100047940 | Ga0068860_1000479401 | 159 |
| 225 | 3300005843 | Ga0068860_100050021 | Ga0068860_1000500212 | 159 |
| 226 | 3300005844 | Ga0068862_100000002 | Ga0068862_100000002123 | 159 |
| 227 | 3300005844 | Ga0068862_100000127 | Ga0068862_10000012759 | 159 |
| 228 | 3300005844 | Ga0068862_100012350 | Ga0068862_1000123506 | 159 |
| 229 | 3300005985 | Ga0081539_10016957 | Ga0081539_100169575 | 159 |
| 230 | 3300005985 | Ga0081539_10030696 | Ga0081539_100306963 | 159 |
| 231 | 3300006195 | Ga0075366_10116659 | Ga0075366_101166592 | 159 |
| 232 | 3300006237 | Ga0097621_100001517 | Ga0097621_1000015176 | 159 |
| 233 | 3300006358 | Ga0068871_100034759 | Ga0068871_1000347592 | 159 |
| 234 | 3300006931 | Ga0097620_100007709 | Ga0097620_1000077093 | 159 |
| 235 | 3300006931 | Ga0097620_100043963 | Ga0097620_1000439636 | 159 |
| 236 | 3300006931 | Ga0097620_100237977 | Ga0097620_1002379772 | 159 |
| 237 | 3300006931 | Ga0097620_100488467 | Ga0097620_1004884672 | 159 |
| 238 | 3300006948 | Ga0099826_10180708 | Ga0099826_101807082 | 159 |
| 239 | 3300009011 | Ga0105251_10002072 | Ga0105251_100020727 | 159 |
| 240 | 3300009093 | Ga0105240_10285343 | Ga0105240_102853432 | 159 |
| 241 | 3300009093 | Ga0105240_10334979 | Ga0105240_103349792 | 159 |
| 242 | 3300009093 | Ga0105240_10516549 | Ga0105240_105165491 | 159 |
| 243 | 3300009094 | Ga0111539_10030040 | Ga0111539_100300408 | 159 |
| 244 | 3300009101 | Ga0105247_10017235 | Ga0105247_100172353 | 159 |
| 245 | 3300009148 | Ga0105243_10405376 | Ga0105243_104053762 | 159 |
| 246 | 3300009148 | Ga0105243_10837138 | Ga0105243_108371382 | 159 |
| 247 | 3300009174 | Ga0105241_10031069 | Ga0105241_100310694 | 159 |
| 248 | 3300009176 | Ga0105242_11342761 | Ga0105242_113427611 | 159 |
| 249 | 3300009177 | Ga0105248_10000016 | Ga0105248_1000001635 | 159 |
| 250 | 3300009177 | Ga0105248_10001313 | Ga0105248_1000131320 | 159 |
| 251 | 3300009177 | Ga0105248_10400887 | Ga0105248_104008872 | 159 |
| 252 | 3300009551 | Ga0105238_10022206 | Ga0105238_100222068 | 159 |
| 253 | 3300009551 | Ga0105238_10145820 | Ga0105238_101458204 | 159 |
| 254 | 3300009553 | Ga0105249_10000149 | Ga0105249_1000014923 | 159 |
| 255 | 3300009553 | Ga0105249_10002669 | Ga0105249_1000266918 | 159 |
| 256 | 3300010375 | Ga0105239_10675382 | Ga0105239_106753823 | 159 |
| 257 | 3300013100 | Ga0157373_10387539 | Ga0157373_103875392 | 159 |
| 258 | 3300013104 | Ga0157370_10114710 | Ga0157370_101147102 | 159 |
| 259 | 3300013296 | Ga0157374_10598723 | Ga0157374_105987232 | 159 |
| 260 | 3300013306 | Ga0163162_10187148 | Ga0163162_101871483 | 159 |
| 261 | 3300013306 | Ga0163162_10308126 | Ga0163162_103081263 | 159 |
| 262 | 3300013307 | Ga0157372_10613374 | Ga0157372_106133742 | 159 |
| 263 | 3300013308 | Ga0157375_10006743 | Ga0157375_100067438 | 159 |
| 264 | 3300014326 | Ga0157380_10487206 | Ga0157380_104872062 | 159 |
| 265 | 3300017792 | Ga0163161_10026502 | Ga0163161_100265025 | 159 |
| 266 | 3300017792 | Ga0163161_10145799 | Ga0163161_101457992 | 159 |
| 267 | 3300017792 | Ga0163161_10703080 | Ga0163161_107030802 | 159 |
| 268 | 3300017792 | Ga0163161_10758648 | Ga0163161_107586481 | 159 |
| 269 | 3300017792 | Ga0163161_11102181 | Ga0163161_111021811 | 159 |
| 270 | 3300020070 | Ga0206356_10680400 | Ga0206356_106804001 | 159 |
| 271 | 3300020082 | Ga0206353_10860786 | Ga0206353_108607861 | 159 |
| 272 | 3300025208 | Ga0209436_122295 | Ga0209436_1222951 | 159 |
| 273 | 3300025233 | Ga0209437_120019 | Ga0209437_1200192 | 159 |
| 274 | 3300025245 | Ga0207425_1015748 | Ga0207425_10157482 | 159 |
| 275 | 3300025261 | Ga0209233_1000052 | Ga0209233_10000526 | 159 |
| 276 | 3300025263 | Ga0209565_1000007 | Ga0209565_100000763 | 159 |
| 277 | 3300025273 | Ga0209673_1001603 | Ga0209673_100160318 | 159 |
| 278 | 3300025291 | Ga0209675_1000075 | Ga0209675_1000075111 | 159 |
| 279 | 3300025291 | Ga0209675_1040054 | Ga0209675_10400542 | 159 |
| 280 | 3300025292 | Ga0209676_1000457 | Ga0209676_100045755 | 159 |
| 281 | 3300025292 | Ga0209676_1000554 | Ga0209676_100055420 | 159 |
| 282 | 3300025294 | Ga0209025_1018162 | Ga0209025_10181625 | 159 |
| 283 | 3300025298 | Ga0209050_1000017 | Ga0209050_1000017123 | 159 |
| 284 | 3300025298 | Ga0209050_1000196 | Ga0209050_100019681 | 159 |
| 285 | 3300025298 | Ga0209050_1008963 | Ga0209050_10089636 | 159 |
| 286 | 3300025298 | Ga0209050_1023424 | Ga0209050_10234241 | 159 |
| 287 | 3300025298 | Ga0209050_1055100 | Ga0209050_10551001 | 159 |
| 288 | 3300025299 | Ga0209256_1000009 | Ga0209256_100000995 | 159 |
| 289 | 3300025299 | Ga0209256_1000010 | Ga0209256_100001019 | 159 |
| 290 | 3300025304 | Ga0209257_1000206 | Ga0209257_1000206123 | 159 |
| 291 | 3300025304 | Ga0209257_1000228 | Ga0209257_100022881 | 159 |
| 292 | 3300025304 | Ga0209257_1000456 | Ga0209257_100045623 | 159 |
| 293 | 3300025304 | Ga0209257_1003373 | Ga0209257_10033739 | 159 |
| 294 | 3300025304 | Ga0209257_1003588 | Ga0209257_100358810 | 159 |
| 295 | 3300025304 | Ga0209257_1009860 | Ga0209257_10098602 | 159 |
| 296 | 3300025321 | Ga0207656_10225270 | Ga0207656_102252702 | 159 |
| 297 | 3300025735 | Ga0207713_1005825 | Ga0207713_10058258 | 159 |
| 298 | 3300025900 | Ga0207710_10009393 | Ga0207710_100093933 | 159 |
| 299 | 3300025900 | Ga0207710_10014488 | Ga0207710_100144883 | 159 |
| 300 | 3300025909 | Ga0207705_10132887 | Ga0207705_101328873 | 159 |
| 301 | 3300025909 | Ga0207705_10954933 | Ga0207705_109549331 | 159 |
| 302 | 3300025912 | Ga0207707_10038563 | Ga0207707_100385634 | 159 |
| 303 | 3300025912 | Ga0207707_10196038 | Ga0207707_101960382 | 159 |
| 304 | 3300025912 | Ga0207707_11076108 | Ga0207707_110761082 | 159 |
| 305 | 3300025913 | Ga0207695_10521279 | Ga0207695_105212791 | 159 |
| 306 | 3300025917 | Ga0207660_10000218 | Ga0207660_100002183 | 159 |
| 307 | 3300025919 | Ga0207657_10016201 | Ga0207657_100162012 | 159 |
| 308 | 3300025919 | Ga0207657_10030743 | Ga0207657_100307434 | 159 |
| 309 | 3300025919 | Ga0207657_10906562 | Ga0207657_109065621 | 159 |
| 310 | 3300025920 | Ga0207649_10058668 | Ga0207649_100586685 | 159 |
| 311 | 3300025920 | Ga0207649_10344177 | Ga0207649_103441772 | 159 |
| 312 | 3300025921 | Ga0207652_10000001 | Ga0207652_1000000136 | 159 |
| 313 | 3300025921 | Ga0207652_10936671 | Ga0207652_109366711 | 159 |
| 314 | 3300025924 | Ga0207694_10079449 | Ga0207694_100794492 | 159 |
| 315 | 3300025924 | Ga0207694_10647951 | Ga0207694_106479512 | 159 |
| 316 | 3300025925 | Ga0207650_10000643 | Ga0207650_1000064325 | 159 |
| 317 | 3300025925 | Ga0207650_10584424 | Ga0207650_105844242 | 159 |
| 318 | 3300025929 | Ga0207664_10041175 | Ga0207664_100411754 | 159 |
| 319 | 3300025929 | Ga0207664_10372572 | Ga0207664_103725722 | 159 |
| 320 | 3300025931 | Ga0207644_10247829 | Ga0207644_102478292 | 159 |
| 321 | 3300025931 | Ga0207644_10622150 | Ga0207644_106221502 | 159 |
| 322 | 3300025932 | Ga0207690_10090242 | Ga0207690_100902422 | 159 |
| 323 | 3300025933 | Ga0207706_10048755 | Ga0207706_100487556 | 159 |
| 324 | 3300025934 | Ga0207686_10729720 | Ga0207686_107297202 | 159 |
| 325 | 3300025935 | Ga0207709_11193086 | Ga0207709_111930861 | 159 |
| 326 | 3300025937 | Ga0207669_11240076 | Ga0207669_112400761 | 159 |
| 327 | 3300025941 | Ga0207711_10000022 | Ga0207711_1000002235 | 159 |
| 328 | 3300025941 | Ga0207711_10000956 | Ga0207711_1000095620 | 159 |
| 329 | 3300025941 | Ga0207711_10006787 | Ga0207711_1000678713 | 159 |
| 330 | 3300025944 | Ga0207661_10001385 | Ga0207661_100013859 | 159 |
| 331 | 3300025945 | Ga0207679_10112459 | Ga0207679_101124592 | 159 |
| 332 | 3300025949 | Ga0207667_10000035 | Ga0207667_1000003537 | 159 |
| 333 | 3300025949 | Ga0207667_10002213 | Ga0207667_100022138 | 159 |
| 334 | 3300025949 | Ga0207667_10293890 | Ga0207667_102938902 | 159 |
| 335 | 3300025949 | Ga0207667_10401981 | Ga0207667_104019812 | 159 |
| 336 | 3300025961 | Ga0207712_10000111 | Ga0207712_1000011123 | 159 |
| 337 | 3300025961 | Ga0207712_10005353 | Ga0207712_100053531 | 159 |
| 338 | 3300025961 | Ga0207712_11321897 | Ga0207712_113218971 | 159 |
| 339 | 3300025972 | Ga0207668_10001243 | Ga0207668_1000124311 | 159 |
| 340 | 3300025972 | Ga0207668_10012621 | Ga0207668_100126212 | 159 |
| 341 | 3300025972 | Ga0207668_10295261 | Ga0207668_102952612 | 159 |
| 342 | 3300025972 | Ga0207668_10626718 | Ga0207668_106267181 | 159 |
| 343 | 3300025981 | Ga0207640_10000085 | Ga0207640_1000008574 | 159 |
| 344 | 3300025981 | Ga0207640_10111622 | Ga0207640_101116222 | 159 |
| 345 | 3300025981 | Ga0207640_10322787 | Ga0207640_103227872 | 159 |
| 346 | 3300025981 | Ga0207640_11182351 | Ga0207640_111823512 | 159 |
| 347 | 3300025986 | Ga0207658_10000589 | Ga0207658_100005897 | 159 |
| 348 | 3300026035 | Ga0207703_10000510 | Ga0207703_1000051045 | 159 |
| 349 | 3300026035 | Ga0207703_10072971 | Ga0207703_100729713 | 159 |
| 350 | 3300026035 | Ga0207703_10592700 | Ga0207703_105927002 | 159 |
| 351 | 3300026035 | Ga0207703_11263858 | Ga0207703_112638581 | 159 |
| 352 | 3300026041 | Ga0207639_10012952 | Ga0207639_100129525 | 159 |
| 353 | 3300026041 | Ga0207639_10048127 | Ga0207639_100481273 | 159 |
| 354 | 3300026067 | Ga0207678_10005202 | Ga0207678_1000520211 | 159 |
| 355 | 3300026067 | Ga0207678_10099206 | Ga0207678_100992062 | 159 |
| 356 | 3300026078 | Ga0207702_10031113 | Ga0207702_100311137 | 159 |
| 357 | 3300026078 | Ga0207702_10574549 | Ga0207702_105745492 | 159 |
| 358 | 3300026088 | Ga0207641_10000002 | Ga0207641_10000002859 | 159 |
| 359 | 3300026088 | Ga0207641_10055125 | Ga0207641_100551254 | 159 |
| 360 | 3300026089 | Ga0207648_10271929 | Ga0207648_102719292 | 159 |
| 361 | 3300026095 | Ga0207676_10000040 | Ga0207676_1000004054 | 159 |
| 362 | 3300026116 | Ga0207674_10011562 | Ga0207674_100115626 | 159 |
| 363 | 3300026116 | Ga0207674_10015944 | Ga0207674_100159443 | 159 |
| 364 | 3300026116 | Ga0207674_10037608 | Ga0207674_100376084 | 159 |
| 365 | 3300026116 | Ga0207674_10206109 | Ga0207674_102061091 | 159 |
| 366 | 3300026118 | Ga0207675_100000317 | Ga0207675_10000031714 | 159 |
| 367 | 3300026118 | Ga0207675_100303528 | Ga0207675_1003035283 | 159 |
| 368 | 3300026142 | Ga0207698_10279055 | Ga0207698_102790552 | 159 |
| 369 | 3300026142 | Ga0207698_10279145 | Ga0207698_102791452 | 159 |
| 370 | 3300027666 | Ga0209282_1166632 | Ga0209282_11666322 | 159 |
| 371 | 3300027876 | Ga0209974_10143705 | Ga0209974_101437052 | 159 |
| 372 | 3300028379 | Ga0268266_10000015 | Ga0268266_10000015234 | 159 |
| 373 | 3300028379 | Ga0268266_10000055 | Ga0268266_10000055217 | 159 |
| 374 | 3300028380 | Ga0268265_10000003 | Ga0268265_10000003131 | 159 |
| 375 | 3300028380 | Ga0268265_10000385 | Ga0268265_100003857 | 159 |
| 376 | 3300028380 | Ga0268265_10115292 | Ga0268265_101152924 | 159 |
| 377 | 3300028381 | Ga0268264_10009236 | Ga0268264_100092362 | 159 |
| 378 | 3300028381 | Ga0268264_10080903 | Ga0268264_100809032 | 159 |
| 379 | 3300030522 | Ga0307512_10209745 | Ga0307512_102097452 | 159 |
| 380 | 3300030745 | Ga0316182_1432900 | Ga0316182_14329001 | 159 |
| 381 | 3300031250 | Ga0265331_10000005 | Ga0265331_10000005405 | 159 |
| 382 | 3300031456 | Ga0307513_10095479 | Ga0307513_100954793 | 159 |
| 383 | 3300031456 | Ga0307513_10154019 | Ga0307513_101540193 | 159 |
| 384 | 3300031548 | Ga0307408_100019783 | Ga0307408_1000197836 | 159 |
| 385 | 3300031548 | Ga0307408_100085229 | Ga0307408_1000852292 | 159 |
| 386 | 3300031548 | Ga0307408_100096460 | Ga0307408_1000964602 | 159 |
| 387 | 3300031548 | Ga0307408_100422366 | Ga0307408_1004223662 | 159 |
| 388 | 3300031548 | Ga0307408_100671021 | Ga0307408_1006710212 | 159 |
| 389 | 3300031548 | Ga0307408_100886971 | Ga0307408_1008869711 | 159 |
| 390 | 3300031616 | Ga0307508_10004215 | Ga0307508_100042156 | 159 |
| 391 | 3300031731 | Ga0307405_10177100 | Ga0307405_101771001 | 159 |
| 392 | 3300031731 | Ga0307405_10802798 | Ga0307405_108027982 | 159 |
| 393 | 3300031824 | Ga0307413_10291379 | Ga0307413_102913792 | 159 |
| 394 | 3300031824 | Ga0307413_10298467 | Ga0307413_102984673 | 159 |
| 395 | 3300031852 | Ga0307410_10071133 | Ga0307410_100711335 | 159 |
| 396 | 3300031852 | Ga0307410_10369168 | Ga0307410_103691681 | 159 |
| 397 | 3300031901 | Ga0307406_10044506 | Ga0307406_100445064 | 159 |
| 398 | 3300031901 | Ga0307406_10060279 | Ga0307406_100602791 | 159 |
| 399 | 3300031901 | Ga0307406_10115111 | Ga0307406_101151113 | 159 |
| 400 | 3300031901 | Ga0307406_10138152 | Ga0307406_101381522 | 159 |
| 401 | 3300031901 | Ga0307406_10785034 | Ga0307406_107850342 | 159 |
| 402 | 3300031903 | Ga0307407_10274665 | Ga0307407_102746651 | 159 |
| 403 | 3300031903 | Ga0307407_10408881 | Ga0307407_104088812 | 159 |
| 404 | 3300031911 | Ga0307412_10005529 | Ga0307412_100055291 | 159 |
| 405 | 3300031911 | Ga0307412_10007833 | Ga0307412_100078334 | 159 |
| 406 | 3300031911 | Ga0307412_10009359 | Ga0307412_100093596 | 159 |
| 407 | 3300031911 | Ga0307412_10251859 | Ga0307412_102518593 | 159 |
| 408 | 3300031911 | Ga0307412_10329095 | Ga0307412_103290952 | 159 |
| 409 | 3300031911 | Ga0307412_10410544 | Ga0307412_104105442 | 159 |
| 410 | 3300031911 | Ga0307412_10543575 | Ga0307412_105435752 | 159 |
| 411 | 3300031911 | Ga0307412_10764066 | Ga0307412_107640662 | 159 |
| 412 | 3300031995 | Ga0307409_100681128 | Ga0307409_1006811282 | 159 |
| 413 | 3300031995 | Ga0307409_100844442 | Ga0307409_1008444422 | 159 |
| 414 | 3300032002 | Ga0307416_100024239 | Ga0307416_1000242393 | 159 |
| 415 | 3300032002 | Ga0307416_100039249 | Ga0307416_1000392494 | 159 |
| 416 | 3300032002 | Ga0307416_100310481 | Ga0307416_1003104812 | 159 |
| 417 | 3300032004 | Ga0307414_10000070 | Ga0307414_1000007076 | 159 |
| 418 | 3300032004 | Ga0307414_10000908 | Ga0307414_100009089 | 159 |
| 419 | 3300032004 | Ga0307414_10021947 | Ga0307414_100219472 | 159 |
| 420 | 3300032004 | Ga0307414_10034425 | Ga0307414_100344253 | 159 |
| 421 | 3300032004 | Ga0307414_10067246 | Ga0307414_100672462 | 159 |
| 422 | 3300032004 | Ga0307414_10637974 | Ga0307414_106379742 | 159 |
| 423 | 3300032004 | Ga0307414_10895295 | Ga0307414_108952951 | 159 |
| 424 | 3300032004 | Ga0307414_11249117 | Ga0307414_112491171 | 159 |
| 425 | 3300032005 | Ga0307411_10048286 | Ga0307411_100482861 | 159 |
| 426 | 3300032005 | Ga0307411_10140883 | Ga0307411_101408832 | 159 |
| 427 | 3300032005 | Ga0307411_10561176 | Ga0307411_105611762 | 159 |
| 428 | 3300032005 | Ga0307411_10582318 | Ga0307411_105823182 | 159 |
| 429 | 3300032005 | Ga0307411_10849728 | Ga0307411_108497282 | 159 |
| 430 | 3300032005 | Ga0307411_11971721 | Ga0307411_119717211 | 159 |
| 431 | 3300032126 | Ga0307415_100082053 | Ga0307415_1000820534 | 159 |
| 432 | 3300032126 | Ga0307415_100157314 | Ga0307415_1001573143 | 159 |
| 433 | 3300032126 | Ga0307415_100199808 | Ga0307415_1001998082 | 159 |
| 434 | 3300032126 | Ga0307415_100507489 | Ga0307415_1005074892 | 159 |
| 435 | 3300033180 | Ga0307510_10021872 | Ga0307510_100218727 | 159 |
| 436 | 3300035117 | Ga0373953_0178203 | Ga0373953_0178203_96_575 | 159 |
| 437 | 3300035118 | Ga0373954_0140379 | Ga0373954_0140379_31_510 | 159 |
| 438 | 3300035119 | Ga0373956_0081265 | Ga0373956_0081265_634_1113 | 159 |
| 439 | 3300035120 | Ga0373957_0116690 | Ga0373957_0116690_372_851 | 159 |
| 440 | 3300035170 | Ga0373943_0004063 | Ga0373943_0004063_6140_6619 | 159 |
| 441 | 3300035172 | Ga0373955_0002343 | Ga0373955_0002343_6279_6758 | 159 |
| 442 | 3300035692 | Ga0373935_0210574 | Ga0373935_0210574_265_744 | 159 |
| 443 | 3300035725 | Ga0373947_0396628 | Ga0373947_0396628_225_704 | 159 |
| 444 | 3300036401 | Ga0373937_0013140 | Ga0373937_0013140_3339_3818 | 159 |
| 445 | 3300036647 | Ga0316582_0000396 | Ga0316582_0000396_7845_8324 | 159 |
| 446 | 3300036712 | Ga0316584_0020794 | Ga0316584_0020794_935_1414 | 159 |
| 447 | 3300036712 | Ga0316584_0312609 | Ga0316584_0312609_360_839 | 159 |
| 448 | 3300037068 | Ga0373925_0033233 | Ga0373925_0033233_2333_2812 | 159 |
| 449 | 3300037312 | Ga0395899_0001872 | Ga0395899_0001872_2856_3335 | 159 |
| 450 | 3300037312 | Ga0395899_0014790 | Ga0395899_0014790_2449_2928 | 159 |
| 451 | 3300037312 | Ga0395899_0154353 | Ga0395899_0154353_170_649 | 159 |
| 452 | 3300037312 | Ga0395899_0335232 | Ga0395899_0335232_21_500 | 159 |
| 453 | 3300037312 | Ga0395899_0451793 | Ga0395899_0451793_141_620 | 159 |
| 454 | 3300037418 | Ga0395900_0000084 | Ga0395900_0000084_58182_58661 | 159 |
| 455 | 3300037418 | Ga0395900_0131251 | Ga0395900_0131251_2026_2505 | 159 |
| 456 | 3300037418 | Ga0395900_0148125 | Ga0395900_0148125_205_684 | 159 |
| 457 | 3300037418 | Ga0395900_0367779 | Ga0395900_0367779_404_883 | 159 |
| 458 | 3300037418 | Ga0395900_0424270 | Ga0395900_0424270_291_770 | 159 |
| 459 | 3300037466 | Ga0395898_0000021 | Ga0395898_0000021_274644_275123 | 159 |
| 460 | 3300037466 | Ga0395898_0003569 | Ga0395898_0003569_11672_12151 | 159 |
| 461 | 3300037466 | Ga0395898_0152050 | Ga0395898_0152050_142_621 | 159 |
| 462 | 3300037466 | Ga0395898_0155205 | Ga0395898_0155205_1203_1682 | 159 |
| 463 | 3300037471 | Ga0395905_0000006 | Ga0395905_0000006_490896_491375 | 159 |
| 464 | 3300037471 | Ga0395905_0006269 | Ga0395905_0006269_926_1405 | 159 |
| 465 | 3300037471 | Ga0395905_0008304 | Ga0395905_0008304_384_863 | 159 |
| 466 | 3300037471 | Ga0395905_0019553 | Ga0395905_0019553_4810_5289 | 159 |
| 467 | 3300037471 | Ga0395905_0087484 | Ga0395905_0087484_1273_1752 | 159 |
| 468 | 3300037471 | Ga0395905_0298168 | Ga0395905_0298168_984_1463 | 159 |
| 469 | 3300037471 | Ga0395905_0305467 | Ga0395905_0305467_415_894 | 159 |
| 470 | 3300037471 | Ga0395905_0403724 | Ga0395905_0403724_741_1220 | 159 |
| 471 | 3300037853 | Ga0436364_0416603 | Ga0436364_0416603_655_1134 | 159 |
| 472 | 3300038443 | Ga0395901_0001581 | Ga0395901_0001581_10728_11207 | 159 |
| 473 | 3300038443 | Ga0395901_0004950 | Ga0395901_0004950_951_1430 | 159 |
| 474 | 3300038443 | Ga0395901_0032271 | Ga0395901_0032271_1843_2322 | 159 |
| 475 | 3300038443 | Ga0395901_0145215 | Ga0395901_0145215_1704_2183 | 159 |
| 476 | 3300038443 | Ga0395901_0409938 | Ga0395901_0409938_413_892 | 159 |
| 477 | 3300038705 | Ga0237819_02700 | Ga0237819_02700_2076_2555 | 159 |
| 478 | 3300039453 | Ga0436362_1101242 | Ga0436362_1101242_97_576 | 159 |
| 479 | 3300041404 | Ga0439436_0062191 | Ga0439436_0062191_124_603 | 159 |
| 480 | 3300041405 | Ga0439438_062014 | Ga0439438_062014_162_641 | 159 |
| 481 | 3300041406 | Ga0439439_0017369 | Ga0439439_0017369_1152_1631 | 159 |
| 482 | 3300041407 | Ga0439447_096548 | Ga0439447_096548_183_662 | 159 |
| 483 | 3300041410 | Ga0439461_0000237 | Ga0439461_0000237_7295_7774 | 159 |
| 484 | 3300041413 | Ga0439465_0001413 | Ga0439465_0001413_1998_2477 | 159 |
| 485 | 3300041413 | Ga0439465_0003226 | Ga0439465_0003226_1549_2028 | 159 |
| 486 | 3300041452 | Ga0451793_1016855 | Ga0451793_1016855_176_655 | 159 |
| 487 | 3300041452 | Ga0451793_1315180 | Ga0451793_1315180_306_785 | 159 |
| 488 | 3300041461 | Ga0451805_038860 | Ga0451805_038860_39_521 | 159 |
| 489 | 3300041461 | Ga0451805_107206 | Ga0451805_107206_35_517 | 159 |
| 490 | 3300041997 | Ga0439431_0000173 | Ga0439431_0000173_4587_5066 | 159 |
| 491 | 3300041997 | Ga0439431_0004664 | Ga0439431_0004664_1085_1564 | 159 |
| 492 | 3300042002 | Ga0439442_004433 | Ga0439442_004433_1731_2210 | 159 |
| 493 | 3300042004 | Ga0439445_0000812 | Ga0439445_0000812_3475_3954 | 159 |
| 494 | 3300042004 | Ga0439445_0003186 | Ga0439445_0003186_2666_3145 | 159 |
| 495 | 3300042004 | Ga0439445_0032828 | Ga0439445_0032828_827_1306 | 159 |
| 496 | 3300042004 | Ga0439445_0164879 | Ga0439445_0164879_88_567 | 159 |
| 497 | 3300042006 | Ga0439432_019352 | Ga0439432_019352_585_1064 | 159 |
| 498 | 3300042006 | Ga0439432_032722 | Ga0439432_032722_238_717 | 159 |
| 499 | 3300042014 | Ga0439457_053736 | Ga0439457_053736_116_595 | 159 |
| 500 | 3300042015 | Ga0439462_0000167 | Ga0439462_0000167_890_1369 | 159 |
| 501 | 3300042142 | Ga0450905_009047 | Ga0450905_009047_171_650 | 159 |
| 502 | 3300042144 | Ga0450889_000888 | Ga0450889_000888_2127_2606 | 159 |
| 503 | 3300042156 | Ga0439446_0050764 | Ga0439446_0050764_10_489 | 159 |
| 504 | 3300042435 | Ga0439434_0002832 | Ga0439434_0002832_155_634 | 159 |
| 505 | 3300042439 | Ga0439464_0191058 | Ga0439464_0191058_83_562 | 159 |
| 506 | 3300044693 | Ga0466961_0211685 | Ga0466961_0211685_216_695 | 159 |
| 507 | 3300044694 | Ga0466963_0025116 | Ga0466963_0025116_262_741 | 159 |
| 508 | 3300044719 | Ga0466971_0450653 | Ga0466971_0450653_93_572 | 159 |
| 509 | 3300044735 | Ga0466968_0505422 | Ga0466968_0505422_34_513 | 159 |
| 510 | 3300044765 | Ga0466970_0091618 | Ga0466970_0091618_955_1434 | 159 |
| 511 | 3300044842 | Ga0466957_0278994 | Ga0466957_0278994_110_589 | 159 |
| 512 | 3300045049 | Ga0466959_0400199 | Ga0466959_0400199_46_525 | 159 |
| 513 | 3300045836 | Ga0466958_0078077 | Ga0466958_0078077_29_508 | 159 |
| 514 | 3300045836 | Ga0466958_0188814 | Ga0466958_0188814_311_790 | 159 |
| 515 | 3300045836 | Ga0466958_0534752 | Ga0466958_0534752_77_556 | 159 |
| 516 | 3300045976 | Ga0466967_0023474 | Ga0466967_0023474_1226_1705 | 159 |
| 517 | 3300045976 | Ga0466967_0509192 | Ga0466967_0509192_227_706 | 159 |
| 518 | 3300046460 | Ga0495638_0000714 | Ga0495638_0000714_31799_32278 | 159 |
| 519 | 3300046492 | Ga0495585_0027193 | Ga0495585_0027193_2578_3057 | 159 |
| 520 | 3300046522 | Ga0495643_0051033 | Ga0495643_0051033_559_1038 | 159 |
| 521 | 3300046616 | Ga0495668_0000076 | Ga0495668_0000076_135886_136368 | 159 |
| 522 | 3300046616 | Ga0495668_0115150 | Ga0495668_0115150_672_1151 | 159 |
| 523 | 3300046616 | Ga0495668_0542498 | Ga0495668_0542498_105_584 | 159 |
| 524 | 3300046660 | Ga0495625_0000936 | Ga0495625_0000936_19570_20052 | 159 |
| 525 | 3300046660 | Ga0495625_0001409 | Ga0495625_0001409_24258_24737 | 159 |
| 526 | 3300046660 | Ga0495625_0042798 | Ga0495625_0042798_91_570 | 159 |
| 527 | 3300046679 | Ga0495623_0257708 | Ga0495623_0257708_440_919 | 159 |
| 528 | 3300046691 | Ga0495670_0000003 | Ga0495670_0000003_289832_290311 | 159 |
| 529 | 3300047472 | Ga0495686_0000082 | Ga0495686_0000082_45930_46409 | 159 |
| 530 | 3300047472 | Ga0495686_0045625 | Ga0495686_0045625_1744_2223 | 159 |
| 531 | 3300048906 | Ga0496103_0064131 | Ga0496103_0064131_1286_1765 | 159 |
| 532 | 3300048912 | Ga0496109_0157652 | Ga0496109_0157652_1275_1754 | 159 |
| 533 | 3300048912 | Ga0496109_0310766 | Ga0496109_0310766_309_788 | 159 |
| 534 | 3300048914 | Ga0496111_0086926 | Ga0496111_0086926_1638_2117 | 159 |
| 535 | 3300048915 | Ga0496112_0003706 | Ga0496112_0003706_12069_12548 | 159 |
| 536 | 3300048915 | Ga0496112_0035620 | Ga0496112_0035620_1479_2060 | 159 |
| 537 | 3300048916 | Ga0496113_0002272 | Ga0496113_0002272_2726_3205 | 159 |
| 538 | 3300048918 | Ga0496115_0292471 | Ga0496115_0292471_340_819 | 159 |
| 539 | 3300048920 | Ga0496117_0003086 | Ga0496117_0003086_15092_15571 | 159 |
| 540 | 3300048921 | Ga0496118_0072196 | Ga0496118_0072196_779_1258 | 159 |
| 541 | 3300048922 | Ga0496119_0049487 | Ga0496119_0049487_1926_2405 | 159 |
| 542 | 3300048925 | Ga0496122_0001177 | Ga0496122_0001177_9743_10222 | 159 |
| 543 | 3300048926 | Ga0496123_0000754 | Ga0496123_0000754_17370_17849 | 159 |
| 544 | 3300048927 | Ga0496124_0049520 | Ga0496124_0049520_2903_3382 | 159 |
| 545 | 3300049130 | Ga0501310_052323 | Ga0501310_052323_34_513 | 159 |
| 546 | 3300049160 | Ga0501304_031661 | Ga0501304_031661_73_552 | 159 |
| 547 | 3300049513 | Ga0501290_000076 | Ga0501290_000076_6989_7468 | 159 |
| 548 | 3300049515 | Ga0501292_000037 | Ga0501292_000037_22736_23215 | 159 |
| 549 | 3300049517 | Ga0501294_000020 | Ga0501294_000020_463_942 | 159 |
| 550 | 3300049529 | Ga0501313_051858 | Ga0501313_051858_45_524 | 159 |
| 551 | 3300049529 | Ga0501313_058902 | Ga0501313_058902_26_505 | 159 |
| 552 | 3300049530 | Ga0501314_002904 | Ga0501314_002904_299_778 | 159 |
| 553 | 3300049531 | Ga0501315_004097 | Ga0501315_004097_529_1008 | 159 |
| 554 | 3300049533 | Ga0501317_013270 | Ga0501317_013270_474_953 | 159 |
| 555 | 3300049536 | Ga0501320_036411 | Ga0501320_036411_112_591 | 159 |
| 556 | 3300049536 | Ga0501320_049645 | Ga0501320_049645_46_525 | 159 |
| 557 | 3300049539 | Ga0501323_022668 | Ga0501323_022668_57_536 | 159 |
| 558 | 3300049551 | Ga0501335_036996 | Ga0501335_036996_28_507 | 159 |
| 559 | 3300049554 | Ga0501338_06694 | Ga0501338_06694_78_557 | 159 |
| 560 | 3300049568 | Ga0501031_0100697 | Ga0501031_0100697_843_1436 | 159 |
| 561 | 3300049569 | Ga0501032_0007617 | Ga0501032_0007617_4943_5536 | 159 |
| 562 | 3300049570 | Ga0501033_0011285 | Ga0501033_0011285_450_1043 | 159 |
| 563 | 3300049571 | Ga0501034_0124569 | Ga0501034_0124569_30_623 | 159 |
| 564 | 3300049571 | Ga0501034_0169927 | Ga0501034_0169927_1556_2035 | 159 |
| 565 | 3300049572 | Ga0501036_0052934 | Ga0501036_0052934_1561_2154 | 159 |
| 566 | 3300049573 | Ga0501037_0022098 | Ga0501037_0022098_687_1280 | 159 |
| 567 | 3300049574 | Ga0501038_0221942 | Ga0501038_0221942_450_1043 | 159 |
| 568 | 3300049575 | Ga0501039_0108807 | Ga0501039_0108807_987_1580 | 159 |
| 569 | 3300049579 | Ga0501043_0087084 | Ga0501043_0087084_577_1170 | 159 |
| 570 | 3300049581 | Ga0501047_0180019 | Ga0501047_0180019_196_789 | 159 |
| 571 | 3300049581 | Ga0501047_0340756 | Ga0501047_0340756_367_846 | 159 |
| 572 | 3300049581 | Ga0501047_0392506 | Ga0501047_0392506_641_1120 | 159 |
| 573 | 3300049581 | Ga0501047_0403264 | Ga0501047_0403264_711_1190 | 159 |
| 574 | 3300049590 | Ga0501074_0956433 | Ga0501074_0956433_71_550 | 159 |
| 575 | 3300049592 | Ga0501076_1065584 | Ga0501076_1065584_149_628 | 159 |
| 576 | 3300049663 | Ga0501223_000755 | Ga0501223_000755_4971_5450 | 159 |
| 577 | 3300049664 | Ga0501224_000016 | Ga0501224_000016_79773_80252 | 159 |
| 578 | 3300049668 | Ga0501233_009888 | Ga0501233_009888_650_1129 | 159 |
| 579 | 3300049679 | Ga0501249_041261 | Ga0501249_041261_519_998 | 159 |
| 580 | 3300049686 | Ga0501257_000240 | Ga0501257_000240_5854_6333 | 159 |
| 581 | 3300049704 | Ga0501221_030695 | Ga0501221_030695_369_848 | 159 |
| 582 | 3300049705 | Ga0501225_0000016 | Ga0501225_0000016_5874_6353 | 159 |
| 583 | 3300049705 | Ga0501225_0006759 | Ga0501225_0006759_2537_3016 | 159 |
| 584 | 3300049742 | Ga0501080_0104794 | Ga0501080_0104794_1519_1998 | 159 |
| 585 | 3300049764 | Ga0501267_007509 | Ga0501267_007509_193_672 | 159 |
| 586 | 3300049775 | Ga0501279_000008 | Ga0501279_000008_11911_12390 | 159 |
| 587 | 3300049776 | Ga0501280_000013 | Ga0501280_000013_19488_19967 | 159 |
| 588 | 3300049776 | Ga0501280_001260 | Ga0501280_001260_559_1038 | 159 |
| 589 | 3300049777 | Ga0501281_00107 | Ga0501281_00107_8339_8818 | 159 |
| 590 | 3300049778 | Ga0501282_000282 | Ga0501282_000282_5634_6113 | 159 |
| 591 | 3300049822 | Ga0501035_0005503 | Ga0501035_0005503_10582_11175 | 159 |
| 592 | 3300049822 | Ga0501035_0692300 | Ga0501035_0692300_317_796 | 159 |
| 593 | 3300049822 | Ga0501035_0888428 | Ga0501035_0888428_106_585 | 159 |
| 594 | 3300049823 | Ga0501044_0006511 | Ga0501044_0006511_566_1159 | 159 |
| 595 | 3300049823 | Ga0501044_0059423 | Ga0501044_0059423_1049_1549 | 159 |
| 596 | 3300049853 | Ga0501226_000020 | Ga0501226_000020_134847_135326 | 159 |
| 597 | 3300050508 | nmdc:mga09592_222938_c1 | nmdc:mga09592_222938_c1_652_1131 | 159 |
| 598 | 3300050511 | nmdc:mga08y16_50996_c1 | nmdc:mga08y16_50996_c1_1256_1735 | 159 |
| 599 | 3300053087 | Ga0500643_000005 | Ga0500643_000005_315898_316377 | 159 |
| 600 | 3300053087 | Ga0500643_000139 | Ga0500643_000139_4685_5164 | 159 |
| 601 | 3300053087 | Ga0500643_002899 | Ga0500643_002899_6466_6945 | 159 |
| 602 | 3300053087 | Ga0500643_006988 | Ga0500643_006988_173_652 | 159 |
| 603 | 3300053087 | Ga0500643_045751 | Ga0500643_045751_255_734 | 159 |
| 604 | 3300053090 | Ga0500646_0126254 | Ga0500646_0126254_156_635 | 159 |
| 605 | 3300053094 | Ga0500566_0015418 | Ga0500566_0015418_3660_4139 | 159 |
| 606 | 3300053118 | Ga0500594_0148399 | Ga0500594_0148399_128_607 | 159 |
| 607 | 3300053122 | Ga0500608_017499 | Ga0500608_017499_2749_3234 | 159 |
| 608 | 3300053130 | Ga0500642_0000001 | Ga0500642_0000001_589143_589628 | 159 |
| 609 | 3300053136 | Ga0500559_0028545 | Ga0500559_0028545_1319_1798 | 159 |
| 610 | 3300053139 | Ga0500568_0000942 | Ga0500568_0000942_11865_12344 | 159 |
| 611 | 3300053139 | Ga0500568_0001466 | Ga0500568_0001466_2176_2658 | 159 |
| 612 | 3300053151 | Ga0500604_0000043 | Ga0500604_0000043_12070_12549 | 159 |
| 613 | 3300053153 | Ga0500616_0000293 | Ga0500616_0000293_39400_39879 | 159 |
| 614 | 3300053153 | Ga0500616_0017603 | Ga0500616_0017603_461_940 | 159 |
| 615 | 3300053157 | Ga0500624_000205 | Ga0500624_000205_11771_12250 | 159 |
| 616 | 3300059424 | Ga0590075_135422 | Ga0590075_135422_92_571 | 159 |
| 617 | 3300059426 | Ga0590077_100922 | Ga0590077_100922_28_507 | 159 |
| 618 | 3300059493 | Ga0587077_188167 | Ga0587077_188167_42_521 | 159 |
| 619 | 3300059504 | Ga0587082_136199 | Ga0587082_136199_40_519 | 159 |
| 620 | 3300059504 | Ga0587082_140545 | Ga0587082_140545_36_515 | 159 |
| 621 | 3300059507 | Ga0587086_028513 | Ga0587086_028513_285_764 | 159 |
| 622 | 3300059630 | Ga0587128_024646 | Ga0587128_024646_58_537 | 159 |
| 623 | 3300059645 | Ga0587076_077902 | Ga0587076_077902_87_566 | 159 |
| 624 | 3300059660 | Ga0587124_033839 | Ga0587124_033839_50_529 | 159 |
| 625 | 3300061719 | Ga0466962_0232925 | Ga0466962_0232925_74_553 | 159 |
| 626 | iso_pu_bacteria | 2895880812 | 2895881071 | 159 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7asn-assembly1.cif.gz_H | staphylococcus aureus 50s after 30 minutes incubation a 37c | 0.9437 | 14 | 147 |
| 7ood-assembly1.cif.gz_i | mycoplasma pneumoniae 50s subunit of ribosomes in chloramphenicol-treated cells | 0.9435 | 12 | 146 |
| 4ce4-assembly1.cif.gz_N | 39s large subunit of the porcine mitochondrial ribosome | 0.9419 | 17 | 146 |
| 6ppk-assembly1.cif.gz_J | rbga+45srbga complex | 0.9413 | 12 | 146 |
| 6ysi-assembly1.cif.gz_F | acinetobacter baumannii ribosome-tigecycline complex - 50s subunit | 0.94 | 8 | 147 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6SWN9_25_183_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9437 | 17 | 148 | 3.90.1180.10 |
| af_A0A0R0E7H3_25_163_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9424 | 17 | 148 | 3.90.1180.10 |
| 4dhcN00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9229 | 8 | 147 | 3.90.1180.10 |
| af_Q9VJ38_1_177_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9186 | 16 | 147 | 3.90.1180.10 |
| 4dhcN00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9104 | 8 | 147 | 3.90.1180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258RNK1-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9742 | 23 | 159 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A1Q7BZ54-F1-model_v4 | 50S ribosomal protein L13 | 0.9688 | 20 | 159 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A1Y2K1C2-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9686 | 11 | 147 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-C6XKJ9-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9669 | 8 | 159 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A1E5QAR2-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9664 | 8 | 159 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar