F470371
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 625 | 380 | 598 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10123178|Ga0265338_101231783 |
| Length | 111 |
| Sequence | MSLFGKQEAKKAEHIDLAPHYNVVLSPVITEKATNGSQYNQVTFRVHRQSTKPQIRMAIEALFNVKVTAVNTHNRMGKTKRVKGRKGFRQDVKFAIVTLKEGNTIDVTTGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 2 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 3 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 4 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 5 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 6 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 7 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 8 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 9 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 10 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 11 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 12 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 13 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 14 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 15 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 16 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 17 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 18 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 19 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 20 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 21 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 22 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 23 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 24 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 25 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 26 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 27 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 28 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 29 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 30 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 34 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 35 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 36 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 86 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 111 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 112 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 113 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 114 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 115 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 116 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 158 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 159 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 160 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 161 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 166 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 168 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 169 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 170 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 175 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 176 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 178 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 179 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 182 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 183 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 184 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 186 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 189 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 195 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 197 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 198 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 199 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 202 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 209 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 228 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 229 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 230 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 231 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 235 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 236 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 237 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 238 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 239 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 240 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 241 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 242 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 243 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 244 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 245 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 246 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 299 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 300 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 301 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 302 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 303 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 306 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 307 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 308 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 309 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 310 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 311 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 312 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 351 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 352 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 353 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 367 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 368 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 370 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 371 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 372 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 373 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 374 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 375 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 376 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.44 |
| Metatranscriptomes | 2.24 |
| Isolates | 4.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.56 |
| Nodule | 2.88 |
| Rhizoplane | 4 |
| Rhizosphere | 79.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10118782 | 3300003203 | Bacteria | 779 |
| 2 | JGI25160J50197_1015787 | 3300003354 | Bacteria | 2463 |
| 3 | Ga0055536_1023681 | 3300003781 | Bacteria | 1799 |
| 4 | Ga0055536_1024175 | 3300003781 | Bacteria | 1767 |
| 5 | Ga0055536_1091335 | 3300003781 | Bacteria | 559 |
| 6 | Ga0055530_10009419 | 3300003791 | Bacteria | 3754 |
| 7 | Ga0055530_10052734 | 3300003791 | Bacteria | 937 |
| 8 | Ga0055531_10024322 | 3300003794 | Bacteria | 2239 |
| 9 | Ga0055531_10024340 | 3300003794 | Bacteria | 2238 |
| 10 | Ga0058859_11684652 | 3300004798 | Bacteria | 773 |
| 11 | Ga0058861_11770653 | 3300004800 | Bacteria | 551 |
| 12 | Ga0058862_12365026 | 3300004803 | Bacteria | 614 |
| 13 | Ga0065165_1044790 | 3300005262 | Bacteria | 1292 |
| 14 | Ga0070683_100046388 | 3300005329 | Bacteria | 4014 |
| 15 | Ga0070683_101934320 | 3300005329 | Bacteria | 567 |
| 16 | Ga0070690_100226037 | 3300005330 | Bacteria | 1313 |
| 17 | Ga0068868_101436419 | 3300005338 | Bacteria | 644 |
| 18 | Ga0070660_101134532 | 3300005339 | Bacteria | 662 |
| 19 | Ga0070661_100593494 | 3300005344 | Bacteria | 895 |
| 20 | Ga0070661_101916657 | 3300005344 | Bacteria | 504 |
| 21 | Ga0070675_100564595 | 3300005354 | Bacteria | 1030 |
| 22 | Ga0070673_101097538 | 3300005364 | Bacteria | 743 |
| 23 | Ga0070659_100018511 | 3300005366 | Bacteria | 5255 |
| 24 | Ga0070667_100479068 | 3300005367 | Bacteria | 1139 |
| 25 | Ga0070713_100051698 | 3300005436 | Bacteria | 3399 |
| 26 | Ga0070710_10052773 | 3300005437 | Bacteria | 2287 |
| 27 | Ga0070710_10220853 | 3300005437 | Bacteria | 1206 |
| 28 | Ga0070711_100027798 | 3300005439 | Bacteria | 3716 |
| 29 | Ga0070694_100286379 | 3300005444 | Bacteria | 1258 |
| 30 | Ga0070694_101529228 | 3300005444 | Bacteria | 565 |
| 31 | Ga0070663_100467597 | 3300005455 | Bacteria | 1042 |
| 32 | Ga0070678_100515496 | 3300005456 | Bacteria | 1057 |
| 33 | Ga0070662_100616111 | 3300005457 | Bacteria | 914 |
| 34 | Ga0070685_11444064 | 3300005466 | Bacteria | 529 |
| 35 | Ga0070707_100478908 | 3300005468 | Bacteria | 1206 |
| 36 | Ga0070699_100135661 | 3300005518 | Bacteria | 2171 |
| 37 | Ga0070697_100008562 | 3300005536 | Bacteria | 7989 |
| 38 | Ga0068853_100399888 | 3300005539 | Bacteria | 1285 |
| 39 | Ga0068853_102022781 | 3300005539 | Bacteria | 559 |
| 40 | Ga0070695_101436464 | 3300005545 | Bacteria | 573 |
| 41 | Ga0070665_102388972 | 3300005548 | Bacteria | 531 |
| 42 | Ga0070664_100036245 | 3300005564 | Bacteria | 4144 |
| 43 | Ga0070702_101202788 | 3300005615 | Bacteria | 611 |
| 44 | Ga0068866_10391805 | 3300005718 | Bacteria | 894 |
| 45 | Ga0068866_11007875 | 3300005718 | Bacteria | 592 |
| 46 | Ga0068863_101241058 | 3300005841 | Bacteria | 752 |
| 47 | Ga0068858_101304821 | 3300005842 | Bacteria | 714 |
| 48 | Ga0068860_100751746 | 3300005843 | Bacteria | 987 |
| 49 | Ga0068860_102048812 | 3300005843 | Bacteria | 594 |
| 50 | Ga0068862_102024259 | 3300005844 | Bacteria | 587 |
| 51 | Ga0081455_10017756 | 3300005937 | Bacteria | 6806 |
| 52 | Ga0081538_10159181 | 3300005981 | Bacteria | 1007 |
| 53 | Ga0081540_1058910 | 3300005983 | Bacteria | 1847 |
| 54 | Ga0081539_10054324 | 3300005985 | Bacteria | 2237 |
| 55 | Ga0070717_10162531 | 3300006028 | Bacteria | 1938 |
| 56 | Ga0070717_10362285 | 3300006028 | Bacteria | 1298 |
| 57 | Ga0075365_10292346 | 3300006038 | Bacteria | 1146 |
| 58 | Ga0075365_10913982 | 3300006038 | Bacteria | 619 |
| 59 | Ga0070712_100037138 | 3300006175 | Bacteria | 3319 |
| 60 | Ga0070712_101602211 | 3300006175 | Bacteria | 569 |
| 61 | Ga0075369_10163231 | 3300006186 | Bacteria | 1021 |
| 62 | Ga0075369_10381955 | 3300006186 | Bacteria | 663 |
| 63 | Ga0075366_10828867 | 3300006195 | Bacteria | 576 |
| 64 | Ga0097621_100320313 | 3300006237 | Bacteria | 1373 |
| 65 | Ga0075370_10183910 | 3300006353 | Bacteria | 1230 |
| 66 | Ga0068871_100758913 | 3300006358 | Bacteria | 892 |
| 67 | Ga0068871_101241073 | 3300006358 | Bacteria | 700 |
| 68 | Ga0068871_102148488 | 3300006358 | Bacteria | 532 |
| 69 | Ga0075428_100048564 | 3300006844 | Bacteria | 4657 |
| 70 | Ga0075428_100665538 | 3300006844 | Bacteria | 1110 |
| 71 | Ga0075430_100078655 | 3300006846 | Bacteria | 2764 |
| 72 | Ga0075430_100816232 | 3300006846 | Bacteria | 768 |
| 73 | Ga0075431_100610933 | 3300006847 | Bacteria | 1073 |
| 74 | Ga0075433_10461696 | 3300006852 | Bacteria | 1119 |
| 75 | Ga0075429_100421797 | 3300006880 | Bacteria | 1169 |
| 76 | Ga0075429_100812466 | 3300006880 | Bacteria | 819 |
| 77 | Ga0068865_100539559 | 3300006881 | Bacteria | 978 |
| 78 | Ga0068865_101207197 | 3300006881 | Bacteria | 670 |
| 79 | Ga0099825_1058931 | 3300006941 | Bacteria | 683 |
| 80 | Ga0099795_10085530 | 3300007788 | Bacteria | 1214 |
| 81 | Ga0105240_11919212 | 3300009093 | Bacteria | 616 |
| 82 | Ga0111539_10105552 | 3300009094 | Bacteria | 3305 |
| 83 | Ga0111539_10146569 | 3300009094 | Bacteria | 2764 |
| 84 | Ga0105247_10646913 | 3300009101 | Bacteria | 789 |
| 85 | Ga0114129_10347685 | 3300009147 | Bacteria | 1965 |
| 86 | Ga0114129_13141115 | 3300009147 | Bacteria | 539 |
| 87 | Ga0105243_11798327 | 3300009148 | Bacteria | 644 |
| 88 | Ga0105243_11913280 | 3300009148 | Bacteria | 626 |
| 89 | Ga0105241_10826564 | 3300009174 | Bacteria | 855 |
| 90 | Ga0105248_10731539 | 3300009177 | Bacteria | 1116 |
| 91 | Ga0105248_10955830 | 3300009177 | Bacteria | 968 |
| 92 | Ga0105237_10533898 | 3300009545 | Bacteria | 1180 |
| 93 | Ga0105238_10877479 | 3300009551 | Bacteria | 915 |
| 94 | Ga0105249_11168554 | 3300009553 | Bacteria | 840 |
| 95 | Ga0099796_10081278 | 3300010159 | Bacteria | 1189 |
| 96 | Ga0105239_10585271 | 3300010375 | Bacteria | 1272 |
| 97 | Ga0157317_1007058 | 3300012475 | Bacteria | 798 |
| 98 | Ga0157373_10213046 | 3300013100 | Bacteria | 1362 |
| 99 | Ga0157373_10214208 | 3300013100 | Bacteria | 1358 |
| 100 | Ga0157370_11276082 | 3300013104 | Bacteria | 662 |
| 101 | Ga0163162_12455721 | 3300013306 | Bacteria | 599 |
| 102 | Ga0163162_12620359 | 3300013306 | Bacteria | 580 |
| 103 | Ga0157375_12854714 | 3300013308 | Bacteria | 577 |
| 104 | Ga0163163_10186186 | 3300014325 | Bacteria | 2124 |
| 105 | Ga0163163_10639346 | 3300014325 | Bacteria | 1127 |
| 106 | Ga0163163_11936755 | 3300014325 | Bacteria | 649 |
| 107 | Ga0157380_10192942 | 3300014326 | Bacteria | 1800 |
| 108 | Ga0157377_10312618 | 3300014745 | Bacteria | 1041 |
| 109 | Ga0163161_10506257 | 3300017792 | Bacteria | 984 |
| 110 | Ga0163161_11457255 | 3300017792 | Bacteria | 600 |
| 111 | Ga0184598_102540 | 3300019182 | Bacteria | 534 |
| 112 | Ga0206356_11866436 | 3300020070 | Bacteria | 617 |
| 113 | Ga0214544_1000006 | 3300021320 | Bacteria | 380728 |
| 114 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 115 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 116 | Ga0214543_1000017 | 3300021327 | Bacteria | 290109 |
| 117 | Ga0213876_10159791 | 3300021384 | Bacteria | 1199 |
| 118 | Ga0213876_10568084 | 3300021384 | Bacteria | 603 |
| 119 | Ga0213871_10041410 | 3300021441 | Bacteria | 1238 |
| 120 | Ga0209675_1000104 | 3300025291 | Bacteria | 121249 |
| 121 | Ga0209676_1004257 | 3300025292 | Bacteria | 8077 |
| 122 | Ga0209676_1027868 | 3300025292 | Bacteria | 1770 |
| 123 | Ga0209025_1036659 | 3300025294 | Bacteria | 2191 |
| 124 | Ga0209758_1053903 | 3300025297 | Bacteria | 1378 |
| 125 | Ga0209758_1143284 | 3300025297 | Bacteria | 616 |
| 126 | Ga0209050_1012904 | 3300025298 | Bacteria | 3779 |
| 127 | Ga0209050_1038106 | 3300025298 | Bacteria | 1376 |
| 128 | Ga0207426_1012954 | 3300025302 | Bacteria | 3111 |
| 129 | Ga0209257_1006356 | 3300025304 | Bacteria | 7669 |
| 130 | Ga0209257_1021998 | 3300025304 | Bacteria | 2291 |
| 131 | Ga0207692_10223839 | 3300025898 | Bacteria | 1116 |
| 132 | Ga0207692_10523415 | 3300025898 | Bacteria | 755 |
| 133 | Ga0207642_10424902 | 3300025899 | Bacteria | 800 |
| 134 | Ga0207710_10029828 | 3300025900 | Bacteria | 2376 |
| 135 | Ga0207688_10423533 | 3300025901 | Bacteria | 827 |
| 136 | Ga0207699_10359866 | 3300025906 | Bacteria | 1029 |
| 137 | Ga0207699_10529140 | 3300025906 | Bacteria | 853 |
| 138 | Ga0207654_10477711 | 3300025911 | Bacteria | 877 |
| 139 | Ga0207707_10146707 | 3300025912 | Bacteria | 2063 |
| 140 | Ga0207671_10318504 | 3300025914 | Bacteria | 1231 |
| 141 | Ga0207693_10085957 | 3300025915 | Bacteria | 2464 |
| 142 | Ga0207693_10200166 | 3300025915 | Bacteria | 1571 |
| 143 | Ga0207693_11085378 | 3300025915 | Bacteria | 608 |
| 144 | Ga0207693_11141061 | 3300025915 | Bacteria | 590 |
| 145 | Ga0207663_10214435 | 3300025916 | Bacteria | 1397 |
| 146 | Ga0207652_10727643 | 3300025921 | Unclassified | 884 |
| 147 | Ga0207652_11232291 | 3300025921 | Bacteria | 650 |
| 148 | Ga0207694_10591075 | 3300025924 | Bacteria | 933 |
| 149 | Ga0207650_10557869 | 3300025925 | Bacteria | 961 |
| 150 | Ga0207659_10882526 | 3300025926 | Bacteria | 769 |
| 151 | Ga0207700_10053321 | 3300025928 | Bacteria | 3029 |
| 152 | Ga0207700_10303832 | 3300025928 | Bacteria | 1379 |
| 153 | Ga0207700_11617775 | 3300025928 | Bacteria | 573 |
| 154 | Ga0207664_10915155 | 3300025929 | Bacteria | 787 |
| 155 | Ga0207664_11845639 | 3300025929 | Bacteria | 527 |
| 156 | Ga0207690_10175415 | 3300025932 | Bacteria | 1609 |
| 157 | Ga0207706_10335759 | 3300025933 | Bacteria | 1315 |
| 158 | Ga0207686_11786121 | 3300025934 | Bacteria | 509 |
| 159 | Ga0207709_10442975 | 3300025935 | Bacteria | 1002 |
| 160 | Ga0207669_10710593 | 3300025937 | Bacteria | 827 |
| 161 | Ga0207669_11463202 | 3300025937 | Bacteria | 582 |
| 162 | Ga0207704_10273867 | 3300025938 | Bacteria | 1279 |
| 163 | Ga0207665_10601169 | 3300025939 | Bacteria | 859 |
| 164 | Ga0207711_10528708 | 3300025941 | Bacteria | 1100 |
| 165 | Ga0207661_12009544 | 3300025944 | Bacteria | 524 |
| 166 | Ga0207679_10065715 | 3300025945 | Bacteria | 2716 |
| 167 | Ga0207651_10427475 | 3300025960 | Bacteria | 1132 |
| 168 | Ga0207712_10386287 | 3300025961 | Bacteria | 1173 |
| 169 | Ga0207639_10053240 | 3300026041 | Bacteria | 3087 |
| 170 | Ga0207639_10807664 | 3300026041 | Bacteria | 874 |
| 171 | Ga0207678_10313479 | 3300026067 | Bacteria | 1349 |
| 172 | Ga0207641_11674369 | 3300026088 | Unclassified | 638 |
| 173 | Ga0207648_10565264 | 3300026089 | Bacteria | 1046 |
| 174 | Ga0207675_100633306 | 3300026118 | Bacteria | 1074 |
| 175 | Ga0207683_11155753 | 3300026121 | Bacteria | 718 |
| 176 | Ga0209389_1002002 | 3300027296 | Bacteria | 15108 |
| 177 | Ga0209589_1000300 | 3300027357 | Bacteria | 63625 |
| 178 | Ga0209489_100010 | 3300027361 | Bacteria | 252139 |
| 179 | Ga0209489_116934 | 3300027361 | Bacteria | 3599 |
| 180 | Ga0209700_100031 | 3300027363 | Bacteria | 207349 |
| 181 | Ga0209974_10029965 | 3300027876 | Bacteria | 1803 |
| 182 | Ga0207428_10164487 | 3300027907 | Bacteria | 1683 |
| 183 | Ga0268266_11386884 | 3300028379 | Bacteria | 678 |
| 184 | Ga0268266_12228493 | 3300028379 | Bacteria | 520 |
| 185 | Ga0265337_1002429 | 3300028556 | Bacteria | 8569 |
| 186 | Ga0265326_10039873 | 3300028558 | Bacteria | 1333 |
| 187 | Ga0265319_1001825 | 3300028563 | Bacteria | 12143 |
| 188 | Ga0265334_10000469 | 3300028573 | Bacteria | 20809 |
| 189 | Ga0265318_10040136 | 3300028577 | Bacteria | 1783 |
| 190 | Ga0265323_10001237 | 3300028653 | Bacteria | 12839 |
| 191 | Ga0265322_10008354 | 3300028654 | Bacteria | 3017 |
| 192 | Ga0265336_10000535 | 3300028666 | Bacteria | 21804 |
| 193 | Ga0265338_10000131 | 3300028800 | Bacteria | 137627 |
| 194 | Ga0265338_10033513 | 3300028800 | Bacteria | 4981 |
| 195 | Ga0265338_10065290 | 3300028800 | Bacteria | 3158 |
| 196 | Ga0265338_10123178 | 3300028800 | Bacteria | 2062 |
| 197 | Ga0265338_10162190 | 3300028800 | Bacteria | 1725 |
| 198 | Ga0265338_10426269 | 3300028800 | Bacteria | 942 |
| 199 | Ga0265338_10884516 | 3300028800 | Bacteria | 609 |
| 200 | Ga0265324_10001269 | 3300029957 | Bacteria | 14862 |
| 201 | Ga0314311_1091187 | 3300030733 | Bacteria | 759 |
| 202 | Ga0316181_1093387 | 3300030744 | Bacteria | 1010 |
| 203 | Ga0265763_1023796 | 3300030763 | Unclassified | 660 |
| 204 | Ga0265328_10055566 | 3300031239 | Bacteria | 1453 |
| 205 | Ga0265325_10001071 | 3300031241 | Bacteria | 19727 |
| 206 | Ga0265325_10136758 | 3300031241 | Bacteria | 1168 |
| 207 | Ga0265339_10000053 | 3300031249 | Bacteria | 101277 |
| 208 | Ga0265339_10200458 | 3300031249 | Bacteria | 985 |
| 209 | Ga0265331_10002092 | 3300031250 | Bacteria | 13775 |
| 210 | Ga0265331_10073351 | 3300031250 | Bacteria | 1598 |
| 211 | Ga0307513_10333316 | 3300031456 | Bacteria | 1271 |
| 212 | Ga0307513_11059987 | 3300031456 | Bacteria | 522 |
| 213 | Ga0307509_10387826 | 3300031507 | Bacteria | 1108 |
| 214 | Ga0307408_100445374 | 3300031548 | Bacteria | 1122 |
| 215 | Ga0307408_101349918 | 3300031548 | Bacteria | 670 |
| 216 | Ga0265313_10000098 | 3300031595 | Bacteria | 89130 |
| 217 | Ga0265313_10006263 | 3300031595 | Bacteria | 8479 |
| 218 | Ga0316575_10088184 | 3300031665 | Bacteria | 1255 |
| 219 | Ga0265314_10018555 | 3300031711 | Bacteria | 5422 |
| 220 | Ga0265342_10574296 | 3300031712 | Bacteria | 570 |
| 221 | Ga0307407_11273433 | 3300031903 | Bacteria | 576 |
| 222 | Ga0307412_11420581 | 3300031911 | Bacteria | 628 |
| 223 | Ga0307409_100947105 | 3300031995 | Bacteria | 877 |
| 224 | Ga0307409_101583311 | 3300031995 | Bacteria | 683 |
| 225 | Ga0307416_100482412 | 3300032002 | Bacteria | 1300 |
| 226 | Ga0307416_103404498 | 3300032002 | Bacteria | 532 |
| 227 | Ga0307414_10012056 | 3300032004 | Bacteria | 5098 |
| 228 | Ga0307414_10107832 | 3300032004 | Bacteria | 2111 |
| 229 | Ga0307411_10046512 | 3300032005 | Bacteria | 2798 |
| 230 | Ga0307411_10706699 | 3300032005 | Bacteria | 879 |
| 231 | Ga0307411_10829394 | 3300032005 | Bacteria | 816 |
| 232 | Ga0316583_10003862 | 3300032133 | Bacteria | 5316 |
| 233 | Ga0316583_10041645 | 3300032133 | Bacteria | 1625 |
| 234 | Ga0316593_10033258 | 3300032168 | Bacteria | 1687 |
| 235 | Ga0316593_10417561 | 3300032168 | Bacteria | 520 |
| 236 | Ga0307510_10263101 | 3300033180 | Bacteria | 1205 |
| 237 | Ga0373930_0040694 | 3300034816 | Bacteria | 989 |
| 238 | Ga0373930_0097218 | 3300034816 | Bacteria | 697 |
| 239 | Ga0373928_0060312 | 3300035084 | Bacteria | 916 |
| 240 | Ga0373940_0014901 | 3300035088 | Bacteria | 1904 |
| 241 | Ga0373951_0013840 | 3300035091 | Bacteria | 1814 |
| 242 | Ga0373952_0171613 | 3300035092 | Bacteria | 620 |
| 243 | Ga0373923_0005324 | 3300035111 | Bacteria | 4366 |
| 244 | Ga0373923_0031770 | 3300035111 | Bacteria | 2130 |
| 245 | Ga0373941_0029005 | 3300035115 | Bacteria | 1629 |
| 246 | Ga0373941_0060667 | 3300035115 | Bacteria | 1230 |
| 247 | Ga0373945_0322626 | 3300035116 | Bacteria | 665 |
| 248 | Ga0373953_0017061 | 3300035117 | Bacteria | 2662 |
| 249 | Ga0373953_0100833 | 3300035117 | Bacteria | 1215 |
| 250 | Ga0373954_0421854 | 3300035118 | Bacteria | 660 |
| 251 | Ga0373954_0467305 | 3300035118 | Bacteria | 625 |
| 252 | Ga0373956_0291928 | 3300035119 | Bacteria | 776 |
| 253 | Ga0373957_0051619 | 3300035120 | Bacteria | 1573 |
| 254 | Ga0373960_0004525 | 3300035121 | Bacteria | 3192 |
| 255 | Ga0373946_0205547 | 3300035171 | Bacteria | 945 |
| 256 | Ga0373946_0205850 | 3300035171 | Bacteria | 944 |
| 257 | Ga0373961_0436798 | 3300035241 | Bacteria | 508 |
| 258 | Ga0373924_0015063 | 3300035410 | Bacteria | 2932 |
| 259 | Ga0373924_0047473 | 3300035410 | Bacteria | 1771 |
| 260 | Ga0373931_0028558 | 3300035691 | Bacteria | 2857 |
| 261 | Ga0373935_0023907 | 3300035692 | Bacteria | 3755 |
| 262 | Ga0373927_0008214 | 3300035695 | Bacteria | 7031 |
| 263 | Ga0373927_0029560 | 3300035695 | Bacteria | 3572 |
| 264 | Ga0373933_0001245 | 3300035724 | Bacteria | 15041 |
| 265 | Ga0373933_0413541 | 3300035724 | Bacteria | 880 |
| 266 | Ga0373933_0555914 | 3300035724 | Bacteria | 753 |
| 267 | Ga0373947_0034962 | 3300035725 | Bacteria | 2974 |
| 268 | Ga0373947_0927229 | 3300035725 | Bacteria | 594 |
| 269 | Ga0373937_0001081 | 3300036401 | Bacteria | 22992 |
| 270 | Ga0373937_0126066 | 3300036401 | Bacteria | 2388 |
| 271 | Ga0373925_0032780 | 3300037068 | Bacteria | 3825 |
| 272 | Ga0373925_0066308 | 3300037068 | Bacteria | 2721 |
| 273 | Ga0395899_0124704 | 3300037312 | Bacteria | 1842 |
| 274 | Ga0395900_0022503 | 3300037418 | Bacteria | 6447 |
| 275 | Ga0395898_0371206 | 3300037466 | Bacteria | 1364 |
| 276 | Ga0395905_0413453 | 3300037471 | Bacteria | 1244 |
| 277 | Ga0395905_1057099 | 3300037471 | Bacteria | 715 |
| 278 | Ga0436364_0539527 | 3300037853 | Bacteria | 2120 |
| 279 | Ga0436364_0563378 | 3300037853 | Bacteria | 671 |
| 280 | Ga0395901_0045720 | 3300038443 | Bacteria | 4545 |
| 281 | Ga0395901_1927766 | 3300038443 | Bacteria | 538 |
| 282 | Ga0436365_0614193 | 3300039437 | Bacteria | 1043 |
| 283 | Ga0436365_1046860 | 3300039437 | Bacteria | 692 |
| 284 | Ga0436365_1245822 | 3300039437 | Bacteria | 2312 |
| 285 | Ga0436365_1445192 | 3300039437 | Bacteria | 788 |
| 286 | Ga0436365_1605872 | 3300039437 | Bacteria | 2574 |
| 287 | Ga0436365_1608629 | 3300039437 | Bacteria | 1009 |
| 288 | Ga0436365_1935336 | 3300039437 | Bacteria | 1255 |
| 289 | Ga0436360_1351765 | 3300039438 | Bacteria | 819 |
| 290 | Ga0436361_0551964 | 3300039447 | Bacteria | 1481 |
| 291 | Ga0436361_0659925 | 3300039447 | Bacteria | 2225 |
| 292 | Ga0436363_0233082 | 3300039450 | Bacteria | 651 |
| 293 | Ga0436363_1069942 | 3300039450 | Bacteria | 938 |
| 294 | Ga0436363_1174974 | 3300039450 | Bacteria | 1518 |
| 295 | Ga0436362_0221915 | 3300039453 | Bacteria | 981 |
| 296 | Ga0451791_0684621 | 3300041451 | Bacteria | 902 |
| 297 | Ga0451797_0774619 | 3300041453 | Bacteria | 543 |
| 298 | Ga0451807_0919669 | 3300041486 | Bacteria | 831 |
| 299 | Ga0451807_1734530 | 3300041486 | Bacteria | 1199 |
| 300 | Ga0451833_0197010 | 3300041491 | Bacteria | 847 |
| 301 | Ga0451841_0062055 | 3300041498 | Bacteria | 976 |
| 302 | Ga0451843_0375183 | 3300041509 | Bacteria | 1129 |
| 303 | Ga0451853_3743631 | 3300041512 | Bacteria | 501 |
| 304 | Ga0439445_0252529 | 3300042004 | Bacteria | 527 |
| 305 | Ga0466972_0019604 | 3300044658 | Bacteria | 3381 |
| 306 | Ga0466972_0088328 | 3300044658 | Bacteria | 1471 |
| 307 | Ga0466965_0752777 | 3300044683 | Bacteria | 561 |
| 308 | Ga0466971_0579684 | 3300044719 | Bacteria | 558 |
| 309 | Ga0466968_0300698 | 3300044735 | Bacteria | 771 |
| 310 | Ga0466960_0660720 | 3300044901 | Bacteria | 624 |
| 311 | Ga0466959_0327013 | 3300045049 | Bacteria | 1047 |
| 312 | Ga0466967_0178939 | 3300045976 | Bacteria | 1999 |
| 313 | Ga0495592_0002995 | 3300046454 | Bacteria | 12028 |
| 314 | Ga0495592_0116414 | 3300046454 | Bacteria | 1886 |
| 315 | Ga0495590_0018187 | 3300046457 | Bacteria | 2519 |
| 316 | Ga0495629_0003398 | 3300046459 | Bacteria | 12038 |
| 317 | Ga0495629_0151603 | 3300046459 | Bacteria | 1611 |
| 318 | Ga0495641_0140173 | 3300046461 | Bacteria | 1080 |
| 319 | Ga0495651_0010780 | 3300046462 | Bacteria | 7027 |
| 320 | Ga0495651_0175282 | 3300046462 | Bacteria | 1523 |
| 321 | Ga0495653_0000370 | 3300046463 | Bacteria | 36284 |
| 322 | Ga0495653_0061061 | 3300046463 | Bacteria | 2853 |
| 323 | Ga0495653_0063779 | 3300046463 | Bacteria | 2779 |
| 324 | Ga0495639_0619637 | 3300046475 | Bacteria | 557 |
| 325 | Ga0495639_0741729 | 3300046475 | Bacteria | 508 |
| 326 | Ga0495662_0204999 | 3300046476 | Bacteria | 972 |
| 327 | Ga0495664_0060532 | 3300046477 | Bacteria | 2254 |
| 328 | Ga0495664_0104730 | 3300046477 | Bacteria | 1705 |
| 329 | Ga0495664_0515831 | 3300046477 | Bacteria | 713 |
| 330 | Ga0495594_0155889 | 3300046499 | Bacteria | 1297 |
| 331 | Ga0495596_0178998 | 3300046500 | Bacteria | 824 |
| 332 | Ga0495596_0332349 | 3300046500 | Bacteria | 591 |
| 333 | Ga0495608_0014254 | 3300046511 | Bacteria | 5515 |
| 334 | Ga0495608_0071471 | 3300046511 | Bacteria | 2264 |
| 335 | Ga0495608_0491643 | 3300046511 | Bacteria | 744 |
| 336 | Ga0495618_0012751 | 3300046514 | Bacteria | 5109 |
| 337 | Ga0495618_0590176 | 3300046514 | Bacteria | 662 |
| 338 | Ga0495620_0080340 | 3300046515 | Bacteria | 1320 |
| 339 | Ga0495628_0003568 | 3300046516 | Bacteria | 13931 |
| 340 | Ga0495628_0005831 | 3300046516 | Bacteria | 10790 |
| 341 | Ga0495630_1227919 | 3300046517 | Bacteria | 566 |
| 342 | Ga0495643_0024522 | 3300046522 | Bacteria | 3420 |
| 343 | Ga0495663_0066915 | 3300046525 | Bacteria | 1138 |
| 344 | Ga0495642_0200367 | 3300046528 | Bacteria | 870 |
| 345 | Ga0495652_0090680 | 3300046529 | Bacteria | 2500 |
| 346 | Ga0495652_0394656 | 3300046529 | Bacteria | 981 |
| 347 | Ga0495654_0062673 | 3300046530 | Bacteria | 1782 |
| 348 | Ga0495665_0072108 | 3300046531 | Bacteria | 1819 |
| 349 | Ga0495665_0127749 | 3300046531 | Bacteria | 1331 |
| 350 | Ga0495640_0000769 | 3300046533 | Bacteria | 24154 |
| 351 | Ga0495640_0099168 | 3300046533 | Bacteria | 1914 |
| 352 | Ga0495640_0199344 | 3300046533 | Bacteria | 1269 |
| 353 | Ga0495586_0305532 | 3300046535 | Bacteria | 912 |
| 354 | Ga0495586_0565733 | 3300046535 | Bacteria | 656 |
| 355 | Ga0495587_0001869 | 3300046536 | Bacteria | 14016 |
| 356 | Ga0495587_0643958 | 3300046536 | Bacteria | 582 |
| 357 | Ga0495645_0050307 | 3300046543 | Bacteria | 3034 |
| 358 | Ga0495645_0317334 | 3300046543 | Bacteria | 1013 |
| 359 | Ga0495645_0389262 | 3300046543 | Bacteria | 890 |
| 360 | Ga0495667_0001942 | 3300046559 | Bacteria | 13669 |
| 361 | Ga0495667_0115907 | 3300046559 | Bacteria | 1731 |
| 362 | Ga0495668_0000015 | 3300046616 | Bacteria | 441932 |
| 363 | Ga0495634_0002200 | 3300046642 | Bacteria | 16376 |
| 364 | Ga0495625_0004430 | 3300046660 | Bacteria | 13282 |
| 365 | Ga0495635_0004328 | 3300046663 | Bacteria | 9835 |
| 366 | Ga0495635_0008888 | 3300046663 | Bacteria | 7012 |
| 367 | Ga0495635_0532097 | 3300046663 | Bacteria | 772 |
| 368 | Ga0495657_0015052 | 3300046675 | Bacteria | 5670 |
| 369 | Ga0495657_0096649 | 3300046675 | Bacteria | 1887 |
| 370 | Ga0495599_0054944 | 3300046678 | Bacteria | 2494 |
| 371 | Ga0495599_0067022 | 3300046678 | Bacteria | 2242 |
| 372 | Ga0495623_0003723 | 3300046679 | Bacteria | 10054 |
| 373 | Ga0495623_0040141 | 3300046679 | Bacteria | 2989 |
| 374 | Ga0495646_0022938 | 3300046680 | Bacteria | 3932 |
| 375 | Ga0495646_0091953 | 3300046680 | Bacteria | 1750 |
| 376 | Ga0495646_0171244 | 3300046680 | Bacteria | 1196 |
| 377 | Ga0495658_0015745 | 3300046683 | Bacteria | 3883 |
| 378 | Ga0495658_0086177 | 3300046683 | Bacteria | 1852 |
| 379 | Ga0495624_0354859 | 3300046690 | Bacteria | 882 |
| 380 | Ga0495671_0348952 | 3300046692 | Bacteria | 710 |
| 381 | Ga0495600_0000422 | 3300046809 | Bacteria | 21824 |
| 382 | Ga0495600_0152028 | 3300046809 | Bacteria | 1498 |
| 383 | Ga0495581_0228187 | 3300047315 | Bacteria | 1089 |
| 384 | Ga0495604_0000406 | 3300047317 | Bacteria | 38847 |
| 385 | Ga0495604_0053710 | 3300047317 | Bacteria | 3112 |
| 386 | Ga0495604_0083692 | 3300047317 | Bacteria | 2383 |
| 387 | Ga0495674_0000757 | 3300047319 | Bacteria | 30677 |
| 388 | Ga0495674_0360804 | 3300047319 | Bacteria | 1178 |
| 389 | Ga0495674_0375532 | 3300047319 | Bacteria | 1151 |
| 390 | Ga0495674_0487973 | 3300047319 | Bacteria | 987 |
| 391 | Ga0495672_0191493 | 3300047320 | Bacteria | 1028 |
| 392 | Ga0495676_0030911 | 3300047321 | Bacteria | 4536 |
| 393 | Ga0495680_0001477 | 3300047322 | Bacteria | 25369 |
| 394 | Ga0495680_0058793 | 3300047322 | Bacteria | 2969 |
| 395 | Ga0495680_0068123 | 3300047322 | Bacteria | 2720 |
| 396 | Ga0495675_0062506 | 3300047444 | Bacteria | 2357 |
| 397 | Ga0495675_0426758 | 3300047444 | Bacteria | 770 |
| 398 | Ga0495684_0008747 | 3300047471 | Bacteria | 7832 |
| 399 | Ga0495684_0165279 | 3300047471 | Bacteria | 1649 |
| 400 | Ga0495686_0280624 | 3300047472 | Bacteria | 926 |
| 401 | Ga0495602_0064112 | 3300048088 | Bacteria | 3179 |
| 402 | Ga0495602_0231319 | 3300048088 | Bacteria | 1388 |
| 403 | Ga0495602_0481283 | 3300048088 | Bacteria | 871 |
| 404 | Ga0495626_0094952 | 3300048091 | Bacteria | 1307 |
| 405 | Ga0496100_1466706 | 3300048903 | Bacteria | 539 |
| 406 | Ga0496101_0125826 | 3300048904 | Bacteria | 1942 |
| 407 | Ga0496102_0188965 | 3300048905 | Bacteria | 1941 |
| 408 | Ga0496102_0459565 | 3300048905 | Bacteria | 1194 |
| 409 | Ga0496104_0000399 | 3300048907 | Bacteria | 38066 |
| 410 | Ga0496104_0521147 | 3300048907 | Bacteria | 1100 |
| 411 | Ga0496104_0523266 | 3300048907 | Bacteria | 1097 |
| 412 | Ga0496105_0002417 | 3300048908 | Bacteria | 13529 |
| 413 | Ga0496105_0098094 | 3300048908 | Bacteria | 2420 |
| 414 | Ga0496106_0042430 | 3300048909 | Bacteria | 3412 |
| 415 | Ga0496107_0118946 | 3300048910 | Bacteria | 1945 |
| 416 | Ga0496107_0337157 | 3300048910 | Bacteria | 1122 |
| 417 | Ga0496108_1155255 | 3300048911 | Bacteria | 656 |
| 418 | Ga0496108_1770880 | 3300048911 | Bacteria | 506 |
| 419 | Ga0496109_0226409 | 3300048912 | Bacteria | 1759 |
| 420 | Ga0496109_0962903 | 3300048912 | Bacteria | 791 |
| 421 | Ga0496110_0457281 | 3300048913 | Bacteria | 1163 |
| 422 | Ga0496110_1202111 | 3300048913 | Bacteria | 667 |
| 423 | Ga0496112_0699138 | 3300048915 | Bacteria | 942 |
| 424 | Ga0496115_0047461 | 3300048918 | Bacteria | 3435 |
| 425 | Ga0496115_0076081 | 3300048918 | Bacteria | 2728 |
| 426 | Ga0496118_0227250 | 3300048921 | Bacteria | 1080 |
| 427 | Ga0496124_0238928 | 3300048927 | Bacteria | 1352 |
| 428 | Ga0496124_0991349 | 3300048927 | Bacteria | 501 |
| 429 | Ga0496125_0023890 | 3300048928 | Bacteria | 5632 |
| 430 | Ga0496126_0396598 | 3300048929 | Bacteria | 1120 |
| 431 | Ga0501306_023495 | 3300049127 | Bacteria | 876 |
| 432 | Ga0495678_118787 | 3300049459 | Bacteria | 891 |
| 433 | Ga0501312_057425 | 3300049528 | Bacteria | 668 |
| 434 | Ga0501320_036040 | 3300049536 | Bacteria | 633 |
| 435 | Ga0501322_018236 | 3300049538 | Bacteria | 600 |
| 436 | Ga0501031_0335074 | 3300049568 | Bacteria | 979 |
| 437 | Ga0501031_0956069 | 3300049568 | Bacteria | 548 |
| 438 | Ga0501032_0045571 | 3300049569 | Bacteria | 2965 |
| 439 | Ga0501032_0058423 | 3300049569 | Bacteria | 2589 |
| 440 | Ga0501032_0474181 | 3300049569 | Bacteria | 801 |
| 441 | Ga0501033_0107086 | 3300049570 | Bacteria | 2036 |
| 442 | Ga0501033_0328006 | 3300049570 | Bacteria | 1074 |
| 443 | Ga0501033_1165786 | 3300049570 | Bacteria | 511 |
| 444 | Ga0501034_0090345 | 3300049571 | Bacteria | 3060 |
| 445 | Ga0501034_0132600 | 3300049571 | Bacteria | 2474 |
| 446 | Ga0501034_0134254 | 3300049571 | Bacteria | 2456 |
| 447 | Ga0501034_0212658 | 3300049571 | Bacteria | 1888 |
| 448 | Ga0501034_0623346 | 3300049571 | Bacteria | 982 |
| 449 | Ga0501034_1540172 | 3300049571 | Bacteria | 538 |
| 450 | Ga0501036_0189285 | 3300049572 | Bacteria | 1732 |
| 451 | Ga0501036_0268203 | 3300049572 | Bacteria | 1429 |
| 452 | Ga0501036_0270240 | 3300049572 | Bacteria | 1423 |
| 453 | Ga0501036_0312106 | 3300049572 | Bacteria | 1314 |
| 454 | Ga0501036_0528883 | 3300049572 | Bacteria | 980 |
| 455 | Ga0501037_0118828 | 3300049573 | Bacteria | 1901 |
| 456 | Ga0501037_0426027 | 3300049573 | Bacteria | 908 |
| 457 | Ga0501037_0851841 | 3300049573 | Bacteria | 599 |
| 458 | Ga0501038_0058047 | 3300049574 | Bacteria | 3319 |
| 459 | Ga0501038_0300648 | 3300049574 | Bacteria | 1259 |
| 460 | Ga0501039_0070689 | 3300049575 | Bacteria | 2712 |
| 461 | Ga0501039_0097766 | 3300049575 | Bacteria | 2289 |
| 462 | Ga0501039_0119198 | 3300049575 | Bacteria | 2067 |
| 463 | Ga0501040_0026515 | 3300049576 | Bacteria | 3898 |
| 464 | Ga0501040_0297895 | 3300049576 | Bacteria | 1153 |
| 465 | Ga0501040_0345520 | 3300049576 | Bacteria | 1065 |
| 466 | Ga0501041_0021685 | 3300049577 | Bacteria | 3847 |
| 467 | Ga0501042_0094589 | 3300049578 | Bacteria | 2146 |
| 468 | Ga0501042_0380390 | 3300049578 | Bacteria | 1022 |
| 469 | Ga0501042_0867999 | 3300049578 | Bacteria | 657 |
| 470 | Ga0501043_0348979 | 3300049579 | Bacteria | 1124 |
| 471 | Ga0501043_0460436 | 3300049579 | Bacteria | 954 |
| 472 | Ga0501043_0654040 | 3300049579 | Bacteria | 771 |
| 473 | Ga0501046_0507063 | 3300049580 | Bacteria | 863 |
| 474 | Ga0501047_0155663 | 3300049581 | Bacteria | 2159 |
| 475 | Ga0501047_0205740 | 3300049581 | Bacteria | 1827 |
| 476 | Ga0501048_0308399 | 3300049582 | Bacteria | 1126 |
| 477 | Ga0501048_0393070 | 3300049582 | Bacteria | 991 |
| 478 | Ga0501048_0810775 | 3300049582 | Bacteria | 673 |
| 479 | Ga0501067_0051199 | 3300049583 | Bacteria | 2289 |
| 480 | Ga0501067_0251762 | 3300049583 | Bacteria | 983 |
| 481 | Ga0501068_0029125 | 3300049584 | Bacteria | 3269 |
| 482 | Ga0501068_0057493 | 3300049584 | Bacteria | 2358 |
| 483 | Ga0501068_0111569 | 3300049584 | Bacteria | 1700 |
| 484 | Ga0501068_0858507 | 3300049584 | Bacteria | 596 |
| 485 | Ga0501069_0030545 | 3300049585 | Bacteria | 2959 |
| 486 | Ga0501069_0040203 | 3300049585 | Bacteria | 2585 |
| 487 | Ga0501069_0383742 | 3300049585 | Bacteria | 830 |
| 488 | Ga0501069_0710591 | 3300049585 | Bacteria | 606 |
| 489 | Ga0501070_0067473 | 3300049586 | Bacteria | 2962 |
| 490 | Ga0501070_0083561 | 3300049586 | Bacteria | 2643 |
| 491 | Ga0501070_0202001 | 3300049586 | Bacteria | 1632 |
| 492 | Ga0501070_0242991 | 3300049586 | Bacteria | 1473 |
| 493 | Ga0501070_0794514 | 3300049586 | Bacteria | 743 |
| 494 | Ga0501071_0063412 | 3300049587 | Bacteria | 2679 |
| 495 | Ga0501071_0088539 | 3300049587 | Bacteria | 2272 |
| 496 | Ga0501071_0357403 | 3300049587 | Bacteria | 1112 |
| 497 | Ga0501071_0782871 | 3300049587 | Bacteria | 735 |
| 498 | Ga0501072_0029078 | 3300049588 | Bacteria | 4314 |
| 499 | Ga0501072_0067263 | 3300049588 | Bacteria | 2827 |
| 500 | Ga0501072_0646656 | 3300049588 | Bacteria | 832 |
| 501 | Ga0501073_0040649 | 3300049589 | Bacteria | 3289 |
| 502 | Ga0501073_0086033 | 3300049589 | Bacteria | 2186 |
| 503 | Ga0501073_0311672 | 3300049589 | Bacteria | 1085 |
| 504 | Ga0501073_0728373 | 3300049589 | Bacteria | 684 |
| 505 | Ga0501073_0907682 | 3300049589 | Bacteria | 606 |
| 506 | Ga0501074_0049622 | 3300049590 | Bacteria | 3030 |
| 507 | Ga0501074_0057437 | 3300049590 | Bacteria | 2803 |
| 508 | Ga0501074_0146813 | 3300049590 | Bacteria | 1686 |
| 509 | Ga0501074_0254529 | 3300049590 | Bacteria | 1249 |
| 510 | Ga0501075_0114552 | 3300049591 | Bacteria | 2050 |
| 511 | Ga0501075_0217916 | 3300049591 | Bacteria | 1456 |
| 512 | Ga0501076_0081388 | 3300049592 | Bacteria | 2600 |
| 513 | Ga0501076_0222571 | 3300049592 | Bacteria | 1542 |
| 514 | Ga0501076_0342573 | 3300049592 | Bacteria | 1227 |
| 515 | Ga0501076_0378993 | 3300049592 | Bacteria | 1163 |
| 516 | Ga0501077_0305720 | 3300049593 | Bacteria | 1013 |
| 517 | Ga0501077_0360821 | 3300049593 | Bacteria | 928 |
| 518 | Ga0501079_0126533 | 3300049741 | Bacteria | 1988 |
| 519 | Ga0501079_0182947 | 3300049741 | Bacteria | 1636 |
| 520 | Ga0501079_0453911 | 3300049741 | Bacteria | 1007 |
| 521 | Ga0501080_0041183 | 3300049742 | Bacteria | 4305 |
| 522 | Ga0501080_0075103 | 3300049742 | Bacteria | 3144 |
| 523 | Ga0501080_0133703 | 3300049742 | Bacteria | 2296 |
| 524 | Ga0501080_0141304 | 3300049742 | Bacteria | 2225 |
| 525 | Ga0501080_0195626 | 3300049742 | Bacteria | 1857 |
| 526 | Ga0501081_0047513 | 3300049743 | Bacteria | 2953 |
| 527 | Ga0501081_0664905 | 3300049743 | Bacteria | 781 |
| 528 | Ga0501081_0734657 | 3300049743 | Bacteria | 742 |
| 529 | Ga0501081_0872663 | 3300049743 | Bacteria | 678 |
| 530 | Ga0501081_1381942 | 3300049743 | Bacteria | 534 |
| 531 | Ga0501083_0153487 | 3300049744 | Bacteria | 1507 |
| 532 | Ga0501083_0340546 | 3300049744 | Bacteria | 975 |
| 533 | Ga0501035_0160450 | 3300049822 | Bacteria | 1946 |
| 534 | Ga0501035_0349581 | 3300049822 | Bacteria | 1237 |
| 535 | Ga0501035_1116084 | 3300049822 | Bacteria | 615 |
| 536 | Ga0501035_1127664 | 3300049822 | Bacteria | 611 |
| 537 | Ga0501044_0105973 | 3300049823 | Bacteria | 2823 |
| 538 | Ga0501044_0128361 | 3300049823 | Bacteria | 2531 |
| 539 | Ga0501044_0172926 | 3300049823 | Bacteria | 2130 |
| 540 | Ga0501044_0270613 | 3300049823 | Bacteria | 1634 |
| 541 | Ga0501044_0273668 | 3300049823 | Bacteria | 1623 |
| 542 | Ga0501044_0900254 | 3300049823 | Bacteria | 760 |
| 543 | Ga0501045_0070801 | 3300049824 | Bacteria | 2566 |
| 544 | Ga0501045_0313307 | 3300049824 | Bacteria | 1168 |
| 545 | nmdc:mga03n38_54352_c1 | 3300050490 | Bacteria | 1799 |
| 546 | nmdc:mga0k408_872986_c1 | 3300050493 | Bacteria | 522 |
| 547 | nmdc:mga07m45_115921_c1 | 3300050496 | Bacteria | 1545 |
| 548 | nmdc:mga05p37_2115048_c1 | 3300050507 | Bacteria | 527 |
| 549 | nmdc:mga05p37_434840_c1 | 3300050507 | Bacteria | 1523 |
| 550 | nmdc:mga05p37_747044_c1 | 3300050507 | Bacteria | 1079 |
| 551 | nmdc:mga09592_372677_c1 | 3300050508 | Bacteria | 1235 |
| 552 | nmdc:mga09592_450583_c1 | 3300050508 | Bacteria | 1110 |
| 553 | nmdc:mga0qj67_225617_c1 | 3300050509 | Bacteria | 1520 |
| 554 | nmdc:mga0qj67_44746_c1 | 3300050509 | Bacteria | 3491 |
| 555 | nmdc:mga0qj67_875435_c1 | 3300050509 | Bacteria | 709 |
| 556 | nmdc:mga06r32_1156660_c1 | 3300050510 | Bacteria | 721 |
| 557 | nmdc:mga06r32_887796_c1 | 3300050510 | Bacteria | 848 |
| 558 | nmdc:mga08y16_136821_c1 | 3300050511 | Bacteria | 2546 |
| 559 | nmdc:mga08y16_348236_c1 | 3300050511 | Bacteria | 1522 |
| 560 | nmdc:mga0n895_189483_c1 | 3300050512 | Bacteria | 2088 |
| 561 | nmdc:mga0a205_66873_c1 | 3300050515 | Bacteria | 3472 |
| 562 | Ga0495601_0003476 | 3300053077 | Bacteria | 9041 |
| 563 | Ga0495601_0004742 | 3300053077 | Bacteria | 7882 |
| 564 | Ga0495601_0007996 | 3300053077 | Bacteria | 6229 |
| 565 | Ga0495612_0002228 | 3300053078 | Bacteria | 7968 |
| 566 | Ga0495612_0089635 | 3300053078 | Bacteria | 1300 |
| 567 | Ga0495612_0144431 | 3300053078 | Bacteria | 1033 |
| 568 | Ga0495655_0031218 | 3300053083 | Bacteria | 1295 |
| 569 | Ga0495655_0120006 | 3300053083 | Bacteria | 799 |
| 570 | Ga0495595_0001345 | 3300053084 | Bacteria | 9543 |
| 571 | Ga0495595_0007610 | 3300053084 | Bacteria | 4434 |
| 572 | Ga0495595_0040126 | 3300053084 | Bacteria | 2138 |
| 573 | Ga0495619_0000352 | 3300053085 | Bacteria | 32130 |
| 574 | Ga0495619_0013467 | 3300053085 | Bacteria | 5152 |
| 575 | Ga0495619_0015650 | 3300053085 | Bacteria | 4801 |
| 576 | Ga0500644_0008929 | 3300053088 | Bacteria | 2662 |
| 577 | Ga0500592_004394 | 3300053116 | Bacteria | 2248 |
| 578 | Ga0500652_005263 | 3300053131 | Bacteria | 4059 |
| 579 | Ga0500658_0011094 | 3300053134 | Bacteria | 3321 |
| 580 | Ga0500568_0013224 | 3300053139 | Bacteria | 3765 |
| 581 | Ga0500604_0032973 | 3300053151 | Bacteria | 1529 |
| 582 | Ga0500616_0179292 | 3300053153 | Bacteria | 955 |
| 583 | Ga0500616_0284023 | 3300053153 | Bacteria | 693 |
| 584 | Ga0500627_0000009 | 3300053158 | Bacteria | 153203 |
| 585 | Ga0500637_0029919 | 3300053178 | Bacteria | 3025 |
| 586 | Ga0500596_039807 | 3300053735 | Bacteria | 747 |
| 587 | Ga0500601_002145 | 3300053737 | Bacteria | 2118 |
| 588 | Ga0501084_0130731 | 3300054114 | Bacteria | 2113 |
| 589 | Ga0501084_0268841 | 3300054114 | Bacteria | 1439 |
| 590 | Ga0501084_0303891 | 3300054114 | Bacteria | 1348 |
| 591 | Ga0501084_0595091 | 3300054114 | Bacteria | 934 |
| 592 | Ga0587084_159606 | 3300059477 | Bacteria | 501 |
| 593 | Ga0587077_236276 | 3300059493 | Bacteria | 522 |
| 594 | Ga0501082_0109453 | 3300060353 | Bacteria | 2391 |
| 595 | Ga0501082_0301898 | 3300060353 | Bacteria | 1394 |
| 596 | Ga0501082_0788570 | 3300060353 | Bacteria | 831 |
| 597 | Ga0501082_1148750 | 3300060353 | Bacteria | 679 |
| 598 | Ga0466962_0597379 | 3300061719 | Bacteria | 562 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041486 | Ga0451807_0919669 | Ga0451807_0919669_301_603 | 77 |
| 2 | 3300006186 | Ga0075369_10163231 | Ga0075369_101632312 | 92 |
| 3 | 3300012475 | Ga0157317_1007058 | Ga0157317_10070582 | 92 |
| 4 | 3300005329 | Ga0070683_100046388 | Ga0070683_1000463887 | 93 |
| 5 | 3300005518 | Ga0070699_100135661 | Ga0070699_1001356613 | 93 |
| 6 | 3300005536 | Ga0070697_100008562 | Ga0070697_1000085622 | 93 |
| 7 | 3300025921 | Ga0207652_10727643 | Ga0207652_107276432 | 93 |
| 8 | 3300031239 | Ga0265328_10055566 | Ga0265328_100555662 | 93 |
| 9 | 3300031250 | Ga0265331_10002092 | Ga0265331_1000209226 | 93 |
| 10 | 3300004800 | Ga0058861_11770653 | Ga0058861_117706532 | 94 |
| 11 | 3300004803 | Ga0058862_12365026 | Ga0058862_123650262 | 94 |
| 12 | 3300005329 | Ga0070683_101934320 | Ga0070683_1019343202 | 94 |
| 13 | 3300005338 | Ga0068868_101436419 | Ga0068868_1014364192 | 94 |
| 14 | 3300005344 | Ga0070661_101916657 | Ga0070661_1019166571 | 94 |
| 15 | 3300005718 | Ga0068866_11007875 | Ga0068866_110078752 | 94 |
| 16 | 3300006358 | Ga0068871_101241073 | Ga0068871_1012410732 | 94 |
| 17 | 3300009148 | Ga0105243_11798327 | Ga0105243_117983272 | 94 |
| 18 | 3300009177 | Ga0105248_10955830 | Ga0105248_109558302 | 94 |
| 19 | 3300017792 | Ga0163161_11457255 | Ga0163161_114572551 | 94 |
| 20 | 3300025912 | Ga0207707_10146707 | Ga0207707_101467074 | 94 |
| 21 | 3300025935 | Ga0207709_10442975 | Ga0207709_104429752 | 94 |
| 22 | 3300025937 | Ga0207669_11463202 | Ga0207669_114632022 | 94 |
| 23 | 3300025944 | Ga0207661_12009544 | Ga0207661_120095441 | 94 |
| 24 | 3300030763 | Ga0265763_1023796 | Ga0265763_10237962 | 94 |
| 25 | 3300034816 | Ga0373930_0097218 | Ga0373930_0097218_133_417 | 94 |
| 26 | 3300046475 | Ga0495639_0619637 | Ga0495639_0619637_78_362 | 94 |
| 27 | 3300046477 | Ga0495664_0515831 | Ga0495664_0515831_332_616 | 94 |
| 28 | 3300046535 | Ga0495586_0305532 | Ga0495586_0305532_422_706 | 94 |
| 29 | 3300046663 | Ga0495635_0532097 | Ga0495635_0532097_349_633 | 94 |
| 30 | 3300047319 | Ga0495674_0375532 | Ga0495674_0375532_227_511 | 94 |
| 31 | 3300049528 | Ga0501312_057425 | Ga0501312_057425_313_603 | 95 |
| 32 | 3300005354 | Ga0070675_100564595 | Ga0070675_1005645952 | 96 |
| 33 | 3300005364 | Ga0070673_101097538 | Ga0070673_1010975381 | 96 |
| 34 | 3300005456 | Ga0070678_100515496 | Ga0070678_1005154962 | 96 |
| 35 | 3300005468 | Ga0070707_100478908 | Ga0070707_1004789082 | 96 |
| 36 | 3300005548 | Ga0070665_102388972 | Ga0070665_1023889722 | 96 |
| 37 | 3300005615 | Ga0070702_101202788 | Ga0070702_1012027881 | 96 |
| 38 | 3300005841 | Ga0068863_101241058 | Ga0068863_1012410582 | 96 |
| 39 | 3300005842 | Ga0068858_101304821 | Ga0068858_1013048212 | 96 |
| 40 | 3300005843 | Ga0068860_102048812 | Ga0068860_1020488122 | 96 |
| 41 | 3300006237 | Ga0097621_100320313 | Ga0097621_1003203133 | 96 |
| 42 | 3300013308 | Ga0157375_12854714 | Ga0157375_128547141 | 96 |
| 43 | 3300014325 | Ga0163163_10186186 | Ga0163163_101861863 | 96 |
| 44 | 3300025925 | Ga0207650_10557869 | Ga0207650_105578692 | 96 |
| 45 | 3300025926 | Ga0207659_10882526 | Ga0207659_108825262 | 96 |
| 46 | 3300026088 | Ga0207641_11674369 | Ga0207641_116743692 | 96 |
| 47 | 3300026121 | Ga0207683_11155753 | Ga0207683_111557532 | 96 |
| 48 | iso_pu_bacteria | 2513237092 | 2513625270 | 96 |
| 49 | iso_pu_bacteria | 2513237104 | 2513715018 | 96 |
| 50 | iso_pu_bacteria | 2517093001 | 2517103520 | 96 |
| 51 | iso_pu_bacteria | 2617270741 | 2617378173 | 96 |
| 52 | iso_pu_bacteria | 2643221563 | 2643835056 | 96 |
| 53 | iso_pu_bacteria | 2643221608 | 2644055983 | 96 |
| 54 | iso_pu_bacteria | 2824600985 | 2824602115 | 96 |
| 55 | iso_pu_bacteria | 2824609381 | 2824610103 | 96 |
| 56 | iso_pu_bacteria | 2824653114 | 2824654959 | 96 |
| 57 | iso_pu_bacteria | 2824679649 | 2824680844 | 96 |
| 58 | iso_pu_bacteria | 2824732956 | 2824733559 | 96 |
| 59 | iso_pu_bacteria | 2824746037 | 2824746934 | 96 |
| 60 | iso_pu_bacteria | 2841957949 | 2841962243 | 96 |
| 61 | iso_pu_bacteria | 2847930680 | 2847934829 | 96 |
| 62 | iso_pu_bacteria | 2852653556 | 2852655871 | 96 |
| 63 | iso_pu_bacteria | 2852680915 | 2852683076 | 96 |
| 64 | iso_pu_bacteria | 2857509624 | 2857510229 | 96 |
| 65 | iso_pu_bacteria | 2874612657 | 2874615656 | 96 |
| 66 | iso_pu_bacteria | 2876761206 | 2876765726 | 96 |
| 67 | iso_pu_bacteria | 2879083081 | 2879089276 | 96 |
| 68 | iso_pu_bacteria | 2881364244 | 2881366223 | 96 |
| 69 | iso_pu_bacteria | 2881665667 | 2881671564 | 96 |
| 70 | iso_pu_bacteria | 2888419890 | 2888423294 | 96 |
| 71 | iso_pu_bacteria | 2908775508 | 2908778937 | 96 |
| 72 | iso_pu_bacteria | 2922393267 | 2922395223 | 96 |
| 73 | iso_pu_bacteria | 3005483717 | 3005488143 | 96 |
| 74 | iso_pu_bacteria | 3005587118 | 3005590475 | 96 |
| 75 | 3300005339 | Ga0070660_101134532 | Ga0070660_1011345322 | 98 |
| 76 | 3300005344 | Ga0070661_100593494 | Ga0070661_1005934942 | 98 |
| 77 | 3300005366 | Ga0070659_100018511 | Ga0070659_10001851111 | 98 |
| 78 | 3300005367 | Ga0070667_100479068 | Ga0070667_1004790682 | 98 |
| 79 | 3300005444 | Ga0070694_101529228 | Ga0070694_1015292282 | 98 |
| 80 | 3300005455 | Ga0070663_100467597 | Ga0070663_1004675972 | 98 |
| 81 | 3300005466 | Ga0070685_11444064 | Ga0070685_114440641 | 98 |
| 82 | 3300005539 | Ga0068853_100399888 | Ga0068853_1003998883 | 98 |
| 83 | 3300005564 | Ga0070664_100036245 | Ga0070664_1000362455 | 98 |
| 84 | 3300005718 | Ga0068866_10391805 | Ga0068866_103918052 | 98 |
| 85 | 3300005844 | Ga0068862_102024259 | Ga0068862_1020242592 | 98 |
| 86 | 3300006358 | Ga0068871_102148488 | Ga0068871_1021484882 | 98 |
| 87 | 3300006844 | Ga0075428_100665538 | Ga0075428_1006655381 | 98 |
| 88 | 3300006880 | Ga0075429_100812466 | Ga0075429_1008124662 | 98 |
| 89 | 3300006881 | Ga0068865_100539559 | Ga0068865_1005395592 | 98 |
| 90 | 3300009094 | Ga0111539_10105552 | Ga0111539_101055525 | 98 |
| 91 | 3300009147 | Ga0114129_13141115 | Ga0114129_131411152 | 98 |
| 92 | 3300009148 | Ga0105243_11913280 | Ga0105243_119132802 | 98 |
| 93 | 3300009177 | Ga0105248_10731539 | Ga0105248_107315392 | 98 |
| 94 | 3300009551 | Ga0105238_10877479 | Ga0105238_108774792 | 98 |
| 95 | 3300013100 | Ga0157373_10213046 | Ga0157373_102130462 | 98 |
| 96 | 3300013100 | Ga0157373_10214208 | Ga0157373_102142082 | 98 |
| 97 | 3300013104 | Ga0157370_11276082 | Ga0157370_112760822 | 98 |
| 98 | 3300013306 | Ga0163162_12620359 | Ga0163162_126203592 | 98 |
| 99 | 3300014745 | Ga0157377_10312618 | Ga0157377_103126182 | 98 |
| 100 | 3300025899 | Ga0207642_10424902 | Ga0207642_104249022 | 98 |
| 101 | 3300025901 | Ga0207688_10423533 | Ga0207688_104235332 | 98 |
| 102 | 3300025915 | Ga0207693_11085378 | Ga0207693_110853781 | 98 |
| 103 | 3300025932 | Ga0207690_10175415 | Ga0207690_101754153 | 98 |
| 104 | 3300025937 | Ga0207669_10710593 | Ga0207669_107105932 | 98 |
| 105 | 3300025938 | Ga0207704_10273867 | Ga0207704_102738672 | 98 |
| 106 | 3300025941 | Ga0207711_10528708 | Ga0207711_105287082 | 98 |
| 107 | 3300025945 | Ga0207679_10065715 | Ga0207679_100657152 | 98 |
| 108 | 3300025960 | Ga0207651_10427475 | Ga0207651_104274752 | 98 |
| 109 | 3300026041 | Ga0207639_10053240 | Ga0207639_100532404 | 98 |
| 110 | 3300026041 | Ga0207639_10807664 | Ga0207639_108076642 | 98 |
| 111 | 3300026067 | Ga0207678_10313479 | Ga0207678_103134793 | 98 |
| 112 | 3300026089 | Ga0207648_10565264 | Ga0207648_105652642 | 98 |
| 113 | 3300026118 | Ga0207675_100633306 | Ga0207675_1006333062 | 98 |
| 114 | 3300028379 | Ga0268266_11386884 | Ga0268266_113868842 | 98 |
| 115 | 3300028800 | Ga0265338_10065290 | Ga0265338_100652905 | 98 |
| 116 | 3300028800 | Ga0265338_10162190 | Ga0265338_101621903 | 98 |
| 117 | 3300028800 | Ga0265338_10426269 | Ga0265338_104262692 | 98 |
| 118 | 3300031250 | Ga0265331_10073351 | Ga0265331_100733512 | 98 |
| 119 | 3300031711 | Ga0265314_10018555 | Ga0265314_1001855512 | 98 |
| 120 | 3300031903 | Ga0307407_11273433 | Ga0307407_112734332 | 98 |
| 121 | 3300032002 | Ga0307416_100482412 | Ga0307416_1004824122 | 98 |
| 122 | 3300032002 | Ga0307416_103404498 | Ga0307416_1034044981 | 98 |
| 123 | 3300032005 | Ga0307411_10706699 | Ga0307411_107066991 | 98 |
| 124 | 3300039450 | Ga0436363_1174974 | Ga0436363_1174974_525_821 | 98 |
| 125 | 3300046500 | Ga0495596_0332349 | Ga0495596_0332349_159_455 | 98 |
| 126 | 3300046515 | Ga0495620_0080340 | Ga0495620_0080340_804_1100 | 98 |
| 127 | 3300048903 | Ga0496100_1466706 | Ga0496100_1466706_172_468 | 98 |
| 128 | 3300048905 | Ga0496102_0459565 | Ga0496102_0459565_370_666 | 98 |
| 129 | 3300048911 | Ga0496108_1155255 | Ga0496108_1155255_67_363 | 98 |
| 130 | 3300048913 | Ga0496110_0457281 | Ga0496110_0457281_847_1143 | 98 |
| 131 | 3300049568 | Ga0501031_0956069 | Ga0501031_0956069_199_495 | 98 |
| 132 | 3300049570 | Ga0501033_1165786 | Ga0501033_1165786_138_434 | 98 |
| 133 | 3300049572 | Ga0501036_0270240 | Ga0501036_0270240_847_1143 | 98 |
| 134 | 3300049575 | Ga0501039_0119198 | Ga0501039_0119198_777_1073 | 98 |
| 135 | 3300049576 | Ga0501040_0345520 | Ga0501040_0345520_148_444 | 98 |
| 136 | 3300049577 | Ga0501041_0021685 | Ga0501041_0021685_2480_2776 | 98 |
| 137 | 3300049578 | Ga0501042_0094589 | Ga0501042_0094589_57_353 | 98 |
| 138 | 3300049579 | Ga0501043_0460436 | Ga0501043_0460436_10_306 | 98 |
| 139 | 3300049582 | Ga0501048_0810775 | Ga0501048_0810775_172_468 | 98 |
| 140 | 3300049585 | Ga0501069_0040203 | Ga0501069_0040203_1428_1724 | 98 |
| 141 | 3300049590 | Ga0501074_0254529 | Ga0501074_0254529_420_716 | 98 |
| 142 | 3300049591 | Ga0501075_0114552 | Ga0501075_0114552_1702_1998 | 98 |
| 143 | 3300049592 | Ga0501076_0081388 | Ga0501076_0081388_2280_2576 | 98 |
| 144 | 3300049592 | Ga0501076_0378993 | Ga0501076_0378993_684_980 | 98 |
| 145 | 3300049593 | Ga0501077_0360821 | Ga0501077_0360821_535_831 | 98 |
| 146 | 3300049741 | Ga0501079_0126533 | Ga0501079_0126533_898_1194 | 98 |
| 147 | 3300049741 | Ga0501079_0453911 | Ga0501079_0453911_569_865 | 98 |
| 148 | 3300049742 | Ga0501080_0075103 | Ga0501080_0075103_1757_2053 | 98 |
| 149 | 3300049742 | Ga0501080_0133703 | Ga0501080_0133703_194_490 | 98 |
| 150 | 3300049743 | Ga0501081_0047513 | Ga0501081_0047513_1847_2143 | 98 |
| 151 | 3300049743 | Ga0501081_1381942 | Ga0501081_1381942_219_515 | 98 |
| 152 | 3300049822 | Ga0501035_0349581 | Ga0501035_0349581_215_511 | 98 |
| 153 | 3300049823 | Ga0501044_0900254 | Ga0501044_0900254_91_387 | 98 |
| 154 | 3300049824 | Ga0501045_0070801 | Ga0501045_0070801_1834_2130 | 98 |
| 155 | 3300050490 | nmdc:mga03n38_54352_c1 | nmdc:mga03n38_54352_c1_618_914 | 98 |
| 156 | 3300050493 | nmdc:mga0k408_872986_c1 | nmdc:mga0k408_872986_c1_77_373 | 98 |
| 157 | 3300050507 | nmdc:mga05p37_747044_c1 | nmdc:mga05p37_747044_c1_657_953 | 98 |
| 158 | 3300050508 | nmdc:mga09592_450583_c1 | nmdc:mga09592_450583_c1_371_667 | 98 |
| 159 | 3300050510 | nmdc:mga06r32_1156660_c1 | nmdc:mga06r32_1156660_c1_273_569 | 98 |
| 160 | 3300050511 | nmdc:mga08y16_348236_c1 | nmdc:mga08y16_348236_c1_124_420 | 98 |
| 161 | 3300053083 | Ga0495655_0120006 | Ga0495655_0120006_192_488 | 98 |
| 162 | 3300053131 | Ga0500652_005263 | Ga0500652_005263_3465_3788 | 98 |
| 163 | 3300053178 | Ga0500637_0029919 | Ga0500637_0029919_615_947 | 98 |
| 164 | 3300053735 | Ga0500596_039807 | Ga0500596_039807_201_533 | 98 |
| 165 | 3300053737 | Ga0500601_002145 | Ga0500601_002145_850_1182 | 98 |
| 166 | 3300054114 | Ga0501084_0268841 | Ga0501084_0268841_973_1269 | 98 |
| 167 | 3300003781 | Ga0055536_1023681 | Ga0055536_10236813 | 99 |
| 168 | 3300003781 | Ga0055536_1024175 | Ga0055536_10241753 | 99 |
| 169 | 3300003781 | Ga0055536_1091335 | Ga0055536_10913351 | 99 |
| 170 | 3300003791 | Ga0055530_10009419 | Ga0055530_100094191 | 99 |
| 171 | 3300003791 | Ga0055530_10052734 | Ga0055530_100527342 | 99 |
| 172 | 3300003794 | Ga0055531_10024322 | Ga0055531_100243221 | 99 |
| 173 | 3300003794 | Ga0055531_10024340 | Ga0055531_100243401 | 99 |
| 174 | 3300004798 | Ga0058859_11684652 | Ga0058859_116846522 | 99 |
| 175 | 3300005330 | Ga0070690_100226037 | Ga0070690_1002260373 | 99 |
| 176 | 3300005436 | Ga0070713_100051698 | Ga0070713_1000516984 | 99 |
| 177 | 3300005437 | Ga0070710_10052773 | Ga0070710_100527734 | 99 |
| 178 | 3300005437 | Ga0070710_10220853 | Ga0070710_102208532 | 99 |
| 179 | 3300005439 | Ga0070711_100027798 | Ga0070711_1000277982 | 99 |
| 180 | 3300005444 | Ga0070694_100286379 | Ga0070694_1002863792 | 99 |
| 181 | 3300005457 | Ga0070662_100616111 | Ga0070662_1006161112 | 99 |
| 182 | 3300005539 | Ga0068853_102022781 | Ga0068853_1020227811 | 99 |
| 183 | 3300005545 | Ga0070695_101436464 | Ga0070695_1014364642 | 99 |
| 184 | 3300005843 | Ga0068860_100751746 | Ga0068860_1007517462 | 99 |
| 185 | 3300005937 | Ga0081455_10017756 | Ga0081455_100177565 | 99 |
| 186 | 3300005981 | Ga0081538_10159181 | Ga0081538_101591812 | 99 |
| 187 | 3300005983 | Ga0081540_1058910 | Ga0081540_10589102 | 99 |
| 188 | 3300006028 | Ga0070717_10162531 | Ga0070717_101625311 | 99 |
| 189 | 3300006028 | Ga0070717_10362285 | Ga0070717_103622852 | 99 |
| 190 | 3300006038 | Ga0075365_10292346 | Ga0075365_102923461 | 99 |
| 191 | 3300006038 | Ga0075365_10913982 | Ga0075365_109139822 | 99 |
| 192 | 3300006175 | Ga0070712_100037138 | Ga0070712_1000371383 | 99 |
| 193 | 3300006175 | Ga0070712_101602211 | Ga0070712_1016022111 | 99 |
| 194 | 3300006186 | Ga0075369_10381955 | Ga0075369_103819552 | 99 |
| 195 | 3300006195 | Ga0075366_10828867 | Ga0075366_108288672 | 99 |
| 196 | 3300006353 | Ga0075370_10183910 | Ga0075370_101839102 | 99 |
| 197 | 3300006358 | Ga0068871_100758913 | Ga0068871_1007589132 | 99 |
| 198 | 3300006844 | Ga0075428_100048564 | Ga0075428_1000485643 | 99 |
| 199 | 3300006846 | Ga0075430_100078655 | Ga0075430_1000786552 | 99 |
| 200 | 3300006846 | Ga0075430_100816232 | Ga0075430_1008162322 | 99 |
| 201 | 3300006847 | Ga0075431_100610933 | Ga0075431_1006109332 | 99 |
| 202 | 3300006852 | Ga0075433_10461696 | Ga0075433_104616961 | 99 |
| 203 | 3300006880 | Ga0075429_100421797 | Ga0075429_1004217972 | 99 |
| 204 | 3300006881 | Ga0068865_101207197 | Ga0068865_1012071972 | 99 |
| 205 | 3300007788 | Ga0099795_10085530 | Ga0099795_100855302 | 99 |
| 206 | 3300009093 | Ga0105240_11919212 | Ga0105240_119192122 | 99 |
| 207 | 3300009094 | Ga0111539_10146569 | Ga0111539_101465695 | 99 |
| 208 | 3300009101 | Ga0105247_10646913 | Ga0105247_106469131 | 99 |
| 209 | 3300009147 | Ga0114129_10347685 | Ga0114129_103476852 | 99 |
| 210 | 3300009174 | Ga0105241_10826564 | Ga0105241_108265642 | 99 |
| 211 | 3300009545 | Ga0105237_10533898 | Ga0105237_105338982 | 99 |
| 212 | 3300009553 | Ga0105249_11168554 | Ga0105249_111685542 | 99 |
| 213 | 3300010159 | Ga0099796_10081278 | Ga0099796_100812782 | 99 |
| 214 | 3300010375 | Ga0105239_10585271 | Ga0105239_105852712 | 99 |
| 215 | 3300013306 | Ga0163162_12455721 | Ga0163162_124557212 | 99 |
| 216 | 3300014325 | Ga0163163_10639346 | Ga0163163_106393462 | 99 |
| 217 | 3300014325 | Ga0163163_11936755 | Ga0163163_119367552 | 99 |
| 218 | 3300014326 | Ga0157380_10192942 | Ga0157380_101929423 | 99 |
| 219 | 3300017792 | Ga0163161_10506257 | Ga0163161_105062572 | 99 |
| 220 | 3300019182 | Ga0184598_102540 | Ga0184598_1025402 | 99 |
| 221 | 3300021384 | Ga0213876_10159791 | Ga0213876_101597912 | 99 |
| 222 | 3300021384 | Ga0213876_10568084 | Ga0213876_105680842 | 99 |
| 223 | 3300021441 | Ga0213871_10041410 | Ga0213871_100414102 | 99 |
| 224 | 3300025291 | Ga0209675_1000104 | Ga0209675_100010411 | 99 |
| 225 | 3300025292 | Ga0209676_1004257 | Ga0209676_10042575 | 99 |
| 226 | 3300025292 | Ga0209676_1027868 | Ga0209676_10278682 | 99 |
| 227 | 3300025294 | Ga0209025_1036659 | Ga0209025_10366593 | 99 |
| 228 | 3300025297 | Ga0209758_1053903 | Ga0209758_10539032 | 99 |
| 229 | 3300025297 | Ga0209758_1143284 | Ga0209758_11432841 | 99 |
| 230 | 3300025298 | Ga0209050_1012904 | Ga0209050_10129045 | 99 |
| 231 | 3300025298 | Ga0209050_1038106 | Ga0209050_10381062 | 99 |
| 232 | 3300025304 | Ga0209257_1006356 | Ga0209257_10063567 | 99 |
| 233 | 3300025304 | Ga0209257_1021998 | Ga0209257_10219984 | 99 |
| 234 | 3300025898 | Ga0207692_10223839 | Ga0207692_102238392 | 99 |
| 235 | 3300025900 | Ga0207710_10029828 | Ga0207710_100298282 | 99 |
| 236 | 3300025906 | Ga0207699_10359866 | Ga0207699_103598662 | 99 |
| 237 | 3300025906 | Ga0207699_10529140 | Ga0207699_105291402 | 99 |
| 238 | 3300025911 | Ga0207654_10477711 | Ga0207654_104777112 | 99 |
| 239 | 3300025914 | Ga0207671_10318504 | Ga0207671_103185042 | 99 |
| 240 | 3300025915 | Ga0207693_10085957 | Ga0207693_100859573 | 99 |
| 241 | 3300025915 | Ga0207693_10200166 | Ga0207693_102001662 | 99 |
| 242 | 3300025915 | Ga0207693_11141061 | Ga0207693_111410611 | 99 |
| 243 | 3300025916 | Ga0207663_10214435 | Ga0207663_102144351 | 99 |
| 244 | 3300025921 | Ga0207652_11232291 | Ga0207652_112322912 | 99 |
| 245 | 3300025924 | Ga0207694_10591075 | Ga0207694_105910752 | 99 |
| 246 | 3300025928 | Ga0207700_10053321 | Ga0207700_100533214 | 99 |
| 247 | 3300025928 | Ga0207700_10303832 | Ga0207700_103038322 | 99 |
| 248 | 3300025928 | Ga0207700_11617775 | Ga0207700_116177752 | 99 |
| 249 | 3300025929 | Ga0207664_10915155 | Ga0207664_109151552 | 99 |
| 250 | 3300025929 | Ga0207664_11845639 | Ga0207664_118456392 | 99 |
| 251 | 3300025933 | Ga0207706_10335759 | Ga0207706_103357592 | 99 |
| 252 | 3300025934 | Ga0207686_11786121 | Ga0207686_117861212 | 99 |
| 253 | 3300025939 | Ga0207665_10601169 | Ga0207665_106011691 | 99 |
| 254 | 3300025961 | Ga0207712_10386287 | Ga0207712_103862872 | 99 |
| 255 | 3300027876 | Ga0209974_10029965 | Ga0209974_100299653 | 99 |
| 256 | 3300027907 | Ga0207428_10164487 | Ga0207428_101644873 | 99 |
| 257 | 3300028379 | Ga0268266_12228493 | Ga0268266_122284932 | 99 |
| 258 | 3300028556 | Ga0265337_1002429 | Ga0265337_100242919 | 99 |
| 259 | 3300028558 | Ga0265326_10039873 | Ga0265326_100398731 | 99 |
| 260 | 3300028563 | Ga0265319_1001825 | Ga0265319_10018255 | 99 |
| 261 | 3300028573 | Ga0265334_10000469 | Ga0265334_1000046920 | 99 |
| 262 | 3300028577 | Ga0265318_10040136 | Ga0265318_100401362 | 99 |
| 263 | 3300028653 | Ga0265323_10001237 | Ga0265323_100012376 | 99 |
| 264 | 3300028654 | Ga0265322_10008354 | Ga0265322_100083545 | 99 |
| 265 | 3300028666 | Ga0265336_10000535 | Ga0265336_1000053525 | 99 |
| 266 | 3300028800 | Ga0265338_10000131 | Ga0265338_10000131111 | 99 |
| 267 | 3300028800 | Ga0265338_10033513 | Ga0265338_100335136 | 99 |
| 268 | 3300028800 | Ga0265338_10123178 | Ga0265338_101231783 | 99 |
| 269 | 3300028800 | Ga0265338_10884516 | Ga0265338_108845162 | 99 |
| 270 | 3300029957 | Ga0265324_10001269 | Ga0265324_100012699 | 99 |
| 271 | 3300030733 | Ga0314311_1091187 | Ga0314311_10911872 | 99 |
| 272 | 3300030744 | Ga0316181_1093387 | Ga0316181_10933872 | 99 |
| 273 | 3300031241 | Ga0265325_10001071 | Ga0265325_100010715 | 99 |
| 274 | 3300031241 | Ga0265325_10136758 | Ga0265325_101367582 | 99 |
| 275 | 3300031249 | Ga0265339_10000053 | Ga0265339_1000005326 | 99 |
| 276 | 3300031249 | Ga0265339_10200458 | Ga0265339_102004582 | 99 |
| 277 | 3300031456 | Ga0307513_10333316 | Ga0307513_103333162 | 99 |
| 278 | 3300031456 | Ga0307513_11059987 | Ga0307513_110599872 | 99 |
| 279 | 3300031507 | Ga0307509_10387826 | Ga0307509_103878262 | 99 |
| 280 | 3300031548 | Ga0307408_100445374 | Ga0307408_1004453743 | 99 |
| 281 | 3300031548 | Ga0307408_101349918 | Ga0307408_1013499181 | 99 |
| 282 | 3300031595 | Ga0265313_10000098 | Ga0265313_1000009861 | 99 |
| 283 | 3300031595 | Ga0265313_10006263 | Ga0265313_100062632 | 99 |
| 284 | 3300031665 | Ga0316575_10088184 | Ga0316575_100881842 | 99 |
| 285 | 3300031712 | Ga0265342_10574296 | Ga0265342_105742961 | 99 |
| 286 | 3300031911 | Ga0307412_11420581 | Ga0307412_114205812 | 99 |
| 287 | 3300031995 | Ga0307409_100947105 | Ga0307409_1009471052 | 99 |
| 288 | 3300031995 | Ga0307409_101583311 | Ga0307409_1015833112 | 99 |
| 289 | 3300032004 | Ga0307414_10012056 | Ga0307414_100120562 | 99 |
| 290 | 3300032004 | Ga0307414_10107832 | Ga0307414_101078323 | 99 |
| 291 | 3300032005 | Ga0307411_10046512 | Ga0307411_100465125 | 99 |
| 292 | 3300032005 | Ga0307411_10829394 | Ga0307411_108293942 | 99 |
| 293 | 3300032133 | Ga0316583_10003862 | Ga0316583_100038625 | 99 |
| 294 | 3300032133 | Ga0316583_10041645 | Ga0316583_100416452 | 99 |
| 295 | 3300032168 | Ga0316593_10033258 | Ga0316593_100332582 | 99 |
| 296 | 3300032168 | Ga0316593_10417561 | Ga0316593_104175612 | 99 |
| 297 | 3300033180 | Ga0307510_10263101 | Ga0307510_102631012 | 99 |
| 298 | 3300034816 | Ga0373930_0040694 | Ga0373930_0040694_128_427 | 99 |
| 299 | 3300035084 | Ga0373928_0060312 | Ga0373928_0060312_118_417 | 99 |
| 300 | 3300035088 | Ga0373940_0014901 | Ga0373940_0014901_48_347 | 99 |
| 301 | 3300035091 | Ga0373951_0013840 | Ga0373951_0013840_694_993 | 99 |
| 302 | 3300035092 | Ga0373952_0171613 | Ga0373952_0171613_23_322 | 99 |
| 303 | 3300035111 | Ga0373923_0005324 | Ga0373923_0005324_1749_2048 | 99 |
| 304 | 3300035111 | Ga0373923_0031770 | Ga0373923_0031770_1685_1984 | 99 |
| 305 | 3300035115 | Ga0373941_0029005 | Ga0373941_0029005_278_577 | 99 |
| 306 | 3300035115 | Ga0373941_0060667 | Ga0373941_0060667_636_935 | 99 |
| 307 | 3300035116 | Ga0373945_0322626 | Ga0373945_0322626_134_433 | 99 |
| 308 | 3300035117 | Ga0373953_0017061 | Ga0373953_0017061_1820_2119 | 99 |
| 309 | 3300035117 | Ga0373953_0100833 | Ga0373953_0100833_303_602 | 99 |
| 310 | 3300035118 | Ga0373954_0421854 | Ga0373954_0421854_19_318 | 99 |
| 311 | 3300035118 | Ga0373954_0467305 | Ga0373954_0467305_121_420 | 99 |
| 312 | 3300035119 | Ga0373956_0291928 | Ga0373956_0291928_430_729 | 99 |
| 313 | 3300035120 | Ga0373957_0051619 | Ga0373957_0051619_1206_1505 | 99 |
| 314 | 3300035121 | Ga0373960_0004525 | Ga0373960_0004525_777_1076 | 99 |
| 315 | 3300035171 | Ga0373946_0205547 | Ga0373946_0205547_289_588 | 99 |
| 316 | 3300035171 | Ga0373946_0205850 | Ga0373946_0205850_336_635 | 99 |
| 317 | 3300035241 | Ga0373961_0436798 | Ga0373961_0436798_65_364 | 99 |
| 318 | 3300035410 | Ga0373924_0015063 | Ga0373924_0015063_371_670 | 99 |
| 319 | 3300035410 | Ga0373924_0047473 | Ga0373924_0047473_997_1296 | 99 |
| 320 | 3300035691 | Ga0373931_0028558 | Ga0373931_0028558_721_1020 | 99 |
| 321 | 3300035692 | Ga0373935_0023907 | Ga0373935_0023907_3433_3732 | 99 |
| 322 | 3300035695 | Ga0373927_0008214 | Ga0373927_0008214_2842_3141 | 99 |
| 323 | 3300035695 | Ga0373927_0029560 | Ga0373927_0029560_1713_2012 | 99 |
| 324 | 3300035724 | Ga0373933_0001245 | Ga0373933_0001245_11596_11895 | 99 |
| 325 | 3300035724 | Ga0373933_0413541 | Ga0373933_0413541_266_565 | 99 |
| 326 | 3300035724 | Ga0373933_0555914 | Ga0373933_0555914_254_553 | 99 |
| 327 | 3300035725 | Ga0373947_0034962 | Ga0373947_0034962_1050_1349 | 99 |
| 328 | 3300035725 | Ga0373947_0927229 | Ga0373947_0927229_130_429 | 99 |
| 329 | 3300036401 | Ga0373937_0001081 | Ga0373937_0001081_12609_12908 | 99 |
| 330 | 3300036401 | Ga0373937_0126066 | Ga0373937_0126066_244_543 | 99 |
| 331 | 3300037068 | Ga0373925_0032780 | Ga0373925_0032780_3150_3449 | 99 |
| 332 | 3300037068 | Ga0373925_0066308 | Ga0373925_0066308_1023_1322 | 99 |
| 333 | 3300037471 | Ga0395905_1057099 | Ga0395905_1057099_335_634 | 99 |
| 334 | 3300037853 | Ga0436364_0539527 | Ga0436364_0539527_1373_1672 | 99 |
| 335 | 3300037853 | Ga0436364_0563378 | Ga0436364_0563378_131_430 | 99 |
| 336 | 3300038443 | Ga0395901_1927766 | Ga0395901_1927766_174_473 | 99 |
| 337 | 3300039437 | Ga0436365_0614193 | Ga0436365_0614193_51_350 | 99 |
| 338 | 3300039437 | Ga0436365_1046860 | Ga0436365_1046860_281_580 | 99 |
| 339 | 3300039437 | Ga0436365_1245822 | Ga0436365_1245822_265_564 | 99 |
| 340 | 3300039437 | Ga0436365_1445192 | Ga0436365_1445192_377_676 | 99 |
| 341 | 3300039437 | Ga0436365_1605872 | Ga0436365_1605872_564_863 | 99 |
| 342 | 3300039437 | Ga0436365_1608629 | Ga0436365_1608629_513_812 | 99 |
| 343 | 3300039437 | Ga0436365_1935336 | Ga0436365_1935336_145_444 | 99 |
| 344 | 3300039438 | Ga0436360_1351765 | Ga0436360_1351765_421_723 | 99 |
| 345 | 3300039447 | Ga0436361_0551964 | Ga0436361_0551964_130_429 | 99 |
| 346 | 3300039447 | Ga0436361_0659925 | Ga0436361_0659925_1096_1395 | 99 |
| 347 | 3300039450 | Ga0436363_0233082 | Ga0436363_0233082_73_372 | 99 |
| 348 | 3300039450 | Ga0436363_1069942 | Ga0436363_1069942_457_756 | 99 |
| 349 | 3300039453 | Ga0436362_0221915 | Ga0436362_0221915_85_384 | 99 |
| 350 | 3300041451 | Ga0451791_0684621 | Ga0451791_0684621_144_452 | 99 |
| 351 | 3300041453 | Ga0451797_0774619 | Ga0451797_0774619_222_530 | 99 |
| 352 | 3300041486 | Ga0451807_1734530 | Ga0451807_1734530_270_578 | 99 |
| 353 | 3300041491 | Ga0451833_0197010 | Ga0451833_0197010_321_629 | 99 |
| 354 | 3300041498 | Ga0451841_0062055 | Ga0451841_0062055_516_824 | 99 |
| 355 | 3300041509 | Ga0451843_0375183 | Ga0451843_0375183_599_907 | 99 |
| 356 | 3300041512 | Ga0451853_3743631 | Ga0451853_3743631_38_337 | 99 |
| 357 | 3300042004 | Ga0439445_0252529 | Ga0439445_0252529_160_459 | 99 |
| 358 | 3300044719 | Ga0466971_0579684 | Ga0466971_0579684_19_318 | 99 |
| 359 | 3300045049 | Ga0466959_0327013 | Ga0466959_0327013_17_316 | 99 |
| 360 | 3300045976 | Ga0466967_0178939 | Ga0466967_0178939_684_983 | 99 |
| 361 | 3300046454 | Ga0495592_0002995 | Ga0495592_0002995_4416_4715 | 99 |
| 362 | 3300046454 | Ga0495592_0116414 | Ga0495592_0116414_1480_1779 | 99 |
| 363 | 3300046457 | Ga0495590_0018187 | Ga0495590_0018187_302_601 | 99 |
| 364 | 3300046459 | Ga0495629_0003398 | Ga0495629_0003398_8695_8994 | 99 |
| 365 | 3300046459 | Ga0495629_0151603 | Ga0495629_0151603_178_477 | 99 |
| 366 | 3300046461 | Ga0495641_0140173 | Ga0495641_0140173_143_442 | 99 |
| 367 | 3300046462 | Ga0495651_0010780 | Ga0495651_0010780_821_1120 | 99 |
| 368 | 3300046462 | Ga0495651_0175282 | Ga0495651_0175282_412_711 | 99 |
| 369 | 3300046463 | Ga0495653_0000370 | Ga0495653_0000370_24410_24709 | 99 |
| 370 | 3300046463 | Ga0495653_0061061 | Ga0495653_0061061_167_466 | 99 |
| 371 | 3300046463 | Ga0495653_0063779 | Ga0495653_0063779_412_711 | 99 |
| 372 | 3300046475 | Ga0495639_0741729 | Ga0495639_0741729_62_361 | 99 |
| 373 | 3300046476 | Ga0495662_0204999 | Ga0495662_0204999_517_816 | 99 |
| 374 | 3300046477 | Ga0495664_0060532 | Ga0495664_0060532_1668_1967 | 99 |
| 375 | 3300046477 | Ga0495664_0104730 | Ga0495664_0104730_11_310 | 99 |
| 376 | 3300046499 | Ga0495594_0155889 | Ga0495594_0155889_786_1085 | 99 |
| 377 | 3300046500 | Ga0495596_0178998 | Ga0495596_0178998_139_447 | 99 |
| 378 | 3300046511 | Ga0495608_0014254 | Ga0495608_0014254_2562_2861 | 99 |
| 379 | 3300046511 | Ga0495608_0071471 | Ga0495608_0071471_306_605 | 99 |
| 380 | 3300046511 | Ga0495608_0491643 | Ga0495608_0491643_119_418 | 99 |
| 381 | 3300046514 | Ga0495618_0012751 | Ga0495618_0012751_3414_3713 | 99 |
| 382 | 3300046514 | Ga0495618_0590176 | Ga0495618_0590176_329_628 | 99 |
| 383 | 3300046516 | Ga0495628_0003568 | Ga0495628_0003568_7521_7820 | 99 |
| 384 | 3300046516 | Ga0495628_0005831 | Ga0495628_0005831_2031_2330 | 99 |
| 385 | 3300046517 | Ga0495630_1227919 | Ga0495630_1227919_96_395 | 99 |
| 386 | 3300046522 | Ga0495643_0024522 | Ga0495643_0024522_687_995 | 99 |
| 387 | 3300046525 | Ga0495663_0066915 | Ga0495663_0066915_665_973 | 99 |
| 388 | 3300046528 | Ga0495642_0200367 | Ga0495642_0200367_502_801 | 99 |
| 389 | 3300046529 | Ga0495652_0090680 | Ga0495652_0090680_935_1234 | 99 |
| 390 | 3300046529 | Ga0495652_0394656 | Ga0495652_0394656_133_432 | 99 |
| 391 | 3300046530 | Ga0495654_0062673 | Ga0495654_0062673_112_420 | 99 |
| 392 | 3300046531 | Ga0495665_0072108 | Ga0495665_0072108_559_858 | 99 |
| 393 | 3300046531 | Ga0495665_0127749 | Ga0495665_0127749_738_1037 | 99 |
| 394 | 3300046533 | Ga0495640_0000769 | Ga0495640_0000769_16149_16448 | 99 |
| 395 | 3300046533 | Ga0495640_0099168 | Ga0495640_0099168_1034_1333 | 99 |
| 396 | 3300046533 | Ga0495640_0199344 | Ga0495640_0199344_922_1221 | 99 |
| 397 | 3300046535 | Ga0495586_0565733 | Ga0495586_0565733_85_384 | 99 |
| 398 | 3300046536 | Ga0495587_0001869 | Ga0495587_0001869_1439_1738 | 99 |
| 399 | 3300046536 | Ga0495587_0643958 | Ga0495587_0643958_53_352 | 99 |
| 400 | 3300046543 | Ga0495645_0050307 | Ga0495645_0050307_812_1111 | 99 |
| 401 | 3300046543 | Ga0495645_0317334 | Ga0495645_0317334_273_572 | 99 |
| 402 | 3300046543 | Ga0495645_0389262 | Ga0495645_0389262_289_588 | 99 |
| 403 | 3300046559 | Ga0495667_0001942 | Ga0495667_0001942_8963_9262 | 99 |
| 404 | 3300046559 | Ga0495667_0115907 | Ga0495667_0115907_391_690 | 99 |
| 405 | 3300046616 | Ga0495668_0000015 | Ga0495668_0000015_4284_4592 | 99 |
| 406 | 3300046642 | Ga0495634_0002200 | Ga0495634_0002200_8988_9287 | 99 |
| 407 | 3300046660 | Ga0495625_0004430 | Ga0495625_0004430_11776_12084 | 99 |
| 408 | 3300046663 | Ga0495635_0004328 | Ga0495635_0004328_6815_7114 | 99 |
| 409 | 3300046663 | Ga0495635_0008888 | Ga0495635_0008888_368_667 | 99 |
| 410 | 3300046675 | Ga0495657_0015052 | Ga0495657_0015052_143_442 | 99 |
| 411 | 3300046675 | Ga0495657_0096649 | Ga0495657_0096649_1001_1300 | 99 |
| 412 | 3300046678 | Ga0495599_0054944 | Ga0495599_0054944_401_700 | 99 |
| 413 | 3300046678 | Ga0495599_0067022 | Ga0495599_0067022_1663_1962 | 99 |
| 414 | 3300046679 | Ga0495623_0003723 | Ga0495623_0003723_8938_9237 | 99 |
| 415 | 3300046679 | Ga0495623_0040141 | Ga0495623_0040141_376_675 | 99 |
| 416 | 3300046680 | Ga0495646_0022938 | Ga0495646_0022938_641_940 | 99 |
| 417 | 3300046680 | Ga0495646_0091953 | Ga0495646_0091953_774_1073 | 99 |
| 418 | 3300046680 | Ga0495646_0171244 | Ga0495646_0171244_285_584 | 99 |
| 419 | 3300046683 | Ga0495658_0015745 | Ga0495658_0015745_3227_3526 | 99 |
| 420 | 3300046683 | Ga0495658_0086177 | Ga0495658_0086177_22_321 | 99 |
| 421 | 3300046690 | Ga0495624_0354859 | Ga0495624_0354859_163_462 | 99 |
| 422 | 3300046692 | Ga0495671_0348952 | Ga0495671_0348952_92_391 | 99 |
| 423 | 3300046809 | Ga0495600_0000422 | Ga0495600_0000422_11905_12204 | 99 |
| 424 | 3300046809 | Ga0495600_0152028 | Ga0495600_0152028_1043_1342 | 99 |
| 425 | 3300047315 | Ga0495581_0228187 | Ga0495581_0228187_112_411 | 99 |
| 426 | 3300047317 | Ga0495604_0000406 | Ga0495604_0000406_18044_18343 | 99 |
| 427 | 3300047317 | Ga0495604_0053710 | Ga0495604_0053710_421_720 | 99 |
| 428 | 3300047317 | Ga0495604_0083692 | Ga0495604_0083692_904_1203 | 99 |
| 429 | 3300047319 | Ga0495674_0000757 | Ga0495674_0000757_22349_22648 | 99 |
| 430 | 3300047319 | Ga0495674_0360804 | Ga0495674_0360804_738_1037 | 99 |
| 431 | 3300047319 | Ga0495674_0487973 | Ga0495674_0487973_570_869 | 99 |
| 432 | 3300047320 | Ga0495672_0191493 | Ga0495672_0191493_549_848 | 99 |
| 433 | 3300047321 | Ga0495676_0030911 | Ga0495676_0030911_3768_4067 | 99 |
| 434 | 3300047322 | Ga0495680_0001477 | Ga0495680_0001477_12322_12621 | 99 |
| 435 | 3300047322 | Ga0495680_0058793 | Ga0495680_0058793_317_616 | 99 |
| 436 | 3300047322 | Ga0495680_0068123 | Ga0495680_0068123_694_993 | 99 |
| 437 | 3300047444 | Ga0495675_0062506 | Ga0495675_0062506_250_549 | 99 |
| 438 | 3300047444 | Ga0495675_0426758 | Ga0495675_0426758_199_498 | 99 |
| 439 | 3300047471 | Ga0495684_0008747 | Ga0495684_0008747_1566_1865 | 99 |
| 440 | 3300047471 | Ga0495684_0165279 | Ga0495684_0165279_500_799 | 99 |
| 441 | 3300047472 | Ga0495686_0280624 | Ga0495686_0280624_334_633 | 99 |
| 442 | 3300048088 | Ga0495602_0064112 | Ga0495602_0064112_2641_2940 | 99 |
| 443 | 3300048088 | Ga0495602_0231319 | Ga0495602_0231319_554_853 | 99 |
| 444 | 3300048088 | Ga0495602_0481283 | Ga0495602_0481283_362_661 | 99 |
| 445 | 3300048091 | Ga0495626_0094952 | Ga0495626_0094952_180_479 | 99 |
| 446 | 3300048904 | Ga0496101_0125826 | Ga0496101_0125826_248_547 | 99 |
| 447 | 3300048905 | Ga0496102_0188965 | Ga0496102_0188965_1520_1819 | 99 |
| 448 | 3300048907 | Ga0496104_0000399 | Ga0496104_0000399_35811_36110 | 99 |
| 449 | 3300048907 | Ga0496104_0521147 | Ga0496104_0521147_567_866 | 99 |
| 450 | 3300048907 | Ga0496104_0523266 | Ga0496104_0523266_588_887 | 99 |
| 451 | 3300048908 | Ga0496105_0002417 | Ga0496105_0002417_11733_12032 | 99 |
| 452 | 3300048908 | Ga0496105_0098094 | Ga0496105_0098094_1728_2027 | 99 |
| 453 | 3300048909 | Ga0496106_0042430 | Ga0496106_0042430_1301_1600 | 99 |
| 454 | 3300048910 | Ga0496107_0118946 | Ga0496107_0118946_156_455 | 99 |
| 455 | 3300048910 | Ga0496107_0337157 | Ga0496107_0337157_275_574 | 99 |
| 456 | 3300048911 | Ga0496108_1770880 | Ga0496108_1770880_180_479 | 99 |
| 457 | 3300048912 | Ga0496109_0226409 | Ga0496109_0226409_553_852 | 99 |
| 458 | 3300048912 | Ga0496109_0962903 | Ga0496109_0962903_464_763 | 99 |
| 459 | 3300048913 | Ga0496110_1202111 | Ga0496110_1202111_185_484 | 99 |
| 460 | 3300048915 | Ga0496112_0699138 | Ga0496112_0699138_333_632 | 99 |
| 461 | 3300048918 | Ga0496115_0047461 | Ga0496115_0047461_995_1294 | 99 |
| 462 | 3300048918 | Ga0496115_0076081 | Ga0496115_0076081_938_1237 | 99 |
| 463 | 3300048921 | Ga0496118_0227250 | Ga0496118_0227250_640_939 | 99 |
| 464 | 3300048927 | Ga0496124_0238928 | Ga0496124_0238928_292_591 | 99 |
| 465 | 3300048927 | Ga0496124_0991349 | Ga0496124_0991349_152_460 | 99 |
| 466 | 3300048928 | Ga0496125_0023890 | Ga0496125_0023890_5115_5414 | 99 |
| 467 | 3300048929 | Ga0496126_0396598 | Ga0496126_0396598_316_624 | 99 |
| 468 | 3300049127 | Ga0501306_023495 | Ga0501306_023495_455_763 | 99 |
| 469 | 3300049536 | Ga0501320_036040 | Ga0501320_036040_49_357 | 99 |
| 470 | 3300049538 | Ga0501322_018236 | Ga0501322_018236_130_438 | 99 |
| 471 | 3300049568 | Ga0501031_0335074 | Ga0501031_0335074_305_604 | 99 |
| 472 | 3300049569 | Ga0501032_0045571 | Ga0501032_0045571_735_1034 | 99 |
| 473 | 3300049569 | Ga0501032_0058423 | Ga0501032_0058423_1501_1800 | 99 |
| 474 | 3300049569 | Ga0501032_0474181 | Ga0501032_0474181_492_791 | 99 |
| 475 | 3300049570 | Ga0501033_0107086 | Ga0501033_0107086_240_539 | 99 |
| 476 | 3300049570 | Ga0501033_0328006 | Ga0501033_0328006_496_795 | 99 |
| 477 | 3300049571 | Ga0501034_0090345 | Ga0501034_0090345_2390_2689 | 99 |
| 478 | 3300049571 | Ga0501034_0132600 | Ga0501034_0132600_145_444 | 99 |
| 479 | 3300049571 | Ga0501034_0134254 | Ga0501034_0134254_1489_1788 | 99 |
| 480 | 3300049571 | Ga0501034_0212658 | Ga0501034_0212658_59_358 | 99 |
| 481 | 3300049571 | Ga0501034_0623346 | Ga0501034_0623346_448_753 | 99 |
| 482 | 3300049572 | Ga0501036_0189285 | Ga0501036_0189285_1257_1556 | 99 |
| 483 | 3300049572 | Ga0501036_0268203 | Ga0501036_0268203_824_1123 | 99 |
| 484 | 3300049572 | Ga0501036_0312106 | Ga0501036_0312106_999_1298 | 99 |
| 485 | 3300049572 | Ga0501036_0528883 | Ga0501036_0528883_49_348 | 99 |
| 486 | 3300049573 | Ga0501037_0118828 | Ga0501037_0118828_774_1073 | 99 |
| 487 | 3300049573 | Ga0501037_0426027 | Ga0501037_0426027_461_766 | 99 |
| 488 | 3300049573 | Ga0501037_0851841 | Ga0501037_0851841_119_418 | 99 |
| 489 | 3300049574 | Ga0501038_0058047 | Ga0501038_0058047_1551_1850 | 99 |
| 490 | 3300049574 | Ga0501038_0300648 | Ga0501038_0300648_54_353 | 99 |
| 491 | 3300049575 | Ga0501039_0070689 | Ga0501039_0070689_227_526 | 99 |
| 492 | 3300049575 | Ga0501039_0097766 | Ga0501039_0097766_1458_1757 | 99 |
| 493 | 3300049576 | Ga0501040_0026515 | Ga0501040_0026515_719_1018 | 99 |
| 494 | 3300049576 | Ga0501040_0297895 | Ga0501040_0297895_347_646 | 99 |
| 495 | 3300049578 | Ga0501042_0380390 | Ga0501042_0380390_181_480 | 99 |
| 496 | 3300049578 | Ga0501042_0867999 | Ga0501042_0867999_133_432 | 99 |
| 497 | 3300049579 | Ga0501043_0348979 | Ga0501043_0348979_107_406 | 99 |
| 498 | 3300049579 | Ga0501043_0654040 | Ga0501043_0654040_53_352 | 99 |
| 499 | 3300049580 | Ga0501046_0507063 | Ga0501046_0507063_511_810 | 99 |
| 500 | 3300049581 | Ga0501047_0155663 | Ga0501047_0155663_460_759 | 99 |
| 501 | 3300049581 | Ga0501047_0205740 | Ga0501047_0205740_723_1022 | 99 |
| 502 | 3300049582 | Ga0501048_0308399 | Ga0501048_0308399_317_616 | 99 |
| 503 | 3300049582 | Ga0501048_0393070 | Ga0501048_0393070_643_942 | 99 |
| 504 | 3300049583 | Ga0501067_0051199 | Ga0501067_0051199_15_314 | 99 |
| 505 | 3300049583 | Ga0501067_0251762 | Ga0501067_0251762_64_363 | 99 |
| 506 | 3300049584 | Ga0501068_0029125 | Ga0501068_0029125_786_1085 | 99 |
| 507 | 3300049584 | Ga0501068_0057493 | Ga0501068_0057493_801_1100 | 99 |
| 508 | 3300049584 | Ga0501068_0111569 | Ga0501068_0111569_376_675 | 99 |
| 509 | 3300049584 | Ga0501068_0858507 | Ga0501068_0858507_235_534 | 99 |
| 510 | 3300049585 | Ga0501069_0030545 | Ga0501069_0030545_913_1212 | 99 |
| 511 | 3300049585 | Ga0501069_0383742 | Ga0501069_0383742_142_441 | 99 |
| 512 | 3300049585 | Ga0501069_0710591 | Ga0501069_0710591_189_488 | 99 |
| 513 | 3300049586 | Ga0501070_0067473 | Ga0501070_0067473_1198_1497 | 99 |
| 514 | 3300049586 | Ga0501070_0083561 | Ga0501070_0083561_1477_1776 | 99 |
| 515 | 3300049586 | Ga0501070_0202001 | Ga0501070_0202001_772_1077 | 99 |
| 516 | 3300049586 | Ga0501070_0242991 | Ga0501070_0242991_44_343 | 99 |
| 517 | 3300049586 | Ga0501070_0794514 | Ga0501070_0794514_19_318 | 99 |
| 518 | 3300049587 | Ga0501071_0063412 | Ga0501071_0063412_1118_1417 | 99 |
| 519 | 3300049587 | Ga0501071_0088539 | Ga0501071_0088539_494_793 | 99 |
| 520 | 3300049587 | Ga0501071_0357403 | Ga0501071_0357403_122_421 | 99 |
| 521 | 3300049587 | Ga0501071_0782871 | Ga0501071_0782871_406_705 | 99 |
| 522 | 3300049588 | Ga0501072_0029078 | Ga0501072_0029078_3384_3683 | 99 |
| 523 | 3300049588 | Ga0501072_0067263 | Ga0501072_0067263_1318_1617 | 99 |
| 524 | 3300049588 | Ga0501072_0646656 | Ga0501072_0646656_324_623 | 99 |
| 525 | 3300049589 | Ga0501073_0040649 | Ga0501073_0040649_2273_2572 | 99 |
| 526 | 3300049589 | Ga0501073_0086033 | Ga0501073_0086033_1382_1681 | 99 |
| 527 | 3300049589 | Ga0501073_0311672 | Ga0501073_0311672_444_743 | 99 |
| 528 | 3300049589 | Ga0501073_0728373 | Ga0501073_0728373_34_333 | 99 |
| 529 | 3300049589 | Ga0501073_0907682 | Ga0501073_0907682_189_488 | 99 |
| 530 | 3300049590 | Ga0501074_0049622 | Ga0501074_0049622_1483_1782 | 99 |
| 531 | 3300049590 | Ga0501074_0057437 | Ga0501074_0057437_64_363 | 99 |
| 532 | 3300049590 | Ga0501074_0146813 | Ga0501074_0146813_726_1025 | 99 |
| 533 | 3300049591 | Ga0501075_0217916 | Ga0501075_0217916_251_550 | 99 |
| 534 | 3300049592 | Ga0501076_0222571 | Ga0501076_0222571_62_361 | 99 |
| 535 | 3300049592 | Ga0501076_0342573 | Ga0501076_0342573_39_338 | 99 |
| 536 | 3300049593 | Ga0501077_0305720 | Ga0501077_0305720_273_572 | 99 |
| 537 | 3300049741 | Ga0501079_0182947 | Ga0501079_0182947_514_813 | 99 |
| 538 | 3300049742 | Ga0501080_0041183 | Ga0501080_0041183_3767_4066 | 99 |
| 539 | 3300049742 | Ga0501080_0141304 | Ga0501080_0141304_1198_1497 | 99 |
| 540 | 3300049742 | Ga0501080_0195626 | Ga0501080_0195626_890_1189 | 99 |
| 541 | 3300049743 | Ga0501081_0664905 | Ga0501081_0664905_375_674 | 99 |
| 542 | 3300049743 | Ga0501081_0734657 | Ga0501081_0734657_329_628 | 99 |
| 543 | 3300049743 | Ga0501081_0872663 | Ga0501081_0872663_272_571 | 99 |
| 544 | 3300049744 | Ga0501083_0153487 | Ga0501083_0153487_1038_1337 | 99 |
| 545 | 3300049744 | Ga0501083_0340546 | Ga0501083_0340546_543_842 | 99 |
| 546 | 3300049822 | Ga0501035_0160450 | Ga0501035_0160450_1280_1579 | 99 |
| 547 | 3300049822 | Ga0501035_1116084 | Ga0501035_1116084_245_550 | 99 |
| 548 | 3300049822 | Ga0501035_1127664 | Ga0501035_1127664_245_550 | 99 |
| 549 | 3300049823 | Ga0501044_0105973 | Ga0501044_0105973_1499_1798 | 99 |
| 550 | 3300049823 | Ga0501044_0128361 | Ga0501044_0128361_2150_2455 | 99 |
| 551 | 3300049823 | Ga0501044_0172926 | Ga0501044_0172926_1687_1986 | 99 |
| 552 | 3300049823 | Ga0501044_0270613 | Ga0501044_0270613_809_1108 | 99 |
| 553 | 3300049823 | Ga0501044_0273668 | Ga0501044_0273668_1262_1561 | 99 |
| 554 | 3300049824 | Ga0501045_0313307 | Ga0501045_0313307_844_1143 | 99 |
| 555 | 3300050496 | nmdc:mga07m45_115921_c1 | nmdc:mga07m45_115921_c1_807_1106 | 99 |
| 556 | 3300050507 | nmdc:mga05p37_2115048_c1 | nmdc:mga05p37_2115048_c1_46_345 | 99 |
| 557 | 3300050507 | nmdc:mga05p37_434840_c1 | nmdc:mga05p37_434840_c1_546_845 | 99 |
| 558 | 3300050508 | nmdc:mga09592_372677_c1 | nmdc:mga09592_372677_c1_520_819 | 99 |
| 559 | 3300050509 | nmdc:mga0qj67_225617_c1 | nmdc:mga0qj67_225617_c1_427_726 | 99 |
| 560 | 3300050509 | nmdc:mga0qj67_44746_c1 | nmdc:mga0qj67_44746_c1_1906_2205 | 99 |
| 561 | 3300050509 | nmdc:mga0qj67_875435_c1 | nmdc:mga0qj67_875435_c1_177_476 | 99 |
| 562 | 3300050510 | nmdc:mga06r32_887796_c1 | nmdc:mga06r32_887796_c1_168_467 | 99 |
| 563 | 3300050511 | nmdc:mga08y16_136821_c1 | nmdc:mga08y16_136821_c1_231_530 | 99 |
| 564 | 3300050512 | nmdc:mga0n895_189483_c1 | nmdc:mga0n895_189483_c1_917_1216 | 99 |
| 565 | 3300050515 | nmdc:mga0a205_66873_c1 | nmdc:mga0a205_66873_c1_1204_1503 | 99 |
| 566 | 3300053077 | Ga0495601_0003476 | Ga0495601_0003476_8503_8802 | 99 |
| 567 | 3300053077 | Ga0495601_0004742 | Ga0495601_0004742_3488_3787 | 99 |
| 568 | 3300053077 | Ga0495601_0007996 | Ga0495601_0007996_2311_2610 | 99 |
| 569 | 3300053078 | Ga0495612_0002228 | Ga0495612_0002228_3974_4273 | 99 |
| 570 | 3300053078 | Ga0495612_0089635 | Ga0495612_0089635_588_887 | 99 |
| 571 | 3300053078 | Ga0495612_0144431 | Ga0495612_0144431_119_418 | 99 |
| 572 | 3300053083 | Ga0495655_0031218 | Ga0495655_0031218_948_1247 | 99 |
| 573 | 3300053084 | Ga0495595_0001345 | Ga0495595_0001345_8424_8723 | 99 |
| 574 | 3300053084 | Ga0495595_0007610 | Ga0495595_0007610_777_1076 | 99 |
| 575 | 3300053084 | Ga0495595_0040126 | Ga0495595_0040126_283_582 | 99 |
| 576 | 3300053085 | Ga0495619_0000352 | Ga0495619_0000352_18620_18919 | 99 |
| 577 | 3300053085 | Ga0495619_0013467 | Ga0495619_0013467_3773_4072 | 99 |
| 578 | 3300053085 | Ga0495619_0015650 | Ga0495619_0015650_407_706 | 99 |
| 579 | 3300053088 | Ga0500644_0008929 | Ga0500644_0008929_324_623 | 99 |
| 580 | 3300053116 | Ga0500592_004394 | Ga0500592_004394_31_339 | 99 |
| 581 | 3300053134 | Ga0500658_0011094 | Ga0500658_0011094_1376_1684 | 99 |
| 582 | 3300053139 | Ga0500568_0013224 | Ga0500568_0013224_2452_2760 | 99 |
| 583 | 3300053151 | Ga0500604_0032973 | Ga0500604_0032973_792_1100 | 99 |
| 584 | 3300053153 | Ga0500616_0179292 | Ga0500616_0179292_186_485 | 99 |
| 585 | 3300053153 | Ga0500616_0284023 | Ga0500616_0284023_365_664 | 99 |
| 586 | 3300053158 | Ga0500627_0000009 | Ga0500627_0000009_148524_148832 | 99 |
| 587 | 3300054114 | Ga0501084_0130731 | Ga0501084_0130731_1263_1562 | 99 |
| 588 | 3300054114 | Ga0501084_0303891 | Ga0501084_0303891_263_562 | 99 |
| 589 | 3300054114 | Ga0501084_0595091 | Ga0501084_0595091_31_330 | 99 |
| 590 | 3300059493 | Ga0587077_236276 | Ga0587077_236276_175_483 | 99 |
| 591 | 3300060353 | Ga0501082_0109453 | Ga0501082_0109453_613_912 | 99 |
| 592 | 3300060353 | Ga0501082_0301898 | Ga0501082_0301898_372_671 | 99 |
| 593 | 3300060353 | Ga0501082_0788570 | Ga0501082_0788570_28_327 | 99 |
| 594 | 3300060353 | Ga0501082_1148750 | Ga0501082_1148750_144_443 | 99 |
| 595 | 3300061719 | Ga0466962_0597379 | Ga0466962_0597379_139_438 | 99 |
| 596 | 3300003203 | JGI25406J46586_10118782 | JGI25406J46586_101187822 | 100 |
| 597 | 3300003354 | JGI25160J50197_1015787 | JGI25160J50197_10157873 | 100 |
| 598 | 3300005262 | Ga0065165_1044790 | Ga0065165_10447902 | 100 |
| 599 | 3300005985 | Ga0081539_10054324 | Ga0081539_100543245 | 100 |
| 600 | 3300006941 | Ga0099825_1058931 | Ga0099825_10589312 | 100 |
| 601 | 3300020070 | Ga0206356_11866436 | Ga0206356_118664362 | 100 |
| 602 | 3300021320 | Ga0214544_1000006 | Ga0214544_1000006183 | 100 |
| 603 | 3300021321 | Ga0214542_1000002 | Ga0214542_1000002192 | 100 |
| 604 | 3300021324 | Ga0214545_1000002 | Ga0214545_1000002527 | 100 |
| 605 | 3300021327 | Ga0214543_1000017 | Ga0214543_1000017131 | 100 |
| 606 | 3300025302 | Ga0207426_1012954 | Ga0207426_10129545 | 100 |
| 607 | 3300025898 | Ga0207692_10523415 | Ga0207692_105234152 | 100 |
| 608 | 3300027296 | Ga0209389_1002002 | Ga0209389_100200223 | 100 |
| 609 | 3300027357 | Ga0209589_1000300 | Ga0209589_100030021 | 100 |
| 610 | 3300027361 | Ga0209489_100010 | Ga0209489_100010236 | 100 |
| 611 | 3300027361 | Ga0209489_116934 | Ga0209489_1169345 | 100 |
| 612 | 3300027363 | Ga0209700_100031 | Ga0209700_100031166 | 100 |
| 613 | 3300037312 | Ga0395899_0124704 | Ga0395899_0124704_1028_1330 | 100 |
| 614 | 3300037418 | Ga0395900_0022503 | Ga0395900_0022503_3277_3579 | 100 |
| 615 | 3300037466 | Ga0395898_0371206 | Ga0395898_0371206_607_909 | 100 |
| 616 | 3300037471 | Ga0395905_0413453 | Ga0395905_0413453_915_1217 | 100 |
| 617 | 3300038443 | Ga0395901_0045720 | Ga0395901_0045720_2051_2353 | 100 |
| 618 | 3300044658 | Ga0466972_0019604 | Ga0466972_0019604_2443_2745 | 100 |
| 619 | 3300044658 | Ga0466972_0088328 | Ga0466972_0088328_841_1143 | 100 |
| 620 | 3300044683 | Ga0466965_0752777 | Ga0466965_0752777_107_409 | 100 |
| 621 | 3300044735 | Ga0466968_0300698 | Ga0466968_0300698_380_682 | 100 |
| 622 | 3300044901 | Ga0466960_0660720 | Ga0466960_0660720_55_357 | 100 |
| 623 | 3300049459 | Ga0495678_118787 | Ga0495678_118787_481_783 | 100 |
| 624 | 3300049571 | Ga0501034_1540172 | Ga0501034_1540172_200_502 | 100 |
| 625 | 3300059477 | Ga0587084_159606 | Ga0587084_159606_170_472 | 100 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7m4z-assembly1.cif.gz_S | a. baumannii ribosome-eravacycline complex: hpf-bound 70s | 0.9725 | 8 | 92 |
| 8cgd-assembly1.cif.gz_s | clindamycin bound to the 50s subunit | 0.9711 | 8 | 89 |
| 7nhn-assembly1.cif.gz_W | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9653 | 9 | 95 |
| 6ppf-assembly1.cif.gz_T | bacterial 45srbga ribosomal particle class b | 0.9612 | 9 | 95 |
| 8cvm-assembly1.cif.gz_s | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9592 | 9 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9613 | 9 | 95 | 3.30.70.330 |
| 4ukhK00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9513 | 9 | 92 | 3.30.70.330 |
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9199 | 9 | 95 | 3.30.70.330 |
| 4garT00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9148 | 6 | 94 | 3.30.70.330 |
| af_P61845_1_86_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9041 | 11 | 95 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F8FZ40-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9919 | 12 | 95 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1G2RDF2-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9901 | 11 | 96 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1F8FIA2-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9881 | 12 | 96 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2H0VBE9-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.987 | 9 | 95 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A554K197-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9869 | 7 | 96 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar