F470371

General Info

Members Datasets Scaffolds Average Seq Length
625 380 598 99

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10123178|Ga0265338_101231783
Length 111
Sequence MSLFGKQEAKKAEHIDLAPHYNVVLSPVITEKATNGSQYNQVTFRVHRQSTKPQIRMAIEALFNVKVTAVNTHNRMGKTKRVKGRKGFRQDVKFAIVTLKEGNTIDVTTGL

Samples

Sample ID Description Type Environment
1 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
2 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
3 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
4 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
5 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
6 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
7 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
8 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
9 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
10 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
11 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
12 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
13 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
14 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
15 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
16 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
17 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
18 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
19 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
20 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
21 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
22 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
23 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
24 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
25 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
26 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
27 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
28 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
30 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
34 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
35 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
111 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
112 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
113 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
116 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
158 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
159 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
160 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
165 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
166 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
167 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
168 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
169 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
170 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
171 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
174 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
175 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
176 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
178 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
185 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
195 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
197 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
198 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
199 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
200 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
201 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
204 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
205 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
206 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
207 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
208 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
209 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
212 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
230 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
231 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
232 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
233 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
234 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
235 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
236 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
239 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
240 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
241 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
242 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
243 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
246 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
247 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
248 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
249 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
256 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
257 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
258 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
259 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
260 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
261 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
262 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
263 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
264 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
265 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
266 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
267 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
268 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
269 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
270 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
271 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
278 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
279 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
280 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
281 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
282 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
283 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
284 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
285 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
286 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
287 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
288 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
289 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
290 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
291 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
292 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
293 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
294 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
295 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
296 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
297 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
298 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
309 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
310 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
311 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
312 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
314 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
333 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
334 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
335 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
336 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
337 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
338 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
339 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
340 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
341 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
342 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
343 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
344 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
345 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
346 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
347 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
350 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
351 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
352 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
355 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
356 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
357 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
358 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
359 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
360 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
361 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
362 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
363 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
364 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
365 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
366 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
367 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
368 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
369 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
370 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
371 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
372 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
373 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
374 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
375 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
376 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
377 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
380 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.44
Metatranscriptomes 2.24
Isolates 4.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.56
Nodule 2.88
Rhizoplane 4
Rhizosphere 79.36
Stem 0
Stem Tuber 0
Unclassified 7.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10118782 3300003203 Bacteria 779
2 JGI25160J50197_1015787 3300003354 Bacteria 2463
3 Ga0055536_1023681 3300003781 Bacteria 1799
4 Ga0055536_1024175 3300003781 Bacteria 1767
5 Ga0055536_1091335 3300003781 Bacteria 559
6 Ga0055530_10009419 3300003791 Bacteria 3754
7 Ga0055530_10052734 3300003791 Bacteria 937
8 Ga0055531_10024322 3300003794 Bacteria 2239
9 Ga0055531_10024340 3300003794 Bacteria 2238
10 Ga0058859_11684652 3300004798 Bacteria 773
11 Ga0058861_11770653 3300004800 Bacteria 551
12 Ga0058862_12365026 3300004803 Bacteria 614
13 Ga0065165_1044790 3300005262 Bacteria 1292
14 Ga0070683_100046388 3300005329 Bacteria 4014
15 Ga0070683_101934320 3300005329 Bacteria 567
16 Ga0070690_100226037 3300005330 Bacteria 1313
17 Ga0068868_101436419 3300005338 Bacteria 644
18 Ga0070660_101134532 3300005339 Bacteria 662
19 Ga0070661_100593494 3300005344 Bacteria 895
20 Ga0070661_101916657 3300005344 Bacteria 504
21 Ga0070675_100564595 3300005354 Bacteria 1030
22 Ga0070673_101097538 3300005364 Bacteria 743
23 Ga0070659_100018511 3300005366 Bacteria 5255
24 Ga0070667_100479068 3300005367 Bacteria 1139
25 Ga0070713_100051698 3300005436 Bacteria 3399
26 Ga0070710_10052773 3300005437 Bacteria 2287
27 Ga0070710_10220853 3300005437 Bacteria 1206
28 Ga0070711_100027798 3300005439 Bacteria 3716
29 Ga0070694_100286379 3300005444 Bacteria 1258
30 Ga0070694_101529228 3300005444 Bacteria 565
31 Ga0070663_100467597 3300005455 Bacteria 1042
32 Ga0070678_100515496 3300005456 Bacteria 1057
33 Ga0070662_100616111 3300005457 Bacteria 914
34 Ga0070685_11444064 3300005466 Bacteria 529
35 Ga0070707_100478908 3300005468 Bacteria 1206
36 Ga0070699_100135661 3300005518 Bacteria 2171
37 Ga0070697_100008562 3300005536 Bacteria 7989
38 Ga0068853_100399888 3300005539 Bacteria 1285
39 Ga0068853_102022781 3300005539 Bacteria 559
40 Ga0070695_101436464 3300005545 Bacteria 573
41 Ga0070665_102388972 3300005548 Bacteria 531
42 Ga0070664_100036245 3300005564 Bacteria 4144
43 Ga0070702_101202788 3300005615 Bacteria 611
44 Ga0068866_10391805 3300005718 Bacteria 894
45 Ga0068866_11007875 3300005718 Bacteria 592
46 Ga0068863_101241058 3300005841 Bacteria 752
47 Ga0068858_101304821 3300005842 Bacteria 714
48 Ga0068860_100751746 3300005843 Bacteria 987
49 Ga0068860_102048812 3300005843 Bacteria 594
50 Ga0068862_102024259 3300005844 Bacteria 587
51 Ga0081455_10017756 3300005937 Bacteria 6806
52 Ga0081538_10159181 3300005981 Bacteria 1007
53 Ga0081540_1058910 3300005983 Bacteria 1847
54 Ga0081539_10054324 3300005985 Bacteria 2237
55 Ga0070717_10162531 3300006028 Bacteria 1938
56 Ga0070717_10362285 3300006028 Bacteria 1298
57 Ga0075365_10292346 3300006038 Bacteria 1146
58 Ga0075365_10913982 3300006038 Bacteria 619
59 Ga0070712_100037138 3300006175 Bacteria 3319
60 Ga0070712_101602211 3300006175 Bacteria 569
61 Ga0075369_10163231 3300006186 Bacteria 1021
62 Ga0075369_10381955 3300006186 Bacteria 663
63 Ga0075366_10828867 3300006195 Bacteria 576
64 Ga0097621_100320313 3300006237 Bacteria 1373
65 Ga0075370_10183910 3300006353 Bacteria 1230
66 Ga0068871_100758913 3300006358 Bacteria 892
67 Ga0068871_101241073 3300006358 Bacteria 700
68 Ga0068871_102148488 3300006358 Bacteria 532
69 Ga0075428_100048564 3300006844 Bacteria 4657
70 Ga0075428_100665538 3300006844 Bacteria 1110
71 Ga0075430_100078655 3300006846 Bacteria 2764
72 Ga0075430_100816232 3300006846 Bacteria 768
73 Ga0075431_100610933 3300006847 Bacteria 1073
74 Ga0075433_10461696 3300006852 Bacteria 1119
75 Ga0075429_100421797 3300006880 Bacteria 1169
76 Ga0075429_100812466 3300006880 Bacteria 819
77 Ga0068865_100539559 3300006881 Bacteria 978
78 Ga0068865_101207197 3300006881 Bacteria 670
79 Ga0099825_1058931 3300006941 Bacteria 683
80 Ga0099795_10085530 3300007788 Bacteria 1214
81 Ga0105240_11919212 3300009093 Bacteria 616
82 Ga0111539_10105552 3300009094 Bacteria 3305
83 Ga0111539_10146569 3300009094 Bacteria 2764
84 Ga0105247_10646913 3300009101 Bacteria 789
85 Ga0114129_10347685 3300009147 Bacteria 1965
86 Ga0114129_13141115 3300009147 Bacteria 539
87 Ga0105243_11798327 3300009148 Bacteria 644
88 Ga0105243_11913280 3300009148 Bacteria 626
89 Ga0105241_10826564 3300009174 Bacteria 855
90 Ga0105248_10731539 3300009177 Bacteria 1116
91 Ga0105248_10955830 3300009177 Bacteria 968
92 Ga0105237_10533898 3300009545 Bacteria 1180
93 Ga0105238_10877479 3300009551 Bacteria 915
94 Ga0105249_11168554 3300009553 Bacteria 840
95 Ga0099796_10081278 3300010159 Bacteria 1189
96 Ga0105239_10585271 3300010375 Bacteria 1272
97 Ga0157317_1007058 3300012475 Bacteria 798
98 Ga0157373_10213046 3300013100 Bacteria 1362
99 Ga0157373_10214208 3300013100 Bacteria 1358
100 Ga0157370_11276082 3300013104 Bacteria 662
101 Ga0163162_12455721 3300013306 Bacteria 599
102 Ga0163162_12620359 3300013306 Bacteria 580
103 Ga0157375_12854714 3300013308 Bacteria 577
104 Ga0163163_10186186 3300014325 Bacteria 2124
105 Ga0163163_10639346 3300014325 Bacteria 1127
106 Ga0163163_11936755 3300014325 Bacteria 649
107 Ga0157380_10192942 3300014326 Bacteria 1800
108 Ga0157377_10312618 3300014745 Bacteria 1041
109 Ga0163161_10506257 3300017792 Bacteria 984
110 Ga0163161_11457255 3300017792 Bacteria 600
111 Ga0184598_102540 3300019182 Bacteria 534
112 Ga0206356_11866436 3300020070 Bacteria 617
113 Ga0214544_1000006 3300021320 Bacteria 380728
114 Ga0214542_1000002 3300021321 Bacteria 720798
115 Ga0214545_1000002 3300021324 Bacteria 727485
116 Ga0214543_1000017 3300021327 Bacteria 290109
117 Ga0213876_10159791 3300021384 Bacteria 1199
118 Ga0213876_10568084 3300021384 Bacteria 603
119 Ga0213871_10041410 3300021441 Bacteria 1238
120 Ga0209675_1000104 3300025291 Bacteria 121249
121 Ga0209676_1004257 3300025292 Bacteria 8077
122 Ga0209676_1027868 3300025292 Bacteria 1770
123 Ga0209025_1036659 3300025294 Bacteria 2191
124 Ga0209758_1053903 3300025297 Bacteria 1378
125 Ga0209758_1143284 3300025297 Bacteria 616
126 Ga0209050_1012904 3300025298 Bacteria 3779
127 Ga0209050_1038106 3300025298 Bacteria 1376
128 Ga0207426_1012954 3300025302 Bacteria 3111
129 Ga0209257_1006356 3300025304 Bacteria 7669
130 Ga0209257_1021998 3300025304 Bacteria 2291
131 Ga0207692_10223839 3300025898 Bacteria 1116
132 Ga0207692_10523415 3300025898 Bacteria 755
133 Ga0207642_10424902 3300025899 Bacteria 800
134 Ga0207710_10029828 3300025900 Bacteria 2376
135 Ga0207688_10423533 3300025901 Bacteria 827
136 Ga0207699_10359866 3300025906 Bacteria 1029
137 Ga0207699_10529140 3300025906 Bacteria 853
138 Ga0207654_10477711 3300025911 Bacteria 877
139 Ga0207707_10146707 3300025912 Bacteria 2063
140 Ga0207671_10318504 3300025914 Bacteria 1231
141 Ga0207693_10085957 3300025915 Bacteria 2464
142 Ga0207693_10200166 3300025915 Bacteria 1571
143 Ga0207693_11085378 3300025915 Bacteria 608
144 Ga0207693_11141061 3300025915 Bacteria 590
145 Ga0207663_10214435 3300025916 Bacteria 1397
146 Ga0207652_10727643 3300025921 Unclassified 884
147 Ga0207652_11232291 3300025921 Bacteria 650
148 Ga0207694_10591075 3300025924 Bacteria 933
149 Ga0207650_10557869 3300025925 Bacteria 961
150 Ga0207659_10882526 3300025926 Bacteria 769
151 Ga0207700_10053321 3300025928 Bacteria 3029
152 Ga0207700_10303832 3300025928 Bacteria 1379
153 Ga0207700_11617775 3300025928 Bacteria 573
154 Ga0207664_10915155 3300025929 Bacteria 787
155 Ga0207664_11845639 3300025929 Bacteria 527
156 Ga0207690_10175415 3300025932 Bacteria 1609
157 Ga0207706_10335759 3300025933 Bacteria 1315
158 Ga0207686_11786121 3300025934 Bacteria 509
159 Ga0207709_10442975 3300025935 Bacteria 1002
160 Ga0207669_10710593 3300025937 Bacteria 827
161 Ga0207669_11463202 3300025937 Bacteria 582
162 Ga0207704_10273867 3300025938 Bacteria 1279
163 Ga0207665_10601169 3300025939 Bacteria 859
164 Ga0207711_10528708 3300025941 Bacteria 1100
165 Ga0207661_12009544 3300025944 Bacteria 524
166 Ga0207679_10065715 3300025945 Bacteria 2716
167 Ga0207651_10427475 3300025960 Bacteria 1132
168 Ga0207712_10386287 3300025961 Bacteria 1173
169 Ga0207639_10053240 3300026041 Bacteria 3087
170 Ga0207639_10807664 3300026041 Bacteria 874
171 Ga0207678_10313479 3300026067 Bacteria 1349
172 Ga0207641_11674369 3300026088 Unclassified 638
173 Ga0207648_10565264 3300026089 Bacteria 1046
174 Ga0207675_100633306 3300026118 Bacteria 1074
175 Ga0207683_11155753 3300026121 Bacteria 718
176 Ga0209389_1002002 3300027296 Bacteria 15108
177 Ga0209589_1000300 3300027357 Bacteria 63625
178 Ga0209489_100010 3300027361 Bacteria 252139
179 Ga0209489_116934 3300027361 Bacteria 3599
180 Ga0209700_100031 3300027363 Bacteria 207349
181 Ga0209974_10029965 3300027876 Bacteria 1803
182 Ga0207428_10164487 3300027907 Bacteria 1683
183 Ga0268266_11386884 3300028379 Bacteria 678
184 Ga0268266_12228493 3300028379 Bacteria 520
185 Ga0265337_1002429 3300028556 Bacteria 8569
186 Ga0265326_10039873 3300028558 Bacteria 1333
187 Ga0265319_1001825 3300028563 Bacteria 12143
188 Ga0265334_10000469 3300028573 Bacteria 20809
189 Ga0265318_10040136 3300028577 Bacteria 1783
190 Ga0265323_10001237 3300028653 Bacteria 12839
191 Ga0265322_10008354 3300028654 Bacteria 3017
192 Ga0265336_10000535 3300028666 Bacteria 21804
193 Ga0265338_10000131 3300028800 Bacteria 137627
194 Ga0265338_10033513 3300028800 Bacteria 4981
195 Ga0265338_10065290 3300028800 Bacteria 3158
196 Ga0265338_10123178 3300028800 Bacteria 2062
197 Ga0265338_10162190 3300028800 Bacteria 1725
198 Ga0265338_10426269 3300028800 Bacteria 942
199 Ga0265338_10884516 3300028800 Bacteria 609
200 Ga0265324_10001269 3300029957 Bacteria 14862
201 Ga0314311_1091187 3300030733 Bacteria 759
202 Ga0316181_1093387 3300030744 Bacteria 1010
203 Ga0265763_1023796 3300030763 Unclassified 660
204 Ga0265328_10055566 3300031239 Bacteria 1453
205 Ga0265325_10001071 3300031241 Bacteria 19727
206 Ga0265325_10136758 3300031241 Bacteria 1168
207 Ga0265339_10000053 3300031249 Bacteria 101277
208 Ga0265339_10200458 3300031249 Bacteria 985
209 Ga0265331_10002092 3300031250 Bacteria 13775
210 Ga0265331_10073351 3300031250 Bacteria 1598
211 Ga0307513_10333316 3300031456 Bacteria 1271
212 Ga0307513_11059987 3300031456 Bacteria 522
213 Ga0307509_10387826 3300031507 Bacteria 1108
214 Ga0307408_100445374 3300031548 Bacteria 1122
215 Ga0307408_101349918 3300031548 Bacteria 670
216 Ga0265313_10000098 3300031595 Bacteria 89130
217 Ga0265313_10006263 3300031595 Bacteria 8479
218 Ga0316575_10088184 3300031665 Bacteria 1255
219 Ga0265314_10018555 3300031711 Bacteria 5422
220 Ga0265342_10574296 3300031712 Bacteria 570
221 Ga0307407_11273433 3300031903 Bacteria 576
222 Ga0307412_11420581 3300031911 Bacteria 628
223 Ga0307409_100947105 3300031995 Bacteria 877
224 Ga0307409_101583311 3300031995 Bacteria 683
225 Ga0307416_100482412 3300032002 Bacteria 1300
226 Ga0307416_103404498 3300032002 Bacteria 532
227 Ga0307414_10012056 3300032004 Bacteria 5098
228 Ga0307414_10107832 3300032004 Bacteria 2111
229 Ga0307411_10046512 3300032005 Bacteria 2798
230 Ga0307411_10706699 3300032005 Bacteria 879
231 Ga0307411_10829394 3300032005 Bacteria 816
232 Ga0316583_10003862 3300032133 Bacteria 5316
233 Ga0316583_10041645 3300032133 Bacteria 1625
234 Ga0316593_10033258 3300032168 Bacteria 1687
235 Ga0316593_10417561 3300032168 Bacteria 520
236 Ga0307510_10263101 3300033180 Bacteria 1205
237 Ga0373930_0040694 3300034816 Bacteria 989
238 Ga0373930_0097218 3300034816 Bacteria 697
239 Ga0373928_0060312 3300035084 Bacteria 916
240 Ga0373940_0014901 3300035088 Bacteria 1904
241 Ga0373951_0013840 3300035091 Bacteria 1814
242 Ga0373952_0171613 3300035092 Bacteria 620
243 Ga0373923_0005324 3300035111 Bacteria 4366
244 Ga0373923_0031770 3300035111 Bacteria 2130
245 Ga0373941_0029005 3300035115 Bacteria 1629
246 Ga0373941_0060667 3300035115 Bacteria 1230
247 Ga0373945_0322626 3300035116 Bacteria 665
248 Ga0373953_0017061 3300035117 Bacteria 2662
249 Ga0373953_0100833 3300035117 Bacteria 1215
250 Ga0373954_0421854 3300035118 Bacteria 660
251 Ga0373954_0467305 3300035118 Bacteria 625
252 Ga0373956_0291928 3300035119 Bacteria 776
253 Ga0373957_0051619 3300035120 Bacteria 1573
254 Ga0373960_0004525 3300035121 Bacteria 3192
255 Ga0373946_0205547 3300035171 Bacteria 945
256 Ga0373946_0205850 3300035171 Bacteria 944
257 Ga0373961_0436798 3300035241 Bacteria 508
258 Ga0373924_0015063 3300035410 Bacteria 2932
259 Ga0373924_0047473 3300035410 Bacteria 1771
260 Ga0373931_0028558 3300035691 Bacteria 2857
261 Ga0373935_0023907 3300035692 Bacteria 3755
262 Ga0373927_0008214 3300035695 Bacteria 7031
263 Ga0373927_0029560 3300035695 Bacteria 3572
264 Ga0373933_0001245 3300035724 Bacteria 15041
265 Ga0373933_0413541 3300035724 Bacteria 880
266 Ga0373933_0555914 3300035724 Bacteria 753
267 Ga0373947_0034962 3300035725 Bacteria 2974
268 Ga0373947_0927229 3300035725 Bacteria 594
269 Ga0373937_0001081 3300036401 Bacteria 22992
270 Ga0373937_0126066 3300036401 Bacteria 2388
271 Ga0373925_0032780 3300037068 Bacteria 3825
272 Ga0373925_0066308 3300037068 Bacteria 2721
273 Ga0395899_0124704 3300037312 Bacteria 1842
274 Ga0395900_0022503 3300037418 Bacteria 6447
275 Ga0395898_0371206 3300037466 Bacteria 1364
276 Ga0395905_0413453 3300037471 Bacteria 1244
277 Ga0395905_1057099 3300037471 Bacteria 715
278 Ga0436364_0539527 3300037853 Bacteria 2120
279 Ga0436364_0563378 3300037853 Bacteria 671
280 Ga0395901_0045720 3300038443 Bacteria 4545
281 Ga0395901_1927766 3300038443 Bacteria 538
282 Ga0436365_0614193 3300039437 Bacteria 1043
283 Ga0436365_1046860 3300039437 Bacteria 692
284 Ga0436365_1245822 3300039437 Bacteria 2312
285 Ga0436365_1445192 3300039437 Bacteria 788
286 Ga0436365_1605872 3300039437 Bacteria 2574
287 Ga0436365_1608629 3300039437 Bacteria 1009
288 Ga0436365_1935336 3300039437 Bacteria 1255
289 Ga0436360_1351765 3300039438 Bacteria 819
290 Ga0436361_0551964 3300039447 Bacteria 1481
291 Ga0436361_0659925 3300039447 Bacteria 2225
292 Ga0436363_0233082 3300039450 Bacteria 651
293 Ga0436363_1069942 3300039450 Bacteria 938
294 Ga0436363_1174974 3300039450 Bacteria 1518
295 Ga0436362_0221915 3300039453 Bacteria 981
296 Ga0451791_0684621 3300041451 Bacteria 902
297 Ga0451797_0774619 3300041453 Bacteria 543
298 Ga0451807_0919669 3300041486 Bacteria 831
299 Ga0451807_1734530 3300041486 Bacteria 1199
300 Ga0451833_0197010 3300041491 Bacteria 847
301 Ga0451841_0062055 3300041498 Bacteria 976
302 Ga0451843_0375183 3300041509 Bacteria 1129
303 Ga0451853_3743631 3300041512 Bacteria 501
304 Ga0439445_0252529 3300042004 Bacteria 527
305 Ga0466972_0019604 3300044658 Bacteria 3381
306 Ga0466972_0088328 3300044658 Bacteria 1471
307 Ga0466965_0752777 3300044683 Bacteria 561
308 Ga0466971_0579684 3300044719 Bacteria 558
309 Ga0466968_0300698 3300044735 Bacteria 771
310 Ga0466960_0660720 3300044901 Bacteria 624
311 Ga0466959_0327013 3300045049 Bacteria 1047
312 Ga0466967_0178939 3300045976 Bacteria 1999
313 Ga0495592_0002995 3300046454 Bacteria 12028
314 Ga0495592_0116414 3300046454 Bacteria 1886
315 Ga0495590_0018187 3300046457 Bacteria 2519
316 Ga0495629_0003398 3300046459 Bacteria 12038
317 Ga0495629_0151603 3300046459 Bacteria 1611
318 Ga0495641_0140173 3300046461 Bacteria 1080
319 Ga0495651_0010780 3300046462 Bacteria 7027
320 Ga0495651_0175282 3300046462 Bacteria 1523
321 Ga0495653_0000370 3300046463 Bacteria 36284
322 Ga0495653_0061061 3300046463 Bacteria 2853
323 Ga0495653_0063779 3300046463 Bacteria 2779
324 Ga0495639_0619637 3300046475 Bacteria 557
325 Ga0495639_0741729 3300046475 Bacteria 508
326 Ga0495662_0204999 3300046476 Bacteria 972
327 Ga0495664_0060532 3300046477 Bacteria 2254
328 Ga0495664_0104730 3300046477 Bacteria 1705
329 Ga0495664_0515831 3300046477 Bacteria 713
330 Ga0495594_0155889 3300046499 Bacteria 1297
331 Ga0495596_0178998 3300046500 Bacteria 824
332 Ga0495596_0332349 3300046500 Bacteria 591
333 Ga0495608_0014254 3300046511 Bacteria 5515
334 Ga0495608_0071471 3300046511 Bacteria 2264
335 Ga0495608_0491643 3300046511 Bacteria 744
336 Ga0495618_0012751 3300046514 Bacteria 5109
337 Ga0495618_0590176 3300046514 Bacteria 662
338 Ga0495620_0080340 3300046515 Bacteria 1320
339 Ga0495628_0003568 3300046516 Bacteria 13931
340 Ga0495628_0005831 3300046516 Bacteria 10790
341 Ga0495630_1227919 3300046517 Bacteria 566
342 Ga0495643_0024522 3300046522 Bacteria 3420
343 Ga0495663_0066915 3300046525 Bacteria 1138
344 Ga0495642_0200367 3300046528 Bacteria 870
345 Ga0495652_0090680 3300046529 Bacteria 2500
346 Ga0495652_0394656 3300046529 Bacteria 981
347 Ga0495654_0062673 3300046530 Bacteria 1782
348 Ga0495665_0072108 3300046531 Bacteria 1819
349 Ga0495665_0127749 3300046531 Bacteria 1331
350 Ga0495640_0000769 3300046533 Bacteria 24154
351 Ga0495640_0099168 3300046533 Bacteria 1914
352 Ga0495640_0199344 3300046533 Bacteria 1269
353 Ga0495586_0305532 3300046535 Bacteria 912
354 Ga0495586_0565733 3300046535 Bacteria 656
355 Ga0495587_0001869 3300046536 Bacteria 14016
356 Ga0495587_0643958 3300046536 Bacteria 582
357 Ga0495645_0050307 3300046543 Bacteria 3034
358 Ga0495645_0317334 3300046543 Bacteria 1013
359 Ga0495645_0389262 3300046543 Bacteria 890
360 Ga0495667_0001942 3300046559 Bacteria 13669
361 Ga0495667_0115907 3300046559 Bacteria 1731
362 Ga0495668_0000015 3300046616 Bacteria 441932
363 Ga0495634_0002200 3300046642 Bacteria 16376
364 Ga0495625_0004430 3300046660 Bacteria 13282
365 Ga0495635_0004328 3300046663 Bacteria 9835
366 Ga0495635_0008888 3300046663 Bacteria 7012
367 Ga0495635_0532097 3300046663 Bacteria 772
368 Ga0495657_0015052 3300046675 Bacteria 5670
369 Ga0495657_0096649 3300046675 Bacteria 1887
370 Ga0495599_0054944 3300046678 Bacteria 2494
371 Ga0495599_0067022 3300046678 Bacteria 2242
372 Ga0495623_0003723 3300046679 Bacteria 10054
373 Ga0495623_0040141 3300046679 Bacteria 2989
374 Ga0495646_0022938 3300046680 Bacteria 3932
375 Ga0495646_0091953 3300046680 Bacteria 1750
376 Ga0495646_0171244 3300046680 Bacteria 1196
377 Ga0495658_0015745 3300046683 Bacteria 3883
378 Ga0495658_0086177 3300046683 Bacteria 1852
379 Ga0495624_0354859 3300046690 Bacteria 882
380 Ga0495671_0348952 3300046692 Bacteria 710
381 Ga0495600_0000422 3300046809 Bacteria 21824
382 Ga0495600_0152028 3300046809 Bacteria 1498
383 Ga0495581_0228187 3300047315 Bacteria 1089
384 Ga0495604_0000406 3300047317 Bacteria 38847
385 Ga0495604_0053710 3300047317 Bacteria 3112
386 Ga0495604_0083692 3300047317 Bacteria 2383
387 Ga0495674_0000757 3300047319 Bacteria 30677
388 Ga0495674_0360804 3300047319 Bacteria 1178
389 Ga0495674_0375532 3300047319 Bacteria 1151
390 Ga0495674_0487973 3300047319 Bacteria 987
391 Ga0495672_0191493 3300047320 Bacteria 1028
392 Ga0495676_0030911 3300047321 Bacteria 4536
393 Ga0495680_0001477 3300047322 Bacteria 25369
394 Ga0495680_0058793 3300047322 Bacteria 2969
395 Ga0495680_0068123 3300047322 Bacteria 2720
396 Ga0495675_0062506 3300047444 Bacteria 2357
397 Ga0495675_0426758 3300047444 Bacteria 770
398 Ga0495684_0008747 3300047471 Bacteria 7832
399 Ga0495684_0165279 3300047471 Bacteria 1649
400 Ga0495686_0280624 3300047472 Bacteria 926
401 Ga0495602_0064112 3300048088 Bacteria 3179
402 Ga0495602_0231319 3300048088 Bacteria 1388
403 Ga0495602_0481283 3300048088 Bacteria 871
404 Ga0495626_0094952 3300048091 Bacteria 1307
405 Ga0496100_1466706 3300048903 Bacteria 539
406 Ga0496101_0125826 3300048904 Bacteria 1942
407 Ga0496102_0188965 3300048905 Bacteria 1941
408 Ga0496102_0459565 3300048905 Bacteria 1194
409 Ga0496104_0000399 3300048907 Bacteria 38066
410 Ga0496104_0521147 3300048907 Bacteria 1100
411 Ga0496104_0523266 3300048907 Bacteria 1097
412 Ga0496105_0002417 3300048908 Bacteria 13529
413 Ga0496105_0098094 3300048908 Bacteria 2420
414 Ga0496106_0042430 3300048909 Bacteria 3412
415 Ga0496107_0118946 3300048910 Bacteria 1945
416 Ga0496107_0337157 3300048910 Bacteria 1122
417 Ga0496108_1155255 3300048911 Bacteria 656
418 Ga0496108_1770880 3300048911 Bacteria 506
419 Ga0496109_0226409 3300048912 Bacteria 1759
420 Ga0496109_0962903 3300048912 Bacteria 791
421 Ga0496110_0457281 3300048913 Bacteria 1163
422 Ga0496110_1202111 3300048913 Bacteria 667
423 Ga0496112_0699138 3300048915 Bacteria 942
424 Ga0496115_0047461 3300048918 Bacteria 3435
425 Ga0496115_0076081 3300048918 Bacteria 2728
426 Ga0496118_0227250 3300048921 Bacteria 1080
427 Ga0496124_0238928 3300048927 Bacteria 1352
428 Ga0496124_0991349 3300048927 Bacteria 501
429 Ga0496125_0023890 3300048928 Bacteria 5632
430 Ga0496126_0396598 3300048929 Bacteria 1120
431 Ga0501306_023495 3300049127 Bacteria 876
432 Ga0495678_118787 3300049459 Bacteria 891
433 Ga0501312_057425 3300049528 Bacteria 668
434 Ga0501320_036040 3300049536 Bacteria 633
435 Ga0501322_018236 3300049538 Bacteria 600
436 Ga0501031_0335074 3300049568 Bacteria 979
437 Ga0501031_0956069 3300049568 Bacteria 548
438 Ga0501032_0045571 3300049569 Bacteria 2965
439 Ga0501032_0058423 3300049569 Bacteria 2589
440 Ga0501032_0474181 3300049569 Bacteria 801
441 Ga0501033_0107086 3300049570 Bacteria 2036
442 Ga0501033_0328006 3300049570 Bacteria 1074
443 Ga0501033_1165786 3300049570 Bacteria 511
444 Ga0501034_0090345 3300049571 Bacteria 3060
445 Ga0501034_0132600 3300049571 Bacteria 2474
446 Ga0501034_0134254 3300049571 Bacteria 2456
447 Ga0501034_0212658 3300049571 Bacteria 1888
448 Ga0501034_0623346 3300049571 Bacteria 982
449 Ga0501034_1540172 3300049571 Bacteria 538
450 Ga0501036_0189285 3300049572 Bacteria 1732
451 Ga0501036_0268203 3300049572 Bacteria 1429
452 Ga0501036_0270240 3300049572 Bacteria 1423
453 Ga0501036_0312106 3300049572 Bacteria 1314
454 Ga0501036_0528883 3300049572 Bacteria 980
455 Ga0501037_0118828 3300049573 Bacteria 1901
456 Ga0501037_0426027 3300049573 Bacteria 908
457 Ga0501037_0851841 3300049573 Bacteria 599
458 Ga0501038_0058047 3300049574 Bacteria 3319
459 Ga0501038_0300648 3300049574 Bacteria 1259
460 Ga0501039_0070689 3300049575 Bacteria 2712
461 Ga0501039_0097766 3300049575 Bacteria 2289
462 Ga0501039_0119198 3300049575 Bacteria 2067
463 Ga0501040_0026515 3300049576 Bacteria 3898
464 Ga0501040_0297895 3300049576 Bacteria 1153
465 Ga0501040_0345520 3300049576 Bacteria 1065
466 Ga0501041_0021685 3300049577 Bacteria 3847
467 Ga0501042_0094589 3300049578 Bacteria 2146
468 Ga0501042_0380390 3300049578 Bacteria 1022
469 Ga0501042_0867999 3300049578 Bacteria 657
470 Ga0501043_0348979 3300049579 Bacteria 1124
471 Ga0501043_0460436 3300049579 Bacteria 954
472 Ga0501043_0654040 3300049579 Bacteria 771
473 Ga0501046_0507063 3300049580 Bacteria 863
474 Ga0501047_0155663 3300049581 Bacteria 2159
475 Ga0501047_0205740 3300049581 Bacteria 1827
476 Ga0501048_0308399 3300049582 Bacteria 1126
477 Ga0501048_0393070 3300049582 Bacteria 991
478 Ga0501048_0810775 3300049582 Bacteria 673
479 Ga0501067_0051199 3300049583 Bacteria 2289
480 Ga0501067_0251762 3300049583 Bacteria 983
481 Ga0501068_0029125 3300049584 Bacteria 3269
482 Ga0501068_0057493 3300049584 Bacteria 2358
483 Ga0501068_0111569 3300049584 Bacteria 1700
484 Ga0501068_0858507 3300049584 Bacteria 596
485 Ga0501069_0030545 3300049585 Bacteria 2959
486 Ga0501069_0040203 3300049585 Bacteria 2585
487 Ga0501069_0383742 3300049585 Bacteria 830
488 Ga0501069_0710591 3300049585 Bacteria 606
489 Ga0501070_0067473 3300049586 Bacteria 2962
490 Ga0501070_0083561 3300049586 Bacteria 2643
491 Ga0501070_0202001 3300049586 Bacteria 1632
492 Ga0501070_0242991 3300049586 Bacteria 1473
493 Ga0501070_0794514 3300049586 Bacteria 743
494 Ga0501071_0063412 3300049587 Bacteria 2679
495 Ga0501071_0088539 3300049587 Bacteria 2272
496 Ga0501071_0357403 3300049587 Bacteria 1112
497 Ga0501071_0782871 3300049587 Bacteria 735
498 Ga0501072_0029078 3300049588 Bacteria 4314
499 Ga0501072_0067263 3300049588 Bacteria 2827
500 Ga0501072_0646656 3300049588 Bacteria 832
501 Ga0501073_0040649 3300049589 Bacteria 3289
502 Ga0501073_0086033 3300049589 Bacteria 2186
503 Ga0501073_0311672 3300049589 Bacteria 1085
504 Ga0501073_0728373 3300049589 Bacteria 684
505 Ga0501073_0907682 3300049589 Bacteria 606
506 Ga0501074_0049622 3300049590 Bacteria 3030
507 Ga0501074_0057437 3300049590 Bacteria 2803
508 Ga0501074_0146813 3300049590 Bacteria 1686
509 Ga0501074_0254529 3300049590 Bacteria 1249
510 Ga0501075_0114552 3300049591 Bacteria 2050
511 Ga0501075_0217916 3300049591 Bacteria 1456
512 Ga0501076_0081388 3300049592 Bacteria 2600
513 Ga0501076_0222571 3300049592 Bacteria 1542
514 Ga0501076_0342573 3300049592 Bacteria 1227
515 Ga0501076_0378993 3300049592 Bacteria 1163
516 Ga0501077_0305720 3300049593 Bacteria 1013
517 Ga0501077_0360821 3300049593 Bacteria 928
518 Ga0501079_0126533 3300049741 Bacteria 1988
519 Ga0501079_0182947 3300049741 Bacteria 1636
520 Ga0501079_0453911 3300049741 Bacteria 1007
521 Ga0501080_0041183 3300049742 Bacteria 4305
522 Ga0501080_0075103 3300049742 Bacteria 3144
523 Ga0501080_0133703 3300049742 Bacteria 2296
524 Ga0501080_0141304 3300049742 Bacteria 2225
525 Ga0501080_0195626 3300049742 Bacteria 1857
526 Ga0501081_0047513 3300049743 Bacteria 2953
527 Ga0501081_0664905 3300049743 Bacteria 781
528 Ga0501081_0734657 3300049743 Bacteria 742
529 Ga0501081_0872663 3300049743 Bacteria 678
530 Ga0501081_1381942 3300049743 Bacteria 534
531 Ga0501083_0153487 3300049744 Bacteria 1507
532 Ga0501083_0340546 3300049744 Bacteria 975
533 Ga0501035_0160450 3300049822 Bacteria 1946
534 Ga0501035_0349581 3300049822 Bacteria 1237
535 Ga0501035_1116084 3300049822 Bacteria 615
536 Ga0501035_1127664 3300049822 Bacteria 611
537 Ga0501044_0105973 3300049823 Bacteria 2823
538 Ga0501044_0128361 3300049823 Bacteria 2531
539 Ga0501044_0172926 3300049823 Bacteria 2130
540 Ga0501044_0270613 3300049823 Bacteria 1634
541 Ga0501044_0273668 3300049823 Bacteria 1623
542 Ga0501044_0900254 3300049823 Bacteria 760
543 Ga0501045_0070801 3300049824 Bacteria 2566
544 Ga0501045_0313307 3300049824 Bacteria 1168
545 nmdc:mga03n38_54352_c1 3300050490 Bacteria 1799
546 nmdc:mga0k408_872986_c1 3300050493 Bacteria 522
547 nmdc:mga07m45_115921_c1 3300050496 Bacteria 1545
548 nmdc:mga05p37_2115048_c1 3300050507 Bacteria 527
549 nmdc:mga05p37_434840_c1 3300050507 Bacteria 1523
550 nmdc:mga05p37_747044_c1 3300050507 Bacteria 1079
551 nmdc:mga09592_372677_c1 3300050508 Bacteria 1235
552 nmdc:mga09592_450583_c1 3300050508 Bacteria 1110
553 nmdc:mga0qj67_225617_c1 3300050509 Bacteria 1520
554 nmdc:mga0qj67_44746_c1 3300050509 Bacteria 3491
555 nmdc:mga0qj67_875435_c1 3300050509 Bacteria 709
556 nmdc:mga06r32_1156660_c1 3300050510 Bacteria 721
557 nmdc:mga06r32_887796_c1 3300050510 Bacteria 848
558 nmdc:mga08y16_136821_c1 3300050511 Bacteria 2546
559 nmdc:mga08y16_348236_c1 3300050511 Bacteria 1522
560 nmdc:mga0n895_189483_c1 3300050512 Bacteria 2088
561 nmdc:mga0a205_66873_c1 3300050515 Bacteria 3472
562 Ga0495601_0003476 3300053077 Bacteria 9041
563 Ga0495601_0004742 3300053077 Bacteria 7882
564 Ga0495601_0007996 3300053077 Bacteria 6229
565 Ga0495612_0002228 3300053078 Bacteria 7968
566 Ga0495612_0089635 3300053078 Bacteria 1300
567 Ga0495612_0144431 3300053078 Bacteria 1033
568 Ga0495655_0031218 3300053083 Bacteria 1295
569 Ga0495655_0120006 3300053083 Bacteria 799
570 Ga0495595_0001345 3300053084 Bacteria 9543
571 Ga0495595_0007610 3300053084 Bacteria 4434
572 Ga0495595_0040126 3300053084 Bacteria 2138
573 Ga0495619_0000352 3300053085 Bacteria 32130
574 Ga0495619_0013467 3300053085 Bacteria 5152
575 Ga0495619_0015650 3300053085 Bacteria 4801
576 Ga0500644_0008929 3300053088 Bacteria 2662
577 Ga0500592_004394 3300053116 Bacteria 2248
578 Ga0500652_005263 3300053131 Bacteria 4059
579 Ga0500658_0011094 3300053134 Bacteria 3321
580 Ga0500568_0013224 3300053139 Bacteria 3765
581 Ga0500604_0032973 3300053151 Bacteria 1529
582 Ga0500616_0179292 3300053153 Bacteria 955
583 Ga0500616_0284023 3300053153 Bacteria 693
584 Ga0500627_0000009 3300053158 Bacteria 153203
585 Ga0500637_0029919 3300053178 Bacteria 3025
586 Ga0500596_039807 3300053735 Bacteria 747
587 Ga0500601_002145 3300053737 Bacteria 2118
588 Ga0501084_0130731 3300054114 Bacteria 2113
589 Ga0501084_0268841 3300054114 Bacteria 1439
590 Ga0501084_0303891 3300054114 Bacteria 1348
591 Ga0501084_0595091 3300054114 Bacteria 934
592 Ga0587084_159606 3300059477 Bacteria 501
593 Ga0587077_236276 3300059493 Bacteria 522
594 Ga0501082_0109453 3300060353 Bacteria 2391
595 Ga0501082_0301898 3300060353 Bacteria 1394
596 Ga0501082_0788570 3300060353 Bacteria 831
597 Ga0501082_1148750 3300060353 Bacteria 679
598 Ga0466962_0597379 3300061719 Bacteria 562

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041486 Ga0451807_0919669 Ga0451807_0919669_301_603 77
2 3300006186 Ga0075369_10163231 Ga0075369_101632312 92
3 3300012475 Ga0157317_1007058 Ga0157317_10070582 92
4 3300005329 Ga0070683_100046388 Ga0070683_1000463887 93
5 3300005518 Ga0070699_100135661 Ga0070699_1001356613 93
6 3300005536 Ga0070697_100008562 Ga0070697_1000085622 93
7 3300025921 Ga0207652_10727643 Ga0207652_107276432 93
8 3300031239 Ga0265328_10055566 Ga0265328_100555662 93
9 3300031250 Ga0265331_10002092 Ga0265331_1000209226 93
10 3300004800 Ga0058861_11770653 Ga0058861_117706532 94
11 3300004803 Ga0058862_12365026 Ga0058862_123650262 94
12 3300005329 Ga0070683_101934320 Ga0070683_1019343202 94
13 3300005338 Ga0068868_101436419 Ga0068868_1014364192 94
14 3300005344 Ga0070661_101916657 Ga0070661_1019166571 94
15 3300005718 Ga0068866_11007875 Ga0068866_110078752 94
16 3300006358 Ga0068871_101241073 Ga0068871_1012410732 94
17 3300009148 Ga0105243_11798327 Ga0105243_117983272 94
18 3300009177 Ga0105248_10955830 Ga0105248_109558302 94
19 3300017792 Ga0163161_11457255 Ga0163161_114572551 94
20 3300025912 Ga0207707_10146707 Ga0207707_101467074 94
21 3300025935 Ga0207709_10442975 Ga0207709_104429752 94
22 3300025937 Ga0207669_11463202 Ga0207669_114632022 94
23 3300025944 Ga0207661_12009544 Ga0207661_120095441 94
24 3300030763 Ga0265763_1023796 Ga0265763_10237962 94
25 3300034816 Ga0373930_0097218 Ga0373930_0097218_133_417 94
26 3300046475 Ga0495639_0619637 Ga0495639_0619637_78_362 94
27 3300046477 Ga0495664_0515831 Ga0495664_0515831_332_616 94
28 3300046535 Ga0495586_0305532 Ga0495586_0305532_422_706 94
29 3300046663 Ga0495635_0532097 Ga0495635_0532097_349_633 94
30 3300047319 Ga0495674_0375532 Ga0495674_0375532_227_511 94
31 3300049528 Ga0501312_057425 Ga0501312_057425_313_603 95
32 3300005354 Ga0070675_100564595 Ga0070675_1005645952 96
33 3300005364 Ga0070673_101097538 Ga0070673_1010975381 96
34 3300005456 Ga0070678_100515496 Ga0070678_1005154962 96
35 3300005468 Ga0070707_100478908 Ga0070707_1004789082 96
36 3300005548 Ga0070665_102388972 Ga0070665_1023889722 96
37 3300005615 Ga0070702_101202788 Ga0070702_1012027881 96
38 3300005841 Ga0068863_101241058 Ga0068863_1012410582 96
39 3300005842 Ga0068858_101304821 Ga0068858_1013048212 96
40 3300005843 Ga0068860_102048812 Ga0068860_1020488122 96
41 3300006237 Ga0097621_100320313 Ga0097621_1003203133 96
42 3300013308 Ga0157375_12854714 Ga0157375_128547141 96
43 3300014325 Ga0163163_10186186 Ga0163163_101861863 96
44 3300025925 Ga0207650_10557869 Ga0207650_105578692 96
45 3300025926 Ga0207659_10882526 Ga0207659_108825262 96
46 3300026088 Ga0207641_11674369 Ga0207641_116743692 96
47 3300026121 Ga0207683_11155753 Ga0207683_111557532 96
48 iso_pu_bacteria 2513237092 2513625270 96
49 iso_pu_bacteria 2513237104 2513715018 96
50 iso_pu_bacteria 2517093001 2517103520 96
51 iso_pu_bacteria 2617270741 2617378173 96
52 iso_pu_bacteria 2643221563 2643835056 96
53 iso_pu_bacteria 2643221608 2644055983 96
54 iso_pu_bacteria 2824600985 2824602115 96
55 iso_pu_bacteria 2824609381 2824610103 96
56 iso_pu_bacteria 2824653114 2824654959 96
57 iso_pu_bacteria 2824679649 2824680844 96
58 iso_pu_bacteria 2824732956 2824733559 96
59 iso_pu_bacteria 2824746037 2824746934 96
60 iso_pu_bacteria 2841957949 2841962243 96
61 iso_pu_bacteria 2847930680 2847934829 96
62 iso_pu_bacteria 2852653556 2852655871 96
63 iso_pu_bacteria 2852680915 2852683076 96
64 iso_pu_bacteria 2857509624 2857510229 96
65 iso_pu_bacteria 2874612657 2874615656 96
66 iso_pu_bacteria 2876761206 2876765726 96
67 iso_pu_bacteria 2879083081 2879089276 96
68 iso_pu_bacteria 2881364244 2881366223 96
69 iso_pu_bacteria 2881665667 2881671564 96
70 iso_pu_bacteria 2888419890 2888423294 96
71 iso_pu_bacteria 2908775508 2908778937 96
72 iso_pu_bacteria 2922393267 2922395223 96
73 iso_pu_bacteria 3005483717 3005488143 96
74 iso_pu_bacteria 3005587118 3005590475 96
75 3300005339 Ga0070660_101134532 Ga0070660_1011345322 98
76 3300005344 Ga0070661_100593494 Ga0070661_1005934942 98
77 3300005366 Ga0070659_100018511 Ga0070659_10001851111 98
78 3300005367 Ga0070667_100479068 Ga0070667_1004790682 98
79 3300005444 Ga0070694_101529228 Ga0070694_1015292282 98
80 3300005455 Ga0070663_100467597 Ga0070663_1004675972 98
81 3300005466 Ga0070685_11444064 Ga0070685_114440641 98
82 3300005539 Ga0068853_100399888 Ga0068853_1003998883 98
83 3300005564 Ga0070664_100036245 Ga0070664_1000362455 98
84 3300005718 Ga0068866_10391805 Ga0068866_103918052 98
85 3300005844 Ga0068862_102024259 Ga0068862_1020242592 98
86 3300006358 Ga0068871_102148488 Ga0068871_1021484882 98
87 3300006844 Ga0075428_100665538 Ga0075428_1006655381 98
88 3300006880 Ga0075429_100812466 Ga0075429_1008124662 98
89 3300006881 Ga0068865_100539559 Ga0068865_1005395592 98
90 3300009094 Ga0111539_10105552 Ga0111539_101055525 98
91 3300009147 Ga0114129_13141115 Ga0114129_131411152 98
92 3300009148 Ga0105243_11913280 Ga0105243_119132802 98
93 3300009177 Ga0105248_10731539 Ga0105248_107315392 98
94 3300009551 Ga0105238_10877479 Ga0105238_108774792 98
95 3300013100 Ga0157373_10213046 Ga0157373_102130462 98
96 3300013100 Ga0157373_10214208 Ga0157373_102142082 98
97 3300013104 Ga0157370_11276082 Ga0157370_112760822 98
98 3300013306 Ga0163162_12620359 Ga0163162_126203592 98
99 3300014745 Ga0157377_10312618 Ga0157377_103126182 98
100 3300025899 Ga0207642_10424902 Ga0207642_104249022 98
101 3300025901 Ga0207688_10423533 Ga0207688_104235332 98
102 3300025915 Ga0207693_11085378 Ga0207693_110853781 98
103 3300025932 Ga0207690_10175415 Ga0207690_101754153 98
104 3300025937 Ga0207669_10710593 Ga0207669_107105932 98
105 3300025938 Ga0207704_10273867 Ga0207704_102738672 98
106 3300025941 Ga0207711_10528708 Ga0207711_105287082 98
107 3300025945 Ga0207679_10065715 Ga0207679_100657152 98
108 3300025960 Ga0207651_10427475 Ga0207651_104274752 98
109 3300026041 Ga0207639_10053240 Ga0207639_100532404 98
110 3300026041 Ga0207639_10807664 Ga0207639_108076642 98
111 3300026067 Ga0207678_10313479 Ga0207678_103134793 98
112 3300026089 Ga0207648_10565264 Ga0207648_105652642 98
113 3300026118 Ga0207675_100633306 Ga0207675_1006333062 98
114 3300028379 Ga0268266_11386884 Ga0268266_113868842 98
115 3300028800 Ga0265338_10065290 Ga0265338_100652905 98
116 3300028800 Ga0265338_10162190 Ga0265338_101621903 98
117 3300028800 Ga0265338_10426269 Ga0265338_104262692 98
118 3300031250 Ga0265331_10073351 Ga0265331_100733512 98
119 3300031711 Ga0265314_10018555 Ga0265314_1001855512 98
120 3300031903 Ga0307407_11273433 Ga0307407_112734332 98
121 3300032002 Ga0307416_100482412 Ga0307416_1004824122 98
122 3300032002 Ga0307416_103404498 Ga0307416_1034044981 98
123 3300032005 Ga0307411_10706699 Ga0307411_107066991 98
124 3300039450 Ga0436363_1174974 Ga0436363_1174974_525_821 98
125 3300046500 Ga0495596_0332349 Ga0495596_0332349_159_455 98
126 3300046515 Ga0495620_0080340 Ga0495620_0080340_804_1100 98
127 3300048903 Ga0496100_1466706 Ga0496100_1466706_172_468 98
128 3300048905 Ga0496102_0459565 Ga0496102_0459565_370_666 98
129 3300048911 Ga0496108_1155255 Ga0496108_1155255_67_363 98
130 3300048913 Ga0496110_0457281 Ga0496110_0457281_847_1143 98
131 3300049568 Ga0501031_0956069 Ga0501031_0956069_199_495 98
132 3300049570 Ga0501033_1165786 Ga0501033_1165786_138_434 98
133 3300049572 Ga0501036_0270240 Ga0501036_0270240_847_1143 98
134 3300049575 Ga0501039_0119198 Ga0501039_0119198_777_1073 98
135 3300049576 Ga0501040_0345520 Ga0501040_0345520_148_444 98
136 3300049577 Ga0501041_0021685 Ga0501041_0021685_2480_2776 98
137 3300049578 Ga0501042_0094589 Ga0501042_0094589_57_353 98
138 3300049579 Ga0501043_0460436 Ga0501043_0460436_10_306 98
139 3300049582 Ga0501048_0810775 Ga0501048_0810775_172_468 98
140 3300049585 Ga0501069_0040203 Ga0501069_0040203_1428_1724 98
141 3300049590 Ga0501074_0254529 Ga0501074_0254529_420_716 98
142 3300049591 Ga0501075_0114552 Ga0501075_0114552_1702_1998 98
143 3300049592 Ga0501076_0081388 Ga0501076_0081388_2280_2576 98
144 3300049592 Ga0501076_0378993 Ga0501076_0378993_684_980 98
145 3300049593 Ga0501077_0360821 Ga0501077_0360821_535_831 98
146 3300049741 Ga0501079_0126533 Ga0501079_0126533_898_1194 98
147 3300049741 Ga0501079_0453911 Ga0501079_0453911_569_865 98
148 3300049742 Ga0501080_0075103 Ga0501080_0075103_1757_2053 98
149 3300049742 Ga0501080_0133703 Ga0501080_0133703_194_490 98
150 3300049743 Ga0501081_0047513 Ga0501081_0047513_1847_2143 98
151 3300049743 Ga0501081_1381942 Ga0501081_1381942_219_515 98
152 3300049822 Ga0501035_0349581 Ga0501035_0349581_215_511 98
153 3300049823 Ga0501044_0900254 Ga0501044_0900254_91_387 98
154 3300049824 Ga0501045_0070801 Ga0501045_0070801_1834_2130 98
155 3300050490 nmdc:mga03n38_54352_c1 nmdc:mga03n38_54352_c1_618_914 98
156 3300050493 nmdc:mga0k408_872986_c1 nmdc:mga0k408_872986_c1_77_373 98
157 3300050507 nmdc:mga05p37_747044_c1 nmdc:mga05p37_747044_c1_657_953 98
158 3300050508 nmdc:mga09592_450583_c1 nmdc:mga09592_450583_c1_371_667 98
159 3300050510 nmdc:mga06r32_1156660_c1 nmdc:mga06r32_1156660_c1_273_569 98
160 3300050511 nmdc:mga08y16_348236_c1 nmdc:mga08y16_348236_c1_124_420 98
161 3300053083 Ga0495655_0120006 Ga0495655_0120006_192_488 98
162 3300053131 Ga0500652_005263 Ga0500652_005263_3465_3788 98
163 3300053178 Ga0500637_0029919 Ga0500637_0029919_615_947 98
164 3300053735 Ga0500596_039807 Ga0500596_039807_201_533 98
165 3300053737 Ga0500601_002145 Ga0500601_002145_850_1182 98
166 3300054114 Ga0501084_0268841 Ga0501084_0268841_973_1269 98
167 3300003781 Ga0055536_1023681 Ga0055536_10236813 99
168 3300003781 Ga0055536_1024175 Ga0055536_10241753 99
169 3300003781 Ga0055536_1091335 Ga0055536_10913351 99
170 3300003791 Ga0055530_10009419 Ga0055530_100094191 99
171 3300003791 Ga0055530_10052734 Ga0055530_100527342 99
172 3300003794 Ga0055531_10024322 Ga0055531_100243221 99
173 3300003794 Ga0055531_10024340 Ga0055531_100243401 99
174 3300004798 Ga0058859_11684652 Ga0058859_116846522 99
175 3300005330 Ga0070690_100226037 Ga0070690_1002260373 99
176 3300005436 Ga0070713_100051698 Ga0070713_1000516984 99
177 3300005437 Ga0070710_10052773 Ga0070710_100527734 99
178 3300005437 Ga0070710_10220853 Ga0070710_102208532 99
179 3300005439 Ga0070711_100027798 Ga0070711_1000277982 99
180 3300005444 Ga0070694_100286379 Ga0070694_1002863792 99
181 3300005457 Ga0070662_100616111 Ga0070662_1006161112 99
182 3300005539 Ga0068853_102022781 Ga0068853_1020227811 99
183 3300005545 Ga0070695_101436464 Ga0070695_1014364642 99
184 3300005843 Ga0068860_100751746 Ga0068860_1007517462 99
185 3300005937 Ga0081455_10017756 Ga0081455_100177565 99
186 3300005981 Ga0081538_10159181 Ga0081538_101591812 99
187 3300005983 Ga0081540_1058910 Ga0081540_10589102 99
188 3300006028 Ga0070717_10162531 Ga0070717_101625311 99
189 3300006028 Ga0070717_10362285 Ga0070717_103622852 99
190 3300006038 Ga0075365_10292346 Ga0075365_102923461 99
191 3300006038 Ga0075365_10913982 Ga0075365_109139822 99
192 3300006175 Ga0070712_100037138 Ga0070712_1000371383 99
193 3300006175 Ga0070712_101602211 Ga0070712_1016022111 99
194 3300006186 Ga0075369_10381955 Ga0075369_103819552 99
195 3300006195 Ga0075366_10828867 Ga0075366_108288672 99
196 3300006353 Ga0075370_10183910 Ga0075370_101839102 99
197 3300006358 Ga0068871_100758913 Ga0068871_1007589132 99
198 3300006844 Ga0075428_100048564 Ga0075428_1000485643 99
199 3300006846 Ga0075430_100078655 Ga0075430_1000786552 99
200 3300006846 Ga0075430_100816232 Ga0075430_1008162322 99
201 3300006847 Ga0075431_100610933 Ga0075431_1006109332 99
202 3300006852 Ga0075433_10461696 Ga0075433_104616961 99
203 3300006880 Ga0075429_100421797 Ga0075429_1004217972 99
204 3300006881 Ga0068865_101207197 Ga0068865_1012071972 99
205 3300007788 Ga0099795_10085530 Ga0099795_100855302 99
206 3300009093 Ga0105240_11919212 Ga0105240_119192122 99
207 3300009094 Ga0111539_10146569 Ga0111539_101465695 99
208 3300009101 Ga0105247_10646913 Ga0105247_106469131 99
209 3300009147 Ga0114129_10347685 Ga0114129_103476852 99
210 3300009174 Ga0105241_10826564 Ga0105241_108265642 99
211 3300009545 Ga0105237_10533898 Ga0105237_105338982 99
212 3300009553 Ga0105249_11168554 Ga0105249_111685542 99
213 3300010159 Ga0099796_10081278 Ga0099796_100812782 99
214 3300010375 Ga0105239_10585271 Ga0105239_105852712 99
215 3300013306 Ga0163162_12455721 Ga0163162_124557212 99
216 3300014325 Ga0163163_10639346 Ga0163163_106393462 99
217 3300014325 Ga0163163_11936755 Ga0163163_119367552 99
218 3300014326 Ga0157380_10192942 Ga0157380_101929423 99
219 3300017792 Ga0163161_10506257 Ga0163161_105062572 99
220 3300019182 Ga0184598_102540 Ga0184598_1025402 99
221 3300021384 Ga0213876_10159791 Ga0213876_101597912 99
222 3300021384 Ga0213876_10568084 Ga0213876_105680842 99
223 3300021441 Ga0213871_10041410 Ga0213871_100414102 99
224 3300025291 Ga0209675_1000104 Ga0209675_100010411 99
225 3300025292 Ga0209676_1004257 Ga0209676_10042575 99
226 3300025292 Ga0209676_1027868 Ga0209676_10278682 99
227 3300025294 Ga0209025_1036659 Ga0209025_10366593 99
228 3300025297 Ga0209758_1053903 Ga0209758_10539032 99
229 3300025297 Ga0209758_1143284 Ga0209758_11432841 99
230 3300025298 Ga0209050_1012904 Ga0209050_10129045 99
231 3300025298 Ga0209050_1038106 Ga0209050_10381062 99
232 3300025304 Ga0209257_1006356 Ga0209257_10063567 99
233 3300025304 Ga0209257_1021998 Ga0209257_10219984 99
234 3300025898 Ga0207692_10223839 Ga0207692_102238392 99
235 3300025900 Ga0207710_10029828 Ga0207710_100298282 99
236 3300025906 Ga0207699_10359866 Ga0207699_103598662 99
237 3300025906 Ga0207699_10529140 Ga0207699_105291402 99
238 3300025911 Ga0207654_10477711 Ga0207654_104777112 99
239 3300025914 Ga0207671_10318504 Ga0207671_103185042 99
240 3300025915 Ga0207693_10085957 Ga0207693_100859573 99
241 3300025915 Ga0207693_10200166 Ga0207693_102001662 99
242 3300025915 Ga0207693_11141061 Ga0207693_111410611 99
243 3300025916 Ga0207663_10214435 Ga0207663_102144351 99
244 3300025921 Ga0207652_11232291 Ga0207652_112322912 99
245 3300025924 Ga0207694_10591075 Ga0207694_105910752 99
246 3300025928 Ga0207700_10053321 Ga0207700_100533214 99
247 3300025928 Ga0207700_10303832 Ga0207700_103038322 99
248 3300025928 Ga0207700_11617775 Ga0207700_116177752 99
249 3300025929 Ga0207664_10915155 Ga0207664_109151552 99
250 3300025929 Ga0207664_11845639 Ga0207664_118456392 99
251 3300025933 Ga0207706_10335759 Ga0207706_103357592 99
252 3300025934 Ga0207686_11786121 Ga0207686_117861212 99
253 3300025939 Ga0207665_10601169 Ga0207665_106011691 99
254 3300025961 Ga0207712_10386287 Ga0207712_103862872 99
255 3300027876 Ga0209974_10029965 Ga0209974_100299653 99
256 3300027907 Ga0207428_10164487 Ga0207428_101644873 99
257 3300028379 Ga0268266_12228493 Ga0268266_122284932 99
258 3300028556 Ga0265337_1002429 Ga0265337_100242919 99
259 3300028558 Ga0265326_10039873 Ga0265326_100398731 99
260 3300028563 Ga0265319_1001825 Ga0265319_10018255 99
261 3300028573 Ga0265334_10000469 Ga0265334_1000046920 99
262 3300028577 Ga0265318_10040136 Ga0265318_100401362 99
263 3300028653 Ga0265323_10001237 Ga0265323_100012376 99
264 3300028654 Ga0265322_10008354 Ga0265322_100083545 99
265 3300028666 Ga0265336_10000535 Ga0265336_1000053525 99
266 3300028800 Ga0265338_10000131 Ga0265338_10000131111 99
267 3300028800 Ga0265338_10033513 Ga0265338_100335136 99
268 3300028800 Ga0265338_10123178 Ga0265338_101231783 99
269 3300028800 Ga0265338_10884516 Ga0265338_108845162 99
270 3300029957 Ga0265324_10001269 Ga0265324_100012699 99
271 3300030733 Ga0314311_1091187 Ga0314311_10911872 99
272 3300030744 Ga0316181_1093387 Ga0316181_10933872 99
273 3300031241 Ga0265325_10001071 Ga0265325_100010715 99
274 3300031241 Ga0265325_10136758 Ga0265325_101367582 99
275 3300031249 Ga0265339_10000053 Ga0265339_1000005326 99
276 3300031249 Ga0265339_10200458 Ga0265339_102004582 99
277 3300031456 Ga0307513_10333316 Ga0307513_103333162 99
278 3300031456 Ga0307513_11059987 Ga0307513_110599872 99
279 3300031507 Ga0307509_10387826 Ga0307509_103878262 99
280 3300031548 Ga0307408_100445374 Ga0307408_1004453743 99
281 3300031548 Ga0307408_101349918 Ga0307408_1013499181 99
282 3300031595 Ga0265313_10000098 Ga0265313_1000009861 99
283 3300031595 Ga0265313_10006263 Ga0265313_100062632 99
284 3300031665 Ga0316575_10088184 Ga0316575_100881842 99
285 3300031712 Ga0265342_10574296 Ga0265342_105742961 99
286 3300031911 Ga0307412_11420581 Ga0307412_114205812 99
287 3300031995 Ga0307409_100947105 Ga0307409_1009471052 99
288 3300031995 Ga0307409_101583311 Ga0307409_1015833112 99
289 3300032004 Ga0307414_10012056 Ga0307414_100120562 99
290 3300032004 Ga0307414_10107832 Ga0307414_101078323 99
291 3300032005 Ga0307411_10046512 Ga0307411_100465125 99
292 3300032005 Ga0307411_10829394 Ga0307411_108293942 99
293 3300032133 Ga0316583_10003862 Ga0316583_100038625 99
294 3300032133 Ga0316583_10041645 Ga0316583_100416452 99
295 3300032168 Ga0316593_10033258 Ga0316593_100332582 99
296 3300032168 Ga0316593_10417561 Ga0316593_104175612 99
297 3300033180 Ga0307510_10263101 Ga0307510_102631012 99
298 3300034816 Ga0373930_0040694 Ga0373930_0040694_128_427 99
299 3300035084 Ga0373928_0060312 Ga0373928_0060312_118_417 99
300 3300035088 Ga0373940_0014901 Ga0373940_0014901_48_347 99
301 3300035091 Ga0373951_0013840 Ga0373951_0013840_694_993 99
302 3300035092 Ga0373952_0171613 Ga0373952_0171613_23_322 99
303 3300035111 Ga0373923_0005324 Ga0373923_0005324_1749_2048 99
304 3300035111 Ga0373923_0031770 Ga0373923_0031770_1685_1984 99
305 3300035115 Ga0373941_0029005 Ga0373941_0029005_278_577 99
306 3300035115 Ga0373941_0060667 Ga0373941_0060667_636_935 99
307 3300035116 Ga0373945_0322626 Ga0373945_0322626_134_433 99
308 3300035117 Ga0373953_0017061 Ga0373953_0017061_1820_2119 99
309 3300035117 Ga0373953_0100833 Ga0373953_0100833_303_602 99
310 3300035118 Ga0373954_0421854 Ga0373954_0421854_19_318 99
311 3300035118 Ga0373954_0467305 Ga0373954_0467305_121_420 99
312 3300035119 Ga0373956_0291928 Ga0373956_0291928_430_729 99
313 3300035120 Ga0373957_0051619 Ga0373957_0051619_1206_1505 99
314 3300035121 Ga0373960_0004525 Ga0373960_0004525_777_1076 99
315 3300035171 Ga0373946_0205547 Ga0373946_0205547_289_588 99
316 3300035171 Ga0373946_0205850 Ga0373946_0205850_336_635 99
317 3300035241 Ga0373961_0436798 Ga0373961_0436798_65_364 99
318 3300035410 Ga0373924_0015063 Ga0373924_0015063_371_670 99
319 3300035410 Ga0373924_0047473 Ga0373924_0047473_997_1296 99
320 3300035691 Ga0373931_0028558 Ga0373931_0028558_721_1020 99
321 3300035692 Ga0373935_0023907 Ga0373935_0023907_3433_3732 99
322 3300035695 Ga0373927_0008214 Ga0373927_0008214_2842_3141 99
323 3300035695 Ga0373927_0029560 Ga0373927_0029560_1713_2012 99
324 3300035724 Ga0373933_0001245 Ga0373933_0001245_11596_11895 99
325 3300035724 Ga0373933_0413541 Ga0373933_0413541_266_565 99
326 3300035724 Ga0373933_0555914 Ga0373933_0555914_254_553 99
327 3300035725 Ga0373947_0034962 Ga0373947_0034962_1050_1349 99
328 3300035725 Ga0373947_0927229 Ga0373947_0927229_130_429 99
329 3300036401 Ga0373937_0001081 Ga0373937_0001081_12609_12908 99
330 3300036401 Ga0373937_0126066 Ga0373937_0126066_244_543 99
331 3300037068 Ga0373925_0032780 Ga0373925_0032780_3150_3449 99
332 3300037068 Ga0373925_0066308 Ga0373925_0066308_1023_1322 99
333 3300037471 Ga0395905_1057099 Ga0395905_1057099_335_634 99
334 3300037853 Ga0436364_0539527 Ga0436364_0539527_1373_1672 99
335 3300037853 Ga0436364_0563378 Ga0436364_0563378_131_430 99
336 3300038443 Ga0395901_1927766 Ga0395901_1927766_174_473 99
337 3300039437 Ga0436365_0614193 Ga0436365_0614193_51_350 99
338 3300039437 Ga0436365_1046860 Ga0436365_1046860_281_580 99
339 3300039437 Ga0436365_1245822 Ga0436365_1245822_265_564 99
340 3300039437 Ga0436365_1445192 Ga0436365_1445192_377_676 99
341 3300039437 Ga0436365_1605872 Ga0436365_1605872_564_863 99
342 3300039437 Ga0436365_1608629 Ga0436365_1608629_513_812 99
343 3300039437 Ga0436365_1935336 Ga0436365_1935336_145_444 99
344 3300039438 Ga0436360_1351765 Ga0436360_1351765_421_723 99
345 3300039447 Ga0436361_0551964 Ga0436361_0551964_130_429 99
346 3300039447 Ga0436361_0659925 Ga0436361_0659925_1096_1395 99
347 3300039450 Ga0436363_0233082 Ga0436363_0233082_73_372 99
348 3300039450 Ga0436363_1069942 Ga0436363_1069942_457_756 99
349 3300039453 Ga0436362_0221915 Ga0436362_0221915_85_384 99
350 3300041451 Ga0451791_0684621 Ga0451791_0684621_144_452 99
351 3300041453 Ga0451797_0774619 Ga0451797_0774619_222_530 99
352 3300041486 Ga0451807_1734530 Ga0451807_1734530_270_578 99
353 3300041491 Ga0451833_0197010 Ga0451833_0197010_321_629 99
354 3300041498 Ga0451841_0062055 Ga0451841_0062055_516_824 99
355 3300041509 Ga0451843_0375183 Ga0451843_0375183_599_907 99
356 3300041512 Ga0451853_3743631 Ga0451853_3743631_38_337 99
357 3300042004 Ga0439445_0252529 Ga0439445_0252529_160_459 99
358 3300044719 Ga0466971_0579684 Ga0466971_0579684_19_318 99
359 3300045049 Ga0466959_0327013 Ga0466959_0327013_17_316 99
360 3300045976 Ga0466967_0178939 Ga0466967_0178939_684_983 99
361 3300046454 Ga0495592_0002995 Ga0495592_0002995_4416_4715 99
362 3300046454 Ga0495592_0116414 Ga0495592_0116414_1480_1779 99
363 3300046457 Ga0495590_0018187 Ga0495590_0018187_302_601 99
364 3300046459 Ga0495629_0003398 Ga0495629_0003398_8695_8994 99
365 3300046459 Ga0495629_0151603 Ga0495629_0151603_178_477 99
366 3300046461 Ga0495641_0140173 Ga0495641_0140173_143_442 99
367 3300046462 Ga0495651_0010780 Ga0495651_0010780_821_1120 99
368 3300046462 Ga0495651_0175282 Ga0495651_0175282_412_711 99
369 3300046463 Ga0495653_0000370 Ga0495653_0000370_24410_24709 99
370 3300046463 Ga0495653_0061061 Ga0495653_0061061_167_466 99
371 3300046463 Ga0495653_0063779 Ga0495653_0063779_412_711 99
372 3300046475 Ga0495639_0741729 Ga0495639_0741729_62_361 99
373 3300046476 Ga0495662_0204999 Ga0495662_0204999_517_816 99
374 3300046477 Ga0495664_0060532 Ga0495664_0060532_1668_1967 99
375 3300046477 Ga0495664_0104730 Ga0495664_0104730_11_310 99
376 3300046499 Ga0495594_0155889 Ga0495594_0155889_786_1085 99
377 3300046500 Ga0495596_0178998 Ga0495596_0178998_139_447 99
378 3300046511 Ga0495608_0014254 Ga0495608_0014254_2562_2861 99
379 3300046511 Ga0495608_0071471 Ga0495608_0071471_306_605 99
380 3300046511 Ga0495608_0491643 Ga0495608_0491643_119_418 99
381 3300046514 Ga0495618_0012751 Ga0495618_0012751_3414_3713 99
382 3300046514 Ga0495618_0590176 Ga0495618_0590176_329_628 99
383 3300046516 Ga0495628_0003568 Ga0495628_0003568_7521_7820 99
384 3300046516 Ga0495628_0005831 Ga0495628_0005831_2031_2330 99
385 3300046517 Ga0495630_1227919 Ga0495630_1227919_96_395 99
386 3300046522 Ga0495643_0024522 Ga0495643_0024522_687_995 99
387 3300046525 Ga0495663_0066915 Ga0495663_0066915_665_973 99
388 3300046528 Ga0495642_0200367 Ga0495642_0200367_502_801 99
389 3300046529 Ga0495652_0090680 Ga0495652_0090680_935_1234 99
390 3300046529 Ga0495652_0394656 Ga0495652_0394656_133_432 99
391 3300046530 Ga0495654_0062673 Ga0495654_0062673_112_420 99
392 3300046531 Ga0495665_0072108 Ga0495665_0072108_559_858 99
393 3300046531 Ga0495665_0127749 Ga0495665_0127749_738_1037 99
394 3300046533 Ga0495640_0000769 Ga0495640_0000769_16149_16448 99
395 3300046533 Ga0495640_0099168 Ga0495640_0099168_1034_1333 99
396 3300046533 Ga0495640_0199344 Ga0495640_0199344_922_1221 99
397 3300046535 Ga0495586_0565733 Ga0495586_0565733_85_384 99
398 3300046536 Ga0495587_0001869 Ga0495587_0001869_1439_1738 99
399 3300046536 Ga0495587_0643958 Ga0495587_0643958_53_352 99
400 3300046543 Ga0495645_0050307 Ga0495645_0050307_812_1111 99
401 3300046543 Ga0495645_0317334 Ga0495645_0317334_273_572 99
402 3300046543 Ga0495645_0389262 Ga0495645_0389262_289_588 99
403 3300046559 Ga0495667_0001942 Ga0495667_0001942_8963_9262 99
404 3300046559 Ga0495667_0115907 Ga0495667_0115907_391_690 99
405 3300046616 Ga0495668_0000015 Ga0495668_0000015_4284_4592 99
406 3300046642 Ga0495634_0002200 Ga0495634_0002200_8988_9287 99
407 3300046660 Ga0495625_0004430 Ga0495625_0004430_11776_12084 99
408 3300046663 Ga0495635_0004328 Ga0495635_0004328_6815_7114 99
409 3300046663 Ga0495635_0008888 Ga0495635_0008888_368_667 99
410 3300046675 Ga0495657_0015052 Ga0495657_0015052_143_442 99
411 3300046675 Ga0495657_0096649 Ga0495657_0096649_1001_1300 99
412 3300046678 Ga0495599_0054944 Ga0495599_0054944_401_700 99
413 3300046678 Ga0495599_0067022 Ga0495599_0067022_1663_1962 99
414 3300046679 Ga0495623_0003723 Ga0495623_0003723_8938_9237 99
415 3300046679 Ga0495623_0040141 Ga0495623_0040141_376_675 99
416 3300046680 Ga0495646_0022938 Ga0495646_0022938_641_940 99
417 3300046680 Ga0495646_0091953 Ga0495646_0091953_774_1073 99
418 3300046680 Ga0495646_0171244 Ga0495646_0171244_285_584 99
419 3300046683 Ga0495658_0015745 Ga0495658_0015745_3227_3526 99
420 3300046683 Ga0495658_0086177 Ga0495658_0086177_22_321 99
421 3300046690 Ga0495624_0354859 Ga0495624_0354859_163_462 99
422 3300046692 Ga0495671_0348952 Ga0495671_0348952_92_391 99
423 3300046809 Ga0495600_0000422 Ga0495600_0000422_11905_12204 99
424 3300046809 Ga0495600_0152028 Ga0495600_0152028_1043_1342 99
425 3300047315 Ga0495581_0228187 Ga0495581_0228187_112_411 99
426 3300047317 Ga0495604_0000406 Ga0495604_0000406_18044_18343 99
427 3300047317 Ga0495604_0053710 Ga0495604_0053710_421_720 99
428 3300047317 Ga0495604_0083692 Ga0495604_0083692_904_1203 99
429 3300047319 Ga0495674_0000757 Ga0495674_0000757_22349_22648 99
430 3300047319 Ga0495674_0360804 Ga0495674_0360804_738_1037 99
431 3300047319 Ga0495674_0487973 Ga0495674_0487973_570_869 99
432 3300047320 Ga0495672_0191493 Ga0495672_0191493_549_848 99
433 3300047321 Ga0495676_0030911 Ga0495676_0030911_3768_4067 99
434 3300047322 Ga0495680_0001477 Ga0495680_0001477_12322_12621 99
435 3300047322 Ga0495680_0058793 Ga0495680_0058793_317_616 99
436 3300047322 Ga0495680_0068123 Ga0495680_0068123_694_993 99
437 3300047444 Ga0495675_0062506 Ga0495675_0062506_250_549 99
438 3300047444 Ga0495675_0426758 Ga0495675_0426758_199_498 99
439 3300047471 Ga0495684_0008747 Ga0495684_0008747_1566_1865 99
440 3300047471 Ga0495684_0165279 Ga0495684_0165279_500_799 99
441 3300047472 Ga0495686_0280624 Ga0495686_0280624_334_633 99
442 3300048088 Ga0495602_0064112 Ga0495602_0064112_2641_2940 99
443 3300048088 Ga0495602_0231319 Ga0495602_0231319_554_853 99
444 3300048088 Ga0495602_0481283 Ga0495602_0481283_362_661 99
445 3300048091 Ga0495626_0094952 Ga0495626_0094952_180_479 99
446 3300048904 Ga0496101_0125826 Ga0496101_0125826_248_547 99
447 3300048905 Ga0496102_0188965 Ga0496102_0188965_1520_1819 99
448 3300048907 Ga0496104_0000399 Ga0496104_0000399_35811_36110 99
449 3300048907 Ga0496104_0521147 Ga0496104_0521147_567_866 99
450 3300048907 Ga0496104_0523266 Ga0496104_0523266_588_887 99
451 3300048908 Ga0496105_0002417 Ga0496105_0002417_11733_12032 99
452 3300048908 Ga0496105_0098094 Ga0496105_0098094_1728_2027 99
453 3300048909 Ga0496106_0042430 Ga0496106_0042430_1301_1600 99
454 3300048910 Ga0496107_0118946 Ga0496107_0118946_156_455 99
455 3300048910 Ga0496107_0337157 Ga0496107_0337157_275_574 99
456 3300048911 Ga0496108_1770880 Ga0496108_1770880_180_479 99
457 3300048912 Ga0496109_0226409 Ga0496109_0226409_553_852 99
458 3300048912 Ga0496109_0962903 Ga0496109_0962903_464_763 99
459 3300048913 Ga0496110_1202111 Ga0496110_1202111_185_484 99
460 3300048915 Ga0496112_0699138 Ga0496112_0699138_333_632 99
461 3300048918 Ga0496115_0047461 Ga0496115_0047461_995_1294 99
462 3300048918 Ga0496115_0076081 Ga0496115_0076081_938_1237 99
463 3300048921 Ga0496118_0227250 Ga0496118_0227250_640_939 99
464 3300048927 Ga0496124_0238928 Ga0496124_0238928_292_591 99
465 3300048927 Ga0496124_0991349 Ga0496124_0991349_152_460 99
466 3300048928 Ga0496125_0023890 Ga0496125_0023890_5115_5414 99
467 3300048929 Ga0496126_0396598 Ga0496126_0396598_316_624 99
468 3300049127 Ga0501306_023495 Ga0501306_023495_455_763 99
469 3300049536 Ga0501320_036040 Ga0501320_036040_49_357 99
470 3300049538 Ga0501322_018236 Ga0501322_018236_130_438 99
471 3300049568 Ga0501031_0335074 Ga0501031_0335074_305_604 99
472 3300049569 Ga0501032_0045571 Ga0501032_0045571_735_1034 99
473 3300049569 Ga0501032_0058423 Ga0501032_0058423_1501_1800 99
474 3300049569 Ga0501032_0474181 Ga0501032_0474181_492_791 99
475 3300049570 Ga0501033_0107086 Ga0501033_0107086_240_539 99
476 3300049570 Ga0501033_0328006 Ga0501033_0328006_496_795 99
477 3300049571 Ga0501034_0090345 Ga0501034_0090345_2390_2689 99
478 3300049571 Ga0501034_0132600 Ga0501034_0132600_145_444 99
479 3300049571 Ga0501034_0134254 Ga0501034_0134254_1489_1788 99
480 3300049571 Ga0501034_0212658 Ga0501034_0212658_59_358 99
481 3300049571 Ga0501034_0623346 Ga0501034_0623346_448_753 99
482 3300049572 Ga0501036_0189285 Ga0501036_0189285_1257_1556 99
483 3300049572 Ga0501036_0268203 Ga0501036_0268203_824_1123 99
484 3300049572 Ga0501036_0312106 Ga0501036_0312106_999_1298 99
485 3300049572 Ga0501036_0528883 Ga0501036_0528883_49_348 99
486 3300049573 Ga0501037_0118828 Ga0501037_0118828_774_1073 99
487 3300049573 Ga0501037_0426027 Ga0501037_0426027_461_766 99
488 3300049573 Ga0501037_0851841 Ga0501037_0851841_119_418 99
489 3300049574 Ga0501038_0058047 Ga0501038_0058047_1551_1850 99
490 3300049574 Ga0501038_0300648 Ga0501038_0300648_54_353 99
491 3300049575 Ga0501039_0070689 Ga0501039_0070689_227_526 99
492 3300049575 Ga0501039_0097766 Ga0501039_0097766_1458_1757 99
493 3300049576 Ga0501040_0026515 Ga0501040_0026515_719_1018 99
494 3300049576 Ga0501040_0297895 Ga0501040_0297895_347_646 99
495 3300049578 Ga0501042_0380390 Ga0501042_0380390_181_480 99
496 3300049578 Ga0501042_0867999 Ga0501042_0867999_133_432 99
497 3300049579 Ga0501043_0348979 Ga0501043_0348979_107_406 99
498 3300049579 Ga0501043_0654040 Ga0501043_0654040_53_352 99
499 3300049580 Ga0501046_0507063 Ga0501046_0507063_511_810 99
500 3300049581 Ga0501047_0155663 Ga0501047_0155663_460_759 99
501 3300049581 Ga0501047_0205740 Ga0501047_0205740_723_1022 99
502 3300049582 Ga0501048_0308399 Ga0501048_0308399_317_616 99
503 3300049582 Ga0501048_0393070 Ga0501048_0393070_643_942 99
504 3300049583 Ga0501067_0051199 Ga0501067_0051199_15_314 99
505 3300049583 Ga0501067_0251762 Ga0501067_0251762_64_363 99
506 3300049584 Ga0501068_0029125 Ga0501068_0029125_786_1085 99
507 3300049584 Ga0501068_0057493 Ga0501068_0057493_801_1100 99
508 3300049584 Ga0501068_0111569 Ga0501068_0111569_376_675 99
509 3300049584 Ga0501068_0858507 Ga0501068_0858507_235_534 99
510 3300049585 Ga0501069_0030545 Ga0501069_0030545_913_1212 99
511 3300049585 Ga0501069_0383742 Ga0501069_0383742_142_441 99
512 3300049585 Ga0501069_0710591 Ga0501069_0710591_189_488 99
513 3300049586 Ga0501070_0067473 Ga0501070_0067473_1198_1497 99
514 3300049586 Ga0501070_0083561 Ga0501070_0083561_1477_1776 99
515 3300049586 Ga0501070_0202001 Ga0501070_0202001_772_1077 99
516 3300049586 Ga0501070_0242991 Ga0501070_0242991_44_343 99
517 3300049586 Ga0501070_0794514 Ga0501070_0794514_19_318 99
518 3300049587 Ga0501071_0063412 Ga0501071_0063412_1118_1417 99
519 3300049587 Ga0501071_0088539 Ga0501071_0088539_494_793 99
520 3300049587 Ga0501071_0357403 Ga0501071_0357403_122_421 99
521 3300049587 Ga0501071_0782871 Ga0501071_0782871_406_705 99
522 3300049588 Ga0501072_0029078 Ga0501072_0029078_3384_3683 99
523 3300049588 Ga0501072_0067263 Ga0501072_0067263_1318_1617 99
524 3300049588 Ga0501072_0646656 Ga0501072_0646656_324_623 99
525 3300049589 Ga0501073_0040649 Ga0501073_0040649_2273_2572 99
526 3300049589 Ga0501073_0086033 Ga0501073_0086033_1382_1681 99
527 3300049589 Ga0501073_0311672 Ga0501073_0311672_444_743 99
528 3300049589 Ga0501073_0728373 Ga0501073_0728373_34_333 99
529 3300049589 Ga0501073_0907682 Ga0501073_0907682_189_488 99
530 3300049590 Ga0501074_0049622 Ga0501074_0049622_1483_1782 99
531 3300049590 Ga0501074_0057437 Ga0501074_0057437_64_363 99
532 3300049590 Ga0501074_0146813 Ga0501074_0146813_726_1025 99
533 3300049591 Ga0501075_0217916 Ga0501075_0217916_251_550 99
534 3300049592 Ga0501076_0222571 Ga0501076_0222571_62_361 99
535 3300049592 Ga0501076_0342573 Ga0501076_0342573_39_338 99
536 3300049593 Ga0501077_0305720 Ga0501077_0305720_273_572 99
537 3300049741 Ga0501079_0182947 Ga0501079_0182947_514_813 99
538 3300049742 Ga0501080_0041183 Ga0501080_0041183_3767_4066 99
539 3300049742 Ga0501080_0141304 Ga0501080_0141304_1198_1497 99
540 3300049742 Ga0501080_0195626 Ga0501080_0195626_890_1189 99
541 3300049743 Ga0501081_0664905 Ga0501081_0664905_375_674 99
542 3300049743 Ga0501081_0734657 Ga0501081_0734657_329_628 99
543 3300049743 Ga0501081_0872663 Ga0501081_0872663_272_571 99
544 3300049744 Ga0501083_0153487 Ga0501083_0153487_1038_1337 99
545 3300049744 Ga0501083_0340546 Ga0501083_0340546_543_842 99
546 3300049822 Ga0501035_0160450 Ga0501035_0160450_1280_1579 99
547 3300049822 Ga0501035_1116084 Ga0501035_1116084_245_550 99
548 3300049822 Ga0501035_1127664 Ga0501035_1127664_245_550 99
549 3300049823 Ga0501044_0105973 Ga0501044_0105973_1499_1798 99
550 3300049823 Ga0501044_0128361 Ga0501044_0128361_2150_2455 99
551 3300049823 Ga0501044_0172926 Ga0501044_0172926_1687_1986 99
552 3300049823 Ga0501044_0270613 Ga0501044_0270613_809_1108 99
553 3300049823 Ga0501044_0273668 Ga0501044_0273668_1262_1561 99
554 3300049824 Ga0501045_0313307 Ga0501045_0313307_844_1143 99
555 3300050496 nmdc:mga07m45_115921_c1 nmdc:mga07m45_115921_c1_807_1106 99
556 3300050507 nmdc:mga05p37_2115048_c1 nmdc:mga05p37_2115048_c1_46_345 99
557 3300050507 nmdc:mga05p37_434840_c1 nmdc:mga05p37_434840_c1_546_845 99
558 3300050508 nmdc:mga09592_372677_c1 nmdc:mga09592_372677_c1_520_819 99
559 3300050509 nmdc:mga0qj67_225617_c1 nmdc:mga0qj67_225617_c1_427_726 99
560 3300050509 nmdc:mga0qj67_44746_c1 nmdc:mga0qj67_44746_c1_1906_2205 99
561 3300050509 nmdc:mga0qj67_875435_c1 nmdc:mga0qj67_875435_c1_177_476 99
562 3300050510 nmdc:mga06r32_887796_c1 nmdc:mga06r32_887796_c1_168_467 99
563 3300050511 nmdc:mga08y16_136821_c1 nmdc:mga08y16_136821_c1_231_530 99
564 3300050512 nmdc:mga0n895_189483_c1 nmdc:mga0n895_189483_c1_917_1216 99
565 3300050515 nmdc:mga0a205_66873_c1 nmdc:mga0a205_66873_c1_1204_1503 99
566 3300053077 Ga0495601_0003476 Ga0495601_0003476_8503_8802 99
567 3300053077 Ga0495601_0004742 Ga0495601_0004742_3488_3787 99
568 3300053077 Ga0495601_0007996 Ga0495601_0007996_2311_2610 99
569 3300053078 Ga0495612_0002228 Ga0495612_0002228_3974_4273 99
570 3300053078 Ga0495612_0089635 Ga0495612_0089635_588_887 99
571 3300053078 Ga0495612_0144431 Ga0495612_0144431_119_418 99
572 3300053083 Ga0495655_0031218 Ga0495655_0031218_948_1247 99
573 3300053084 Ga0495595_0001345 Ga0495595_0001345_8424_8723 99
574 3300053084 Ga0495595_0007610 Ga0495595_0007610_777_1076 99
575 3300053084 Ga0495595_0040126 Ga0495595_0040126_283_582 99
576 3300053085 Ga0495619_0000352 Ga0495619_0000352_18620_18919 99
577 3300053085 Ga0495619_0013467 Ga0495619_0013467_3773_4072 99
578 3300053085 Ga0495619_0015650 Ga0495619_0015650_407_706 99
579 3300053088 Ga0500644_0008929 Ga0500644_0008929_324_623 99
580 3300053116 Ga0500592_004394 Ga0500592_004394_31_339 99
581 3300053134 Ga0500658_0011094 Ga0500658_0011094_1376_1684 99
582 3300053139 Ga0500568_0013224 Ga0500568_0013224_2452_2760 99
583 3300053151 Ga0500604_0032973 Ga0500604_0032973_792_1100 99
584 3300053153 Ga0500616_0179292 Ga0500616_0179292_186_485 99
585 3300053153 Ga0500616_0284023 Ga0500616_0284023_365_664 99
586 3300053158 Ga0500627_0000009 Ga0500627_0000009_148524_148832 99
587 3300054114 Ga0501084_0130731 Ga0501084_0130731_1263_1562 99
588 3300054114 Ga0501084_0303891 Ga0501084_0303891_263_562 99
589 3300054114 Ga0501084_0595091 Ga0501084_0595091_31_330 99
590 3300059493 Ga0587077_236276 Ga0587077_236276_175_483 99
591 3300060353 Ga0501082_0109453 Ga0501082_0109453_613_912 99
592 3300060353 Ga0501082_0301898 Ga0501082_0301898_372_671 99
593 3300060353 Ga0501082_0788570 Ga0501082_0788570_28_327 99
594 3300060353 Ga0501082_1148750 Ga0501082_1148750_144_443 99
595 3300061719 Ga0466962_0597379 Ga0466962_0597379_139_438 99
596 3300003203 JGI25406J46586_10118782 JGI25406J46586_101187822 100
597 3300003354 JGI25160J50197_1015787 JGI25160J50197_10157873 100
598 3300005262 Ga0065165_1044790 Ga0065165_10447902 100
599 3300005985 Ga0081539_10054324 Ga0081539_100543245 100
600 3300006941 Ga0099825_1058931 Ga0099825_10589312 100
601 3300020070 Ga0206356_11866436 Ga0206356_118664362 100
602 3300021320 Ga0214544_1000006 Ga0214544_1000006183 100
603 3300021321 Ga0214542_1000002 Ga0214542_1000002192 100
604 3300021324 Ga0214545_1000002 Ga0214545_1000002527 100
605 3300021327 Ga0214543_1000017 Ga0214543_1000017131 100
606 3300025302 Ga0207426_1012954 Ga0207426_10129545 100
607 3300025898 Ga0207692_10523415 Ga0207692_105234152 100
608 3300027296 Ga0209389_1002002 Ga0209389_100200223 100
609 3300027357 Ga0209589_1000300 Ga0209589_100030021 100
610 3300027361 Ga0209489_100010 Ga0209489_100010236 100
611 3300027361 Ga0209489_116934 Ga0209489_1169345 100
612 3300027363 Ga0209700_100031 Ga0209700_100031166 100
613 3300037312 Ga0395899_0124704 Ga0395899_0124704_1028_1330 100
614 3300037418 Ga0395900_0022503 Ga0395900_0022503_3277_3579 100
615 3300037466 Ga0395898_0371206 Ga0395898_0371206_607_909 100
616 3300037471 Ga0395905_0413453 Ga0395905_0413453_915_1217 100
617 3300038443 Ga0395901_0045720 Ga0395901_0045720_2051_2353 100
618 3300044658 Ga0466972_0019604 Ga0466972_0019604_2443_2745 100
619 3300044658 Ga0466972_0088328 Ga0466972_0088328_841_1143 100
620 3300044683 Ga0466965_0752777 Ga0466965_0752777_107_409 100
621 3300044735 Ga0466968_0300698 Ga0466968_0300698_380_682 100
622 3300044901 Ga0466960_0660720 Ga0466960_0660720_55_357 100
623 3300049459 Ga0495678_118787 Ga0495678_118787_481_783 100
624 3300049571 Ga0501034_1540172 Ga0501034_1540172_200_502 100
625 3300059477 Ga0587084_159606 Ga0587084_159606_170_472 100

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

22

107

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m4z-assembly1.cif.gz_S a. baumannii ribosome-eravacycline complex: hpf-bound 70s 0.9725 8 92
8cgd-assembly1.cif.gz_s clindamycin bound to the 50s subunit 0.9711 8 89
7nhn-assembly1.cif.gz_W vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9653 9 95
6ppf-assembly1.cif.gz_T bacterial 45srbga ribosomal particle class b 0.9612 9 95
8cvm-assembly1.cif.gz_s cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9592 9 96
ID Description Score Start End Superfamily
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9613 9 95 3.30.70.330
4ukhK00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9513 9 92 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9199 9 95 3.30.70.330
4garT00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9148 6 94 3.30.70.330
af_P61845_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9041 11 95 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A1F8FZ40-F1-model_v4 Large ribosomal subunit protein uL23 0.9919 12 95 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1G2RDF2-F1-model_v4 Large ribosomal subunit protein uL23 0.9901 11 96 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1F8FIA2-F1-model_v4 Large ribosomal subunit protein uL23 0.9881 12 96 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2H0VBE9-F1-model_v4 Large ribosomal subunit protein uL23 0.987 9 95 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A554K197-F1-model_v4 Large ribosomal subunit protein uL23 0.9869 7 96 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
89.36 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map