F497216

General Info

Members Datasets Scaffolds Average Seq Length
3089 1187 2525 331

Family's Representative Sequence

Representative Sequence 3300002070|JGI24750J21931_1005547|JGI24750J21931_10055472
Length 376
Sequence MNGSWPQAKMTLYLAKPLLLDKGPQRAKISFPAGWFPYPAPHPGWTRMAERPIVIVTRKLPDVVETRLRELFDARLNLDDTPFSREELIEAVKTANVLVPTVTDRIDRGVLSQAGPNLKLIAQFGTGVDNIDLETARNRSIIVTNTPGVLTEDTADMTMALIIAVPRRLTEGAAVLRTGNSEWHGWSPTWMLGHRIFGKRLGIVGMGRVGQAVARRAKAFGLQIHYHNRRRVAPEIEKALEATYWDSLDQMLARMDIISINCPHTPATYHLLSARRLALMKPSAYIVNTARGEVIDENALARMIENEELAGAGLDVFEHEPAVNPKLLKSDKVVVLPHMGSATLEGRVDMGEKVIINIKTFLDGHAPPDRVHPAMF

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
9 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
10 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
11 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
12 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
13 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
14 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
15 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
16 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
17 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
18 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
19 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
20 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
21 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
22 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
23 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
24 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
25 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
26 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
27 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
28 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
29 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
30 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
31 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
32 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
33 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
34 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
35 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
36 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
37 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
38 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
39 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
40 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
41 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
42 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
43 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
44 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
45 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
46 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
47 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
48 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
49 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
50 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
51 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
52 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
53 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
54 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
55 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
56 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
57 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
58 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
59 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
60 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
61 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
62 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
63 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
64 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
65 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
66 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
67 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
68 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
69 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
70 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
71 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
72 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
73 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
74 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
75 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
76 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
77 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
78 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
79 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
80 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
81 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
82 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
83 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
84 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
85 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
86 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
87 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
88 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
89 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
90 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
91 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
92 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
93 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
94 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
95 2643221557 Ensifer sp. Root558 Isolate Unclassified
96 2643221582 Rhizobium sp. Root651 Isolate Unclassified
97 2643221583 Caulobacter sp. Root655 Isolate Unclassified
98 2643221584 Caulobacter sp. Root656 Isolate Unclassified
99 2643221599 Rhizobium sp. Root708 Isolate Unclassified
100 2643221610 Ensifer sp. Root74 Isolate Unclassified
101 2643221618 Ensifer sp. Root231 Isolate Unclassified
102 2643221626 Ensifer sp. Root31 Isolate Unclassified
103 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
104 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
105 2643221640 Caulobacter sp. Root342 Isolate Unclassified
106 2643221642 Caulobacter sp. Root343 Isolate Unclassified
107 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
108 2643221651 Afipia sp. Root123D2 Isolate Unclassified
109 2643221655 Ensifer sp. Root1252 Isolate Unclassified
110 2643221659 Ensifer sp. Root127 Isolate Unclassified
111 2643221668 Ensifer sp. Root423 Isolate Unclassified
112 2643221675 Ensifer sp. Root1298 Isolate Unclassified
113 2643221680 Ensifer sp. Root1312 Isolate Unclassified
114 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
115 2643221693 Rhizobium sp. Root491 Isolate Unclassified
116 2643221698 Ensifer sp. Root142 Isolate Unclassified
117 2643221712 Ensifer sp. Root258 Isolate Unclassified
118 2643221718 Rhizobium sp. Root268 Isolate Unclassified
119 2643221723 Ensifer sp. Root278 Isolate Unclassified
120 2643221726 Ensifer sp. Root954 Isolate Unclassified
121 2643221734 Bosea sp. Root670 Isolate Unclassified
122 2643221736 Bosea sp. Root483D1 Isolate Unclassified
123 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
124 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
125 2718217882 Rhizobium sp. N741 Isolate Nodule
126 2718217927 Rhizobium sp. N324 Isolate Nodule
127 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
128 2718218009 Rhizobium sp. N561 Isolate Nodule
129 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
130 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
131 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
132 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
133 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
134 2718218363 Rhizobium sp. N113 Isolate Nodule
135 2718218365 Rhizobium sp. N731 Isolate Nodule
136 2718218366 Rhizobium sp. N621 Isolate Nodule
137 2718218423 Rhizobium sp. N941 Isolate Nodule
138 2721755514 Rhizobium sp. N6212 Isolate Nodule
139 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
140 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
141 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
142 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
143 2721755809 Rhizobium sp. N541 Isolate Nodule
144 2721755810 Rhizobium sp. N871 Isolate Nodule
145 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
146 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
147 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
148 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
149 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
150 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
151 2728369365 Rhizobium sp. N1341 Isolate Nodule
152 2728369397 Rhizobium sp. N1314 Isolate Nodule
153 2738541293 Rhizobium sp. GV031 Isolate Unclassified
154 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
155 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
156 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
157 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
158 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
159 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
160 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
161 2791355256 Rhizobium sp. M10 Isolate Nodule
162 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
163 2791355260 Rhizobium sp. L9 Isolate Nodule
164 2791355261 Rhizobium sp. J15 Isolate Nodule
165 2791355262 Rhizobium sp. M1 Isolate Nodule
166 2791355263 Rhizobium chutanense C5 Isolate Nodule
167 2791355264 Rhizobium sp. S9 Isolate Nodule
168 2791355265 Rhizobium sp. H4 Isolate Nodule
169 2791355267 Rhizobium sp. L18 Isolate Nodule
170 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
171 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
172 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
173 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
174 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
175 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
176 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
177 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
178 2802429633 Rhizobium anhuiense J3 Isolate Nodule
179 2802429634 Rhizobium anhuiense S10 Isolate Nodule
180 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
181 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
182 2802429637 Rhizobium anhuiense C15 Isolate Nodule
183 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
184 2818991435 Caulobacter henricii 536 Isolate Unclassified
185 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
186 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
187 2818991467 Bosea vestrisii 3192 Isolate Unclassified
188 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
189 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
190 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
191 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
192 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
193 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
194 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
195 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
196 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
197 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
198 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
199 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
200 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
201 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
202 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
203 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
204 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
205 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
206 2841760612 Bosea sp. Tri-49 Isolate Nodule
207 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
208 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
209 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
210 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
211 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
212 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
213 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
214 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
215 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
216 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
217 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
218 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
219 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
220 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
221 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
222 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
223 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
224 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
225 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
226 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
227 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
228 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
229 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
230 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
231 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
232 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
233 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
234 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
235 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
236 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
237 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
238 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
239 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
240 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
241 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
242 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
243 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
244 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
245 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
246 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
247 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
248 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
249 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
250 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
251 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
252 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
253 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
254 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
255 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
256 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
257 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
258 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
259 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
260 2844104063 Bosea sp. Tri-39 Isolate Nodule
261 2844163670 Ensifer sp. 1H6 Isolate Unclassified
262 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
263 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
264 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
265 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
266 2849560528 Caulobacter zeae 410 Isolate Unclassified
267 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
268 2851153111 Caulobacter radicis 736 Isolate Unclassified
269 2851182111 Bosea sp. Tri-44 Isolate Nodule
270 2851246043 Bosea sp. Tri-54 Isolate Nodule
271 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
272 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
273 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
274 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
275 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
276 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
277 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
278 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
279 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
280 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
281 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
282 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
283 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
284 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
285 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
286 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
287 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
288 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
289 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
290 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
291 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
292 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
293 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
294 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
295 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
296 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
297 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
298 2904699407
299 2906610324
300 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
301 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
302 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
303 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
304 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
305 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
306 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
307 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
308 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
309 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
310 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
311 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
312 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
313 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
314 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
315 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
316 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
317 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
318 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
319 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
320 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
321 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
322 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
323 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
324 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
325 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
326 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
327 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
328 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
329 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
330 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
331 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
332 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
333 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
334 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
335 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
336 2922425934
337 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
338 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
339 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
340 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
341 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
342 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
343 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
344 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
345 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
346 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
347 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
348 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
349 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
350 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
351 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
352 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
353 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
354 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
355 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
356 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
357 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
358 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
359 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
360 2933599457 Rhizobium phaseoli M3 Isolate Nodule
361 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
362 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
363 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
364 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
365 2936381700 Rhizobium chutanense C16 Isolate Unclassified
366 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
367 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
368 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
369 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
370 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
371 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
372 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
373 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
374 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
375 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
376 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
377 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
378 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
379 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
380 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
381 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
382 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
383 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
384 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
385 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
386 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
387 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
388 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
389 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
390 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
391 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
392 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
393 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
394 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
395 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
396 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
397 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
398 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
399 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
400 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
401 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
402 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
403 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
404 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
405 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
406 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
407 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
408 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
409 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
410 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
411 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
412 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
413 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
414 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
415 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
416 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
417 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
418 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
419 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
420 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
421 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
422 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
423 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
424 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
425 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
426 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
427 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
428 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
429 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
430 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
431 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
432 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
433 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
434 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
435 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
436 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
437 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
438 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
439 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
440 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
441 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
442 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
443 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
444 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
445 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
446 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
447 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
448 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
449 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
450 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
451 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
452 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
453 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
454 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
455 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
456 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
457 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
458 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
459 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
460 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
461 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
462 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
463 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
464 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
465 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
466 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
467 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
468 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
469 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
470 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
471 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
472 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
473 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
474 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
475 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
476 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
477 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
478 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
479 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
480 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
481 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
482 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
483 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
484 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
485 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
486 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
487 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
488 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
489 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
490 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
491 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
492 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
493 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
494 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
495 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
496 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
497 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
498 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
499 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
500 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
501 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
502 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
503 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
504 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
505 2996887358 Rhizobium sp. R711 Isolate Nodule
506 2996893221 Rhizobium sp. R635 Isolate Nodule
507 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
508 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
509 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
510 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
511 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
512 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
513 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
514 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
515 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
516 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
517 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
518 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
519 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
520 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
521 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
522 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
523 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
524 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
525 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
526 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
527 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
528 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
529 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
530 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
531 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
532 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
533 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
534 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
535 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
536 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
537 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
538 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
539 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
540 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
541 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
542 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
543 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
544 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
545 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
546 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
547 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
548 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
549 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
550 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
551 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
552 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
553 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
554 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
555 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
556 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
557 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
558 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
559 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
560 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
561 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
562 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
563 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
564 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
565 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
566 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
567 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
568 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
569 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
570 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
571 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
572 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
573 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
574 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
575 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
576 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
577 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
578 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
579 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
580 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
581 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
582 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
583 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
584 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
585 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
586 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
587 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
588 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
589 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
590 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
591 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
592 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
593 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
594 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
595 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
596 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
597 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
598 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
599 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
600 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
601 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
602 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
603 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
604 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
605 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
606 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
607 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
608 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
609 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
610 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
611 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
612 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
613 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
614 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
615 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
616 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
617 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
618 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
619 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
620 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
621 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
622 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
623 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
624 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
625 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
626 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
627 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
628 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
629 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
630 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
631 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
632 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
633 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
634 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
635 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
636 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
637 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
638 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
639 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
640 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
641 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
642 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
643 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
644 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
645 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
646 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
647 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
648 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
649 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
650 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
651 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
652 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
653 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
654 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
655 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
656 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
657 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
658 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
659 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
660 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
661 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
662 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
663 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
664 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
665 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
666 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
667 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
668 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
669 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
670 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
671 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
672 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
673 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
674 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
675 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
676 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
677 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
678 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
679 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
680 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
681 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
682 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
683 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
684 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
685 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
686 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
687 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
688 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
689 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
690 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
691 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
692 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
693 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
694 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
695 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
696 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
697 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
698 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
699 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
700 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
701 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
702 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
703 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
704 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
705 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
706 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
707 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
708 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
709 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
710 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
711 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
712 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
713 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
714 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
715 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
716 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
717 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
718 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
719 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
720 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
721 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
722 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
723 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
724 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
725 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
726 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
727 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
728 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
729 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
730 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
731 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
732 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
733 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
734 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
735 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
736 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
737 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
738 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
739 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
740 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
741 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
742 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
743 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
744 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
745 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
746 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
747 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
748 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
749 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
750 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
751 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
752 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
753 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
754 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
755 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
756 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
757 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
758 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
759 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
760 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
761 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
762 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
763 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
764 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
765 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
766 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
767 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
768 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
769 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
770 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
771 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
772 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
773 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
774 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
775 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
776 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
777 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
778 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
779 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
780 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
781 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
782 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
783 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
784 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
785 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
786 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
787 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
788 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
789 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
790 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
791 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
792 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
793 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
794 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
795 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
796 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
797 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
798 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
799 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
800 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
801 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
802 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
803 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
804 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
805 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
806 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
807 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
808 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
809 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
810 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
811 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
812 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
813 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
814 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
815 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
816 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
817 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
818 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
819 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
820 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
821 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
822 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
823 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
824 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
825 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
826 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
827 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
828 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
829 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
830 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
831 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
832 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
833 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
834 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
835 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
836 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
837 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
838 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
839 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
840 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
841 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
842 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
843 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
844 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
845 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
846 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
847 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
848 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
849 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
850 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
851 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
852 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
853 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
854 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
855 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
856 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
857 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
858 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
859 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
860 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
861 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
862 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
863 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
864 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
865 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
866 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
867 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
868 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
869 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
870 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
871 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
872 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
873 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
874 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
875 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
876 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
877 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
878 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
879 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
880 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
881 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
882 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
883 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
884 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
885 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
886 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
887 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
888 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
889 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
890 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
891 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
892 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
893 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
894 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
895 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
896 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
897 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
898 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
899 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
900 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
901 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
902 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
903 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
904 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
905 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
906 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
907 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
908 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
909 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
910 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
911 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
912 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
913 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
914 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
915 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
916 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
917 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
918 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
919 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
920 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
921 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
922 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
923 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
924 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
925 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
926 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
927 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
928 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
929 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
930 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
931 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
932 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
933 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
934 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
935 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
936 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
937 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
938 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
939 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
940 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
941 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
942 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
943 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
944 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
945 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
946 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
947 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
948 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
949 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
950 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
951 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
952 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
953 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
954 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
955 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
956 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
957 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
958 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
959 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
960 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
961 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
962 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
963 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
964 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
965 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
966 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
967 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
968 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
969 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
970 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
971 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
972 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
973 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
974 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
975 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
976 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
977 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
978 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
979 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
980 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
981 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
982 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
983 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
984 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
985 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
986 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
987 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
988 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
989 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
990 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
991 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
992 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
993 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
994 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
995 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
996 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
997 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
998 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
999 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
1000 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
1001 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
1002 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1003 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1004 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1005 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1006 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1007 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1008 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1009 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1010 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1011 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1012 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1013 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1014 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1015 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1016 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1017 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1018 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1019 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1020 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1021 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1022 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1023 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1024 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1025 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1026 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1027 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1028 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1029 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
1030 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1031 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1032 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1033 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1034 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1035 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1036 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1037 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1038 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1039 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
1040 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1041 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1042 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1043 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1044 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1045 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1046 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1047 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1048 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1049 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1050 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1051 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1052 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1053 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
1054 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1055 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
1056 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1057 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1058 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
1059 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1060 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1061 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1062 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1063 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1064 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1065 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1066 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1067 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1068 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1069 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1070 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1071 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1072 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
1073 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
1074 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1075 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1076 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1077 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1078 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
1079 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
1080 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1081 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1082 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
1083 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
1084 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1085 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1086 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1087 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
1088 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
1089 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
1090 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1091 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
1092 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
1093 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
1094 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
1095 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
1096 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
1097 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
1098 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
1099 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
1100 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
1101 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
1102 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1103 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
1104 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1105 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1106 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
1107 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1108 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1109 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1110 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
1111 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1112 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1113 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
1114 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
1115 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
1116 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
1117 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
1118 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1119 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1120 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1121 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1122 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1123 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
1124 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1125 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
1126 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1127 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
1128 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
1129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1130 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
1131 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
1132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1133 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
1134 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1135 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1136 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1137 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1138 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1139 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
1140 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
1141 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1142 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1143 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1144 8005258706 Rhizobium sp. R693 Isolate Nodule
1145 8005275841 Rhizobium sp. N4311 Isolate Nodule
1146 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1147 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1148 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1149 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1150 8005321885 Rhizobium sp. R72 Isolate Nodule
1151 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1152 8005382845 Rhizobium sp. R634 Isolate Nodule
1153 8005395548 Rhizobium sp. R339 Isolate Nodule
1154 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1155 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1156 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1157 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1158 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1159 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1160 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1161 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1162 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1163 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1164 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1165 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1166 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
1167 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
1168 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
1169 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1170 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1171 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1172 8018176218 Rhizobium sp. N122 Isolate Nodule
1173 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
1174 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1175 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1176 8024501048 Rhizobium sp. H4 Isolate Nodule
1177 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
1178 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1179 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1180 8056382006 Rhizobium croatiense 13T Isolate Nodule
1181 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
1182 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
1183 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
1184 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1185 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
1186 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
1187 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.63
Metatranscriptomes 0.19
Isolates 18.18

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 11.1
Nodule 13.79
Rhizoplane 5.47
Rhizosphere 61.41
Stem 0
Stem Tuber 0.03
Unclassified 8.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C1066 2010549000 Bacteria 1757
2 LJQas_1003115 3300000549 Bacteria 2242
3 JGI24740J21852_10014701 3300001979 Bacteria 2879
4 JGI24740J21852_10014902 3300001979 Bacteria 2854
5 JGI24739J22299_10000950 3300001989 Bacteria 10788
6 JGI24737J22298_10009769 3300001990 Bacteria 3180
7 JGI24735J21928_10007692 3300002067 Bacteria 3506
8 JGI24750J21931_1005547 3300002070 Bacteria 1552
9 JGI24034J26672_10010561 3300002239 Bacteria 1374
10 JGI24751J29686_10021714 3300002459 Bacteria 1331
11 JGI25152J39213_1000674 3300002773 Bacteria 17788
12 JGI25152J39213_1004074 3300002773 Bacteria 4745
13 JGI25152J39213_1006456 3300002773 Bacteria 3197
14 JGI25150J39212_1000203 3300002774 Bacteria 32405
15 JGI25150J39212_1001315 3300002774 Bacteria 7065
16 JGI25150J39212_1015565 3300002774 Bacteria 1264
17 JGI25159J45721_1001355 3300002987 Bacteria 10249
18 JGI25159J45721_1011714 3300002987 Bacteria 2132
19 JGI25151J46595_10000090 3300003187 Bacteria 123141
20 JGI25151J46595_10000439 3300003187 Bacteria 41010
21 JGI25151J46595_10002698 3300003187 Bacteria 10371
22 JGI25151J46595_10002873 3300003187 Bacteria 9893
23 JGI25165J46597_1000181 3300003214 Bacteria 95569
24 JGI25165J46597_1010025 3300003214 Bacteria 1395
25 JGI25153J46596_10000092 3300003215 Bacteria 105005
26 JGI25153J46596_10002927 3300003215 Bacteria 9665
27 JGI25153J46596_10004444 3300003215 Bacteria 7562
28 JGI25153J46596_10005348 3300003215 Bacteria 6743
29 JGI25153J46596_10009107 3300003215 Bacteria 4658
30 JGI25153J46596_10009146 3300003215 Bacteria 4642
31 rootL2_10058830 3300003322 Bacteria 2220
32 JGI25160J50197_1000061 3300003354 Bacteria 116643
33 JGI25160J50197_1001685 3300003354 Bacteria 10772
34 JGI25160J50197_1018790 3300003354 Bacteria 2141
35 JGI25161J50226_1000220 3300003374 Bacteria 35319
36 JGI25161J50226_1000512 3300003374 Bacteria 16931
37 JGI25161J50226_1000772 3300003374 Bacteria 12162
38 JGI25161J50226_1001749 3300003374 Bacteria 6141
39 Ga0006562J51391_1122603 3300003578 Bacteria 3020
40 JGI25404J52841_10003238 3300003659 Bacteria 3192
41 Ga0055526_1001843 3300003771 Bacteria 14664
42 Ga0055526_1001947 3300003771 Bacteria 14289
43 Ga0055526_1002554 3300003771 Bacteria 12216
44 Ga0055526_1004342 3300003771 Bacteria 8561
45 Ga0055526_1007620 3300003771 Bacteria 5584
46 Ga0055526_1021740 3300003771 Bacteria 2216
47 Ga0055537_1001649 3300003773 Bacteria 8347
48 Ga0055524_1000011 3300003775 Bacteria 261442
49 Ga0055524_1002068 3300003775 Bacteria 10650
50 Ga0055524_1007314 3300003775 Bacteria 4707
51 Ga0055524_1007822 3300003775 Bacteria 4505
52 Ga0055524_1030684 3300003775 Bacteria 1562
53 Ga0055524_1032073 3300003775 Bacteria 1498
54 Ga0055536_1004582 3300003781 Bacteria 7010
55 Ga0055536_1006935 3300003781 Bacteria 5163
56 Ga0055536_1007470 3300003781 Bacteria 4880
57 Ga0055528_1001428 3300003790 Bacteria 14606
58 Ga0055528_1001489 3300003790 Bacteria 14222
59 Ga0055528_1002038 3300003790 Bacteria 11304
60 Ga0055528_1003297 3300003790 Bacteria 8203
61 Ga0055528_1003532 3300003790 Bacteria 7798
62 Ga0055528_1004890 3300003790 Bacteria 6334
63 Ga0055528_1006206 3300003790 Bacteria 5444
64 Ga0055528_1006729 3300003790 Bacteria 5177
65 Ga0055530_10012021 3300003791 Bacteria 3050
66 Ga0055540_1002547 3300003792 Bacteria 9501
67 Ga0055540_1018803 3300003792 Bacteria 1882
68 Ga0055531_10000473 3300003794 Bacteria 37228
69 Ga0055531_10006330 3300003794 Bacteria 6738
70 Ga0055531_10006445 3300003794 Bacteria 6663
71 Ga0055543_1000069 3300004625 Bacteria 94040
72 Ga0055543_1000187 3300004625 Bacteria 50429
73 Ga0055543_1000488 3300004625 Bacteria 22933
74 Ga0065165_1000047 3300005262 Bacteria 197811
75 Ga0065165_1000146 3300005262 Bacteria 122774
76 Ga0065165_1001792 3300005262 Bacteria 21168
77 Ga0065165_1003760 3300005262 Bacteria 10192
78 Ga0070658_10002784 3300005327 Bacteria 14531
79 Ga0070658_10339971 3300005327 Bacteria 1284
80 Ga0070676_10003148 3300005328 Bacteria 8535
81 Ga0070676_10015038 3300005328 Bacteria 4263
82 Ga0070683_100051341 3300005329 Bacteria 3818
83 Ga0070683_100064839 3300005329 Bacteria 3401
84 Ga0070683_100089393 3300005329 Bacteria 2890
85 Ga0070683_100196356 3300005329 Bacteria 1916
86 Ga0070690_100000389 3300005330 Bacteria 22358
87 Ga0070670_100002883 3300005331 Bacteria 14232
88 Ga0070666_10001402 3300005335 Bacteria 14566
89 Ga0070666_10001559 3300005335 Bacteria 13905
90 Ga0070666_10026321 3300005335 Bacteria 3799
91 Ga0070680_100000100 3300005336 Bacteria 49540
92 Ga0070680_100003596 3300005336 Bacteria 11574
93 Ga0070680_100005087 3300005336 Bacteria 9922
94 Ga0070680_100009352 3300005336 Bacteria 7530
95 Ga0070680_100026391 3300005336 Bacteria 4647
96 Ga0070680_100032161 3300005336 Bacteria 4221
97 Ga0070680_100109995 3300005336 Bacteria 2293
98 Ga0070680_100173925 3300005336 Bacteria 1813
99 Ga0070682_100005140 3300005337 Bacteria 7279
100 Ga0070682_100013397 3300005337 Bacteria 4716
101 Ga0068868_100010298 3300005338 Bacteria 6763
102 Ga0068868_100059072 3300005338 Bacteria 3033
103 Ga0068868_100077716 3300005338 Bacteria 2655
104 Ga0068868_100127452 3300005338 Bacteria 2080
105 Ga0070660_100007614 3300005339 Bacteria 7548
106 Ga0070660_100018794 3300005339 Bacteria 5056
107 Ga0070660_100025418 3300005339 Bacteria 4401
108 Ga0070660_100064348 3300005339 Bacteria 2853
109 Ga0070660_100171986 3300005339 Bacteria 1750
110 Ga0070689_100000375 3300005340 Bacteria 26301
111 Ga0070691_10000041 3300005341 Bacteria 37274
112 Ga0070691_10003741 3300005341 Bacteria 6870
113 Ga0070691_10005991 3300005341 Bacteria 5548
114 Ga0070691_10020657 3300005341 Bacteria 3044
115 Ga0070691_10041118 3300005341 Bacteria 2185
116 Ga0070691_10081652 3300005341 Bacteria 1584
117 Ga0070691_10140083 3300005341 Bacteria 1232
118 Ga0070687_100001858 3300005343 Bacteria 7653
119 Ga0070661_100000067 3300005344 Bacteria 84376
120 Ga0070661_100004833 3300005344 Bacteria 9275
121 Ga0070661_100163610 3300005344 Bacteria 1686
122 Ga0070661_100213257 3300005344 Bacteria 1479
123 Ga0070661_100243789 3300005344 Bacteria 1385
124 Ga0070692_10003517 3300005345 Bacteria 6365
125 Ga0070668_100000633 3300005347 Bacteria 23643
126 Ga0070668_100004810 3300005347 Bacteria 10014
127 Ga0070668_100012224 3300005347 Bacteria 6396
128 Ga0070668_100024237 3300005347 Bacteria 4595
129 Ga0070668_100068675 3300005347 Bacteria 2755
130 Ga0070668_100294359 3300005347 Bacteria 1360
131 Ga0070669_100008669 3300005353 Bacteria 7255
132 Ga0070669_100196996 3300005353 Bacteria 1583
133 Ga0070669_100242408 3300005353 Bacteria 1433
134 Ga0070675_100004951 3300005354 Bacteria 10161
135 Ga0070671_100000406 3300005355 Bacteria 29740
136 Ga0070671_100020442 3300005355 Bacteria 5399
137 Ga0070671_100288600 3300005355 Bacteria 1396
138 Ga0070674_100001559 3300005356 Bacteria 12281
139 Ga0070674_100055283 3300005356 Bacteria 2748
140 Ga0070674_100141079 3300005356 Bacteria 1808
141 Ga0070673_100000480 3300005364 Bacteria 21257
142 Ga0070673_100292383 3300005364 Bacteria 1432
143 Ga0070688_100000498 3300005365 Bacteria 19894
144 Ga0070659_100011837 3300005366 Bacteria 6457
145 Ga0070659_100013043 3300005366 Bacteria 6180
146 Ga0070659_100022454 3300005366 Bacteria 4818
147 Ga0070659_100039074 3300005366 Bacteria 3703
148 Ga0070659_100061535 3300005366 Bacteria 2966
149 Ga0070659_100093538 3300005366 Bacteria 2412
150 Ga0070659_100170753 3300005366 Bacteria 1781
151 Ga0070659_100396374 3300005366 Bacteria 1165
152 Ga0070667_100001184 3300005367 Bacteria 23726
153 Ga0070667_100048011 3300005367 Bacteria 3593
154 Ga0070667_100057255 3300005367 Bacteria 3294
155 Ga0070667_100147059 3300005367 Bacteria 2067
156 Ga0070709_10000294 3300005434 Bacteria 31597
157 Ga0070709_10004705 3300005434 Bacteria 7373
158 Ga0070709_10077760 3300005434 Bacteria 2158
159 Ga0070714_100065139 3300005435 Bacteria 3138
160 Ga0070714_100198725 3300005435 Bacteria 1833
161 Ga0070713_100000001 3300005436 Bacteria 257984
162 Ga0070713_100001031 3300005436 Bacteria 17809
163 Ga0070713_100074116 3300005436 Bacteria 2883
164 Ga0070713_100078712 3300005436 Bacteria 2807
165 Ga0070713_100119880 3300005436 Bacteria 2306
166 Ga0070713_100144444 3300005436 Bacteria 2110
167 Ga0070713_100156922 3300005436 Bacteria 2029
168 Ga0070713_100221376 3300005436 Bacteria 1717
169 Ga0070710_10000872 3300005437 Bacteria 14419
170 Ga0070710_10065957 3300005437 Bacteria 2075
171 Ga0070701_10003193 3300005438 Bacteria 6449
172 Ga0070711_100000095 3300005439 Bacteria 47489
173 Ga0070711_100090510 3300005439 Bacteria 2204
174 Ga0070711_100180844 3300005439 Bacteria 1614
175 Ga0070705_100002620 3300005440 Bacteria 9009
176 Ga0070700_100000562 3300005441 Bacteria 18616
177 Ga0070700_100002014 3300005441 Bacteria 10323
178 Ga0070694_100002046 3300005444 Bacteria 11968
179 Ga0070694_100005444 3300005444 Bacteria 7707
180 Ga0070694_100029748 3300005444 Bacteria 3567
181 Ga0070694_100084940 3300005444 Bacteria 2209
182 Ga0070694_100328533 3300005444 Bacteria 1179
183 Ga0070708_100016880 3300005445 Bacteria 6070
184 Ga0070708_100046475 3300005445 Bacteria 3830
185 Ga0070708_100160614 3300005445 Bacteria 2094
186 Ga0070663_100001178 3300005455 Bacteria 14395
187 Ga0070663_100013916 3300005455 Bacteria 5148
188 Ga0070663_100021780 3300005455 Bacteria 4269
189 Ga0070663_100022015 3300005455 Bacteria 4252
190 Ga0070663_100049211 3300005455 Bacteria 2992
191 Ga0070663_100077368 3300005455 Bacteria 2435
192 Ga0070678_100000023 3300005456 Bacteria 49327
193 Ga0070678_100007819 3300005456 Bacteria 6361
194 Ga0070678_100105278 3300005456 Bacteria 2196
195 Ga0070662_100001426 3300005457 Bacteria 14751
196 Ga0070662_100290964 3300005457 Bacteria 1324
197 Ga0070681_10000003 3300005458 Bacteria 252785
198 Ga0070681_10001010 3300005458 Bacteria 23785
199 Ga0070681_10003070 3300005458 Bacteria 15491
200 Ga0070681_10015986 3300005458 Bacteria 7483
201 Ga0070681_10016571 3300005458 Bacteria 7359
202 Ga0070681_10129396 3300005458 Bacteria 2457
203 Ga0070681_10164093 3300005458 Bacteria 2145
204 Ga0070681_10282353 3300005458 Bacteria 1571
205 Ga0070681_10302560 3300005458 Bacteria 1509
206 Ga0070681_10480356 3300005458 Bacteria 1155
207 Ga0068867_100017555 3300005459 Bacteria 5082
208 Ga0068867_100122661 3300005459 Bacteria 2010
209 Ga0068867_100186462 3300005459 Bacteria 1652
210 Ga0070706_100047102 3300005467 Bacteria 3978
211 Ga0070706_100146757 3300005467 Bacteria 2203
212 Ga0070707_100216663 3300005468 Bacteria 1866
213 Ga0070707_100301273 3300005468 Bacteria 1558
214 Ga0070698_100001072 3300005471 Bacteria 30058
215 Ga0070698_100236948 3300005471 Bacteria 1758
216 Ga0070698_100310482 3300005471 Bacteria 1508
217 Ga0070699_100000345 3300005518 Bacteria 44889
218 Ga0070699_100092839 3300005518 Bacteria 2640
219 Ga0070699_100149525 3300005518 Bacteria 2065
220 Ga0070699_100247295 3300005518 Bacteria 1593
221 Ga0070699_100489532 3300005518 Bacteria 1117
222 Ga0070679_100000617 3300005530 Bacteria 30256
223 Ga0070679_100008440 3300005530 Bacteria 9699
224 Ga0070679_100019447 3300005530 Bacteria 6603
225 Ga0070679_100024710 3300005530 Bacteria 5888
226 Ga0070679_100041775 3300005530 Bacteria 4564
227 Ga0070679_100045565 3300005530 Bacteria 4370
228 Ga0070679_100048104 3300005530 Bacteria 4250
229 Ga0070679_100061030 3300005530 Bacteria 3758
230 Ga0070684_100017519 3300005535 Bacteria 5881
231 Ga0070684_100066098 3300005535 Bacteria 3174
232 Ga0070684_100147742 3300005535 Bacteria 2128
233 Ga0070697_100000586 3300005536 Bacteria 27495
234 Ga0070697_100008494 3300005536 Bacteria 8015
235 Ga0068853_100001678 3300005539 Bacteria 16210
236 Ga0068853_100005846 3300005539 Bacteria 9691
237 Ga0068853_100010092 3300005539 Bacteria 7631
238 Ga0068853_100010722 3300005539 Bacteria 7421
239 Ga0068853_100031778 3300005539 Bacteria 4467
240 Ga0068853_100036036 3300005539 Bacteria 4205
241 Ga0068853_100049276 3300005539 Bacteria 3620
242 Ga0068853_100052565 3300005539 Bacteria 3509
243 Ga0068853_100063111 3300005539 Bacteria 3208
244 Ga0068853_100115329 3300005539 Bacteria 2390
245 Ga0068853_100293268 3300005539 Bacteria 1502
246 Ga0070672_100002661 3300005543 Bacteria 11415
247 Ga0070686_100008353 3300005544 Bacteria 5798
248 Ga0070695_100000122 3300005545 Bacteria 34844
249 Ga0070695_100001235 3300005545 Bacteria 14049
250 Ga0070695_100012698 3300005545 Bacteria 5056
251 Ga0070695_100018662 3300005545 Bacteria 4213
252 Ga0070695_100061908 3300005545 Bacteria 2429
253 Ga0070695_100092379 3300005545 Bacteria 2023
254 Ga0070696_100000049 3300005546 Bacteria 55513
255 Ga0070696_100004629 3300005546 Bacteria 9187
256 Ga0070696_100021655 3300005546 Bacteria 4359
257 Ga0070696_100106897 3300005546 Bacteria 2012
258 Ga0070693_100000781 3300005547 Bacteria 14052
259 Ga0070693_100011657 3300005547 Bacteria 4431
260 Ga0070693_100030257 3300005547 Bacteria 2959
261 Ga0070693_100097590 3300005547 Bacteria 1784
262 Ga0070665_100001203 3300005548 Bacteria 31567
263 Ga0070665_100018122 3300005548 Bacteria 7064
264 Ga0070665_100025502 3300005548 Bacteria 5955
265 Ga0070665_100046204 3300005548 Bacteria 4374
266 Ga0070665_100110634 3300005548 Bacteria 2750
267 Ga0070665_100117714 3300005548 Bacteria 2660
268 Ga0070665_100133875 3300005548 Bacteria 2480
269 Ga0070665_100284113 3300005548 Bacteria 1657
270 Ga0070704_100000417 3300005549 Bacteria 19773
271 Ga0070704_100000535 3300005549 Bacteria 18135
272 Ga0070704_100001522 3300005549 Bacteria 12496
273 Ga0068855_100000374 3300005563 Bacteria 55329
274 Ga0068855_100001459 3300005563 Bacteria 29520
275 Ga0068855_100003400 3300005563 Bacteria 19482
276 Ga0068855_100018777 3300005563 Bacteria 8312
277 Ga0068855_100034337 3300005563 Bacteria 6050
278 Ga0068855_100037580 3300005563 Bacteria 5757
279 Ga0068855_100048648 3300005563 Bacteria 5004
280 Ga0068855_100130111 3300005563 Bacteria 2875
281 Ga0068855_100161531 3300005563 Bacteria 2542
282 Ga0068855_100281023 3300005563 Bacteria 1848
283 Ga0068855_100544684 3300005563 Bacteria 1257
284 Ga0070664_100002837 3300005564 Bacteria 14017
285 Ga0070664_100015702 3300005564 Bacteria 6198
286 Ga0070664_100103905 3300005564 Bacteria 2474
287 Ga0068857_100001101 3300005577 Bacteria 20972
288 Ga0068857_100002988 3300005577 Bacteria 13941
289 Ga0068857_100003027 3300005577 Bacteria 13894
290 Ga0068857_100003727 3300005577 Bacteria 12794
291 Ga0068857_100008016 3300005577 Bacteria 9109
292 Ga0068857_100015801 3300005577 Bacteria 6606
293 Ga0068857_100020464 3300005577 Bacteria 5820
294 Ga0068857_100118656 3300005577 Bacteria 2381
295 Ga0068857_100146391 3300005577 Bacteria 2137
296 Ga0068854_100000689 3300005578 Bacteria 20158
297 Ga0068854_100003176 3300005578 Bacteria 10252
298 Ga0068854_100053164 3300005578 Bacteria 2907
299 Ga0068854_100148740 3300005578 Bacteria 1804
300 Ga0068854_100172802 3300005578 Bacteria 1682
301 Ga0068854_100387805 3300005578 Bacteria 1153
302 Ga0068856_100000170 3300005614 Bacteria 67625
303 Ga0068856_100000761 3300005614 Bacteria 34979
304 Ga0068856_100001226 3300005614 Bacteria 26883
305 Ga0068856_100004965 3300005614 Bacteria 13168
306 Ga0068856_100041193 3300005614 Bacteria 4537
307 Ga0068856_100091417 3300005614 Bacteria 3028
308 Ga0068856_100091492 3300005614 Bacteria 3026
309 Ga0068856_100384554 3300005614 Bacteria 1423
310 Ga0068856_100441769 3300005614 Bacteria 1321
311 Ga0070702_100000010 3300005615 Bacteria 60028
312 Ga0070702_100141591 3300005615 Bacteria 1532
313 Ga0068852_100006707 3300005616 Bacteria 8350
314 Ga0068852_100041580 3300005616 Bacteria 3886
315 Ga0068852_100060110 3300005616 Bacteria 3298
316 Ga0068852_100091596 3300005616 Bacteria 2721
317 Ga0068852_100140371 3300005616 Bacteria 2235
318 Ga0068852_100159079 3300005616 Bacteria 2107
319 Ga0068852_100275390 3300005616 Bacteria 1621
320 Ga0068852_100314820 3300005616 Bacteria 1518
321 Ga0068859_100031468 3300005617 Bacteria 5329
322 Ga0068859_100109037 3300005617 Bacteria 2830
323 Ga0068859_100113481 3300005617 Bacteria 2773
324 Ga0068859_100347583 3300005617 Bacteria 1578
325 Ga0068859_100462183 3300005617 Bacteria 1365
326 Ga0068864_100007442 3300005618 Bacteria 9016
327 Ga0068864_100010685 3300005618 Bacteria 7587
328 Ga0068861_100002394 3300005719 Bacteria 12222
329 Ga0068861_100008440 3300005719 Bacteria 7093
330 Ga0068861_100074139 3300005719 Bacteria 2646
331 Ga0068861_100418304 3300005719 Bacteria 1194
332 Ga0068851_10033878 3300005834 Bacteria 2547
333 Ga0068851_10168022 3300005834 Bacteria 1209
334 Ga0068863_100009117 3300005841 Bacteria 9690
335 Ga0068858_100012529 3300005842 Bacteria 7998
336 Ga0068858_100019227 3300005842 Bacteria 6387
337 Ga0068858_100024626 3300005842 Bacteria 5607
338 Ga0068858_100025596 3300005842 Bacteria 5490
339 Ga0068858_100041806 3300005842 Bacteria 4249
340 Ga0068858_100081391 3300005842 Bacteria 3010
341 Ga0068858_100553265 3300005842 Bacteria 1114
342 Ga0068860_100000066 3300005843 Bacteria 182836
343 Ga0068860_100007555 3300005843 Bacteria 10875
344 Ga0068860_100008983 3300005843 Bacteria 9955
345 Ga0068862_100030026 3300005844 Bacteria 4580
346 Ga0068862_100042147 3300005844 Bacteria 3887
347 Ga0068862_100051026 3300005844 Bacteria 3537
348 Ga0068862_100216270 3300005844 Bacteria 1733
349 Ga0068862_100411551 3300005844 Bacteria 1267
350 Ga0081455_10000041 3300005937 Bacteria 134032
351 Ga0081455_10002724 3300005937 Bacteria 20860
352 Ga0081455_10003058 3300005937 Bacteria 19485
353 Ga0081455_10004726 3300005937 Bacteria 15138
354 Ga0081455_10005493 3300005937 Bacteria 13894
355 Ga0081455_10014056 3300005937 Bacteria 7868
356 Ga0081455_10045494 3300005937 Bacteria 3818
357 Ga0081455_10051679 3300005937 Bacteria 3524
358 Ga0081455_10079004 3300005937 Bacteria 2703
359 Ga0081538_10001948 3300005981 Bacteria 20673
360 Ga0081538_10008257 3300005981 Bacteria 8869
361 Ga0081538_10008912 3300005981 Bacteria 8433
362 Ga0081540_1000091 3300005983 Bacteria 94664
363 Ga0081540_1002768 3300005983 Bacteria 14227
364 Ga0081540_1039990 3300005983 Bacteria 2450
365 Ga0081540_1048814 3300005983 Bacteria 2117
366 Ga0081540_1060822 3300005983 Bacteria 1804
367 Ga0081539_10001293 3300005985 Bacteria 43956
368 Ga0081539_10012018 3300005985 Bacteria 6740
369 Ga0081539_10071497 3300005985 Bacteria 1858
370 Ga0081539_10081675 3300005985 Bacteria 1696
371 Ga0070717_10003745 3300006028 Bacteria 10920
372 Ga0070717_10051071 3300006028 Bacteria 3401
373 Ga0070717_10129791 3300006028 Bacteria 2166
374 Ga0070717_10163410 3300006028 Bacteria 1933
375 Ga0070717_10181087 3300006028 Bacteria 1837
376 Ga0070717_10273340 3300006028 Bacteria 1497
377 Ga0070717_10334769 3300006028 Bacteria 1351
378 Ga0075365_10003247 3300006038 Bacteria 8332
379 Ga0075365_10003259 3300006038 Bacteria 8316
380 Ga0075365_10009883 3300006038 Bacteria 5522
381 Ga0075365_10026369 3300006038 Bacteria 3689
382 Ga0075365_10032735 3300006038 Bacteria 3345
383 Ga0075365_10045568 3300006038 Bacteria 2877
384 Ga0075365_10053769 3300006038 Bacteria 2668
385 Ga0075365_10054088 3300006038 Bacteria 2661
386 Ga0075365_10203341 3300006038 Bacteria 1388
387 Ga0075368_10000481 3300006042 Bacteria 11795
388 Ga0075368_10010391 3300006042 Bacteria 3364
389 Ga0075368_10013479 3300006042 Bacteria 3003
390 Ga0075368_10016233 3300006042 Bacteria 2775
391 Ga0075368_10060715 3300006042 Bacteria 1513
392 Ga0075368_10076908 3300006042 Bacteria 1354
393 Ga0075363_100003259 3300006048 Bacteria 6869
394 Ga0075363_100126640 3300006048 Bacteria 1430
395 Ga0075364_10012655 3300006051 Bacteria 5168
396 Ga0075364_10058333 3300006051 Bacteria 2530
397 Ga0070715_10000073 3300006163 Bacteria 30256
398 Ga0070715_10001222 3300006163 Bacteria 7384
399 Ga0070716_100001707 3300006173 Bacteria 9900
400 Ga0070712_100000305 3300006175 Bacteria 27733
401 Ga0070712_100000898 3300006175 Bacteria 17819
402 Ga0070712_100004558 3300006175 Bacteria 8556
403 Ga0070712_100009491 3300006175 Bacteria 6134
404 Ga0070712_100053201 3300006175 Bacteria 2826
405 Ga0070712_100079979 3300006175 Bacteria 2364
406 Ga0070712_100302589 3300006175 Bacteria 1295
407 Ga0075362_10001918 3300006177 Bacteria 6834
408 Ga0075362_10004991 3300006177 Bacteria 4813
409 Ga0075362_10041504 3300006177 Bacteria 2030
410 Ga0075362_10068988 3300006177 Bacteria 1611
411 Ga0075367_10001874 3300006178 Bacteria 9304
412 Ga0075367_10002704 3300006178 Bacteria 8180
413 Ga0075367_10016557 3300006178 Bacteria 4026
414 Ga0075367_10033480 3300006178 Bacteria 2962
415 Ga0075367_10040566 3300006178 Bacteria 2718
416 Ga0075367_10075222 3300006178 Bacteria 2037
417 Ga0075367_10173441 3300006178 Bacteria 1344
418 Ga0075369_10000126 3300006186 Bacteria 21261
419 Ga0075369_10002052 3300006186 Bacteria 7100
420 Ga0075369_10022742 3300006186 Bacteria 2588
421 Ga0075369_10030464 3300006186 Bacteria 2272
422 Ga0075369_10039640 3300006186 Bacteria 2012
423 Ga0075366_10004158 3300006195 Bacteria 7752
424 Ga0075366_10005341 3300006195 Bacteria 6963
425 Ga0075366_10006147 3300006195 Bacteria 6550
426 Ga0075366_10037847 3300006195 Bacteria 2849
427 Ga0097621_100000226 3300006237 Bacteria 37795
428 Ga0097621_100005281 3300006237 Bacteria 9095
429 Ga0097621_100027543 3300006237 Bacteria 4470
430 Ga0097621_100083502 3300006237 Bacteria 2662
431 Ga0097621_100202064 3300006237 Bacteria 1726
432 Ga0097621_100217082 3300006237 Bacteria 1665
433 Ga0075370_10004618 3300006353 Bacteria 6719
434 Ga0075370_10043910 3300006353 Bacteria 2526
435 Ga0068871_100000241 3300006358 Bacteria 38434
436 Ga0068871_100019265 3300006358 Bacteria 5208
437 Ga0068871_100094818 3300006358 Bacteria 2491
438 Ga0068871_100391802 3300006358 Bacteria 1236
439 Ga0075428_100019804 3300006844 Bacteria 7447
440 Ga0075428_100025849 3300006844 Bacteria 6501
441 Ga0075428_100106760 3300006844 Bacteria 3052
442 Ga0075428_100124438 3300006844 Bacteria 2806
443 Ga0075428_100131669 3300006844 Bacteria 2720
444 Ga0075430_100010468 3300006846 Bacteria 7853
445 Ga0075430_100016774 3300006846 Bacteria 6238
446 Ga0075430_100053264 3300006846 Bacteria 3407
447 Ga0075430_100078360 3300006846 Bacteria 2770
448 Ga0075431_100000560 3300006847 Bacteria 31320
449 Ga0075431_100000703 3300006847 Bacteria 28837
450 Ga0075431_100000737 3300006847 Bacteria 28232
451 Ga0075431_100001272 3300006847 Bacteria 22977
452 Ga0075431_100065979 3300006847 Bacteria 3737
453 Ga0075433_10140404 3300006852 Bacteria 2147
454 Ga0075433_10396964 3300006852 Bacteria 1217
455 Ga0075433_10464244 3300006852 Bacteria 1116
456 Ga0075434_100093977 3300006871 Bacteria 3003
457 Ga0075434_100356993 3300006871 Bacteria 1483
458 Ga0075434_100456079 3300006871 Bacteria 1299
459 Ga0075429_100017850 3300006880 Bacteria 6136
460 Ga0075429_100036430 3300006880 Bacteria 4279
461 Ga0068865_100036018 3300006881 Bacteria 3333
462 Ga0068865_100039847 3300006881 Bacteria 3189
463 Ga0075436_100001205 3300006914 Bacteria 17600
464 Ga0075436_100006299 3300006914 Bacteria 8129
465 Ga0097620_100031471 3300006931 Bacteria 5329
466 Ga0097620_100109032 3300006931 Bacteria 2830
467 Ga0097620_100113485 3300006931 Bacteria 2773
468 Ga0097620_100347603 3300006931 Bacteria 1578
469 Ga0097620_100462170 3300006931 Bacteria 1365
470 Ga0099824_1004995 3300006942 Bacteria 18868
471 Ga0099822_1001207 3300006943 Bacteria 29221
472 Ga0099826_10000728 3300006948 Bacteria 17292
473 Ga0099826_10011894 3300006948 Bacteria 6555
474 Ga0075435_100024962 3300007076 Bacteria 4647
475 Ga0075435_100025834 3300007076 Bacteria 4576
476 Ga0075435_100043489 3300007076 Bacteria 3595
477 Ga0075435_100049600 3300007076 Bacteria 3376
478 Ga0099794_10122469 3300007265 Bacteria 1309
479 Ga0099795_10017573 3300007788 Bacteria 2283
480 Ga0105251_10016015 3300009011 Bacteria 4070
481 Ga0105251_10059285 3300009011 Bacteria 1805
482 Ga0105240_10002036 3300009093 Bacteria 33289
483 Ga0105240_10007524 3300009093 Bacteria 15801
484 Ga0105240_10007562 3300009093 Bacteria 15748
485 Ga0105240_10032680 3300009093 Bacteria 6734
486 Ga0105240_10096941 3300009093 Bacteria 3593
487 Ga0105240_10135081 3300009093 Bacteria 2954
488 Ga0105240_10173981 3300009093 Bacteria 2547
489 Ga0105240_10391244 3300009093 Bacteria 1568
490 Ga0111539_10000041 3300009094 Bacteria 131679
491 Ga0111539_10000064 3300009094 Bacteria 106969
492 Ga0111539_10008743 3300009094 Bacteria 12846
493 Ga0111539_10010412 3300009094 Bacteria 11707
494 Ga0111539_10108243 3300009094 Bacteria 3261
495 Ga0111539_10189306 3300009094 Bacteria 2401
496 Ga0105245_10021328 3300009098 Bacteria 5681
497 Ga0105245_10030652 3300009098 Bacteria 4757
498 Ga0105247_10001227 3300009101 Bacteria 19035
499 Ga0105247_10005586 3300009101 Bacteria 7896
500 Ga0105247_10006342 3300009101 Bacteria 7327
501 Ga0105247_10029065 3300009101 Bacteria 3348
502 Ga0114129_10007502 3300009147 Bacteria 15534
503 Ga0114129_10010008 3300009147 Bacteria 13516
504 Ga0114129_10015291 3300009147 Bacteria 10920
505 Ga0114129_10041796 3300009147 Bacteria 6456
506 Ga0114129_10169853 3300009147 Bacteria 2974
507 Ga0114129_10545783 3300009147 Bacteria 1508
508 Ga0114129_10563878 3300009147 Bacteria 1479
509 Ga0114129_10666771 3300009147 Bacteria 1341
510 Ga0105243_10000233 3300009148 Bacteria 64046
511 Ga0105243_10007941 3300009148 Bacteria 8149
512 Ga0105243_10033784 3300009148 Bacteria 3956
513 Ga0105243_10045498 3300009148 Bacteria 3449
514 Ga0105243_10203667 3300009148 Bacteria 1737
515 Ga0105241_10002823 3300009174 Bacteria 12985
516 Ga0105241_10004949 3300009174 Bacteria 9827
517 Ga0105241_10008983 3300009174 Bacteria 7349
518 Ga0105241_10023338 3300009174 Bacteria 4587
519 Ga0105241_10031094 3300009174 Bacteria 3995
520 Ga0105241_10033652 3300009174 Bacteria 3848
521 Ga0105241_10037835 3300009174 Bacteria 3636
522 Ga0105241_10091921 3300009174 Bacteria 2395
523 Ga0105242_10010792 3300009176 Bacteria 7014
524 Ga0105242_10016623 3300009176 Bacteria 5722
525 Ga0105242_10390764 3300009176 Bacteria 1295
526 Ga0105248_10000001 3300009177 Bacteria 1881304
527 Ga0105248_10002936 3300009177 Bacteria 18922
528 Ga0105248_10005964 3300009177 Bacteria 13384
529 Ga0105248_10006268 3300009177 Bacteria 13043
530 Ga0105248_10092104 3300009177 Bacteria 3413
531 Ga0105248_10104881 3300009177 Bacteria 3187
532 Ga0105248_10675922 3300009177 Bacteria 1165
533 Ga0105237_10000727 3300009545 Bacteria 45465
534 Ga0105237_10031092 3300009545 Bacteria 5415
535 Ga0105237_10062665 3300009545 Bacteria 3718
536 Ga0105237_10083687 3300009545 Bacteria 3181
537 Ga0105237_10083697 3300009545 Bacteria 3181
538 Ga0105237_10087993 3300009545 Bacteria 3095
539 Ga0105237_10131085 3300009545 Bacteria 2501
540 Ga0105237_10400753 3300009545 Bacteria 1377
541 Ga0105238_10003292 3300009551 Bacteria 16138
542 Ga0105238_10016590 3300009551 Bacteria 7457
543 Ga0105238_10018935 3300009551 Bacteria 7010
544 Ga0105238_10023997 3300009551 Bacteria 6219
545 Ga0105238_10028229 3300009551 Bacteria 5717
546 Ga0105238_10037968 3300009551 Bacteria 4894
547 Ga0105238_10068965 3300009551 Bacteria 3537
548 Ga0105238_10094450 3300009551 Bacteria 2978
549 Ga0105238_10312831 3300009551 Bacteria 1556
550 Ga0105249_10000366 3300009553 Bacteria 44857
551 Ga0105249_10002823 3300009553 Bacteria 14985
552 Ga0105249_10004035 3300009553 Bacteria 12667
553 Ga0105249_10043286 3300009553 Bacteria 4095
554 Ga0105249_10116839 3300009553 Bacteria 2529
555 Ga0105249_10489235 3300009553 Bacteria 1274
556 Ga0123341_1000017 3300009765 Bacteria 82963
557 Ga0123342_1019278 3300009766 Bacteria 5246
558 Ga0105028_101403 3300009993 Bacteria 2548
559 Ga0099796_10001437 3300010159 Bacteria 4794
560 Ga0105239_10005956 3300010375 Bacteria 14187
561 Ga0105239_10006483 3300010375 Bacteria 13572
562 Ga0105239_10011356 3300010375 Bacteria 9936
563 Ga0105239_10016604 3300010375 Bacteria 8138
564 Ga0105239_10058682 3300010375 Bacteria 4223
565 Ga0105239_10072516 3300010375 Bacteria 3786
566 Ga0105239_10089625 3300010375 Bacteria 3392
567 Ga0105239_10099189 3300010375 Bacteria 3220
568 Ga0105239_10110775 3300010375 Bacteria 3043
569 Ga0105239_10127937 3300010375 Bacteria 2824
570 Ga0105239_10140208 3300010375 Bacteria 2694
571 Ga0105239_10165635 3300010375 Bacteria 2471
572 Ga0105239_10410635 3300010375 Bacteria 1533
573 Ga0105246_10000058 3300011119 Bacteria 44703
574 Ga0105246_10015807 3300011119 Bacteria 4771
575 Ga0105246_10058031 3300011119 Bacteria 2681
576 Ga0105246_10112681 3300011119 Bacteria 2001
577 Ga0157373_10003148 3300013100 Bacteria 12468
578 Ga0157373_10004620 3300013100 Bacteria 10359
579 Ga0157373_10039283 3300013100 Bacteria 3389
580 Ga0157371_10000004 3300013102 Bacteria 512593
581 Ga0157371_10012011 3300013102 Bacteria 6639
582 Ga0157370_10001986 3300013104 Bacteria 25145
583 Ga0157370_10008939 3300013104 Bacteria 10762
584 Ga0157370_10021189 3300013104 Bacteria 6480
585 Ga0157370_10044307 3300013104 Bacteria 4277
586 Ga0157370_10045169 3300013104 Bacteria 4228
587 Ga0157370_10067410 3300013104 Bacteria 3383
588 Ga0157370_10088427 3300013104 Bacteria 2909
589 Ga0157370_10231509 3300013104 Bacteria 1710
590 Ga0157370_10261644 3300013104 Bacteria 1599
591 Ga0157370_10490894 3300013104 Bacteria 1128
592 Ga0157369_10007040 3300013105 Bacteria 12967
593 Ga0157369_10014541 3300013105 Bacteria 8880
594 Ga0157369_10045513 3300013105 Bacteria 4772
595 Ga0157369_10122600 3300013105 Bacteria 2757
596 Ga0157369_10347052 3300013105 Bacteria 1542
597 Ga0157369_10636720 3300013105 Bacteria 1100
598 Ga0171463_1001 3300013249 Bacteria 1406070
599 Ga0171462_1015 3300013250 Bacteria 169578
600 Ga0157374_10003265 3300013296 Bacteria 13623
601 Ga0157374_10015702 3300013296 Bacteria 6648
602 Ga0157378_10004249 3300013297 Bacteria 12632
603 Ga0157378_10007733 3300013297 Bacteria 9381
604 Ga0157378_10447073 3300013297 Bacteria 1282
605 Ga0163162_10008325 3300013306 Bacteria 10114
606 Ga0163162_10021719 3300013306 Bacteria 6322
607 Ga0163162_10087159 3300013306 Bacteria 3200
608 Ga0163162_10093349 3300013306 Bacteria 3094
609 Ga0163162_10094809 3300013306 Bacteria 3071
610 Ga0157372_10001212 3300013307 Bacteria 27905
611 Ga0157372_10002186 3300013307 Bacteria 21283
612 Ga0157372_10002471 3300013307 Bacteria 20046
613 Ga0157372_10007637 3300013307 Bacteria 11499
614 Ga0157372_10039385 3300013307 Bacteria 5216
615 Ga0157372_10067946 3300013307 Bacteria 4007
616 Ga0157372_10079051 3300013307 Bacteria 3718
617 Ga0157372_10533403 3300013307 Bacteria 1368
618 Ga0157375_10000904 3300013308 Bacteria 25826
619 Ga0157375_10002641 3300013308 Bacteria 15519
620 Ga0157375_10026900 3300013308 Bacteria 5369
621 Ga0157375_10124804 3300013308 Bacteria 2688
622 Ga0163163_10000113 3300014325 Bacteria 86256
623 Ga0163163_10005141 3300014325 Bacteria 11278
624 Ga0163163_10052491 3300014325 Bacteria 4022
625 Ga0163163_10094400 3300014325 Bacteria 3009
626 Ga0163163_10148933 3300014325 Bacteria 2385
627 Ga0163163_10226316 3300014325 Bacteria 1919
628 Ga0157380_10014539 3300014326 Bacteria 5760
629 Ga0157380_10182166 3300014326 Bacteria 1846
630 Ga0157380_10444161 3300014326 Bacteria 1244
631 Ga0182008_10011324 3300014497 Bacteria 4749
632 Ga0182008_10035900 3300014497 Bacteria 2481
633 Ga0157377_10035649 3300014745 Bacteria 2730
634 Ga0157377_10123658 3300014745 Bacteria 1571
635 Ga0157379_10001157 3300014968 Bacteria 21520
636 Ga0157379_10001421 3300014968 Bacteria 19658
637 Ga0157379_10008980 3300014968 Bacteria 8713
638 Ga0157379_10009555 3300014968 Bacteria 8445
639 Ga0157379_10065259 3300014968 Bacteria 3254
640 Ga0157379_10071700 3300014968 Bacteria 3099
641 Ga0157379_10081188 3300014968 Bacteria 2904
642 Ga0157379_10116000 3300014968 Bacteria 2408
643 Ga0157379_10178548 3300014968 Bacteria 1918
644 Ga0157379_10313048 3300014968 Bacteria 1432
645 Ga0157376_10000941 3300014969 Bacteria 18932
646 Ga0157376_10049317 3300014969 Bacteria 3486
647 Ga0157376_10361908 3300014969 Bacteria 1391
648 Ga0183363_1300 3300015690 Bacteria 6977
649 Ga0163161_10004854 3300017792 Bacteria 9361
650 Ga0163161_10017729 3300017792 Bacteria 4989
651 Ga0163161_10074115 3300017792 Bacteria 2496
652 Ga0213873_10007116 3300021358 Bacteria 2229
653 Ga0213873_10010251 3300021358 Bacteria 1972
654 Ga0213872_10019300 3300021361 Bacteria 3141
655 Ga0213874_10004623 3300021377 Bacteria 3161
656 Ga0213874_10013371 3300021377 Bacteria 2125
657 Ga0213874_10015488 3300021377 Bacteria 2012
658 Ga0213876_10000498 3300021384 Bacteria 30587
659 Ga0213876_10000743 3300021384 Bacteria 22586
660 Ga0213876_10005774 3300021384 Bacteria 6777
661 Ga0213876_10007143 3300021384 Bacteria 6086
662 Ga0213876_10009091 3300021384 Bacteria 5349
663 Ga0213876_10028455 3300021384 Bacteria 2947
664 Ga0213876_10111848 3300021384 Bacteria 1449
665 Ga0213875_10002092 3300021388 Bacteria 12237
666 Ga0213871_10000661 3300021441 Bacteria 4958
667 Ga0213871_10005961 3300021441 Bacteria 2550
668 Ga0228711_1000006 3300022739 Bacteria 202437
669 Ga0228710_1000004 3300022740 Bacteria 250560
670 Ga0224572_1012588 3300024225 Bacteria 1610
671 Ga0228598_1015034 3300024227 Bacteria 1529
672 Ga0209436_100222 3300025208 Bacteria 26108
673 Ga0209436_100520 3300025208 Bacteria 16779
674 Ga0207425_1000052 3300025245 Bacteria 162123
675 Ga0207425_1004846 3300025245 Bacteria 3948
676 Ga0207425_1008423 3300025245 Bacteria 2640
677 Ga0209677_100313 3300025253 Bacteria 31691
678 Ga0209148_1000582 3300025254 Bacteria 33646
679 Ga0209129_1000446 3300025258 Bacteria 30875
680 Ga0209129_1000512 3300025258 Bacteria 27712
681 Ga0209129_1000941 3300025258 Bacteria 17565
682 Ga0209129_1001773 3300025258 Bacteria 11510
683 Ga0209233_1000045 3300025261 Bacteria 473379
684 Ga0209233_1002747 3300025261 Bacteria 6335
685 Ga0209233_1004470 3300025261 Bacteria 4748
686 Ga0209565_1000172 3300025263 Bacteria 84264
687 Ga0209455_1002476 3300025272 Bacteria 7100
688 Ga0209455_1012590 3300025272 Bacteria 2014
689 Ga0209673_1000024 3300025273 Bacteria 409632
690 Ga0209673_1000358 3300025273 Bacteria 82232
691 Ga0209673_1000451 3300025273 Bacteria 69853
692 Ga0209673_1000526 3300025273 Bacteria 62641
693 Ga0209673_1007086 3300025273 Bacteria 5252
694 Ga0209673_1011414 3300025273 Bacteria 3665
695 Ga0209130_1000002 3300025284 Bacteria 722648
696 Ga0209130_1000005 3300025284 Bacteria 599620
697 Ga0209130_1000555 3300025284 Bacteria 37191
698 Ga0209675_1000438 3300025291 Bacteria 32911
699 Ga0209675_1000594 3300025291 Bacteria 25933
700 Ga0209675_1007854 3300025291 Bacteria 4011
701 Ga0209676_1000257 3300025292 Bacteria 112662
702 Ga0209676_1000316 3300025292 Bacteria 94380
703 Ga0209676_1005091 3300025292 Bacteria 7017
704 Ga0209025_1000010 3300025294 Bacteria 986612
705 Ga0209025_1000144 3300025294 Bacteria 181446
706 Ga0209025_1000274 3300025294 Bacteria 119322
707 Ga0209025_1000777 3300025294 Bacteria 52804
708 Ga0209025_1002335 3300025294 Bacteria 20489
709 Ga0209025_1004395 3300025294 Bacteria 12270
710 Ga0209025_1013602 3300025294 Bacteria 5095
711 Ga0209025_1013636 3300025294 Bacteria 5085
712 Ga0209025_1018691 3300025294 Bacteria 3906
713 Ga0209025_1032964 3300025294 Bacteria 2408
714 Ga0209564_1000019 3300025295 Bacteria 573686
715 Ga0209564_1000143 3300025295 Bacteria 177136
716 Ga0209564_1000590 3300025295 Bacteria 57280
717 Ga0209564_1000747 3300025295 Bacteria 46025
718 Ga0209564_1001082 3300025295 Bacteria 32571
719 Ga0209564_1002120 3300025295 Bacteria 16833
720 Ga0209564_1002146 3300025295 Bacteria 16663
721 Ga0209564_1002755 3300025295 Bacteria 13209
722 Ga0209564_1003448 3300025295 Bacteria 10811
723 Ga0209564_1008220 3300025295 Bacteria 5202
724 Ga0209564_1008892 3300025295 Bacteria 4877
725 Ga0209564_1010734 3300025295 Bacteria 4180
726 Ga0209564_1023896 3300025295 Bacteria 2105
727 Ga0209564_1032977 3300025295 Bacteria 1548
728 Ga0209758_1000008 3300025297 Bacteria 1215263
729 Ga0209758_1000029 3300025297 Bacteria 520787
730 Ga0209758_1000519 3300025297 Bacteria 61859
731 Ga0209758_1000753 3300025297 Bacteria 46946
732 Ga0209758_1002068 3300025297 Bacteria 21433
733 Ga0209758_1002473 3300025297 Bacteria 18796
734 Ga0209758_1003885 3300025297 Bacteria 13076
735 Ga0209758_1006062 3300025297 Bacteria 8909
736 Ga0209758_1006314 3300025297 Bacteria 8605
737 Ga0209758_1059118 3300025297 Bacteria 1277
738 Ga0209050_1000604 3300025298 Bacteria 57101
739 Ga0209050_1001742 3300025298 Bacteria 21662
740 Ga0209050_1002258 3300025298 Bacteria 17118
741 Ga0209050_1002878 3300025298 Bacteria 13603
742 Ga0209050_1006384 3300025298 Bacteria 6995
743 Ga0209050_1009991 3300025298 Bacteria 4748
744 Ga0209256_1000111 3300025299 Bacteria 178442
745 Ga0209256_1000989 3300025299 Bacteria 34009
746 Ga0209256_1003426 3300025299 Bacteria 11139
747 Ga0209256_1003678 3300025299 Bacteria 10443
748 Ga0209256_1003995 3300025299 Bacteria 9667
749 Ga0209256_1006241 3300025299 Bacteria 6414
750 Ga0209256_1006497 3300025299 Bacteria 6153
751 Ga0209256_1007818 3300025299 Bacteria 5145
752 Ga0209256_1008478 3300025299 Bacteria 4757
753 Ga0209256_1010638 3300025299 Bacteria 3820
754 Ga0207426_1000013 3300025302 Bacteria 721897
755 Ga0207426_1000015 3300025302 Bacteria 599316
756 Ga0207426_1000142 3300025302 Bacteria 194023
757 Ga0207426_1000608 3300025302 Bacteria 46209
758 Ga0209051_1000170 3300025303 Bacteria 119026
759 Ga0209051_1003216 3300025303 Bacteria 10907
760 Ga0209051_1004235 3300025303 Bacteria 8944
761 Ga0209051_1007592 3300025303 Bacteria 5905
762 Ga0209051_1009521 3300025303 Bacteria 4998
763 Ga0209051_1023061 3300025303 Bacteria 2600
764 Ga0209257_1000192 3300025304 Bacteria 151851
765 Ga0209257_1000541 3300025304 Bacteria 64943
766 Ga0209257_1000549 3300025304 Bacteria 64410
767 Ga0209257_1002111 3300025304 Bacteria 20790
768 Ga0209257_1005285 3300025304 Bacteria 9197
769 Ga0209257_1020537 3300025304 Bacteria 2437
770 Ga0209257_1053623 3300025304 Bacteria 1127
771 Ga0207656_10167164 3300025321 Bacteria 1050
772 Ga0207653_10001781 3300025885 Bacteria 6886
773 Ga0207692_10010103 3300025898 Bacteria 3965
774 Ga0207642_10001307 3300025899 Bacteria 7701
775 Ga0207710_10013005 3300025900 Bacteria 3506
776 Ga0207710_10019359 3300025900 Bacteria 2904
777 Ga0207710_10026191 3300025900 Bacteria 2519
778 Ga0207688_10000068 3300025901 Bacteria 38177
779 Ga0207688_10048311 3300025901 Bacteria 2378
780 Ga0207680_10000525 3300025903 Bacteria 18250
781 Ga0207680_10025710 3300025903 Bacteria 3251
782 Ga0207680_10034614 3300025903 Bacteria 2892
783 Ga0207680_10071001 3300025903 Bacteria 2157
784 Ga0207647_10001441 3300025904 Bacteria 18249
785 Ga0207647_10048726 3300025904 Bacteria 2631
786 Ga0207685_10008201 3300025905 Bacteria 2960
787 Ga0207685_10026807 3300025905 Bacteria 2009
788 Ga0207699_10000432 3300025906 Bacteria 21399
789 Ga0207699_10002859 3300025906 Bacteria 8174
790 Ga0207699_10017718 3300025906 Bacteria 3758
791 Ga0207699_10045628 3300025906 Bacteria 2559
792 Ga0207699_10092336 3300025906 Bacteria 1903
793 Ga0207699_10145086 3300025906 Bacteria 1564
794 Ga0207699_10183040 3300025906 Bacteria 1409
795 Ga0207699_10231964 3300025906 Bacteria 1264
796 Ga0207705_10007266 3300025909 Bacteria 8149
797 Ga0207705_10032731 3300025909 Bacteria 3715
798 Ga0207705_10111901 3300025909 Bacteria 2018
799 Ga0207684_10091643 3300025910 Bacteria 2591
800 Ga0207654_10000250 3300025911 Bacteria 32514
801 Ga0207654_10002071 3300025911 Bacteria 10281
802 Ga0207654_10012451 3300025911 Bacteria 4358
803 Ga0207654_10021937 3300025911 Bacteria 3401
804 Ga0207654_10024384 3300025911 Bacteria 3251
805 Ga0207654_10127802 3300025911 Bacteria 1605
806 Ga0207654_10135114 3300025911 Bacteria 1566
807 Ga0207707_10000001 3300025912 Bacteria 1212482
808 Ga0207707_10000526 3300025912 Bacteria 39289
809 Ga0207707_10001497 3300025912 Bacteria 21565
810 Ga0207707_10005935 3300025912 Bacteria 10688
811 Ga0207707_10010978 3300025912 Bacteria 7880
812 Ga0207707_10046150 3300025912 Bacteria 3794
813 Ga0207707_10125242 3300025912 Bacteria 2247
814 Ga0207707_10163375 3300025912 Bacteria 1946
815 Ga0207707_10191269 3300025912 Bacteria 1785
816 Ga0207707_10267944 3300025912 Bacteria 1481
817 Ga0207695_10000004 3300025913 Bacteria 1288665
818 Ga0207695_10000479 3300025913 Bacteria 85874
819 Ga0207695_10001357 3300025913 Bacteria 41521
820 Ga0207695_10005090 3300025913 Bacteria 17617
821 Ga0207695_10077640 3300025913 Bacteria 3372
822 Ga0207695_10081108 3300025913 Bacteria 3284
823 Ga0207695_10089217 3300025913 Bacteria 3101
824 Ga0207695_10144265 3300025913 Bacteria 2327
825 Ga0207695_10154981 3300025913 Bacteria 2226
826 Ga0207695_10276968 3300025913 Bacteria 1572
827 Ga0207695_10384585 3300025913 Bacteria 1289
828 Ga0207695_10459809 3300025913 Bacteria 1156
829 Ga0207671_10063857 3300025914 Bacteria 2737
830 Ga0207671_10094823 3300025914 Bacteria 2252
831 Ga0207671_10133388 3300025914 Bacteria 1908
832 Ga0207671_10139264 3300025914 Bacteria 1868
833 Ga0207671_10206860 3300025914 Bacteria 1534
834 Ga0207671_10211675 3300025914 Bacteria 1517
835 Ga0207671_10227669 3300025914 Bacteria 1462
836 Ga0207693_10000062 3300025915 Bacteria 92689
837 Ga0207693_10000116 3300025915 Bacteria 71473
838 Ga0207693_10000156 3300025915 Bacteria 63230
839 Ga0207693_10000456 3300025915 Bacteria 37291
840 Ga0207693_10009900 3300025915 Bacteria 7752
841 Ga0207693_10036069 3300025915 Bacteria 3897
842 Ga0207693_10142639 3300025915 Bacteria 1883
843 Ga0207693_10200128 3300025915 Bacteria 1571
844 Ga0207693_10309835 3300025915 Bacteria 1236
845 Ga0207663_10000158 3300025916 Bacteria 31459
846 Ga0207663_10000415 3300025916 Bacteria 18491
847 Ga0207663_10044460 3300025916 Bacteria 2726
848 Ga0207663_10080892 3300025916 Bacteria 2126
849 Ga0207660_10000081 3300025917 Bacteria 50936
850 Ga0207660_10005316 3300025917 Bacteria 8367
851 Ga0207660_10018909 3300025917 Bacteria 4600
852 Ga0207660_10034446 3300025917 Bacteria 3510
853 Ga0207660_10114173 3300025917 Bacteria 2037
854 Ga0207660_10128027 3300025917 Bacteria 1930
855 Ga0207660_10159395 3300025917 Bacteria 1740
856 Ga0207662_10000382 3300025918 Bacteria 19849
857 Ga0207662_10182934 3300025918 Bacteria 1349
858 Ga0207657_10000023 3300025919 Bacteria 152701
859 Ga0207657_10000144 3300025919 Bacteria 72030
860 Ga0207657_10004389 3300025919 Bacteria 14926
861 Ga0207657_10011015 3300025919 Bacteria 8988
862 Ga0207657_10027165 3300025919 Bacteria 5245
863 Ga0207657_10027653 3300025919 Bacteria 5190
864 Ga0207657_10051425 3300025919 Bacteria 3581
865 Ga0207657_10114988 3300025919 Bacteria 2218
866 Ga0207657_10154860 3300025919 Bacteria 1864
867 Ga0207657_10182937 3300025919 Bacteria 1693
868 Ga0207649_10000039 3300025920 Bacteria 118724
869 Ga0207649_10008903 3300025920 Bacteria 5481
870 Ga0207652_10000413 3300025921 Bacteria 44358
871 Ga0207652_10001692 3300025921 Bacteria 19294
872 Ga0207652_10006466 3300025921 Bacteria 9450
873 Ga0207652_10023234 3300025921 Bacteria 5134
874 Ga0207652_10032926 3300025921 Bacteria 4362
875 Ga0207652_10035426 3300025921 Bacteria 4212
876 Ga0207652_10037808 3300025921 Bacteria 4087
877 Ga0207652_10044041 3300025921 Bacteria 3801
878 Ga0207652_10068847 3300025921 Bacteria 3071
879 Ga0207652_10096366 3300025921 Bacteria 2606
880 Ga0207652_10146914 3300025921 Bacteria 2110
881 Ga0207652_10269421 3300025921 Bacteria 1536
882 Ga0207646_10040495 3300025922 Bacteria 4189
883 Ga0207646_10118805 3300025922 Bacteria 2375
884 Ga0207646_10286633 3300025922 Bacteria 1488
885 Ga0207681_10057652 3300025923 Bacteria 2655
886 Ga0207681_10067785 3300025923 Bacteria 2476
887 Ga0207681_10149286 3300025923 Bacteria 1750
888 Ga0207681_10197121 3300025923 Bacteria 1544
889 Ga0207694_10000044 3300025924 Bacteria 169595
890 Ga0207694_10000662 3300025924 Bacteria 31000
891 Ga0207694_10009782 3300025924 Bacteria 7236
892 Ga0207694_10080240 3300025924 Bacteria 2560
893 Ga0207650_10016010 3300025925 Bacteria 5232
894 Ga0207659_10051803 3300025926 Bacteria 2921
895 Ga0207659_10053494 3300025926 Bacteria 2880
896 Ga0207659_10058846 3300025926 Bacteria 2760
897 Ga0207687_10005332 3300025927 Bacteria 8516
898 Ga0207687_10021258 3300025927 Bacteria 4310
899 Ga0207687_10021407 3300025927 Bacteria 4296
900 Ga0207687_10032556 3300025927 Bacteria 3531
901 Ga0207700_10000015 3300025928 Bacteria 224772
902 Ga0207700_10007816 3300025928 Bacteria 6574
903 Ga0207700_10013486 3300025928 Bacteria 5321
904 Ga0207700_10033809 3300025928 Bacteria 3662
905 Ga0207700_10062912 3300025928 Bacteria 2820
906 Ga0207700_10063078 3300025928 Bacteria 2817
907 Ga0207700_10174690 3300025928 Bacteria 1795
908 Ga0207700_10179662 3300025928 Bacteria 1771
909 Ga0207700_10240234 3300025928 Bacteria 1544
910 Ga0207700_10475639 3300025928 Bacteria 1103
911 Ga0207664_10005758 3300025929 Bacteria 8474
912 Ga0207664_10007283 3300025929 Bacteria 7672
913 Ga0207664_10023882 3300025929 Bacteria 4588
914 Ga0207664_10056391 3300025929 Bacteria 3120
915 Ga0207664_10117111 3300025929 Bacteria 2224
916 Ga0207664_10228167 3300025929 Bacteria 1618
917 Ga0207644_10017690 3300025931 Bacteria 4820
918 Ga0207644_10164411 3300025931 Bacteria 1728
919 Ga0207644_10281082 3300025931 Bacteria 1336
920 Ga0207690_10000718 3300025932 Bacteria 21331
921 Ga0207690_10011327 3300025932 Bacteria 5331
922 Ga0207690_10014742 3300025932 Bacteria 4727
923 Ga0207690_10061099 3300025932 Bacteria 2560
924 Ga0207690_10109928 3300025932 Bacteria 1983
925 Ga0207706_10000019 3300025933 Bacteria 167592
926 Ga0207706_10045695 3300025933 Bacteria 3879
927 Ga0207706_10056096 3300025933 Bacteria 3474
928 Ga0207686_10049259 3300025934 Bacteria 2614
929 Ga0207686_10063151 3300025934 Bacteria 2354
930 Ga0207686_10130542 3300025934 Bacteria 1723
931 Ga0207709_10019254 3300025935 Bacteria 3834
932 Ga0207709_10097307 3300025935 Bacteria 1938
933 Ga0207709_10245624 3300025935 Bacteria 1304
934 Ga0207670_10118208 3300025936 Bacteria 1922
935 Ga0207669_10013806 3300025937 Bacteria 4028
936 Ga0207669_10042124 3300025937 Bacteria 2662
937 Ga0207669_10131444 3300025937 Bacteria 1721
938 Ga0207704_10032978 3300025938 Bacteria 2939
939 Ga0207704_10100576 3300025938 Bacteria 1926
940 Ga0207665_10000161 3300025939 Bacteria 45172
941 Ga0207665_10000767 3300025939 Bacteria 21619
942 Ga0207665_10080449 3300025939 Bacteria 2241
943 Ga0207691_10011388 3300025940 Bacteria 8537
944 Ga0207691_10142390 3300025940 Bacteria 2112
945 Ga0207691_10233013 3300025940 Bacteria 1594
946 Ga0207711_10000001 3300025941 Bacteria 1325674
947 Ga0207711_10010590 3300025941 Bacteria 7666
948 Ga0207711_10076483 3300025941 Bacteria 2915
949 Ga0207711_10145914 3300025941 Bacteria 2132
950 Ga0207711_10361160 3300025941 Bacteria 1345
951 Ga0207689_10004156 3300025942 Bacteria 13164
952 Ga0207689_10118379 3300025942 Bacteria 2178
953 Ga0207689_10154332 3300025942 Bacteria 1893
954 Ga0207689_10246159 3300025942 Bacteria 1478
955 Ga0207661_10000579 3300025944 Bacteria 23347
956 Ga0207661_10124852 3300025944 Bacteria 2197
957 Ga0207661_10130999 3300025944 Bacteria 2148
958 Ga0207661_10166959 3300025944 Bacteria 1913
959 Ga0207661_10201936 3300025944 Bacteria 1748
960 Ga0207661_10211564 3300025944 Bacteria 1709
961 Ga0207661_10291233 3300025944 Bacteria 1461
962 Ga0207679_10007069 3300025945 Bacteria 7117
963 Ga0207667_10000012 3300025949 Bacteria 445492
964 Ga0207667_10003118 3300025949 Bacteria 20511
965 Ga0207667_10006730 3300025949 Bacteria 13883
966 Ga0207667_10021716 3300025949 Bacteria 7111
967 Ga0207667_10030565 3300025949 Bacteria 5826
968 Ga0207667_10038672 3300025949 Bacteria 5092
969 Ga0207667_10056196 3300025949 Bacteria 4135
970 Ga0207667_10076221 3300025949 Bacteria 3480
971 Ga0207667_10097902 3300025949 Bacteria 3027
972 Ga0207667_10143162 3300025949 Bacteria 2461
973 Ga0207667_10170312 3300025949 Bacteria 2238
974 Ga0207667_10297920 3300025949 Bacteria 1648
975 Ga0207651_10024754 3300025960 Bacteria 3719
976 Ga0207651_10037138 3300025960 Bacteria 3188
977 Ga0207651_10056905 3300025960 Bacteria 2694
978 Ga0207651_10126377 3300025960 Bacteria 1949
979 Ga0207712_10002201 3300025961 Bacteria 12689
980 Ga0207712_10041791 3300025961 Bacteria 3153
981 Ga0207712_10083752 3300025961 Bacteria 2328
982 Ga0207712_10141339 3300025961 Bacteria 1848
983 Ga0207668_10002085 3300025972 Bacteria 11663
984 Ga0207668_10005036 3300025972 Bacteria 7778
985 Ga0207668_10026389 3300025972 Bacteria 3771
986 Ga0207668_10159775 3300025972 Bacteria 1754
987 Ga0207668_10221841 3300025972 Bacteria 1519
988 Ga0207640_10002370 3300025981 Bacteria 10102
989 Ga0207640_10036503 3300025981 Bacteria 3086
990 Ga0207640_10142952 3300025981 Bacteria 1747
991 Ga0207640_10205291 3300025981 Bacteria 1497
992 Ga0207658_10046659 3300025986 Bacteria 3166
993 Ga0207658_10080268 3300025986 Bacteria 2498
994 Ga0207658_10314186 3300025986 Bacteria 1354
995 Ga0207658_10366610 3300025986 Bacteria 1258
996 Ga0207677_10011765 3300026023 Bacteria 5002
997 Ga0207677_10015264 3300026023 Bacteria 4511
998 Ga0207677_10043460 3300026023 Bacteria 2987
999 Ga0207677_10055063 3300026023 Bacteria 2718
1000 Ga0207677_10059509 3300026023 Bacteria 2635
1001 Ga0207677_10246961 3300026023 Bacteria 1447
1002 Ga0207703_10015627 3300026035 Bacteria 5920
1003 Ga0207703_10030990 3300026035 Bacteria 4228
1004 Ga0207703_10078539 3300026035 Bacteria 2742
1005 Ga0207703_10080579 3300026035 Bacteria 2711
1006 Ga0207703_10134507 3300026035 Bacteria 2139
1007 Ga0207703_10175886 3300026035 Bacteria 1886
1008 Ga0207639_10000591 3300026041 Bacteria 24978
1009 Ga0207639_10005685 3300026041 Bacteria 8438
1010 Ga0207639_10010223 3300026041 Bacteria 6492
1011 Ga0207639_10016727 3300026041 Bacteria 5195
1012 Ga0207639_10054815 3300026041 Bacteria 3049
1013 Ga0207639_10056579 3300026041 Bacteria 3007
1014 Ga0207639_10086667 3300026041 Bacteria 2494
1015 Ga0207639_10106888 3300026041 Bacteria 2272
1016 Ga0207639_10237436 3300026041 Bacteria 1583
1017 Ga0207639_10315640 3300026041 Bacteria 1386
1018 Ga0207678_10000017 3300026067 Bacteria 135871
1019 Ga0207678_10001867 3300026067 Bacteria 19220
1020 Ga0207678_10004742 3300026067 Bacteria 12216
1021 Ga0207678_10005908 3300026067 Bacteria 10905
1022 Ga0207678_10008827 3300026067 Bacteria 8872
1023 Ga0207678_10034302 3300026067 Bacteria 4420
1024 Ga0207678_10087496 3300026067 Bacteria 2662
1025 Ga0207678_10091829 3300026067 Bacteria 2595
1026 Ga0207708_10000315 3300026075 Bacteria 38170
1027 Ga0207708_10000637 3300026075 Bacteria 26948
1028 Ga0207708_10014237 3300026075 Bacteria 5949
1029 Ga0207708_10204526 3300026075 Bacteria 1576
1030 Ga0207702_10000004 3300026078 Bacteria 422182
1031 Ga0207702_10000011 3300026078 Bacteria 284514
1032 Ga0207702_10000350 3300026078 Bacteria 52867
1033 Ga0207702_10001929 3300026078 Bacteria 20272
1034 Ga0207702_10071167 3300026078 Bacteria 2994
1035 Ga0207702_10082843 3300026078 Bacteria 2790
1036 Ga0207702_10114386 3300026078 Bacteria 2404
1037 Ga0207702_10127898 3300026078 Bacteria 2283
1038 Ga0207702_10129543 3300026078 Bacteria 2269
1039 Ga0207702_10251055 3300026078 Bacteria 1661
1040 Ga0207641_10008603 3300026088 Bacteria 8423
1041 Ga0207641_10072787 3300026088 Bacteria 2960
1042 Ga0207641_10294005 3300026088 Bacteria 1532
1043 Ga0207641_10398013 3300026088 Bacteria 1322
1044 Ga0207648_10015409 3300026089 Bacteria 7034
1045 Ga0207648_10025889 3300026089 Bacteria 5219
1046 Ga0207648_10149051 3300026089 Bacteria 2064
1047 Ga0207648_10217564 3300026089 Bacteria 1697
1048 Ga0207676_10082027 3300026095 Bacteria 2621
1049 Ga0207676_10124317 3300026095 Bacteria 2181
1050 Ga0207676_10220311 3300026095 Bacteria 1689
1051 Ga0207676_10469141 3300026095 Bacteria 1190
1052 Ga0207674_10000002 3300026116 Bacteria 279738
1053 Ga0207674_10002413 3300026116 Bacteria 23592
1054 Ga0207674_10003060 3300026116 Bacteria 20687
1055 Ga0207674_10003431 3300026116 Bacteria 19400
1056 Ga0207674_10003796 3300026116 Bacteria 18431
1057 Ga0207674_10010629 3300026116 Bacteria 10408
1058 Ga0207674_10027875 3300026116 Bacteria 5967
1059 Ga0207674_10104982 3300026116 Bacteria 2803
1060 Ga0207675_100000439 3300026118 Bacteria 40472
1061 Ga0207675_100044917 3300026118 Bacteria 4128
1062 Ga0207675_100050882 3300026118 Bacteria 3866
1063 Ga0207675_100063041 3300026118 Bacteria 3463
1064 Ga0207675_100075378 3300026118 Bacteria 3158
1065 Ga0207675_100152703 3300026118 Bacteria 2199
1066 Ga0207683_10000030 3300026121 Bacteria 109087
1067 Ga0207683_10005546 3300026121 Bacteria 10807
1068 Ga0207683_10036841 3300026121 Bacteria 4260
1069 Ga0207683_10040442 3300026121 Bacteria 4068
1070 Ga0207683_10106602 3300026121 Bacteria 2506
1071 Ga0207683_10112905 3300026121 Bacteria 2434
1072 Ga0207683_10122853 3300026121 Bacteria 2332
1073 Ga0207683_10431356 3300026121 Bacteria 1214
1074 Ga0207698_10010246 3300026142 Bacteria 6010
1075 Ga0207698_10012872 3300026142 Bacteria 5495
1076 Ga0207698_10038090 3300026142 Bacteria 3549
1077 Ga0207698_10113042 3300026142 Bacteria 2281
1078 Ga0207698_10127789 3300026142 Bacteria 2165
1079 Ga0207698_10361599 3300026142 Bacteria 1375
1080 Ga0209281_1000102 3300027111 Bacteria 221665
1081 Ga0209281_1000571 3300027111 Bacteria 44022
1082 Ga0209371_1000009 3300027312 Bacteria 963030
1083 Ga0209371_1000942 3300027312 Bacteria 22686
1084 Ga0209589_1000046 3300027357 Bacteria 118780
1085 Ga0209489_100106 3300027361 Bacteria 118780
1086 Ga0209700_100105 3300027363 Bacteria 118780
1087 Ga0209970_1011689 3300027614 Bacteria 1447
1088 Ga0209282_1000013 3300027666 Bacteria 215053
1089 Ga0209282_1000274 3300027666 Bacteria 25687
1090 Ga0209282_1119567 3300027666 Bacteria 1320
1091 Ga0209966_1021065 3300027695 Bacteria 1267
1092 Ga0209813_10001922 3300027866 Bacteria 4685
1093 Ga0209813_10003182 3300027866 Bacteria 3824
1094 Ga0209813_10053647 3300027866 Bacteria 1268
1095 Ga0207428_10000072 3300027907 Bacteria 143629
1096 Ga0207428_10018032 3300027907 Bacteria 6044
1097 Ga0207428_10030235 3300027907 Bacteria 4480
1098 Ga0207428_10038011 3300027907 Bacteria 3916
1099 Ga0268266_10001794 3300028379 Bacteria 24326
1100 Ga0268266_10002387 3300028379 Bacteria 20279
1101 Ga0268266_10003485 3300028379 Bacteria 15669
1102 Ga0268266_10012625 3300028379 Bacteria 7299
1103 Ga0268266_10018037 3300028379 Bacteria 6015
1104 Ga0268266_10034992 3300028379 Bacteria 4272
1105 Ga0268266_10052016 3300028379 Bacteria 3516
1106 Ga0268266_10075974 3300028379 Bacteria 2919
1107 Ga0268266_10155688 3300028379 Bacteria 2064
1108 Ga0268266_10354493 3300028379 Bacteria 1379
1109 Ga0268266_10371555 3300028379 Bacteria 1347
1110 Ga0268266_10420615 3300028379 Bacteria 1266
1111 Ga0268265_10000577 3300028380 Bacteria 37110
1112 Ga0268265_10014057 3300028380 Bacteria 5454
1113 Ga0268265_10026973 3300028380 Bacteria 4093
1114 Ga0268265_10035766 3300028380 Bacteria 3632
1115 Ga0268265_10036379 3300028380 Bacteria 3606
1116 Ga0268265_10238276 3300028380 Bacteria 1603
1117 Ga0268264_10000113 3300028381 Bacteria 203262
1118 Ga0268264_10001716 3300028381 Bacteria 20182
1119 Ga0268264_10061091 3300028381 Bacteria 3160
1120 Ga0268264_10095375 3300028381 Bacteria 2574
1121 Ga0268264_10116440 3300028381 Bacteria 2349
1122 Ga0268264_10210866 3300028381 Bacteria 1783
1123 Ga0265334_10005796 3300028573 Bacteria 5381
1124 Ga0265334_10017927 3300028573 Bacteria 2920
1125 Ga0265318_10000017 3300028577 Bacteria 174748
1126 Ga0307517_10000748 3300028786 Bacteria 56107
1127 Ga0307515_10000068 3300028794 Bacteria 242305
1128 Ga0307515_10010603 3300028794 Bacteria 17640
1129 Ga0307515_10102681 3300028794 Bacteria 3436
1130 Ga0265338_10001143 3300028800 Bacteria 43898
1131 Ga0265338_10003201 3300028800 Bacteria 23351
1132 Ga0265338_10020868 3300028800 Bacteria 6864
1133 Ga0265338_10031409 3300028800 Bacteria 5208
1134 Ga0265338_10063560 3300028800 Bacteria 3217
1135 Ga0265338_10169725 3300028800 Bacteria 1675
1136 Ga0265324_10002894 3300029957 Bacteria 8430
1137 Ga0268256_1000010 3300030500 Bacteria 963034
1138 Ga0268256_1002122 3300030500 Bacteria 10587
1139 Ga0265330_10008876 3300031235 Bacteria 4806
1140 Ga0265330_10031382 3300031235 Bacteria 2381
1141 Ga0265330_10036886 3300031235 Bacteria 2177
1142 Ga0265330_10092408 3300031235 Bacteria 1298
1143 Ga0265332_10008235 3300031238 Bacteria 4686
1144 Ga0265332_10031370 3300031238 Bacteria 2318
1145 Ga0265328_10000095 3300031239 Bacteria 44318
1146 Ga0265328_10000874 3300031239 Bacteria 13952
1147 Ga0265328_10001581 3300031239 Bacteria 10500
1148 Ga0265328_10003408 3300031239 Bacteria 7024
1149 Ga0265328_10012744 3300031239 Bacteria 3343
1150 Ga0265328_10028862 3300031239 Bacteria 2074
1151 Ga0265320_10000331 3300031240 Bacteria 38699
1152 Ga0265325_10000003 3300031241 Bacteria 370490
1153 Ga0265325_10000061 3300031241 Bacteria 75502
1154 Ga0265325_10001065 3300031241 Bacteria 19761
1155 Ga0265325_10002405 3300031241 Bacteria 12647
1156 Ga0265325_10012651 3300031241 Bacteria 4819
1157 Ga0265325_10015457 3300031241 Bacteria 4290
1158 Ga0265325_10036289 3300031241 Bacteria 2612
1159 Ga0265325_10061107 3300031241 Bacteria 1912
1160 Ga0265325_10093370 3300031241 Bacteria 1481
1161 Ga0265325_10107686 3300031241 Bacteria 1358
1162 Ga0265329_10028734 3300031242 Bacteria 1822
1163 Ga0265340_10001586 3300031247 Bacteria 13037
1164 Ga0265340_10003602 3300031247 Bacteria 8714
1165 Ga0265340_10003667 3300031247 Bacteria 8643
1166 Ga0265340_10006838 3300031247 Bacteria 6239
1167 Ga0265340_10022473 3300031247 Bacteria 3224
1168 Ga0265340_10030891 3300031247 Bacteria 2683
1169 Ga0265339_10000971 3300031249 Bacteria 21969
1170 Ga0265339_10001193 3300031249 Bacteria 19613
1171 Ga0265339_10001509 3300031249 Bacteria 17199
1172 Ga0265339_10010902 3300031249 Bacteria 5619
1173 Ga0265339_10025148 3300031249 Bacteria 3421
1174 Ga0265339_10033359 3300031249 Bacteria 2899
1175 Ga0265339_10038927 3300031249 Bacteria 2649
1176 Ga0265339_10101783 3300031249 Bacteria 1494
1177 Ga0265331_10000020 3300031250 Bacteria 258149
1178 Ga0265331_10000657 3300031250 Bacteria 29926
1179 Ga0265331_10000702 3300031250 Bacteria 28581
1180 Ga0265331_10001362 3300031250 Bacteria 17953
1181 Ga0265331_10002249 3300031250 Bacteria 13209
1182 Ga0265331_10007852 3300031250 Bacteria 6118
1183 Ga0265331_10009559 3300031250 Bacteria 5436
1184 Ga0265331_10011328 3300031250 Bacteria 4888
1185 Ga0265331_10028196 3300031250 Bacteria 2809
1186 Ga0265331_10032453 3300031250 Bacteria 2587
1187 Ga0265327_10000372 3300031251 Bacteria 84596
1188 Ga0265327_10000620 3300031251 Bacteria 58447
1189 Ga0265327_10004114 3300031251 Bacteria 13133
1190 Ga0265327_10004521 3300031251 Bacteria 12273
1191 Ga0265327_10014298 3300031251 Bacteria 5199
1192 Ga0265327_10065737 3300031251 Bacteria 1833
1193 Ga0265327_10078041 3300031251 Bacteria 1641
1194 Ga0265316_10022088 3300031344 Bacteria 5375
1195 Ga0265316_10031778 3300031344 Bacteria 4313
1196 Ga0265316_10034942 3300031344 Bacteria 4080
1197 Ga0265316_10035427 3300031344 Bacteria 4045
1198 Ga0265316_10036566 3300031344 Bacteria 3970
1199 Ga0265316_10095815 3300031344 Bacteria 2260
1200 Ga0265316_10099166 3300031344 Bacteria 2216
1201 Ga0265316_10116988 3300031344 Bacteria 2015
1202 Ga0265316_10133451 3300031344 Bacteria 1869
1203 Ga0265316_10172732 3300031344 Bacteria 1611
1204 Ga0307513_10000264 3300031456 Bacteria 76010
1205 Ga0307513_10104424 3300031456 Bacteria 2847
1206 Ga0307513_10276107 3300031456 Bacteria 1460
1207 Ga0307509_10165626 3300031507 Bacteria 2100
1208 Ga0307408_100092939 3300031548 Bacteria 2281
1209 Ga0307408_100256897 3300031548 Bacteria 1444
1210 Ga0265313_10000529 3300031595 Bacteria 39938
1211 Ga0265313_10000532 3300031595 Bacteria 39861
1212 Ga0265313_10001127 3300031595 Bacteria 25532
1213 Ga0265313_10003520 3300031595 Bacteria 12624
1214 Ga0265313_10010923 3300031595 Bacteria 5692
1215 Ga0265313_10043654 3300031595 Bacteria 2194
1216 Ga0265313_10062818 3300031595 Bacteria 1734
1217 Ga0307508_10000002 3300031616 Bacteria 407635
1218 Ga0307508_10067883 3300031616 Bacteria 3136
1219 Ga0307508_10069065 3300031616 Bacteria 3104
1220 Ga0316575_10004477 3300031665 Bacteria 4919
1221 Ga0316579_10002402 3300031691 Bacteria 7069
1222 Ga0265314_10002643 3300031711 Bacteria 18036
1223 Ga0265314_10004122 3300031711 Bacteria 13694
1224 Ga0265314_10007663 3300031711 Bacteria 9335
1225 Ga0265314_10016122 3300031711 Bacteria 5917
1226 Ga0265314_10018389 3300031711 Bacteria 5449
1227 Ga0265314_10020887 3300031711 Bacteria 5047
1228 Ga0265314_10027263 3300031711 Bacteria 4279
1229 Ga0265314_10032706 3300031711 Bacteria 3822
1230 Ga0265314_10037359 3300031711 Bacteria 3520
1231 Ga0265314_10045746 3300031711 Bacteria 3092
1232 Ga0265314_10109634 3300031711 Bacteria 1756
1233 Ga0265314_10137042 3300031711 Bacteria 1518
1234 Ga0265314_10157705 3300031711 Bacteria 1384
1235 Ga0265342_10004383 3300031712 Bacteria 11151
1236 Ga0265342_10014737 3300031712 Bacteria 5178
1237 Ga0265342_10016447 3300031712 Bacteria 4835
1238 Ga0265342_10025508 3300031712 Bacteria 3714
1239 Ga0265342_10043577 3300031712 Bacteria 2707
1240 Ga0265342_10053622 3300031712 Bacteria 2399
1241 Ga0265342_10091287 3300031712 Bacteria 1746
1242 Ga0265342_10124129 3300031712 Bacteria 1451
1243 Ga0265342_10157430 3300031712 Bacteria 1257
1244 Ga0316576_10013435 3300031727 Bacteria 5444
1245 Ga0316576_10064235 3300031727 Bacteria 2696
1246 Ga0316576_10083452 3300031727 Bacteria 2373
1247 Ga0316576_10108773 3300031727 Bacteria 2077
1248 Ga0316576_10182389 3300031727 Bacteria 1583
1249 Ga0316576_10230076 3300031727 Bacteria 1394
1250 Ga0316578_10059583 3300031728 Bacteria 2246
1251 Ga0307516_10010347 3300031730 Bacteria 10269
1252 Ga0307516_10031335 3300031730 Bacteria 5360
1253 Ga0307516_10057865 3300031730 Bacteria 3775
1254 Ga0307516_10096909 3300031730 Bacteria 2770
1255 Ga0307405_10000276 3300031731 Bacteria 18944
1256 Ga0316577_10012808 3300031733 Bacteria 4575
1257 Ga0316577_10160350 3300031733 Bacteria 1269
1258 Ga0307406_10102388 3300031901 Bacteria 1953
1259 Ga0307406_10250579 3300031901 Bacteria 1334
1260 Ga0307412_10047890 3300031911 Bacteria 2809
1261 Ga0315914_1000004 3300031967 Bacteria 288534
1262 Ga0307409_100003189 3300031995 Bacteria 8819
1263 Ga0307409_100091540 3300031995 Bacteria 2493
1264 Ga0307409_100115574 3300031995 Bacteria 2260
1265 Ga0307409_100432530 3300031995 Bacteria 1265
1266 Ga0307416_100246548 3300032002 Bacteria 1735
1267 Ga0307411_10043818 3300032005 Bacteria 2865
1268 Ga0307411_10173590 3300032005 Bacteria 1628
1269 Ga0307411_10412389 3300032005 Bacteria 1120
1270 Ga0316583_10067993 3300032133 Bacteria 1247
1271 Ga0316585_10044309 3300032137 Bacteria 1421
1272 Ga0316580_10014292 3300032139 Bacteria 2423
1273 Ga0316593_10012780 3300032168 Bacteria 2470
1274 Ga0307510_10024095 3300033180 Bacteria 7040
1275 Ga0307510_10104114 3300033180 Bacteria 2613
1276 Ga0315913_1000011 3300033430 Bacteria 140532
1277 Ga0315911_1000013 3300033442 Bacteria 239334
1278 Ga0315915_1000003 3300033464 Bacteria 407996
1279 Ga0316586_1021179 3300033527 Bacteria 1073
1280 Ga0316588_1004413 3300033528 Bacteria 2662
1281 Ga0316596_1010722 3300033541 Bacteria 2226
1282 Ga0373950_0014213 3300034818 Bacteria 1337
1283 Ga0373926_0029899 3300035083 Bacteria 1916
1284 Ga0373929_0011235 3300035085 Bacteria 1685
1285 Ga0373934_0063644 3300035086 Bacteria 1471
1286 Ga0373951_0021232 3300035091 Bacteria 1490
1287 Ga0373952_0018511 3300035092 Bacteria 1442
1288 Ga0373923_0001479 3300035111 Bacteria 6760
1289 Ga0373932_0010088 3300035112 Bacteria 2280
1290 Ga0373936_0077826 3300035113 Bacteria 1376
1291 Ga0373939_0004562 3300035114 Bacteria 3278
1292 Ga0373941_0016579 3300035115 Bacteria 2005
1293 Ga0373945_0005952 3300035116 Bacteria 3916
1294 Ga0373953_0005379 3300035117 Bacteria 4150
1295 Ga0373954_0000303 3300035118 Bacteria 17880
1296 Ga0373954_0003408 3300035118 Bacteria 6732
1297 Ga0373954_0031321 3300035118 Bacteria 2455
1298 Ga0373954_0107606 3300035118 Bacteria 1347
1299 Ga0373956_0001298 3300035119 Bacteria 10347
1300 Ga0373956_0021820 3300035119 Bacteria 2733
1301 Ga0373957_0001076 3300035120 Bacteria 7207
1302 Ga0373957_0049650 3300035120 Bacteria 1602
1303 Ga0373943_0032651 3300035170 Bacteria 2475
1304 Ga0373943_0057642 3300035170 Bacteria 1931
1305 Ga0373946_0000876 3300035171 Bacteria 10352
1306 Ga0373946_0006820 3300035171 Bacteria 4156
1307 Ga0373946_0114993 3300035171 Bacteria 1222
1308 Ga0373955_0000243 3300035172 Bacteria 22516
1309 Ga0373955_0000648 3300035172 Bacteria 14857
1310 Ga0373961_0011987 3300035241 Bacteria 2162
1311 Ga0373961_0021948 3300035241 Bacteria 1703
1312 Ga0373961_0038739 3300035241 Bacteria 1367
1313 Ga0316574_0000352 3300035398 Bacteria 17817
1314 Ga0316574_0001939 3300035398 Bacteria 10146
1315 Ga0316574_0019520 3300035398 Bacteria 4000
1316 Ga0316574_0066066 3300035398 Bacteria 2278
1317 Ga0373924_0000619 3300035410 Bacteria 10965
1318 Ga0373924_0012332 3300035410 Bacteria 3191
1319 Ga0373924_0024969 3300035410 Bacteria 2359
1320 Ga0373924_0158918 3300035410 Bacteria 991
1321 Ga0373931_0003402 3300035691 Bacteria 7141
1322 Ga0373931_0006023 3300035691 Bacteria 5643
1323 Ga0373931_0077843 3300035691 Bacteria 1823
1324 Ga0373931_0174984 3300035691 Bacteria 1267
1325 Ga0373931_0283542 3300035691 Bacteria 1018
1326 Ga0373935_0000506 3300035692 Bacteria 20178
1327 Ga0373935_0006127 3300035692 Bacteria 7155
1328 Ga0373935_0291760 3300035692 Bacteria 1151
1329 Ga0373927_0006818 3300035695 Bacteria 7772
1330 Ga0373927_0013002 3300035695 Bacteria 5535
1331 Ga0373927_0074123 3300035695 Bacteria 2204
1332 Ga0373927_0143555 3300035695 Bacteria 1562
1333 Ga0373927_0164301 3300035695 Bacteria 1455
1334 Ga0373927_0228069 3300035695 Bacteria 1224
1335 Ga0373927_0310268 3300035695 Bacteria 1038
1336 Ga0373933_0000655 3300035724 Bacteria 21529
1337 Ga0373933_0000698 3300035724 Bacteria 20659
1338 Ga0373933_0001045 3300035724 Bacteria 16806
1339 Ga0373933_0031667 3300035724 Bacteria 3069
1340 Ga0373933_0050950 3300035724 Bacteria 2473
1341 Ga0373933_0086290 3300035724 Bacteria 1931
1342 Ga0373933_0105309 3300035724 Bacteria 1754
1343 Ga0373947_0000626 3300035725 Bacteria 20918
1344 Ga0373947_0001758 3300035725 Bacteria 13259
1345 Ga0373947_0005183 3300035725 Bacteria 7631
1346 Ga0373947_0283583 3300035725 Bacteria 1101
1347 Ga0373937_0000081 3300036401 Bacteria 88009
1348 Ga0373937_0014799 3300036401 Bacteria 6888
1349 Ga0373937_0033613 3300036401 Bacteria 4659
1350 Ga0373937_0064174 3300036401 Bacteria 3378
1351 Ga0373937_0141055 3300036401 Bacteria 2255
1352 Ga0373937_0215887 3300036401 Bacteria 1805
1353 Ga0373937_0389773 3300036401 Bacteria 1321
1354 Ga0310112_013850 3300036458 Bacteria 1149
1355 Ga0316584_0002299 3300036712 Bacteria 12024
1356 Ga0316584_0009706 3300036712 Bacteria 6693
1357 Ga0316584_0167716 3300036712 Bacteria 1630
1358 Ga0373925_0000285 3300037068 Bacteria 53117
1359 Ga0373925_0018181 3300037068 Bacteria 5107
1360 Ga0373925_0035861 3300037068 Bacteria 3661
1361 Ga0373925_0036064 3300037068 Bacteria 3651
1362 Ga0373925_0073342 3300037068 Bacteria 2591
1363 Ga0373925_0104373 3300037068 Bacteria 2182
1364 Ga0373925_0105854 3300037068 Bacteria 2168
1365 Ga0373925_0132280 3300037068 Bacteria 1946
1366 Ga0373925_0197132 3300037068 Bacteria 1600
1367 Ga0395899_0037418 3300037312 Bacteria 3637
1368 Ga0395899_0039495 3300037312 Bacteria 3532
1369 Ga0395899_0060349 3300037312 Bacteria 2794
1370 Ga0395900_0004486 3300037418 Bacteria 14782
1371 Ga0395900_0006180 3300037418 Bacteria 12510
1372 Ga0395900_0014278 3300037418 Bacteria 8107
1373 Ga0395900_0074478 3300037418 Bacteria 3490
1374 Ga0395900_0103810 3300037418 Bacteria 2919
1375 Ga0395900_0111514 3300037418 Bacteria 2810
1376 Ga0395898_0010699 3300037466 Bacteria 9587
1377 Ga0395898_0052933 3300037466 Bacteria 3965
1378 Ga0395898_0146728 3300037466 Bacteria 2258
1379 Ga0395898_0216820 3300037466 Bacteria 1825
1380 Ga0395898_0400819 3300037466 Bacteria 1308
1381 Ga0395898_0445986 3300037466 Bacteria 1233
1382 Ga0395905_0001096 3300037471 Bacteria 34060
1383 Ga0395905_0032923 3300037471 Bacteria 4873
1384 Ga0395905_0049319 3300037471 Bacteria 3945
1385 Ga0316581_0014564 3300037588 Bacteria 2240
1386 Ga0436364_0333080 3300037853 Bacteria 1766
1387 Ga0436364_0386322 3300037853 Bacteria 4464
1388 Ga0436364_0470937 3300037853 Bacteria 2120
1389 Ga0436364_0877943 3300037853 Bacteria 1743
1390 Ga0395901_0001359 3300038443 Bacteria 25608
1391 Ga0395901_0024984 3300038443 Bacteria 6132
1392 Ga0395901_0066304 3300038443 Bacteria 3760
1393 Ga0395901_0076884 3300038443 Bacteria 3483
1394 Ga0395901_0118182 3300038443 Bacteria 2785
1395 Ga0400485_22443 3300038735 Bacteria 1237
1396 Ga0400483_118420 3300039062 Bacteria 3032
1397 Ga0400483_135043 3300039062 Bacteria 2128
1398 Ga0400483_139488 3300039062 Bacteria 2412
1399 Ga0400483_210567 3300039062 Bacteria 3415
1400 Ga0400483_210785 3300039062 Bacteria 11023
1401 Ga0400483_221319 3300039062 Bacteria 25576
1402 Ga0400483_222891 3300039062 Bacteria 3061
1403 Ga0400483_281108 3300039062 Bacteria 1459
1404 Ga0400483_289506 3300039062 Bacteria 2827
1405 Ga0400483_291647 3300039062 Bacteria 5797
1406 Ga0436365_0074789 3300039437 Bacteria 30907
1407 Ga0436365_0311340 3300039437 Bacteria 41137
1408 Ga0436365_0475170 3300039437 Bacteria 21720
1409 Ga0436365_0580075 3300039437 Bacteria 21226
1410 Ga0436365_0712113 3300039437 Bacteria 3703
1411 Ga0436365_0758504 3300039437 Bacteria 12855
1412 Ga0436365_1234622 3300039437 Bacteria 117941
1413 Ga0436365_1288885 3300039437 Bacteria 4985
1414 Ga0436365_1459791 3300039437 Bacteria 23537
1415 Ga0436360_0150887 3300039438 Bacteria 8910
1416 Ga0436360_0635024 3300039438 Bacteria 1436
1417 Ga0436360_0638350 3300039438 Bacteria 1389
1418 Ga0436360_0787824 3300039438 Bacteria 1293
1419 Ga0436360_0789853 3300039438 Bacteria 3845
1420 Ga0436360_0969337 3300039438 Bacteria 1986
1421 Ga0436361_0094277 3300039447 Bacteria 27398
1422 Ga0436361_0145263 3300039447 Bacteria 1917
1423 Ga0436361_0202059 3300039447 Bacteria 1017
1424 Ga0436361_0499840 3300039447 Bacteria 2786
1425 Ga0436361_0733426 3300039447 Bacteria 17219
1426 Ga0436361_0792347 3300039447 Bacteria 1424
1427 Ga0436361_0864146 3300039447 Bacteria 2939
1428 Ga0436361_0919750 3300039447 Bacteria 1254
1429 Ga0436361_0922876 3300039447 Bacteria 2007
1430 Ga0436361_1108765 3300039447 Bacteria 2582
1431 Ga0436363_0083698 3300039450 Bacteria 1862
1432 Ga0436363_0177116 3300039450 Bacteria 1867
1433 Ga0436363_0612164 3300039450 Bacteria 7466
1434 Ga0436363_0728332 3300039450 Bacteria 1050
1435 Ga0436363_0793522 3300039450 Bacteria 3192
1436 Ga0436363_1203604 3300039450 Bacteria 11411
1437 Ga0436362_0186295 3300039453 Bacteria 1280
1438 Ga0436362_0646312 3300039453 Bacteria 4312
1439 Ga0436362_1033356 3300039453 Bacteria 2008
1440 Ga0436362_1087921 3300039453 Bacteria 3225
1441 Ga0439436_0021919 3300041404 Bacteria 1895
1442 Ga0439438_007078 3300041405 Bacteria 3874
1443 Ga0439439_0007134 3300041406 Bacteria 2605
1444 Ga0439453_0014729 3300041408 Bacteria 1344
1445 Ga0439466_0021703 3300041411 Bacteria 2272
1446 Ga0439465_0011602 3300041413 Bacteria 2765
1447 Ga0439465_0017434 3300041413 Bacteria 2242
1448 Ga0439465_0021688 3300041413 Bacteria 2016
1449 Ga0439465_0058161 3300041413 Bacteria 1277
1450 Ga0451787_438214 3300041441 Bacteria 2312
1451 Ga0451802_1844261 3300041460 Bacteria 2227
1452 Ga0451835_0541654 3300041492 Bacteria 2935
1453 Ga0451841_0245447 3300041498 Bacteria 2573
1454 Ga0451845_0148773 3300041501 Bacteria 6296
1455 Ga0451847_0231608 3300041503 Bacteria 2077
1456 Ga0451849_0272602 3300041505 Bacteria 1659
1457 Ga0451843_0165771 3300041509 Bacteria 1042
1458 Ga0451843_0225826 3300041509 Bacteria 2348
1459 Ga0451853_1970376 3300041512 Bacteria 1171
1460 Ga0439448_0010399 3300042005 Bacteria 2760
1461 Ga0439449_0056365 3300042007 Bacteria 1451
1462 Ga0450923_009795 3300042125 Bacteria 1684
1463 Ga0450923_029762 3300042125 Bacteria 1108
1464 Ga0439446_0000671 3300042156 Bacteria 7126
1465 Ga0439435_0046552 3300042436 Bacteria 1229
1466 Ga0450893_0005691 3300042532 Bacteria 2008
1467 Ga0451577_0426839 3300042876 Bacteria 1204
1468 Ga0466969_0130998 3300044656 Bacteria 1163
1469 Ga0453683_0007616 3300044673 Bacteria 7334
1470 Ga0453683_0017805 3300044673 Bacteria 4569
1471 Ga0466966_0020472 3300044684 Bacteria 4349
1472 Ga0466966_0034745 3300044684 Bacteria 3259
1473 Ga0466963_0051367 3300044694 Bacteria 2733
1474 Ga0466963_0087761 3300044694 Bacteria 2115
1475 Ga0466963_0160937 3300044694 Bacteria 1562
1476 Ga0453684_0000006 3300044712 Bacteria 1364191
1477 Ga0453684_0004063 3300044712 Bacteria 31797
1478 Ga0453684_0025733 3300044712 Bacteria 8532
1479 Ga0453684_0333900 3300044712 Bacteria 1713
1480 Ga0466971_0058732 3300044719 Bacteria 1736
1481 Ga0466970_0287555 3300044765 Bacteria 925
1482 Ga0466957_0039448 3300044842 Bacteria 2849
1483 Ga0466959_0021240 3300045049 Bacteria 4787
1484 Ga0466959_0064246 3300045049 Bacteria 2665
1485 Ga0451576_0000056 3300045051 Bacteria 303398
1486 Ga0451576_0000552 3300045051 Bacteria 80314
1487 Ga0451576_0004684 3300045051 Bacteria 17611
1488 Ga0451576_0007428 3300045051 Bacteria 13106
1489 Ga0451576_0041269 3300045051 Bacteria 4879
1490 Ga0451576_0127019 3300045051 Bacteria 2657
1491 Ga0451576_0428693 3300045051 Bacteria 1388
1492 Ga0466958_0101373 3300045836 Bacteria 1790
1493 Ga0466967_0029530 3300045976 Bacteria 4590
1494 Ga0466967_0031838 3300045976 Bacteria 4446
1495 Ga0466967_0041810 3300045976 Bacteria 3956
1496 Ga0466967_0165547 3300045976 Bacteria 2078
1497 Ga0466967_0177197 3300045976 Bacteria 2009
1498 Ga0466967_0392564 3300045976 Bacteria 1349
1499 Ga0495627_000982 3300046453 Bacteria 19454
1500 Ga0495592_0000107 3300046454 Bacteria 74318
1501 Ga0495592_0000614 3300046454 Bacteria 25241
1502 Ga0495592_0060587 3300046454 Bacteria 2784
1503 Ga0495603_0000238 3300046455 Bacteria 28693
1504 Ga0495603_0034333 3300046455 Bacteria 3049
1505 Ga0495629_0000781 3300046459 Bacteria 25685
1506 Ga0495629_0000849 3300046459 Bacteria 24681
1507 Ga0495629_0014047 3300046459 Bacteria 5771
1508 Ga0495629_0118839 3300046459 Bacteria 1842
1509 Ga0495638_0000630 3300046460 Bacteria 38937
1510 Ga0495638_0001553 3300046460 Bacteria 20599
1511 Ga0495638_0004215 3300046460 Bacteria 10943
1512 Ga0495638_0011286 3300046460 Bacteria 6157
1513 Ga0495638_0041946 3300046460 Bacteria 2892
1514 Ga0495638_0050719 3300046460 Bacteria 2591
1515 Ga0495638_0087605 3300046460 Bacteria 1880
1516 Ga0495641_0026239 3300046461 Bacteria 2845
1517 Ga0495651_0000331 3300046462 Bacteria 36765
1518 Ga0495651_0001002 3300046462 Bacteria 21924
1519 Ga0495651_0037559 3300046462 Bacteria 3771
1520 Ga0495651_0074998 3300046462 Bacteria 2565
1521 Ga0495653_0000054 3300046463 Bacteria 102885
1522 Ga0495653_0001956 3300046463 Bacteria 16221
1523 Ga0495650_0000168 3300046471 Bacteria 145714
1524 Ga0495580_0000522 3300046472 Bacteria 32417
1525 Ga0495580_0006567 3300046472 Bacteria 9456
1526 Ga0495580_0127077 3300046472 Bacteria 1769
1527 Ga0495580_0169637 3300046472 Bacteria 1509
1528 Ga0495582_0001486 3300046473 Bacteria 13254
1529 Ga0495582_0009344 3300046473 Bacteria 5402
1530 Ga0495582_0033966 3300046473 Bacteria 2804
1531 Ga0495582_0089212 3300046473 Bacteria 1718
1532 Ga0495639_0001124 3300046475 Bacteria 12074
1533 Ga0495639_0036282 3300046475 Bacteria 2207
1534 Ga0495639_0037746 3300046475 Bacteria 2167
1535 Ga0495639_0058181 3300046475 Bacteria 1767
1536 Ga0495639_0059627 3300046475 Bacteria 1747
1537 Ga0495662_0035464 3300046476 Bacteria 2406
1538 Ga0495664_0000020 3300046477 Bacteria 150749
1539 Ga0495664_0154767 3300046477 Bacteria 1390
1540 Ga0495584_0017691 3300046491 Bacteria 3627
1541 Ga0495584_0028845 3300046491 Bacteria 2813
1542 Ga0495585_0004801 3300046492 Bacteria 8686
1543 Ga0495585_0031581 3300046492 Bacteria 3005
1544 Ga0495585_0040474 3300046492 Bacteria 2617
1545 Ga0495594_0000025 3300046499 Bacteria 69403
1546 Ga0495607_0020727 3300046501 Bacteria 4149
1547 Ga0495607_0036129 3300046501 Bacteria 2981
1548 Ga0495607_0170290 3300046501 Bacteria 1100
1549 Ga0495583_0000003 3300046506 Bacteria 709273
1550 Ga0495583_0056351 3300046506 Bacteria 1773
1551 Ga0495606_0000676 3300046507 Bacteria 53366
1552 Ga0495606_0003044 3300046507 Bacteria 18275
1553 Ga0495606_0022055 3300046507 Bacteria 4651
1554 Ga0495606_0035760 3300046507 Bacteria 3391
1555 Ga0495608_0000024 3300046511 Bacteria 159429
1556 Ga0495608_0001026 3300046511 Bacteria 19595
1557 Ga0495608_0214350 3300046511 Bacteria 1210
1558 Ga0495610_0000304 3300046512 Bacteria 51895
1559 Ga0495610_0000327 3300046512 Bacteria 50683
1560 Ga0495616_0000424 3300046513 Bacteria 32547
1561 Ga0495616_0007461 3300046513 Bacteria 6547
1562 Ga0495616_0051868 3300046513 Bacteria 2044
1563 Ga0495618_0000020 3300046514 Bacteria 130661
1564 Ga0495620_0018490 3300046515 Bacteria 3450
1565 Ga0495628_0000015 3300046516 Bacteria 198912
1566 Ga0495628_0107137 3300046516 Bacteria 2152
1567 Ga0495628_0331303 3300046516 Bacteria 1122
1568 Ga0495630_0000748 3300046517 Bacteria 22908
1569 Ga0495630_0071733 3300046517 Bacteria 2607
1570 Ga0495630_0158978 3300046517 Bacteria 1720
1571 Ga0495632_0092428 3300046519 Bacteria 1433
1572 Ga0495632_0175542 3300046519 Bacteria 983
1573 Ga0495637_0008163 3300046520 Bacteria 5153
1574 Ga0495637_0015964 3300046520 Bacteria 3516
1575 Ga0495643_0029728 3300046522 Bacteria 3056
1576 Ga0495643_0038431 3300046522 Bacteria 2621
1577 Ga0495644_0010356 3300046523 Bacteria 3594
1578 Ga0495648_0000107 3300046524 Bacteria 104376
1579 Ga0495648_0001769 3300046524 Bacteria 20843
1580 Ga0495648_0012437 3300046524 Bacteria 6350
1581 Ga0495648_0020469 3300046524 Bacteria 4613
1582 Ga0495648_0116548 3300046524 Bacteria 1443
1583 Ga0495666_0015200 3300046526 Bacteria 3833
1584 Ga0495652_0000006 3300046529 Bacteria 459709
1585 Ga0495652_0014151 3300046529 Bacteria 7167
1586 Ga0495654_0000085 3300046530 Bacteria 107010
1587 Ga0495654_0016639 3300046530 Bacteria 3880
1588 Ga0495665_0028074 3300046531 Bacteria 3020
1589 Ga0495665_0062444 3300046531 Bacteria 1967
1590 Ga0495640_0000002 3300046533 Bacteria 646434
1591 Ga0495640_0035514 3300046533 Bacteria 3528
1592 Ga0495640_0148767 3300046533 Bacteria 1506
1593 Ga0495586_0054322 3300046535 Bacteria 2171
1594 Ga0495587_0000001 3300046536 Bacteria 724132
1595 Ga0495587_0002314 3300046536 Bacteria 12744
1596 Ga0495587_0077617 3300046536 Bacteria 1928
1597 Ga0495587_0120396 3300046536 Bacteria 1504
1598 Ga0495587_0165976 3300046536 Bacteria 1255
1599 Ga0495598_0014037 3300046537 Bacteria 1997
1600 Ga0495621_0087310 3300046539 Bacteria 1171
1601 Ga0495645_0000013 3300046543 Bacteria 186399
1602 Ga0495645_0023603 3300046543 Bacteria 4456
1603 Ga0495645_0038171 3300046543 Bacteria 3503
1604 Ga0495622_0000622 3300046557 Bacteria 20560
1605 Ga0495622_0012907 3300046557 Bacteria 3874
1606 Ga0495622_0056554 3300046557 Bacteria 1819
1607 Ga0495622_0057166 3300046557 Bacteria 1809
1608 Ga0495622_0107712 3300046557 Bacteria 1276
1609 Ga0495633_0028328 3300046558 Bacteria 2730
1610 Ga0495667_0000030 3300046559 Bacteria 147898
1611 Ga0495667_0001358 3300046559 Bacteria 16077
1612 Ga0495656_0010435 3300046615 Bacteria 3378
1613 Ga0495668_0000746 3300046616 Bacteria 38674
1614 Ga0495668_0003726 3300046616 Bacteria 11218
1615 Ga0495668_0007740 3300046616 Bacteria 6823
1616 Ga0495668_0013478 3300046616 Bacteria 4819
1617 Ga0495668_0053871 3300046616 Bacteria 2224
1618 Ga0495668_0082495 3300046616 Bacteria 1764
1619 Ga0495634_0000264 3300046642 Bacteria 49608
1620 Ga0495634_0005995 3300046642 Bacteria 9278
1621 Ga0495634_0009966 3300046642 Bacteria 6981
1622 Ga0495611_0049150 3300046648 Bacteria 1897
1623 Ga0495611_0105030 3300046648 Bacteria 1314
1624 Ga0495625_0000767 3300046660 Bacteria 44760
1625 Ga0495625_0005395 3300046660 Bacteria 11685
1626 Ga0495625_0015230 3300046660 Bacteria 6099
1627 Ga0495625_0090981 3300046660 Bacteria 2109
1628 Ga0495635_0000001 3300046663 Bacteria 704901
1629 Ga0495635_0000809 3300046663 Bacteria 20486
1630 Ga0495659_0025593 3300046664 Bacteria 2021
1631 Ga0495659_0048366 3300046664 Bacteria 1541
1632 Ga0495661_0003135 3300046665 Bacteria 12379
1633 Ga0495588_0000606 3300046674 Bacteria 16874
1634 Ga0495657_0000028 3300046675 Bacteria 131008
1635 Ga0495657_0006732 3300046675 Bacteria 8961
1636 Ga0495657_0100059 3300046675 Bacteria 1848
1637 Ga0495599_0000056 3300046678 Bacteria 76761
1638 Ga0495599_0000513 3300046678 Bacteria 22163
1639 Ga0495623_0000013 3300046679 Bacteria 119870
1640 Ga0495646_0000003 3300046680 Bacteria 287773
1641 Ga0495646_0001869 3300046680 Bacteria 12662
1642 Ga0495647_0006508 3300046681 Bacteria 3873
1643 Ga0495647_0021934 3300046681 Bacteria 2304
1644 Ga0495658_0000599 3300046683 Bacteria 19756
1645 Ga0495658_0006747 3300046683 Bacteria 5647
1646 Ga0495658_0061625 3300046683 Bacteria 2154
1647 Ga0495613_0000236 3300046689 Bacteria 52791
1648 Ga0495613_0012903 3300046689 Bacteria 6210
1649 Ga0495624_0050529 3300046690 Bacteria 2634
1650 Ga0495670_0099438 3300046691 Bacteria 1497
1651 Ga0495671_0068261 3300046692 Bacteria 1748
1652 Ga0495671_0081660 3300046692 Bacteria 1584
1653 Ga0495649_0035101 3300046694 Bacteria 2758
1654 Ga0495589_0001462 3300046794 Bacteria 13600
1655 Ga0495600_0000002 3300046809 Bacteria 186597
1656 Ga0495600_0000981 3300046809 Bacteria 15367
1657 Ga0495600_0140857 3300046809 Bacteria 1565
1658 Ga0495660_0008737 3300046810 Bacteria 5922
1659 Ga0495581_0000730 3300047315 Bacteria 17405
1660 Ga0495581_0011869 3300047315 Bacteria 5042
1661 Ga0495581_0026011 3300047315 Bacteria 3394
1662 Ga0495581_0106650 3300047315 Bacteria 1628
1663 Ga0495604_0000001 3300047317 Bacteria 708627
1664 Ga0495604_0001709 3300047317 Bacteria 18039
1665 Ga0495674_0000018 3300047319 Bacteria 204024
1666 Ga0495674_0011448 3300047319 Bacteria 8369
1667 Ga0495674_0196351 3300047319 Bacteria 1676
1668 Ga0495674_0197883 3300047319 Bacteria 1668
1669 Ga0495672_0000928 3300047320 Bacteria 30608
1670 Ga0495672_0017769 3300047320 Bacteria 4746
1671 Ga0495676_0009487 3300047321 Bacteria 8865
1672 Ga0495676_0060257 3300047321 Bacteria 2976
1673 Ga0495676_0113460 3300047321 Bacteria 1984
1674 Ga0495676_0143913 3300047321 Bacteria 1705
1675 Ga0495680_0000628 3300047322 Bacteria 39637
1676 Ga0495680_0002243 3300047322 Bacteria 19932
1677 Ga0495680_0014657 3300047322 Bacteria 6780
1678 Ga0495680_0289550 3300047322 Bacteria 1152
1679 Ga0495687_020327 3300047443 Bacteria 3237
1680 Ga0495675_0000331 3300047444 Bacteria 33376
1681 Ga0495675_0000978 3300047444 Bacteria 17349
1682 Ga0495677_0050334 3300047445 Bacteria 1533
1683 Ga0495679_014899 3300047446 Bacteria 2862
1684 Ga0495673_0000341 3300047469 Bacteria 59080
1685 Ga0495673_0001139 3300047469 Bacteria 22773
1686 Ga0495673_0006486 3300047469 Bacteria 6869
1687 Ga0495681_0008191 3300047470 Bacteria 6577
1688 Ga0495681_0030152 3300047470 Bacteria 2766
1689 Ga0495681_0084494 3300047470 Bacteria 1411
1690 Ga0495684_0000010 3300047471 Bacteria 198915
1691 Ga0495684_0000081 3300047471 Bacteria 65985
1692 Ga0495684_0033429 3300047471 Bacteria 3944
1693 Ga0495684_0034555 3300047471 Bacteria 3879
1694 Ga0495684_0137770 3300047471 Bacteria 1831
1695 Ga0495686_0000747 3300047472 Bacteria 43114
1696 Ga0495686_0045393 3300047472 Bacteria 2780
1697 Ga0495686_0099990 3300047472 Bacteria 1750
1698 Ga0495686_0101598 3300047472 Bacteria 1733
1699 Ga0495686_0210391 3300047472 Bacteria 1111
1700 Ga0495593_0000335 3300047673 Bacteria 26108
1701 Ga0495593_0000510 3300047673 Bacteria 21940
1702 Ga0495602_0000016 3300048088 Bacteria 190311
1703 Ga0495602_0002985 3300048088 Bacteria 17343
1704 Ga0495602_0116136 3300048088 Bacteria 2163
1705 Ga0495602_0329473 3300048088 Bacteria 1108
1706 Ga0495614_0018939 3300048089 Bacteria 2980
1707 Ga0496100_0002607 3300048903 Bacteria 9193
1708 Ga0496100_0006527 3300048903 Bacteria 6365
1709 Ga0496100_0077900 3300048903 Bacteria 2230
1710 Ga0496100_0106511 3300048903 Bacteria 1941
1711 Ga0496100_0113334 3300048903 Bacteria 1887
1712 Ga0496100_0128580 3300048903 Bacteria 1781
1713 Ga0496101_0003628 3300048904 Bacteria 9636
1714 Ga0496101_0026294 3300048904 Bacteria 4046
1715 Ga0496101_0027218 3300048904 Bacteria 3981
1716 Ga0496101_0036774 3300048904 Bacteria 3468
1717 Ga0496101_0067053 3300048904 Bacteria 2619
1718 Ga0496101_0067439 3300048904 Bacteria 2612
1719 Ga0496101_0122476 3300048904 Bacteria 1967
1720 Ga0496102_0004361 3300048905 Bacteria 11953
1721 Ga0496102_0006851 3300048905 Bacteria 9724
1722 Ga0496102_0011059 3300048905 Bacteria 7774
1723 Ga0496102_0012951 3300048905 Bacteria 7221
1724 Ga0496102_0043732 3300048905 Bacteria 4063
1725 Ga0496102_0053706 3300048905 Bacteria 3672
1726 Ga0496102_0066409 3300048905 Bacteria 3306
1727 Ga0496102_0089933 3300048905 Bacteria 2841
1728 Ga0496102_0126380 3300048905 Bacteria 2390
1729 Ga0496102_0415117 3300048905 Bacteria 1264
1730 Ga0496102_0435887 3300048905 Bacteria 1230
1731 Ga0496103_0005254 3300048906 Bacteria 7770
1732 Ga0496103_0017970 3300048906 Bacteria 4237
1733 Ga0496103_0028238 3300048906 Bacteria 3403
1734 Ga0496104_0000040 3300048907 Bacteria 162886
1735 Ga0496104_0000094 3300048907 Bacteria 86872
1736 Ga0496104_0001082 3300048907 Bacteria 23263
1737 Ga0496104_0008894 3300048907 Bacteria 8925
1738 Ga0496104_0012424 3300048907 Bacteria 7656
1739 Ga0496104_0047526 3300048907 Bacteria 4044
1740 Ga0496104_0119660 3300048907 Bacteria 2528
1741 Ga0496104_0140278 3300048907 Bacteria 2322
1742 Ga0496104_0175958 3300048907 Bacteria 2050
1743 Ga0496104_0182597 3300048907 Bacteria 2008
1744 Ga0496104_0204865 3300048907 Bacteria 1884
1745 Ga0496104_0222655 3300048907 Bacteria 1799
1746 Ga0496105_0000082 3300048908 Bacteria 69786
1747 Ga0496105_0001148 3300048908 Bacteria 18448
1748 Ga0496105_0003994 3300048908 Bacteria 11045
1749 Ga0496105_0005742 3300048908 Bacteria 9450
1750 Ga0496105_0011434 3300048908 Bacteria 7013
1751 Ga0496105_0013484 3300048908 Bacteria 6489
1752 Ga0496105_0027207 3300048908 Bacteria 4669
1753 Ga0496105_0047293 3300048908 Bacteria 3551
1754 Ga0496105_0122557 3300048908 Bacteria 2143
1755 Ga0496105_0227949 3300048908 Bacteria 1515
1756 Ga0496106_0002924 3300048909 Bacteria 12709
1757 Ga0496106_0007060 3300048909 Bacteria 8296
1758 Ga0496106_0007117 3300048909 Bacteria 8266
1759 Ga0496106_0009342 3300048909 Bacteria 7250
1760 Ga0496106_0011693 3300048909 Bacteria 6482
1761 Ga0496106_0026408 3300048909 Bacteria 4325
1762 Ga0496106_0034967 3300048909 Bacteria 3755
1763 Ga0496106_0046946 3300048909 Bacteria 3248
1764 Ga0496106_0054035 3300048909 Bacteria 3034
1765 Ga0496106_0066770 3300048909 Bacteria 2740
1766 Ga0496106_0351528 3300048909 Bacteria 1184
1767 Ga0496107_0000039 3300048910 Bacteria 77588
1768 Ga0496107_0015945 3300048910 Bacteria 5271
1769 Ga0496107_0018143 3300048910 Bacteria 4951
1770 Ga0496107_0024954 3300048910 Bacteria 4230
1771 Ga0496107_0029144 3300048910 Bacteria 3925
1772 Ga0496107_0032513 3300048910 Bacteria 3729
1773 Ga0496107_0051167 3300048910 Bacteria 2979
1774 Ga0496107_0115612 3300048910 Bacteria 1974
1775 Ga0496107_0130664 3300048910 Bacteria 1854
1776 Ga0496107_0140979 3300048910 Bacteria 1782
1777 Ga0496107_0203386 3300048910 Bacteria 1472
1778 Ga0496107_0360543 3300048910 Bacteria 1082
1779 Ga0496108_0000803 3300048911 Bacteria 24388
1780 Ga0496108_0001659 3300048911 Bacteria 17640
1781 Ga0496108_0017563 3300048911 Bacteria 5853
1782 Ga0496108_0029498 3300048911 Bacteria 4543
1783 Ga0496108_0081576 3300048911 Bacteria 2741
1784 Ga0496108_0099253 3300048911 Bacteria 2482
1785 Ga0496108_0099392 3300048911 Bacteria 2480
1786 Ga0496108_0151483 3300048911 Bacteria 2001
1787 Ga0496108_0153998 3300048911 Bacteria 1984
1788 Ga0496108_0163987 3300048911 Bacteria 1921
1789 Ga0496108_0336010 3300048911 Bacteria 1318
1790 Ga0496109_0001236 3300048912 Bacteria 21235
1791 Ga0496109_0005849 3300048912 Bacteria 10314
1792 Ga0496109_0007315 3300048912 Bacteria 9336
1793 Ga0496109_0013373 3300048912 Bacteria 7116
1794 Ga0496109_0052887 3300048912 Bacteria 3703
1795 Ga0496109_0061219 3300048912 Bacteria 3440
1796 Ga0496109_0097975 3300048912 Bacteria 2718
1797 Ga0496109_0123179 3300048912 Bacteria 2416
1798 Ga0496109_0165455 3300048912 Bacteria 2073
1799 Ga0496109_0604969 3300048912 Bacteria 1032
1800 Ga0496110_0009363 3300048913 Bacteria 7927
1801 Ga0496110_0016949 3300048913 Bacteria 6089
1802 Ga0496110_0027403 3300048913 Bacteria 4884
1803 Ga0496110_0033544 3300048913 Bacteria 4441
1804 Ga0496110_0034203 3300048913 Bacteria 4401
1805 Ga0496110_0052155 3300048913 Bacteria 3595
1806 Ga0496110_0090072 3300048913 Bacteria 2742
1807 Ga0496110_0092060 3300048913 Bacteria 2713
1808 Ga0496110_0172729 3300048913 Bacteria 1961
1809 Ga0496110_0190602 3300048913 Bacteria 1862
1810 Ga0496110_0193557 3300048913 Bacteria 1846
1811 Ga0496110_0295645 3300048913 Bacteria 1475
1812 Ga0496111_0015428 3300048914 Bacteria 5243
1813 Ga0496111_0027431 3300048914 Bacteria 4029
1814 Ga0496111_0038045 3300048914 Bacteria 3445
1815 Ga0496111_0047398 3300048914 Bacteria 3095
1816 Ga0496111_0051567 3300048914 Bacteria 2970
1817 Ga0496111_0053853 3300048914 Bacteria 2907
1818 Ga0496111_0083195 3300048914 Bacteria 2339
1819 Ga0496111_0167155 3300048914 Bacteria 1634
1820 Ga0496111_0176431 3300048914 Bacteria 1588
1821 Ga0496111_0215730 3300048914 Bacteria 1425
1822 Ga0496112_0000015 3300048915 Bacteria 206423
1823 Ga0496112_0002678 3300048915 Bacteria 14403
1824 Ga0496112_0004792 3300048915 Bacteria 11544
1825 Ga0496112_0018129 3300048915 Bacteria 6624
1826 Ga0496112_0019376 3300048915 Bacteria 6422
1827 Ga0496112_0020703 3300048915 Bacteria 6240
1828 Ga0496112_0024342 3300048915 Bacteria 5795
1829 Ga0496112_0044902 3300048915 Bacteria 4330
1830 Ga0496112_0084711 3300048915 Bacteria 3136
1831 Ga0496112_0086736 3300048915 Bacteria 3096
1832 Ga0496112_0096124 3300048915 Bacteria 2933
1833 Ga0496112_0119498 3300048915 Bacteria 2605
1834 Ga0496112_0161637 3300048915 Bacteria 2206
1835 Ga0496112_0267603 3300048915 Bacteria 1658
1836 Ga0496113_0000418 3300048916 Bacteria 20649
1837 Ga0496113_0001654 3300048916 Bacteria 12581
1838 Ga0496113_0006745 3300048916 Bacteria 7318
1839 Ga0496113_0008962 3300048916 Bacteria 6550
1840 Ga0496113_0012570 3300048916 Bacteria 5694
1841 Ga0496113_0090908 3300048916 Bacteria 2352
1842 Ga0496114_0018154 3300048917 Bacteria 5683
1843 Ga0496114_0030749 3300048917 Bacteria 4418
1844 Ga0496114_0037711 3300048917 Bacteria 3998
1845 Ga0496114_0040487 3300048917 Bacteria 3858
1846 Ga0496114_0045731 3300048917 Bacteria 3637
1847 Ga0496114_0164860 3300048917 Bacteria 1929
1848 Ga0496114_0186406 3300048917 Bacteria 1813
1849 Ga0496114_0213624 3300048917 Bacteria 1692
1850 Ga0496115_0000849 3300048918 Bacteria 22201
1851 Ga0496115_0001613 3300048918 Bacteria 16216
1852 Ga0496115_0003347 3300048918 Bacteria 11499
1853 Ga0496115_0009727 3300048918 Bacteria 7160
1854 Ga0496115_0014041 3300048918 Bacteria 6063
1855 Ga0496115_0017925 3300048918 Bacteria 5424
1856 Ga0496115_0034663 3300048918 Bacteria 3989
1857 Ga0496115_0044070 3300048918 Bacteria 3557
1858 Ga0496115_0050314 3300048918 Bacteria 3338
1859 Ga0496115_0063009 3300048918 Bacteria 2991
1860 Ga0496115_0064821 3300048918 Bacteria 2950
1861 Ga0496115_0068425 3300048918 Bacteria 2875
1862 Ga0496115_0116851 3300048918 Bacteria 2194
1863 Ga0496115_0128351 3300048918 Bacteria 2089
1864 Ga0496115_0141855 3300048918 Bacteria 1982
1865 Ga0496115_0195810 3300048918 Bacteria 1670
1866 Ga0496115_0257804 3300048918 Bacteria 1434
1867 Ga0496115_0259935 3300048918 Bacteria 1428
1868 Ga0496116_0003976 3300048919 Bacteria 14349
1869 Ga0496116_0012271 3300048919 Bacteria 7006
1870 Ga0496116_0012404 3300048919 Bacteria 6966
1871 Ga0496116_0137234 3300048919 Bacteria 1382
1872 Ga0496117_0000002 3300048920 Bacteria 2483758
1873 Ga0496117_0025429 3300048920 Bacteria 4655
1874 Ga0496117_0028829 3300048920 Bacteria 4291
1875 Ga0496117_0093970 3300048920 Bacteria 1921
1876 Ga0496117_0141310 3300048920 Bacteria 1441
1877 Ga0496118_0002959 3300048921 Bacteria 22001
1878 Ga0496118_0008020 3300048921 Bacteria 11029
1879 Ga0496118_0024457 3300048921 Bacteria 5209
1880 Ga0496118_0033608 3300048921 Bacteria 4205
1881 Ga0496118_0122025 3300048921 Bacteria 1696
1882 Ga0496118_0128567 3300048921 Bacteria 1632
1883 Ga0496119_0001157 3300048922 Bacteria 33058
1884 Ga0496119_0002688 3300048922 Bacteria 19208
1885 Ga0496119_0010578 3300048922 Bacteria 7742
1886 Ga0496119_0074669 3300048922 Bacteria 1973
1887 Ga0496120_0002040 3300048923 Bacteria 21866
1888 Ga0496120_0007537 3300048923 Bacteria 8077
1889 Ga0496120_0077221 3300048923 Bacteria 1813
1890 Ga0496121_0000001 3300048924 Bacteria 1830318
1891 Ga0496121_0000252 3300048924 Bacteria 113870
1892 Ga0496121_0000786 3300048924 Bacteria 57998
1893 Ga0496121_0000865 3300048924 Bacteria 54663
1894 Ga0496121_0001159 3300048924 Bacteria 46235
1895 Ga0496121_0005806 3300048924 Bacteria 15649
1896 Ga0496121_0030552 3300048924 Bacteria 4945
1897 Ga0496121_0045261 3300048924 Bacteria 3783
1898 Ga0496121_0071616 3300048924 Bacteria 2787
1899 Ga0496121_0088411 3300048924 Bacteria 2429
1900 Ga0496121_0094774 3300048924 Bacteria 2321
1901 Ga0496121_0168226 3300048924 Bacteria 1595
1902 Ga0496121_0209406 3300048924 Bacteria 1382
1903 Ga0496121_0285294 3300048924 Bacteria 1127
1904 Ga0496122_0000001 3300048925 Bacteria 1827766
1905 Ga0496122_0008471 3300048925 Bacteria 11086
1906 Ga0496122_0014922 3300048925 Bacteria 7477
1907 Ga0496122_0023911 3300048925 Bacteria 5365
1908 Ga0496122_0027746 3300048925 Bacteria 4829
1909 Ga0496122_0053512 3300048925 Bacteria 3042
1910 Ga0496122_0054114 3300048925 Bacteria 3017
1911 Ga0496122_0085537 3300048925 Bacteria 2175
1912 Ga0496123_0000001 3300048926 Bacteria 1831497
1913 Ga0496123_0019128 3300048926 Bacteria 5407
1914 Ga0496123_0034754 3300048926 Bacteria 3604
1915 Ga0496123_0050827 3300048926 Bacteria 2766
1916 Ga0496123_0052848 3300048926 Bacteria 2690
1917 Ga0496123_0096283 3300048926 Bacteria 1738
1918 Ga0496124_0000855 3300048927 Bacteria 49698
1919 Ga0496124_0006759 3300048927 Bacteria 12398
1920 Ga0496124_0009881 3300048927 Bacteria 9758
1921 Ga0496124_0009914 3300048927 Bacteria 9736
1922 Ga0496124_0044547 3300048927 Bacteria 3806
1923 Ga0496124_0058676 3300048927 Bacteria 3235
1924 Ga0496124_0146766 3300048927 Bacteria 1855
1925 Ga0496124_0189959 3300048927 Bacteria 1573
1926 Ga0496124_0282791 3300048927 Bacteria 1208
1927 Ga0496125_0000001 3300048928 Bacteria 1766138
1928 Ga0496125_0000136 3300048928 Bacteria 160544
1929 Ga0496125_0000843 3300048928 Bacteria 49244
1930 Ga0496125_0001550 3300048928 Bacteria 32806
1931 Ga0496125_0010293 3300048928 Bacteria 9471
1932 Ga0496125_0024228 3300048928 Bacteria 5584
1933 Ga0496125_0027428 3300048928 Bacteria 5161
1934 Ga0496125_0031112 3300048928 Bacteria 4763
1935 Ga0496125_0125602 3300048928 Bacteria 1819
1936 Ga0496125_0126406 3300048928 Bacteria 1811
1937 Ga0496125_0136349 3300048928 Bacteria 1716
1938 Ga0496126_0000727 3300048929 Bacteria 59803
1939 Ga0496126_0001398 3300048929 Bacteria 38223
1940 Ga0496126_0003797 3300048929 Bacteria 18757
1941 Ga0496126_0008016 3300048929 Bacteria 11461
1942 Ga0496126_0013404 3300048929 Bacteria 8340
1943 Ga0496126_0017297 3300048929 Bacteria 7184
1944 Ga0496126_0018058 3300048929 Bacteria 7007
1945 Ga0496126_0025336 3300048929 Bacteria 5707
1946 Ga0496126_0028295 3300048929 Bacteria 5342
1947 Ga0496126_0037453 3300048929 Bacteria 4526
1948 Ga0496126_0055651 3300048929 Bacteria 3578
1949 Ga0496126_0121758 3300048929 Bacteria 2262
1950 Ga0496126_0190310 3300048929 Bacteria 1738
1951 Ga0496126_0231379 3300048929 Bacteria 1548
1952 Ga0496126_0249812 3300048929 Bacteria 1478
1953 Ga0495682_0003930 3300049460 Bacteria 6488
1954 Ga0501031_0004421 3300049568 Bacteria 9112
1955 Ga0501031_0066690 3300049568 Bacteria 2345
1956 Ga0501031_0114326 3300049568 Bacteria 1763
1957 Ga0501031_0191930 3300049568 Bacteria 1334
1958 Ga0501032_0002203 3300049569 Bacteria 15332
1959 Ga0501032_0004526 3300049569 Bacteria 10458
1960 Ga0501032_0006853 3300049569 Bacteria 8354
1961 Ga0501032_0008507 3300049569 Bacteria 7481
1962 Ga0501032_0014322 3300049569 Bacteria 5617
1963 Ga0501032_0030568 3300049569 Bacteria 3696
1964 Ga0501032_0053915 3300049569 Bacteria 2707
1965 Ga0501032_0058193 3300049569 Bacteria 2595
1966 Ga0501032_0286722 3300049569 Bacteria 1065
1967 Ga0501033_0000205 3300049570 Bacteria 56697
1968 Ga0501033_0015545 3300049570 Bacteria 5771
1969 Ga0501033_0017696 3300049570 Bacteria 5382
1970 Ga0501033_0024739 3300049570 Bacteria 4528
1971 Ga0501033_0040012 3300049570 Bacteria 3500
1972 Ga0501033_0047426 3300049570 Bacteria 3194
1973 Ga0501033_0059229 3300049570 Bacteria 2828
1974 Ga0501033_0070531 3300049570 Bacteria 2567
1975 Ga0501033_0073624 3300049570 Bacteria 2508
1976 Ga0501033_0098408 3300049570 Bacteria 2136
1977 Ga0501033_0099008 3300049570 Bacteria 2129
1978 Ga0501033_0099886 3300049570 Bacteria 2118
1979 Ga0501033_0190616 3300049570 Bacteria 1467
1980 Ga0501033_0196654 3300049570 Bacteria 1441
1981 Ga0501033_0314467 3300049570 Bacteria 1101
1982 Ga0501034_0000135 3300049571 Bacteria 137151
1983 Ga0501034_0004302 3300049571 Bacteria 15868
1984 Ga0501034_0008173 3300049571 Bacteria 11094
1985 Ga0501034_0012600 3300049571 Bacteria 8728
1986 Ga0501034_0022336 3300049571 Bacteria 6448
1987 Ga0501034_0044925 3300049571 Bacteria 4465
1988 Ga0501034_0048228 3300049571 Bacteria 4299
1989 Ga0501034_0073946 3300049571 Bacteria 3416
1990 Ga0501034_0148424 3300049571 Bacteria 2321
1991 Ga0501034_0208446 3300049571 Bacteria 1910
1992 Ga0501034_0209260 3300049571 Bacteria 1906
1993 Ga0501034_0230433 3300049571 Bacteria 1801
1994 Ga0501034_0332139 3300049571 Bacteria 1451
1995 Ga0501034_0429484 3300049571 Bacteria 1241
1996 Ga0501036_0004899 3300049572 Bacteria 10816
1997 Ga0501036_0020521 3300049572 Bacteria 5549
1998 Ga0501036_0022546 3300049572 Bacteria 5297
1999 Ga0501036_0023920 3300049572 Bacteria 5149
2000 Ga0501036_0041698 3300049572 Bacteria 3884
2001 Ga0501036_0062427 3300049572 Bacteria 3156
2002 Ga0501036_0095668 3300049572 Bacteria 2511
2003 Ga0501036_0108701 3300049572 Bacteria 2344
2004 Ga0501036_0150919 3300049572 Bacteria 1960
2005 Ga0501036_0327622 3300049572 Bacteria 1279
2006 Ga0501036_0349105 3300049572 Bacteria 1235
2007 Ga0501037_0001134 3300049573 Bacteria 19732
2008 Ga0501037_0001178 3300049573 Bacteria 19304
2009 Ga0501037_0001959 3300049573 Bacteria 14873
2010 Ga0501037_0002456 3300049573 Bacteria 13398
2011 Ga0501037_0017053 3300049573 Bacteria 5343
2012 Ga0501037_0032784 3300049573 Bacteria 3837
2013 Ga0501037_0038192 3300049573 Bacteria 3539
2014 Ga0501037_0051986 3300049573 Bacteria 2996
2015 Ga0501037_0106061 3300049573 Bacteria 2025
2016 Ga0501038_0014768 3300049574 Bacteria 7115
2017 Ga0501038_0017952 3300049574 Bacteria 6391
2018 Ga0501038_0037016 3300049574 Bacteria 4281
2019 Ga0501038_0043898 3300049574 Bacteria 3886
2020 Ga0501038_0053379 3300049574 Bacteria 3480
2021 Ga0501038_0068316 3300049574 Bacteria 3021
2022 Ga0501038_0103949 3300049574 Bacteria 2361
2023 Ga0501038_0114891 3300049574 Bacteria 2226
2024 Ga0501038_0120012 3300049574 Bacteria 2169
2025 Ga0501038_0164561 3300049574 Bacteria 1800
2026 Ga0501038_0165184 3300049574 Bacteria 1796
2027 Ga0501038_0176711 3300049574 Bacteria 1725
2028 Ga0501038_0181319 3300049574 Bacteria 1699
2029 Ga0501038_0189203 3300049574 Bacteria 1657
2030 Ga0501038_0210793 3300049574 Bacteria 1554
2031 Ga0501038_0349196 3300049574 Bacteria 1152
2032 Ga0501039_0000180 3300049575 Bacteria 45008
2033 Ga0501039_0011110 3300049575 Bacteria 6863
2034 Ga0501039_0011643 3300049575 Bacteria 6698
2035 Ga0501039_0014539 3300049575 Bacteria 6027
2036 Ga0501039_0065078 3300049575 Bacteria 2827
2037 Ga0501039_0069316 3300049575 Bacteria 2739
2038 Ga0501039_0104695 3300049575 Bacteria 2209
2039 Ga0501039_0116888 3300049575 Bacteria 2088
2040 Ga0501039_0138145 3300049575 Bacteria 1914
2041 Ga0501039_0203883 3300049575 Bacteria 1555
2042 Ga0501040_0003010 3300049576 Bacteria 10914
2043 Ga0501040_0017186 3300049576 Bacteria 4801
2044 Ga0501040_0073004 3300049576 Bacteria 2370
2045 Ga0501040_0173452 3300049576 Bacteria 1527
2046 Ga0501041_0022145 3300049577 Bacteria 3805
2047 Ga0501041_0053803 3300049577 Bacteria 2455
2048 Ga0501041_0075061 3300049577 Bacteria 2078
2049 Ga0501041_0103916 3300049577 Bacteria 1760
2050 Ga0501041_0141054 3300049577 Bacteria 1503
2051 Ga0501041_0142635 3300049577 Bacteria 1494
2052 Ga0501042_0033845 3300049578 Bacteria 3623
2053 Ga0501042_0039915 3300049578 Bacteria 3337
2054 Ga0501042_0041282 3300049578 Bacteria 3280
2055 Ga0501042_0077277 3300049578 Bacteria 2383
2056 Ga0501042_0105655 3300049578 Bacteria 2026
2057 Ga0501042_0249289 3300049578 Bacteria 1281
2058 Ga0501043_0003235 3300049579 Bacteria 13452
2059 Ga0501043_0010671 3300049579 Bacteria 7196
2060 Ga0501043_0011820 3300049579 Bacteria 6840
2061 Ga0501043_0013802 3300049579 Bacteria 6322
2062 Ga0501043_0020838 3300049579 Bacteria 5142
2063 Ga0501043_0026335 3300049579 Bacteria 4563
2064 Ga0501043_0050934 3300049579 Bacteria 3255
2065 Ga0501043_0053629 3300049579 Bacteria 3166
2066 Ga0501043_0061058 3300049579 Bacteria 2960
2067 Ga0501043_0083582 3300049579 Bacteria 2510
2068 Ga0501043_0138179 3300049579 Bacteria 1909
2069 Ga0501043_0154178 3300049579 Bacteria 1797
2070 Ga0501046_0000108 3300049580 Bacteria 87513
2071 Ga0501046_0000567 3300049580 Bacteria 36589
2072 Ga0501046_0003852 3300049580 Bacteria 13729
2073 Ga0501046_0005064 3300049580 Bacteria 11815
2074 Ga0501046_0007903 3300049580 Bacteria 9314
2075 Ga0501046_0013669 3300049580 Bacteria 6864
2076 Ga0501046_0019851 3300049580 Bacteria 5565
2077 Ga0501046_0042752 3300049580 Bacteria 3612
2078 Ga0501046_0072574 3300049580 Bacteria 2672
2079 Ga0501046_0077687 3300049580 Bacteria 2569
2080 Ga0501046_0092391 3300049580 Bacteria 2327
2081 Ga0501046_0138726 3300049580 Bacteria 1841
2082 Ga0501046_0164987 3300049580 Bacteria 1664
2083 Ga0501046_0207401 3300049580 Bacteria 1456
2084 Ga0501047_0000435 3300049581 Bacteria 46511
2085 Ga0501047_0001266 3300049581 Bacteria 24998
2086 Ga0501047_0010001 3300049581 Bacteria 8967
2087 Ga0501047_0010604 3300049581 Bacteria 8714
2088 Ga0501047_0010641 3300049581 Bacteria 8696
2089 Ga0501047_0010813 3300049581 Bacteria 8626
2090 Ga0501047_0023738 3300049581 Bacteria 5887
2091 Ga0501047_0026727 3300049581 Bacteria 5555
2092 Ga0501047_0038225 3300049581 Bacteria 4643
2093 Ga0501047_0050328 3300049581 Bacteria 4023
2094 Ga0501047_0075535 3300049581 Bacteria 3243
2095 Ga0501047_0088087 3300049581 Bacteria 2981
2096 Ga0501047_0103297 3300049581 Bacteria 2730
2097 Ga0501047_0144065 3300049581 Bacteria 2260
2098 Ga0501047_0251854 3300049581 Bacteria 1614
2099 Ga0501047_0376282 3300049581 Bacteria 1255
2100 Ga0501048_0000636 3300049582 Bacteria 25113
2101 Ga0501048_0019176 3300049582 Bacteria 5021
2102 Ga0501048_0029167 3300049582 Bacteria 4003
2103 Ga0501048_0040017 3300049582 Bacteria 3360
2104 Ga0501048_0047702 3300049582 Bacteria 3056
2105 Ga0501048_0051198 3300049582 Bacteria 2940
2106 Ga0501067_0000085 3300049583 Bacteria 54351
2107 Ga0501067_0000586 3300049583 Bacteria 19606
2108 Ga0501067_0001059 3300049583 Bacteria 14809
2109 Ga0501067_0002179 3300049583 Bacteria 10803
2110 Ga0501067_0005441 3300049583 Bacteria 7071
2111 Ga0501067_0005948 3300049583 Bacteria 6763
2112 Ga0501067_0014319 3300049583 Bacteria 4389
2113 Ga0501067_0025458 3300049583 Bacteria 3280
2114 Ga0501067_0036571 3300049583 Bacteria 2726
2115 Ga0501068_0005767 3300049584 Bacteria 6790
2116 Ga0501068_0006643 3300049584 Bacteria 6386
2117 Ga0501068_0007119 3300049584 Bacteria 6190
2118 Ga0501068_0033384 3300049584 Bacteria 3065
2119 Ga0501068_0102413 3300049584 Bacteria 1775
2120 Ga0501068_0197790 3300049584 Bacteria 1274
2121 Ga0501068_0207461 3300049584 Bacteria 1244
2122 Ga0501068_0214138 3300049584 Bacteria 1224
2123 Ga0501069_0000191 3300049585 Bacteria 27095
2124 Ga0501069_0018188 3300049585 Bacteria 3791
2125 Ga0501069_0024563 3300049585 Bacteria 3288
2126 Ga0501069_0029058 3300049585 Bacteria 3033
2127 Ga0501069_0039452 3300049585 Bacteria 2609
2128 Ga0501070_0000025 3300049586 Bacteria 152175
2129 Ga0501070_0002064 3300049586 Bacteria 17651
2130 Ga0501070_0007834 3300049586 Bacteria 9054
2131 Ga0501070_0014812 3300049586 Bacteria 6561
2132 Ga0501070_0038511 3300049586 Bacteria 3989
2133 Ga0501070_0084568 3300049586 Bacteria 2626
2134 Ga0501070_0106087 3300049586 Bacteria 2322
2135 Ga0501070_0133145 3300049586 Bacteria 2053
2136 Ga0501070_0137187 3300049586 Bacteria 2020
2137 Ga0501070_0181720 3300049586 Bacteria 1731
2138 Ga0501070_0189400 3300049586 Bacteria 1691
2139 Ga0501070_0197684 3300049586 Bacteria 1651
2140 Ga0501071_0026868 3300049587 Bacteria 4044
2141 Ga0501071_0040412 3300049587 Bacteria 3337
2142 Ga0501071_0046710 3300049587 Bacteria 3110
2143 Ga0501071_0067680 3300049587 Bacteria 2598
2144 Ga0501071_0165962 3300049587 Bacteria 1652
2145 Ga0501071_0396737 3300049587 Bacteria 1053
2146 Ga0501072_0002100 3300049588 Bacteria 14838
2147 Ga0501072_0015886 3300049588 Bacteria 5771
2148 Ga0501072_0032562 3300049588 Bacteria 4083
2149 Ga0501072_0044425 3300049588 Bacteria 3494
2150 Ga0501072_0057518 3300049588 Bacteria 3064
2151 Ga0501072_0103105 3300049588 Bacteria 2267
2152 Ga0501072_0478819 3300049588 Bacteria 985
2153 Ga0501073_0000007 3300049589 Bacteria 227229
2154 Ga0501073_0000400 3300049589 Bacteria 29556
2155 Ga0501073_0001773 3300049589 Bacteria 16050
2156 Ga0501073_0008414 3300049589 Bacteria 7652
2157 Ga0501073_0017650 3300049589 Bacteria 5165
2158 Ga0501073_0020091 3300049589 Bacteria 4816
2159 Ga0501073_0030093 3300049589 Bacteria 3878
2160 Ga0501073_0038609 3300049589 Bacteria 3385
2161 Ga0501073_0069052 3300049589 Bacteria 2463
2162 Ga0501073_0102649 3300049589 Bacteria 1986
2163 Ga0501073_0106199 3300049589 Bacteria 1949
2164 Ga0501073_0119501 3300049589 Bacteria 1826
2165 Ga0501073_0151101 3300049589 Bacteria 1609
2166 Ga0501074_0001440 3300049590 Bacteria 15915
2167 Ga0501074_0018091 3300049590 Bacteria 5119
2168 Ga0501074_0027512 3300049590 Bacteria 4123
2169 Ga0501074_0030344 3300049590 Bacteria 3917
2170 Ga0501074_0046941 3300049590 Bacteria 3122
2171 Ga0501074_0232036 3300049590 Bacteria 1314
2172 Ga0501074_0271336 3300049590 Bacteria 1206
2173 Ga0501074_0351877 3300049590 Bacteria 1045
2174 Ga0501075_0020700 3300049591 Bacteria 4787
2175 Ga0501075_0042646 3300049591 Bacteria 3402
2176 Ga0501075_0053326 3300049591 Bacteria 3041
2177 Ga0501075_0058984 3300049591 Bacteria 2890
2178 Ga0501075_0063802 3300049591 Bacteria 2778
2179 Ga0501075_0106403 3300049591 Bacteria 2132
2180 Ga0501075_0144709 3300049591 Bacteria 1812
2181 Ga0501076_0001445 3300049592 Bacteria 15968
2182 Ga0501076_0004665 3300049592 Bacteria 9773
2183 Ga0501076_0007516 3300049592 Bacteria 7931
2184 Ga0501076_0007581 3300049592 Bacteria 7901
2185 Ga0501076_0011267 3300049592 Bacteria 6656
2186 Ga0501076_0012567 3300049592 Bacteria 6334
2187 Ga0501076_0044131 3300049592 Bacteria 3515
2188 Ga0501076_0060163 3300049592 Bacteria 3021
2189 Ga0501076_0073472 3300049592 Bacteria 2738
2190 Ga0501076_0143471 3300049592 Bacteria 1941
2191 Ga0501076_0157297 3300049592 Bacteria 1851
2192 Ga0501076_0275687 3300049592 Bacteria 1377
2193 Ga0501077_0000003 3300049593 Bacteria 143061
2194 Ga0501077_0006350 3300049593 Bacteria 7243
2195 Ga0501077_0006723 3300049593 Bacteria 7076
2196 Ga0501077_0006812 3300049593 Bacteria 7030
2197 Ga0501077_0014733 3300049593 Bacteria 4912
2198 Ga0501077_0021865 3300049593 Bacteria 4050
2199 Ga0501077_0025027 3300049593 Bacteria 3791
2200 Ga0501077_0045897 3300049593 Bacteria 2776
2201 Ga0501077_0079088 3300049593 Bacteria 2083
2202 Ga0501077_0247531 3300049593 Bacteria 1133
2203 Ga0501079_0006332 3300049741 Bacteria 8882
2204 Ga0501079_0010340 3300049741 Bacteria 7090
2205 Ga0501079_0012587 3300049741 Bacteria 6461
2206 Ga0501079_0017908 3300049741 Bacteria 5410
2207 Ga0501079_0038747 3300049741 Bacteria 3675
2208 Ga0501079_0061751 3300049741 Bacteria 2890
2209 Ga0501079_0101202 3300049741 Bacteria 2234
2210 Ga0501079_0176188 3300049741 Bacteria 1668
2211 Ga0501079_0185611 3300049741 Bacteria 1623
2212 Ga0501079_0303815 3300049741 Bacteria 1248
2213 Ga0501079_0366496 3300049741 Bacteria 1129
2214 Ga0501080_0000298 3300049742 Bacteria 37784
2215 Ga0501080_0004728 3300049742 Bacteria 12137
2216 Ga0501080_0005029 3300049742 Bacteria 11781
2217 Ga0501080_0005719 3300049742 Bacteria 11123
2218 Ga0501080_0028987 3300049742 Bacteria 5153
2219 Ga0501080_0038601 3300049742 Bacteria 4458
2220 Ga0501080_0084923 3300049742 Bacteria 2941
2221 Ga0501080_0089960 3300049742 Bacteria 2852
2222 Ga0501080_0103716 3300049742 Bacteria 2637
2223 Ga0501080_0124005 3300049742 Bacteria 2393
2224 Ga0501080_0205982 3300049742 Bacteria 1804
2225 Ga0501080_0236172 3300049742 Bacteria 1670
2226 Ga0501080_0292340 3300049742 Bacteria 1479
2227 Ga0501081_0012020 3300049743 Bacteria 5675
2228 Ga0501081_0022529 3300049743 Bacteria 4216
2229 Ga0501081_0039566 3300049743 Bacteria 3227
2230 Ga0501081_0081858 3300049743 Bacteria 2261
2231 Ga0501081_0084688 3300049743 Bacteria 2224
2232 Ga0501081_0091541 3300049743 Bacteria 2139
2233 Ga0501081_0120659 3300049743 Bacteria 1867
2234 Ga0501081_0129472 3300049743 Bacteria 1802
2235 Ga0501081_0129475 3300049743 Bacteria 1802
2236 Ga0501081_0165825 3300049743 Bacteria 1593
2237 Ga0501083_0001498 3300049744 Bacteria 15946
2238 Ga0501083_0010620 3300049744 Bacteria 6483
2239 Ga0501083_0011721 3300049744 Bacteria 6147
2240 Ga0501083_0014657 3300049744 Bacteria 5481
2241 Ga0501083_0039214 3300049744 Bacteria 3217
2242 Ga0501083_0048703 3300049744 Bacteria 2860
2243 Ga0501083_0227939 3300049744 Bacteria 1213
2244 Ga0501035_0000056 3300049822 Bacteria 137385
2245 Ga0501035_0001043 3300049822 Bacteria 28994
2246 Ga0501035_0074363 3300049822 Bacteria 3006
2247 Ga0501035_0089143 3300049822 Bacteria 2717
2248 Ga0501035_0092990 3300049822 Bacteria 2653
2249 Ga0501035_0133604 3300049822 Bacteria 2162
2250 Ga0501035_0165304 3300049822 Bacteria 1914
2251 Ga0501035_0183527 3300049822 Bacteria 1801
2252 Ga0501035_0207146 3300049822 Bacteria 1679
2253 Ga0501044_0000536 3300049823 Bacteria 46054
2254 Ga0501044_0001925 3300049823 Bacteria 24030
2255 Ga0501044_0002692 3300049823 Bacteria 20204
2256 Ga0501044_0005118 3300049823 Bacteria 14626
2257 Ga0501044_0008454 3300049823 Bacteria 11275
2258 Ga0501044_0012561 3300049823 Bacteria 9172
2259 Ga0501044_0012621 3300049823 Bacteria 9148
2260 Ga0501044_0022552 3300049823 Bacteria 6708
2261 Ga0501044_0030305 3300049823 Bacteria 5704
2262 Ga0501044_0034886 3300049823 Bacteria 5271
2263 Ga0501044_0055013 3300049823 Bacteria 4088
2264 Ga0501044_0059132 3300049823 Bacteria 3928
2265 Ga0501044_0071131 3300049823 Bacteria 3538
2266 Ga0501044_0082739 3300049823 Bacteria 3247
2267 Ga0501044_0082798 3300049823 Bacteria 3245
2268 Ga0501044_0099653 3300049823 Bacteria 2924
2269 Ga0501044_0136876 3300049823 Bacteria 2440
2270 Ga0501044_0144685 3300049823 Bacteria 2364
2271 Ga0501044_0167561 3300049823 Bacteria 2170
2272 Ga0501044_0195341 3300049823 Bacteria 1984
2273 Ga0501044_0197105 3300049823 Bacteria 1973
2274 Ga0501044_0333203 3300049823 Bacteria 1440
2275 Ga0501044_0345544 3300049823 Bacteria 1408
2276 Ga0501044_0441868 3300049823 Bacteria 1208
2277 Ga0501045_0005886 3300049824 Bacteria 8484
2278 Ga0501045_0011602 3300049824 Bacteria 6190
2279 Ga0501045_0013859 3300049824 Bacteria 5702
2280 Ga0501045_0014128 3300049824 Bacteria 5656
2281 Ga0501045_0018315 3300049824 Bacteria 4980
2282 Ga0501045_0018687 3300049824 Bacteria 4935
2283 Ga0501045_0041862 3300049824 Bacteria 3333
2284 Ga0501045_0043592 3300049824 Bacteria 3267
2285 Ga0501045_0047700 3300049824 Bacteria 3121
2286 Ga0501045_0060086 3300049824 Bacteria 2786
2287 Ga0501045_0135685 3300049824 Bacteria 1829
2288 Ga0501045_0250386 3300049824 Bacteria 1319
2289 nmdc:mga03683_10305_c1 3300050489 Bacteria 3351
2290 nmdc:mga03683_34840_c1 3300050489 Bacteria 2039
2291 nmdc:mga03683_3506_c1 3300050489 Bacteria 5077
2292 nmdc:mga03683_6861_c1 3300050489 Bacteria 3922
2293 nmdc:mga03683_97317_c1 3300050489 Bacteria 1290
2294 nmdc:mga03n38_40529_c2 3300050490 Bacteria 1689
2295 nmdc:mga03n38_46530_c1 3300050490 Bacteria 1916
2296 nmdc:mga03n38_46970_c1 3300050490 Bacteria 1909
2297 nmdc:mga03n38_52645_c1 3300050490 Bacteria 1823
2298 nmdc:mga03n38_59834_c1 3300050490 Bacteria 1730
2299 nmdc:mga00v17_102_c1 3300050491 Bacteria 50732
2300 nmdc:mga00v17_126411_c1 3300050491 Bacteria 1631
2301 nmdc:mga00v17_14506_c1 3300050491 Bacteria 4400
2302 nmdc:mga00v17_149998_c1 3300050491 Bacteria 1498
2303 nmdc:mga00v17_22034_c1 3300050491 Bacteria 3672
2304 nmdc:mga0yw44_167449_c1 3300050492 Bacteria 1442
2305 nmdc:mga0yw44_201398_c1 3300050492 Bacteria 1315
2306 nmdc:mga0yw44_20997_c1 3300050492 Bacteria 3636
2307 nmdc:mga0yw44_31592_c1 3300050492 Bacteria 3080
2308 nmdc:mga0yw44_41683_c1 3300050492 Bacteria 2734
2309 nmdc:mga0yw44_55610_c1 3300050492 Bacteria 2408
2310 nmdc:mga0yw44_7061_c1 3300050492 Bacteria 5497
2311 nmdc:mga0k408_15860_c1 3300050493 Bacteria 4171
2312 nmdc:mga0k408_38736_c1 3300050493 Bacteria 2737
2313 nmdc:mga06z11_13229_c1 3300050494 Bacteria 3616
2314 nmdc:mga06z11_31876_c1 3300050494 Bacteria 2566
2315 nmdc:mga06z11_40988_c1 3300050494 Bacteria 2315
2316 nmdc:mga06z11_4172_c1 3300050494 Bacteria 5654
2317 nmdc:mga04h51_2504_c1 3300050495 Bacteria 4369
2318 nmdc:mga04h51_298_c1 3300050495 Bacteria 12697
2319 nmdc:mga04h51_50119_c1 3300050495 Bacteria 1398
2320 nmdc:mga04h51_6296_c1 3300050495 Bacteria 3070
2321 nmdc:mga07m45_1693_c2 3300050496 Bacteria 8663
2322 nmdc:mga07m45_48010_c1 3300050496 Bacteria 2400
2323 nmdc:mga05p37_106683_c1 3300050507 Bacteria 3446
2324 nmdc:mga05p37_328770_c1 3300050507 Bacteria 1806
2325 nmdc:mga05p37_44657_c1 3300050507 Bacteria 5452
2326 nmdc:mga05p37_458464_c1 3300050507 Bacteria 1474
2327 nmdc:mga05p37_79342_c1 3300050507 Bacteria 4042
2328 nmdc:mga09592_109914_c1 3300050508 Bacteria 2365
2329 nmdc:mga09592_13465_c1 3300050508 Bacteria 6677
2330 nmdc:mga09592_42316_c1 3300050508 Bacteria 3831
2331 nmdc:mga09592_63019_c1 3300050508 Bacteria 3137
2332 nmdc:mga0qj67_114776_c1 3300050509 Bacteria 2175
2333 nmdc:mga0qj67_73354_c1 3300050509 Bacteria 2733
2334 nmdc:mga0qj67_91582_c1 3300050509 Bacteria 2444
2335 nmdc:mga06r32_163360_c1 3300050510 Bacteria 2210
2336 nmdc:mga06r32_21058_c1 3300050510 Bacteria 6015
2337 nmdc:mga06r32_29665_c1 3300050510 Bacteria 5129
2338 nmdc:mga06r32_3187_c1 3300050510 Bacteria 14693
2339 nmdc:mga06r32_3592_c1 3300050510 Bacteria 13840
2340 nmdc:mga06r32_403952_c1 3300050510 Bacteria 1348
2341 nmdc:mga06r32_64174_c1 3300050510 Bacteria 3541
2342 nmdc:mga08y16_110704_c1 3300050511 Bacteria 2860
2343 nmdc:mga08y16_124332_c1 3300050511 Bacteria 2684
2344 nmdc:mga08y16_127409_c1 3300050511 Bacteria 2648
2345 nmdc:mga08y16_186802_c1 3300050511 Bacteria 2150
2346 nmdc:mga08y16_279_c1 3300050511 Bacteria 46569
2347 nmdc:mga08y16_38_c1 3300050511 Bacteria 135093
2348 nmdc:mga08y16_437739_c1 3300050511 Bacteria 1335
2349 nmdc:mga08y16_88372_c1 3300050511 Bacteria 3230
2350 nmdc:mga0n895_126423_c1 3300050512 Bacteria 2580
2351 nmdc:mga0n895_171433_c1 3300050512 Bacteria 2202
2352 nmdc:mga0n895_395808_c1 3300050512 Bacteria 1397
2353 nmdc:mga0n895_82729_c1 3300050512 Bacteria 3200
2354 nmdc:mga0rr50_12405_c1 3300050513 Bacteria 5508
2355 nmdc:mga0rr50_20041_c1 3300050513 Bacteria 4531
2356 nmdc:mga0rr50_44120_c1 3300050513 Bacteria 3268
2357 nmdc:mga0rr50_62815_c1 3300050513 Bacteria 2803
2358 nmdc:mga08x19_13933_c1 3300050514 Bacteria 4870
2359 nmdc:mga08x19_166604_c1 3300050514 Bacteria 1499
2360 nmdc:mga08x19_186422_c1 3300050514 Bacteria 1418
2361 nmdc:mga08x19_18_c1 3300050514 Bacteria 321445
2362 nmdc:mga08x19_41_c1 3300050514 Bacteria 151756
2363 nmdc:mga0a205_14215_c1 3300050515 Bacteria 7424
2364 nmdc:mga0a205_19730_c1 3300050515 Bacteria 6361
2365 nmdc:mga0a205_301583_c1 3300050515 Bacteria 1475
2366 nmdc:mga0sz30_113_c1 3300050516 Bacteria 30611
2367 nmdc:mga0sz30_16001_c1 3300050516 Bacteria 2970
2368 nmdc:mga0sz30_18637_c1 3300050516 Bacteria 2780
2369 nmdc:mga0sz30_223_c1 3300050516 Bacteria 21634
2370 nmdc:mga0sz30_22710_c1 3300050516 Bacteria 2548
2371 nmdc:mga0sz30_2619_c1 3300050516 Bacteria 6408
2372 Ga0495601_0000021 3300053077 Bacteria 159355
2373 Ga0495601_0000744 3300053077 Bacteria 17523
2374 Ga0495601_0004544 3300053077 Bacteria 8018
2375 Ga0495601_0133706 3300053077 Bacteria 1616
2376 Ga0495612_0000018 3300053078 Bacteria 150870
2377 Ga0495612_0019274 3300053078 Bacteria 2733
2378 Ga0495595_0000042 3300053084 Bacteria 67264
2379 Ga0495595_0000924 3300053084 Bacteria 11325
2380 Ga0495595_0032580 3300053084 Bacteria 2348
2381 Ga0495595_0041446 3300053084 Bacteria 2107
2382 Ga0495595_0103699 3300053084 Bacteria 1374
2383 Ga0495619_0000006 3300053085 Bacteria 384835
2384 Ga0495619_0000761 3300053085 Bacteria 21031
2385 Ga0495619_0004224 3300053085 Bacteria 9164
2386 Ga0495619_0012457 3300053085 Bacteria 5356
2387 Ga0495619_0183492 3300053085 Bacteria 1448
2388 Ga0495619_0359005 3300053085 Bacteria 1008
2389 Ga0500578_0000015 3300053086 Bacteria 179217
2390 Ga0500578_0047705 3300053086 Bacteria 2748
2391 Ga0500643_000026 3300053087 Bacteria 259231
2392 Ga0500643_001939 3300053087 Bacteria 11215
2393 Ga0500643_008459 3300053087 Bacteria 4041
2394 Ga0500643_014907 3300053087 Bacteria 2683
2395 Ga0500644_0000124 3300053088 Bacteria 47262
2396 Ga0500647_0097732 3300053091 Bacteria 1403
2397 Ga0500647_0175730 3300053091 Bacteria 986
2398 Ga0500583_0105967 3300053092 Bacteria 1381
2399 Ga0500651_0003552 3300053093 Bacteria 8535
2400 Ga0500651_0100268 3300053093 Bacteria 1775
2401 Ga0500566_0000054 3300053094 Bacteria 54975
2402 Ga0500566_0000055 3300053094 Bacteria 54414
2403 Ga0500566_0000670 3300053094 Bacteria 19205
2404 Ga0500566_0006619 3300053094 Bacteria 6862
2405 Ga0500640_024388 3300053095 Bacteria 2627
2406 Ga0500641_0001365 3300053096 Bacteria 8687
2407 Ga0500641_0037060 3300053096 Bacteria 1953
2408 Ga0500641_0092762 3300053096 Bacteria 1290
2409 Ga0500650_0022330 3300053098 Bacteria 2798
2410 Ga0500554_010329 3300053102 Bacteria 2271
2411 Ga0500555_007444 3300053103 Bacteria 3109
2412 Ga0500555_014936 3300053103 Bacteria 2239
2413 Ga0500556_0000006 3300053104 Bacteria 453982
2414 Ga0500556_0000054 3300053104 Bacteria 115949
2415 Ga0500556_0000309 3300053104 Bacteria 37060
2416 Ga0500556_0000933 3300053104 Bacteria 15845
2417 Ga0500569_007795 3300053109 Bacteria 2420
2418 Ga0500572_000348 3300053111 Bacteria 16528
2419 Ga0500592_008792 3300053116 Bacteria 1605
2420 Ga0500594_0000058 3300053118 Bacteria 34612
2421 Ga0500595_000345 3300053119 Bacteria 30235
2422 Ga0500595_000936 3300053119 Bacteria 16529
2423 Ga0500595_001957 3300053119 Bacteria 10591
2424 Ga0500595_005080 3300053119 Bacteria 5781
2425 Ga0500595_020103 3300053119 Bacteria 2410
2426 Ga0500595_029456 3300053119 Bacteria 1862
2427 Ga0500608_000011 3300053122 Bacteria 92215
2428 Ga0500618_000159 3300053125 Bacteria 56114
2429 Ga0500642_0000004 3300053130 Bacteria 433122
2430 Ga0500642_0002040 3300053130 Bacteria 5862
2431 Ga0500652_000980 3300053131 Bacteria 9397
2432 Ga0500658_0001176 3300053134 Bacteria 10657
2433 Ga0500658_0002698 3300053134 Bacteria 6826
2434 Ga0500658_0017375 3300053134 Bacteria 2686
2435 Ga0500658_0018494 3300053134 Bacteria 2613
2436 Ga0500559_0000009 3300053136 Bacteria 174153
2437 Ga0500559_0000305 3300053136 Bacteria 37260
2438 Ga0500559_0000362 3300053136 Bacteria 33750
2439 Ga0500559_0002905 3300053136 Bacteria 8628
2440 Ga0500559_0003529 3300053136 Bacteria 7661
2441 Ga0500561_0000491 3300053137 Bacteria 6418
2442 Ga0500564_001665 3300053138 Bacteria 7823
2443 Ga0500568_0004689 3300053139 Bacteria 7264
2444 Ga0500568_0006864 3300053139 Bacteria 5666
2445 Ga0500568_0020450 3300053139 Bacteria 2861
2446 Ga0500568_0025285 3300053139 Bacteria 2507
2447 Ga0500573_0000003 3300053140 Bacteria 355643
2448 Ga0500577_0001234 3300053142 Bacteria 6544
2449 Ga0500577_0001673 3300053142 Bacteria 5679
2450 Ga0500577_0004433 3300053142 Bacteria 3708
2451 Ga0500577_0114231 3300053142 Bacteria 1117
2452 Ga0500586_000279 3300053145 Bacteria 10288
2453 Ga0500588_0000351 3300053146 Bacteria 7053
2454 Ga0500590_011632 3300053148 Bacteria 4464
2455 Ga0500603_000444 3300053150 Bacteria 10687
2456 Ga0500604_0003442 3300053151 Bacteria 4263
2457 Ga0500616_0000022 3300053153 Bacteria 460463
2458 Ga0500616_0000038 3300053153 Bacteria 386801
2459 Ga0500616_0000712 3300053153 Bacteria 38496
2460 Ga0500616_0001964 3300053153 Bacteria 18305
2461 Ga0500616_0003749 3300053153 Bacteria 11329
2462 Ga0500616_0004603 3300053153 Bacteria 9745
2463 Ga0500616_0005399 3300053153 Bacteria 8678
2464 Ga0500616_0013996 3300053153 Bacteria 4626
2465 Ga0500616_0082748 3300053153 Bacteria 1609
2466 Ga0500616_0109240 3300053153 Bacteria 1338
2467 Ga0500622_0000346 3300053156 Bacteria 45265
2468 Ga0500622_0005433 3300053156 Bacteria 7658
2469 Ga0500622_0007558 3300053156 Bacteria 6159
2470 Ga0500622_0102617 3300053156 Bacteria 1406
2471 Ga0500624_000799 3300053157 Bacteria 7356
2472 Ga0500627_0012815 3300053158 Bacteria 3156
2473 Ga0500627_0123005 3300053158 Bacteria 1171
2474 Ga0500638_046784 3300053162 Bacteria 2096
2475 Ga0500636_0025475 3300053177 Bacteria 3495
2476 Ga0500637_0000053 3300053178 Bacteria 42767
2477 Ga0500637_0000221 3300053178 Bacteria 21184
2478 Ga0500637_0088563 3300053178 Bacteria 1791
2479 Ga0500645_022433 3300053730 Bacteria 1941
2480 Ga0500609_000060 3300053731 Bacteria 14183
2481 Ga0500609_002101 3300053731 Bacteria 2856
2482 Ga0500596_000229 3300053735 Bacteria 9555
2483 Ga0501084_0000081 3300054114 Bacteria 70009
2484 Ga0501084_0006864 3300054114 Bacteria 9374
2485 Ga0501084_0013295 3300054114 Bacteria 6810
2486 Ga0501084_0025519 3300054114 Bacteria 4930
2487 Ga0501084_0044319 3300054114 Bacteria 3724
2488 Ga0501084_0051122 3300054114 Bacteria 3458
2489 Ga0501084_0057756 3300054114 Bacteria 3246
2490 Ga0501084_0099553 3300054114 Bacteria 2441
2491 Ga0501084_0192381 3300054114 Bacteria 1721
2492 Ga0501084_0200136 3300054114 Bacteria 1685
2493 Ga0501084_0217579 3300054114 Bacteria 1612
2494 Ga0501084_0348318 3300054114 Bacteria 1251
2495 Ga0500661_000122 3300055283 Bacteria 12922
2496 Ga0590074_008281 3300059423 Bacteria 1732
2497 Ga0501082_0002024 3300060353 Bacteria 17824
2498 Ga0501082_0002590 3300060353 Bacteria 15812
2499 Ga0501082_0003567 3300060353 Bacteria 13587
2500 Ga0501082_0006137 3300060353 Bacteria 10431
2501 Ga0501082_0007923 3300060353 Bacteria 9176
2502 Ga0501082_0011270 3300060353 Bacteria 7686
2503 Ga0501082_0013055 3300060353 Bacteria 7139
2504 Ga0501082_0019395 3300060353 Bacteria 5861
2505 Ga0501082_0040386 3300060353 Bacteria 4025
2506 Ga0501082_0042564 3300060353 Bacteria 3915
2507 Ga0501082_0044855 3300060353 Bacteria 3813
2508 Ga0501082_0063926 3300060353 Bacteria 3168
2509 Ga0501082_0080623 3300060353 Bacteria 2809
2510 Ga0501082_0085123 3300060353 Bacteria 2727
2511 Ga0501082_0116068 3300060353 Bacteria 2319
2512 Ga0501082_0125797 3300060353 Bacteria 2223
2513 Ga0501082_0126702 3300060353 Bacteria 2214
2514 Ga0501082_0138708 3300060353 Bacteria 2110
2515 Ga0501082_0167971 3300060353 Bacteria 1907
2516 Ga0501082_0207907 3300060353 Bacteria 1703
2517 Ga0501082_0255043 3300060353 Bacteria 1526
2518 Ga0501082_0262129 3300060353 Bacteria 1503
2519 Ga0466962_0146098 3300061719 Bacteria 1147
2520 Ga0530510_0009847 3300061734 Bacteria 6705
2521 Ga0530510_0022825 3300061734 Bacteria 4459
2522 Ga0530510_0025046 3300061734 Bacteria 4265
2523 Ga0530510_0028153 3300061734 Bacteria 4029
2524 Ga0530510_0170652 3300061734 Bacteria 1611
2525 Ga0530510_0212208 3300061734 Bacteria 1438

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009553 Ga0105249_10489235 Ga0105249_104892352 270
2 iso_pu_bacteria 2876808645 2876813428 290
3 3300049588 Ga0501072_0478819 Ga0501072_0478819_13_891 292
4 3300049742 Ga0501080_0038601 Ga0501080_0038601_36_914 292
5 3300053085 Ga0495619_0359005 Ga0495619_0359005_98_982 294
6 3300039447 Ga0436361_0202059 Ga0436361_0202059_10_897 295
7 3300035398 Ga0316574_0001939 Ga0316574_0001939_1478_2368 296
8 3300044765 Ga0466970_0287555 Ga0466970_0287555_16_906 296
9 3300047472 Ga0495686_0210391 Ga0495686_0210391_13_903 296
10 3300048928 Ga0496125_0027428 Ga0496125_0027428_24_959 297
11 3300039438 Ga0436360_0635024 Ga0436360_0635024_363_1346 298
12 3300049571 Ga0501034_0209260 Ga0501034_0209260_532_1500 298
13 3300049580 Ga0501046_0042752 Ga0501046_0042752_2699_3598 299
14 3300053091 Ga0500647_0175730 Ga0500647_0175730_74_973 299
15 iso_pu_bacteria 2840878972 2840880988 303
16 3300061719 Ga0466962_0146098 Ga0466962_0146098_103_1026 305
17 3300009545 Ga0105237_10131085 Ga0105237_101310852 307
18 3300025291 Ga0209675_1007854 Ga0209675_10078542 307
19 3300025295 Ga0209564_1023896 Ga0209564_10238962 307
20 3300025914 Ga0207671_10211675 Ga0207671_102116752 307
21 3300025932 Ga0207690_10011327 Ga0207690_100113274 307
22 3300026041 Ga0207639_10054815 Ga0207639_100548151 307
23 3300028794 Ga0307515_10010603 Ga0307515_1001060315 307
24 3300028800 Ga0265338_10169725 Ga0265338_101697252 307
25 3300031251 Ga0265327_10004114 Ga0265327_100041145 307
26 3300035113 Ga0373936_0077826 Ga0373936_0077826_12_935 307
27 3300035695 Ga0373927_0228069 Ga0373927_0228069_13_936 307
28 3300037418 Ga0395900_0111514 Ga0395900_0111514_985_1971 307
29 3300037466 Ga0395898_0445986 Ga0395898_0445986_185_1171 307
30 3300038443 Ga0395901_0076884 Ga0395901_0076884_586_1572 307
31 3300039062 Ga0400483_221319 Ga0400483_221319_9032_9955 307
32 3300039062 Ga0400483_291647 Ga0400483_291647_4795_5718 307
33 3300046660 Ga0495625_0015230 Ga0495625_0015230_35_958 307
34 3300049583 Ga0501067_0025458 Ga0501067_0025458_2341_3264 307
35 3300049592 Ga0501076_0073472 Ga0501076_0073472_1791_2714 307
36 3300009993 Ga0105028_101403 Ga0105028_1014032 308
37 3300049577 Ga0501041_0141054 Ga0501041_0141054_268_1254 308
38 3300049741 Ga0501079_0176188 Ga0501079_0176188_237_1223 308
39 3300026041 Ga0207639_10315640 Ga0207639_103156401 309
40 3300031344 Ga0265316_10036566 Ga0265316_100365666 309
41 3300035410 Ga0373924_0158918 Ga0373924_0158918_11_940 309
42 3300039447 Ga0436361_0792347 Ga0436361_0792347_404_1333 309
43 3300046519 Ga0495632_0175542 Ga0495632_0175542_43_972 309
44 3300048927 Ga0496124_0189959 Ga0496124_0189959_14_943 309
45 3300049568 Ga0501031_0004421 Ga0501031_0004421_1211_2197 309
46 3300049572 Ga0501036_0022546 Ga0501036_0022546_2307_3293 309
47 3300049574 Ga0501038_0043898 Ga0501038_0043898_833_1819 309
48 3300049575 Ga0501039_0014539 Ga0501039_0014539_2633_3619 309
49 3300049576 Ga0501040_0017186 Ga0501040_0017186_2996_3982 309
50 3300049577 Ga0501041_0075061 Ga0501041_0075061_413_1399 309
51 3300049579 Ga0501043_0061058 Ga0501043_0061058_1723_2709 309
52 3300049580 Ga0501046_0072574 Ga0501046_0072574_755_1741 309
53 3300049581 Ga0501047_0376282 Ga0501047_0376282_289_1218 309
54 3300049582 Ga0501048_0019176 Ga0501048_0019176_1980_2966 309
55 3300049584 Ga0501068_0033384 Ga0501068_0033384_659_1645 309
56 3300049586 Ga0501070_0181720 Ga0501070_0181720_443_1429 309
57 3300049587 Ga0501071_0040412 Ga0501071_0040412_965_1951 309
58 3300049588 Ga0501072_0015886 Ga0501072_0015886_1827_2813 309
59 3300049589 Ga0501073_0151101 Ga0501073_0151101_197_1183 309
60 3300049590 Ga0501074_0351877 Ga0501074_0351877_29_1015 309
61 3300049591 Ga0501075_0042646 Ga0501075_0042646_834_1820 309
62 3300049593 Ga0501077_0006723 Ga0501077_0006723_5143_6129 309
63 3300049741 Ga0501079_0038747 Ga0501079_0038747_1420_2406 309
64 3300049742 Ga0501080_0089960 Ga0501080_0089960_825_1811 309
65 3300049824 Ga0501045_0043592 Ga0501045_0043592_642_1628 309
66 3300054114 Ga0501084_0057756 Ga0501084_0057756_629_1615 309
67 3300060353 Ga0501082_0126702 Ga0501082_0126702_552_1538 309
68 3300009553 Ga0105249_10116839 Ga0105249_101168392 310
69 3300025961 Ga0207712_10083752 Ga0207712_100837523 310
70 3300041509 Ga0451843_0165771 Ga0451843_0165771_74_1006 310
71 3300044712 Ga0453684_0333900 Ga0453684_0333900_180_1169 310
72 3300045051 Ga0451576_0004684 Ga0451576_0004684_16289_17275 310
73 3300048910 Ga0496107_0360543 Ga0496107_0360543_112_1044 310
74 3300049572 Ga0501036_0150919 Ga0501036_0150919_309_1241 310
75 3300054114 Ga0501084_0348318 Ga0501084_0348318_285_1217 310
76 3300035725 Ga0373947_0283583 Ga0373947_0283583_146_1081 311
77 3300039062 Ga0400483_289506 Ga0400483_289506_508_1494 311
78 3300041413 Ga0439465_0058161 Ga0439465_0058161_10_945 311
79 3300045976 Ga0466967_0392564 Ga0466967_0392564_14_952 311
80 3300046664 Ga0495659_0025593 Ga0495659_0025593_1076_2011 311
81 3300048912 Ga0496109_0604969 Ga0496109_0604969_58_993 311
82 3300048915 Ga0496112_0086736 Ga0496112_0086736_2132_3067 311
83 3300048924 Ga0496121_0209406 Ga0496121_0209406_415_1353 311
84 3300050514 nmdc:mga08x19_186422_c1 nmdc:mga08x19_186422_c1_26_961 311
85 3300035691 Ga0373931_0283542 Ga0373931_0283542_45_983 312
86 3300041408 Ga0439453_0014729 Ga0439453_0014729_13_951 312
87 3300049572 Ga0501036_0062427 Ga0501036_0062427_1902_2906 312
88 3300049590 Ga0501074_0271336 Ga0501074_0271336_127_1107 312
89 3300049586 Ga0501070_0133145 Ga0501070_0133145_222_1166 314
90 3300039062 Ga0400483_139488 Ga0400483_139488_228_1175 315
91 3300039062 Ga0400483_222891 Ga0400483_222891_1136_2083 315
92 3300037471 Ga0395905_0049319 Ga0395905_0049319_1170_2162 316
93 iso_pu_bacteria 2919679072 2919681913 316
94 3300031239 Ga0265328_10003408 Ga0265328_100034085 317
95 3300031250 Ga0265331_10032453 Ga0265331_100324532 317
96 3300031251 Ga0265327_10014298 Ga0265327_100142984 317
97 3300031344 Ga0265316_10031778 Ga0265316_100317782 317
98 3300048929 Ga0496126_0190310 Ga0496126_0190310_48_1001 317
99 3300005842 Ga0068858_100553265 Ga0068858_1005532651 318
100 3300005844 Ga0068862_100411551 Ga0068862_1004115512 318
101 3300025295 Ga0209564_1000747 Ga0209564_100074734 318
102 3300048914 Ga0496111_0083195 Ga0496111_0083195_1248_2222 318
103 3300005366 Ga0070659_100039074 Ga0070659_1000390743 319
104 3300005455 Ga0070663_100021780 Ga0070663_1000217804 319
105 3300006038 Ga0075365_10032735 Ga0075365_100327351 319
106 3300006051 Ga0075364_10058333 Ga0075364_100583333 319
107 3300006186 Ga0075369_10030464 Ga0075369_100304642 319
108 3300006871 Ga0075434_100356993 Ga0075434_1003569932 319
109 3300009147 Ga0114129_10563878 Ga0114129_105638782 319
110 3300013104 Ga0157370_10490894 Ga0157370_104908941 319
111 3300025295 Ga0209564_1003448 Ga0209564_10034485 319
112 3300025919 Ga0207657_10004389 Ga0207657_1000438910 319
113 3300026067 Ga0207678_10004742 Ga0207678_100047428 319
114 3300031727 Ga0316576_10230076 Ga0316576_102300762 319
115 3300031911 Ga0307412_10047890 Ga0307412_100478903 319
116 3300046460 Ga0495638_0087605 Ga0495638_0087605_75_1076 319
117 3300046506 Ga0495583_0056351 Ga0495583_0056351_335_1336 319
118 3300046513 Ga0495616_0007461 Ga0495616_0007461_2456_3457 319
119 3300046524 Ga0495648_0020469 Ga0495648_0020469_2048_3049 319
120 3300046530 Ga0495654_0016639 Ga0495654_0016639_1035_2036 319
121 3300046665 Ga0495661_0003135 Ga0495661_0003135_9502_10503 319
122 3300047472 Ga0495686_0101598 Ga0495686_0101598_273_1274 319
123 3300048909 Ga0496106_0351528 Ga0496106_0351528_23_1012 319
124 3300048919 Ga0496116_0003976 Ga0496116_0003976_2879_3880 319
125 3300048920 Ga0496117_0025429 Ga0496117_0025429_2809_3810 319
126 3300048920 Ga0496117_0141310 Ga0496117_0141310_75_1076 319
127 3300048921 Ga0496118_0128567 Ga0496118_0128567_519_1520 319
128 3300048924 Ga0496121_0005806 Ga0496121_0005806_12464_13465 319
129 3300048925 Ga0496122_0054114 Ga0496122_0054114_1775_2776 319
130 3300048926 Ga0496123_0052848 Ga0496123_0052848_647_1648 319
131 3300048927 Ga0496124_0282791 Ga0496124_0282791_17_1018 319
132 3300048928 Ga0496125_0000136 Ga0496125_0000136_109516_110517 319
133 3300048928 Ga0496125_0000843 Ga0496125_0000843_35405_36406 319
134 3300049568 Ga0501031_0191930 Ga0501031_0191930_103_1104 319
135 3300049570 Ga0501033_0040012 Ga0501033_0040012_2210_3211 319
136 3300049570 Ga0501033_0047426 Ga0501033_0047426_32_1033 319
137 3300049570 Ga0501033_0059229 Ga0501033_0059229_1258_2259 319
138 3300049581 Ga0501047_0038225 Ga0501047_0038225_809_1810 319
139 3300049583 Ga0501067_0036571 Ga0501067_0036571_336_1325 319
140 3300049823 Ga0501044_0082739 Ga0501044_0082739_1258_2259 319
141 3300050491 nmdc:mga00v17_14506_c1 nmdc:mga00v17_14506_c1_1075_2076 319
142 3300050496 nmdc:mga07m45_48010_c1 nmdc:mga07m45_48010_c1_829_1830 319
143 3300050507 nmdc:mga05p37_458464_c1 nmdc:mga05p37_458464_c1_289_1278 319
144 3300050511 nmdc:mga08y16_186802_c1 nmdc:mga08y16_186802_c1_408_1397 319
145 3300050512 nmdc:mga0n895_126423_c1 nmdc:mga0n895_126423_c1_1176_2165 319
146 3300050516 nmdc:mga0sz30_18637_c1 nmdc:mga0sz30_18637_c1_976_1977 319
147 3300053093 Ga0500651_0003552 Ga0500651_0003552_1618_2619 319
148 3300053096 Ga0500641_0037060 Ga0500641_0037060_621_1622 319
149 3300053098 Ga0500650_0022330 Ga0500650_0022330_108_1109 319
150 3300053104 Ga0500556_0000006 Ga0500556_0000006_205052_206053 319
151 3300053109 Ga0500569_007795 Ga0500569_007795_1090_2091 319
152 3300053130 Ga0500642_0000004 Ga0500642_0000004_278192_279193 319
153 3300053131 Ga0500652_000980 Ga0500652_000980_3315_4316 319
154 3300053142 Ga0500577_0001673 Ga0500577_0001673_4625_5626 319
155 3300053145 Ga0500586_000279 Ga0500586_000279_671_1672 319
156 3300053153 Ga0500616_0000022 Ga0500616_0000022_202413_203414 319
157 3300053156 Ga0500622_0102617 Ga0500622_0102617_343_1344 319
158 3300048928 Ga0496125_0001550 Ga0496125_0001550_24622_25623 320
159 3300048929 Ga0496126_0017297 Ga0496126_0017297_3329_4330 320
160 3300049569 Ga0501032_0014322 Ga0501032_0014322_1777_2778 320
161 3300049569 Ga0501032_0286722 Ga0501032_0286722_33_1034 320
162 3300049570 Ga0501033_0000205 Ga0501033_0000205_19085_20086 320
163 3300049571 Ga0501034_0148424 Ga0501034_0148424_572_1573 320
164 3300049571 Ga0501034_0332139 Ga0501034_0332139_259_1260 320
165 3300049573 Ga0501037_0001134 Ga0501037_0001134_4678_5679 320
166 3300049573 Ga0501037_0051986 Ga0501037_0051986_1164_2165 320
167 3300049573 Ga0501037_0106061 Ga0501037_0106061_834_1937 320
168 3300049574 Ga0501038_0120012 Ga0501038_0120012_428_1429 320
169 3300049575 Ga0501039_0065078 Ga0501039_0065078_1630_2631 320
170 3300049578 Ga0501042_0041282 Ga0501042_0041282_1477_2478 320
171 3300049579 Ga0501043_0013802 Ga0501043_0013802_1421_2422 320
172 3300049580 Ga0501046_0005064 Ga0501046_0005064_2828_3829 320
173 3300049580 Ga0501046_0019851 Ga0501046_0019851_1675_2676 320
174 3300049581 Ga0501047_0144065 Ga0501047_0144065_111_1112 320
175 3300049583 Ga0501067_0014319 Ga0501067_0014319_1016_2017 320
176 3300049584 Ga0501068_0102413 Ga0501068_0102413_88_1089 320
177 3300049584 Ga0501068_0207461 Ga0501068_0207461_137_1138 320
178 3300049585 Ga0501069_0018188 Ga0501069_0018188_944_1945 320
179 3300049586 Ga0501070_0084568 Ga0501070_0084568_794_1795 320
180 3300049589 Ga0501073_0119501 Ga0501073_0119501_514_1515 320
181 3300049591 Ga0501075_0063802 Ga0501075_0063802_249_1250 320
182 3300049593 Ga0501077_0045897 Ga0501077_0045897_422_1423 320
183 3300049741 Ga0501079_0101202 Ga0501079_0101202_10_1011 320
184 3300049823 Ga0501044_0005118 Ga0501044_0005118_9242_10243 320
185 3300049823 Ga0501044_0055013 Ga0501044_0055013_1189_2190 320
186 3300049824 Ga0501045_0018315 Ga0501045_0018315_3022_4023 320
187 3300053094 Ga0500566_0000055 Ga0500566_0000055_26292_27293 320
188 3300053102 Ga0500554_010329 Ga0500554_010329_412_1413 320
189 3300053136 Ga0500559_0000362 Ga0500559_0000362_11471_12472 320
190 3300053148 Ga0500590_011632 Ga0500590_011632_181_1182 320
191 3300053177 Ga0500636_0025475 Ga0500636_0025475_1894_2895 320
192 3300053178 Ga0500637_0088563 Ga0500637_0088563_643_1644 320
193 3300060353 Ga0501082_0262129 Ga0501082_0262129_323_1324 320
194 3300009094 Ga0111539_10000064 Ga0111539_1000006450 321
195 3300027907 Ga0207428_10000072 Ga0207428_10000072102 321
196 3300031456 Ga0307513_10104424 Ga0307513_101044242 321
197 3300031665 Ga0316575_10004477 Ga0316575_100044774 321
198 3300031727 Ga0316576_10108773 Ga0316576_101087732 321
199 3300039062 Ga0400483_210785 Ga0400483_210785_3983_4948 321
200 3300039438 Ga0436360_0787824 Ga0436360_0787824_55_1041 321
201 3300050511 nmdc:mga08y16_38_c1 nmdc:mga08y16_38_c1_52175_53140 321
202 3300006186 Ga0075369_10000126 Ga0075369_1000012619 322
203 3300037466 Ga0395898_0146728 Ga0395898_0146728_902_1870 322
204 3300024225 Ga0224572_1012588 Ga0224572_10125882 323
205 3300024227 Ga0228598_1015034 Ga0228598_10150342 323
206 3300034818 Ga0373950_0014213 Ga0373950_0014213_328_1299 323
207 3300049575 Ga0501039_0203883 Ga0501039_0203883_528_1526 323
208 iso_pu_bacteria 2883291878 2883297316 323
209 iso_pu_bacteria 2883354860 2883360127 323
210 3300048920 Ga0496117_0028829 Ga0496117_0028829_2410_3411 324
211 3300048925 Ga0496122_0023911 Ga0496122_0023911_1750_2751 324
212 3300048926 Ga0496123_0034754 Ga0496123_0034754_2583_3584 324
213 3300049589 Ga0501073_0106199 Ga0501073_0106199_136_1110 324
214 3300049823 Ga0501044_0099653 Ga0501044_0099653_756_1730 324
215 iso_pu_bacteria 2510917020 2511122291 324
216 iso_pu_bacteria 2582581279 2585149768 324
217 iso_pu_bacteria 2582581280 2585151220 324
218 iso_pu_bacteria 2582581293 2585197090 324
219 iso_pu_bacteria 2585428106 2587919989 324
220 iso_pu_bacteria 2643221545 2643747644 324
221 iso_pu_bacteria 2643221552 2643781955 324
222 iso_pu_bacteria 2643221583 2643924112 324
223 iso_pu_bacteria 2643221584 2643931926 324
224 iso_pu_bacteria 2643221640 2644223379 324
225 iso_pu_bacteria 2643221642 2644237121 324
226 iso_pu_bacteria 2643221691 2644506974 324
227 iso_pu_bacteria 2791355048 2792463089 324
228 iso_pu_bacteria 2818991435 2819538296 324
229 iso_pu_bacteria 2818991454 2819647134 324
230 iso_pu_bacteria 2843744320 2843745425 324
231 iso_pu_bacteria 2849560528 2849561036 324
232 iso_pu_bacteria 2849573788 2849576216 324
233 iso_pu_bacteria 2851153111 2851157074 324
234 iso_pu_bacteria 2854681122 2854684055 324
235 iso_pu_bacteria 2857504554 2857505754 324
236 iso_pu_bacteria 2884960567 2884965573 324
237 iso_pu_bacteria 2898329390 2898332737 324
238 iso_pu_bacteria 2898795034 2898796047 324
239 iso_pu_bacteria 2917554339 2917558201 324
240 iso_pu_bacteria 2919679072 2919682245 324
241 iso_pu_bacteria 2928531327 2928532131 324
242 iso_pu_bacteria 3000405567 3000407784 324
243 3300013250 Ga0171462_1015 Ga0171462_101535 325
244 iso_pu_bacteria 2511231221 2512034508 325
245 iso_pu_bacteria 2522572158 2523103280 325
246 iso_pu_bacteria 2524023250 2524611110 325
247 iso_pu_bacteria 2597490356 2599102871 325
248 iso_pu_bacteria 2842333319 2842335591 325
249 iso_pu_bacteria 2844533157 2844535140 325
250 iso_pu_bacteria 2846952575 2846952745 325
251 iso_pu_bacteria 2848858292 2848861233 325
252 iso_pu_bacteria 2897803580 2897806712 325
253 iso_pu_bacteria 8054002106 8054003952 325
254 3300003215 JGI25153J46596_10000092 JGI25153J46596_1000009245 326
255 3300003794 Ga0055531_10006330 Ga0055531_100063306 326
256 3300005356 Ga0070674_100141079 Ga0070674_1001410791 326
257 3300005467 Ga0070706_100146757 Ga0070706_1001467573 326
258 3300005518 Ga0070699_100489532 Ga0070699_1004895321 326
259 3300005844 Ga0068862_100030026 Ga0068862_1000300266 326
260 3300005844 Ga0068862_100051026 Ga0068862_1000510262 326
261 3300005981 Ga0081538_10008912 Ga0081538_1000891210 326
262 3300006852 Ga0075433_10396964 Ga0075433_103969641 326
263 3300006871 Ga0075434_100456079 Ga0075434_1004560792 326
264 3300006881 Ga0068865_100036018 Ga0068865_1000360183 326
265 3300009093 Ga0105240_10173981 Ga0105240_101739812 326
266 3300009094 Ga0111539_10000041 Ga0111539_1000004163 326
267 3300009147 Ga0114129_10169853 Ga0114129_101698533 326
268 3300010375 Ga0105239_10127937 Ga0105239_101279372 326
269 3300013297 Ga0157378_10447073 Ga0157378_104470732 326
270 3300014325 Ga0163163_10148933 Ga0163163_101489333 326
271 3300014326 Ga0157380_10014539 Ga0157380_100145395 326
272 3300014968 Ga0157379_10313048 Ga0157379_103130482 326
273 3300025254 Ga0209148_1000582 Ga0209148_100058220 326
274 3300025272 Ga0209455_1002476 Ga0209455_10024765 326
275 3300025297 Ga0209758_1000029 Ga0209758_100002957 326
276 3300025298 Ga0209050_1002258 Ga0209050_100225813 326
277 3300025303 Ga0209051_1023061 Ga0209051_10230615 326
278 3300025304 Ga0209257_1000549 Ga0209257_10005499 326
279 3300025922 Ga0207646_10286633 Ga0207646_102866332 326
280 3300026118 Ga0207675_100152703 Ga0207675_1001527033 326
281 3300027907 Ga0207428_10038011 Ga0207428_100380113 326
282 3300028379 Ga0268266_10371555 Ga0268266_103715551 326
283 3300031250 Ga0265331_10001362 Ga0265331_1000136214 326
284 3300031595 Ga0265313_10000532 Ga0265313_1000053218 326
285 3300031711 Ga0265314_10018389 Ga0265314_100183893 326
286 3300031711 Ga0265314_10137042 Ga0265314_101370421 326
287 3300031712 Ga0265342_10043577 Ga0265342_100435772 326
288 3300031995 Ga0307409_100003189 Ga0307409_10000318910 326
289 3300035118 Ga0373954_0107606 Ga0373954_0107606_338_1321 326
290 3300035724 Ga0373933_0050950 Ga0373933_0050950_497_1480 326
291 3300036401 Ga0373937_0215887 Ga0373937_0215887_22_1005 326
292 3300042125 Ga0450923_009795 Ga0450923_009795_686_1666 326
293 3300048905 Ga0496102_0011059 Ga0496102_0011059_3857_4843 326
294 3300049569 Ga0501032_0006853 Ga0501032_0006853_6285_7343 326
295 3300049570 Ga0501033_0017696 Ga0501033_0017696_1708_2691 326
296 3300049571 Ga0501034_0230433 Ga0501034_0230433_354_1412 326
297 3300049572 Ga0501036_0020521 Ga0501036_0020521_1634_2617 326
298 3300049574 Ga0501038_0014768 Ga0501038_0014768_233_1216 326
299 3300049574 Ga0501038_0114891 Ga0501038_0114891_356_1339 326
300 3300049575 Ga0501039_0011110 Ga0501039_0011110_1394_2377 326
301 3300049579 Ga0501043_0003235 Ga0501043_0003235_12346_13404 326
302 3300049579 Ga0501043_0083582 Ga0501043_0083582_840_1823 326
303 3300049580 Ga0501046_0007903 Ga0501046_0007903_6230_7288 326
304 3300049580 Ga0501046_0092391 Ga0501046_0092391_1289_2272 326
305 3300049581 Ga0501047_0010813 Ga0501047_0010813_7479_8462 326
306 3300049581 Ga0501047_0050328 Ga0501047_0050328_1661_2719 326
307 3300049581 Ga0501047_0075535 Ga0501047_0075535_629_1612 326
308 3300049584 Ga0501068_0006643 Ga0501068_0006643_4146_5129 326
309 3300049584 Ga0501068_0007119 Ga0501068_0007119_4154_5137 326
310 3300049585 Ga0501069_0000191 Ga0501069_0000191_14395_15378 326
311 3300049586 Ga0501070_0002064 Ga0501070_0002064_12153_13136 326
312 3300049586 Ga0501070_0137187 Ga0501070_0137187_881_1864 326
313 3300049588 Ga0501072_0032562 Ga0501072_0032562_207_1211 326
314 3300049589 Ga0501073_0000400 Ga0501073_0000400_27970_28953 326
315 3300049589 Ga0501073_0017650 Ga0501073_0017650_321_1304 326
316 3300049589 Ga0501073_0020091 Ga0501073_0020091_3228_4211 326
317 3300049590 Ga0501074_0030344 Ga0501074_0030344_2691_3749 326
318 3300049591 Ga0501075_0144709 Ga0501075_0144709_237_1220 326
319 3300049592 Ga0501076_0012567 Ga0501076_0012567_4796_5800 326
320 3300049593 Ga0501077_0006812 Ga0501077_0006812_4018_5022 326
321 3300049742 Ga0501080_0103716 Ga0501080_0103716_978_1961 326
322 3300049742 Ga0501080_0292340 Ga0501080_0292340_17_1000 326
323 3300049743 Ga0501081_0084688 Ga0501081_0084688_796_1779 326
324 3300049743 Ga0501081_0091541 Ga0501081_0091541_661_1665 326
325 3300049744 Ga0501083_0010620 Ga0501083_0010620_3197_4180 326
326 3300049744 Ga0501083_0039214 Ga0501083_0039214_1845_2828 326
327 3300049822 Ga0501035_0183527 Ga0501035_0183527_390_1373 326
328 3300049823 Ga0501044_0082798 Ga0501044_0082798_1660_2643 326
329 3300049823 Ga0501044_0195341 Ga0501044_0195341_338_1321 326
330 3300050511 nmdc:mga08y16_279_c1 nmdc:mga08y16_279_c1_23169_24152 326
331 3300050515 nmdc:mga0a205_301583_c1 nmdc:mga0a205_301583_c1_329_1315 326
332 3300053086 Ga0500578_0047705 Ga0500578_0047705_1078_2061 326
333 3300053087 Ga0500643_014907 Ga0500643_014907_1062_2045 326
334 3300053093 Ga0500651_0100268 Ga0500651_0100268_163_1146 326
335 3300053119 Ga0500595_000936 Ga0500595_000936_10993_11976 326
336 3300053130 Ga0500642_0002040 Ga0500642_0002040_4724_5707 326
337 3300053134 Ga0500658_0002698 Ga0500658_0002698_3514_4497 326
338 3300053139 Ga0500568_0004689 Ga0500568_0004689_1010_1993 326
339 3300053142 Ga0500577_0004433 Ga0500577_0004433_2669_3652 326
340 3300053146 Ga0500588_0000351 Ga0500588_0000351_988_1971 326
341 3300053151 Ga0500604_0003442 Ga0500604_0003442_3081_4064 326
342 3300053153 Ga0500616_0000712 Ga0500616_0000712_9999_10982 326
343 3300053731 Ga0500609_000060 Ga0500609_000060_5873_6856 326
344 3300054114 Ga0501084_0200136 Ga0501084_0200136_122_1105 326
345 3300059423 Ga0590074_008281 Ga0590074_008281_735_1718 326
346 3300060353 Ga0501082_0063926 Ga0501082_0063926_2028_3011 326
347 iso_pu_bacteria 2882456835 2882458728 326
348 3300003214 JGI25165J46597_1000181 JGI25165J46597_1000181100 327
349 3300005444 Ga0070694_100029748 Ga0070694_1000297483 327
350 3300005445 Ga0070708_100160614 Ga0070708_1001606142 327
351 3300005458 Ga0070681_10015986 Ga0070681_100159868 327
352 3300005471 Ga0070698_100310482 Ga0070698_1003104822 327
353 3300005530 Ga0070679_100008440 Ga0070679_1000084407 327
354 3300005546 Ga0070696_100106897 Ga0070696_1001068974 327
355 3300005841 Ga0068863_100009117 Ga0068863_1000091177 327
356 3300005981 Ga0081538_10001948 Ga0081538_1000194816 327
357 3300005981 Ga0081538_10008257 Ga0081538_100082575 327
358 3300006028 Ga0070717_10273340 Ga0070717_102733401 327
359 3300006846 Ga0075430_100016774 Ga0075430_1000167745 327
360 3300013104 Ga0157370_10008939 Ga0157370_100089393 327
361 3300014497 Ga0182008_10035900 Ga0182008_100359002 327
362 3300021361 Ga0213872_10019300 Ga0213872_100193002 327
363 3300021377 Ga0213874_10015488 Ga0213874_100154882 327
364 3300025261 Ga0209233_1000045 Ga0209233_1000045100 327
365 3300025912 Ga0207707_10046150 Ga0207707_100461503 327
366 3300025921 Ga0207652_10006466 Ga0207652_100064665 327
367 3300026088 Ga0207641_10072787 Ga0207641_100727872 327
368 3300028379 Ga0268266_10155688 Ga0268266_101556883 327
369 3300028577 Ga0265318_10000017 Ga0265318_1000001726 327
370 3300029957 Ga0265324_10002894 Ga0265324_100028946 327
371 3300031239 Ga0265328_10012744 Ga0265328_100127443 327
372 3300031241 Ga0265325_10061107 Ga0265325_100611071 327
373 3300031250 Ga0265331_10000657 Ga0265331_100006577 327
374 3300031250 Ga0265331_10011328 Ga0265331_100113284 327
375 3300031251 Ga0265327_10000620 Ga0265327_1000062025 327
376 3300031251 Ga0265327_10004521 Ga0265327_1000452111 327
377 3300031251 Ga0265327_10065737 Ga0265327_100657371 327
378 3300031251 Ga0265327_10078041 Ga0265327_100780412 327
379 3300031595 Ga0265313_10000529 Ga0265313_1000052910 327
380 3300031595 Ga0265313_10062818 Ga0265313_100628181 327
381 3300031711 Ga0265314_10004122 Ga0265314_1000412210 327
382 3300031711 Ga0265314_10027263 Ga0265314_100272631 327
383 3300031711 Ga0265314_10109634 Ga0265314_101096342 327
384 3300036712 Ga0316584_0167716 Ga0316584_0167716_507_1493 327
385 3300037418 Ga0395900_0103810 Ga0395900_0103810_46_1032 327
386 3300037471 Ga0395905_0032923 Ga0395905_0032923_3663_4649 327
387 3300039062 Ga0400483_118420 Ga0400483_118420_1522_2508 327
388 3300039062 Ga0400483_210567 Ga0400483_210567_870_1856 327
389 3300039438 Ga0436360_0789853 Ga0436360_0789853_2292_3278 327
390 3300039447 Ga0436361_0094277 Ga0436361_0094277_4707_5693 327
391 3300039447 Ga0436361_0864146 Ga0436361_0864146_1245_2231 327
392 3300039450 Ga0436363_0612164 Ga0436363_0612164_560_1543 327
393 3300042876 Ga0451577_0426839 Ga0451577_0426839_198_1184 327
394 3300044673 Ga0453683_0007616 Ga0453683_0007616_2714_3700 327
395 3300044673 Ga0453683_0017805 Ga0453683_0017805_2049_3035 327
396 3300044712 Ga0453684_0000006 Ga0453684_0000006_1355561_1356550 327
397 3300044712 Ga0453684_0004063 Ga0453684_0004063_27343_28329 327
398 3300044712 Ga0453684_0025733 Ga0453684_0025733_5617_6603 327
399 3300045051 Ga0451576_0000056 Ga0451576_0000056_155817_156806 327
400 3300045051 Ga0451576_0000552 Ga0451576_0000552_69289_70275 327
401 3300045051 Ga0451576_0041269 Ga0451576_0041269_2226_3212 327
402 3300045051 Ga0451576_0127019 Ga0451576_0127019_1657_2643 327
403 3300045051 Ga0451576_0428693 Ga0451576_0428693_296_1282 327
404 3300046557 Ga0495622_0012907 Ga0495622_0012907_259_1245 327
405 3300046557 Ga0495622_0056554 Ga0495622_0056554_725_1711 327
406 3300046557 Ga0495622_0057166 Ga0495622_0057166_180_1166 327
407 3300049574 Ga0501038_0181319 Ga0501038_0181319_171_1157 327
408 3300049575 Ga0501039_0069316 Ga0501039_0069316_860_1846 327
409 3300049587 Ga0501071_0165962 Ga0501071_0165962_138_1124 327
410 3300049743 Ga0501081_0081858 Ga0501081_0081858_340_1326 327
411 3300049824 Ga0501045_0018687 Ga0501045_0018687_184_1170 327
412 3300060353 Ga0501082_0013055 Ga0501082_0013055_4983_5969 327
413 3300060353 Ga0501082_0167971 Ga0501082_0167971_404_1390 327
414 iso_pu_bacteria 2513237096 2513658445 327
415 iso_pu_bacteria 2513237137 2513863564 327
416 iso_pu_bacteria 2513237145 2513920561 327
417 iso_pu_bacteria 2517572143 2517888685 327
418 iso_pu_bacteria 2524023228 2524538779 327
419 iso_pu_bacteria 2643221734 2644736069 327
420 iso_pu_bacteria 2643221736 2644743958 327
421 iso_pu_bacteria 2667528175 2671119858 327
422 iso_pu_bacteria 2791355197 2793067503 327
423 iso_pu_bacteria 2818991467 2819722053 327
424 iso_pu_bacteria 2841760612 2841764218 327
425 iso_pu_bacteria 2841911363 2841915568 327
426 iso_pu_bacteria 2841917233 2841920770 327
427 iso_pu_bacteria 2844104063 2844108327 327
428 iso_pu_bacteria 2851182111 2851185537 327
429 iso_pu_bacteria 2851246043 2851250653 327
430 iso_pu_bacteria 2885374607 2885380258 327
431 iso_pu_bacteria 2891088606 2891091234 327
432 iso_pu_bacteria 2904699407 2904708895 327
433 iso_pu_bacteria 2906610324 2906613690 327
434 iso_pu_bacteria 2906635258 2906637382 327
435 iso_pu_bacteria 2906660503 2906668212 327
436 iso_pu_bacteria 2908739725 2908747276 327
437 iso_pu_bacteria 2917699015 2917701938 327
438 iso_pu_bacteria 2922425934 2922434453 327
439 iso_pu_bacteria 2935630451 2935635420 327
440 iso_pu_bacteria 2941507105 2941512283 327
441 iso_pu_bacteria 2941515067 2941519984 327
442 iso_pu_bacteria 2941523033 2941528075 327
443 iso_pu_bacteria 3005474847 3005474912 327
444 iso_pu_bacteria 8002060224 8002060784 327
445 iso_pu_bacteria 8006933436 8006936417 327
446 iso_pu_bacteria 8006973647 8006976387 327
447 iso_pu_bacteria 8019565922 8019572307 327
448 iso_pu_bacteria 8057529695 8057533700 327
449 3300003215 JGI25153J46596_10009146 JGI25153J46596_100091462 328
450 3300003773 Ga0055537_1001649 Ga0055537_10016495 328
451 3300003781 Ga0055536_1004582 Ga0055536_10045822 328
452 3300003781 Ga0055536_1007470 Ga0055536_10074705 328
453 3300003790 Ga0055528_1003297 Ga0055528_10032972 328
454 3300003791 Ga0055530_10012021 Ga0055530_100120212 328
455 3300003794 Ga0055531_10000473 Ga0055531_1000047313 328
456 3300003794 Ga0055531_10006445 Ga0055531_100064455 328
457 3300005262 Ga0065165_1001792 Ga0065165_100179213 328
458 3300005328 Ga0070676_10015038 Ga0070676_100150383 328
459 3300005329 Ga0070683_100089393 Ga0070683_1000893932 328
460 3300005329 Ga0070683_100196356 Ga0070683_1001963562 328
461 3300005335 Ga0070666_10001402 Ga0070666_1000140218 328
462 3300005336 Ga0070680_100000100 Ga0070680_10000010046 328
463 3300005336 Ga0070680_100026391 Ga0070680_1000263913 328
464 3300005338 Ga0068868_100059072 Ga0068868_1000590723 328
465 3300005338 Ga0068868_100077716 Ga0068868_1000777162 328
466 3300005339 Ga0070660_100025418 Ga0070660_1000254183 328
467 3300005339 Ga0070660_100064348 Ga0070660_1000643482 328
468 3300005341 Ga0070691_10003741 Ga0070691_100037417 328
469 3300005344 Ga0070661_100000067 Ga0070661_10000006748 328
470 3300005344 Ga0070661_100163610 Ga0070661_1001636102 328
471 3300005347 Ga0070668_100004810 Ga0070668_10000481011 328
472 3300005347 Ga0070668_100068675 Ga0070668_1000686753 328
473 3300005347 Ga0070668_100294359 Ga0070668_1002943591 328
474 3300005353 Ga0070669_100196996 Ga0070669_1001969961 328
475 3300005366 Ga0070659_100022454 Ga0070659_1000224544 328
476 3300005366 Ga0070659_100093538 Ga0070659_1000935383 328
477 3300005366 Ga0070659_100170753 Ga0070659_1001707532 328
478 3300005366 Ga0070659_100396374 Ga0070659_1003963741 328
479 3300005367 Ga0070667_100048011 Ga0070667_1000480113 328
480 3300005367 Ga0070667_100057255 Ga0070667_1000572551 328
481 3300005434 Ga0070709_10077760 Ga0070709_100777602 328
482 3300005436 Ga0070713_100000001 Ga0070713_100000001201 328
483 3300005444 Ga0070694_100328533 Ga0070694_1003285331 328
484 3300005456 Ga0070678_100105278 Ga0070678_1001052783 328
485 3300005458 Ga0070681_10000003 Ga0070681_1000000393 328
486 3300005458 Ga0070681_10016571 Ga0070681_100165712 328
487 3300005458 Ga0070681_10164093 Ga0070681_101640931 328
488 3300005458 Ga0070681_10302560 Ga0070681_103025602 328
489 3300005459 Ga0068867_100017555 Ga0068867_1000175553 328
490 3300005459 Ga0068867_100186462 Ga0068867_1001864622 328
491 3300005518 Ga0070699_100092839 Ga0070699_1000928392 328
492 3300005518 Ga0070699_100149525 Ga0070699_1001495252 328
493 3300005530 Ga0070679_100000617 Ga0070679_10000061729 328
494 3300005530 Ga0070679_100019447 Ga0070679_1000194475 328
495 3300005530 Ga0070679_100061030 Ga0070679_1000610304 328
496 3300005535 Ga0070684_100017519 Ga0070684_1000175194 328
497 3300005539 Ga0068853_100036036 Ga0068853_1000360362 328
498 3300005539 Ga0068853_100052565 Ga0068853_1000525652 328
499 3300005539 Ga0068853_100115329 Ga0068853_1001153292 328
500 3300005545 Ga0070695_100012698 Ga0070695_1000126985 328
501 3300005547 Ga0070693_100030257 Ga0070693_1000302574 328
502 3300005548 Ga0070665_100001203 Ga0070665_1000012036 328
503 3300005548 Ga0070665_100018122 Ga0070665_1000181225 328
504 3300005548 Ga0070665_100046204 Ga0070665_1000462043 328
505 3300005548 Ga0070665_100133875 Ga0070665_1001338753 328
506 3300005563 Ga0068855_100000374 Ga0068855_10000037436 328
507 3300005563 Ga0068855_100018777 Ga0068855_1000187779 328
508 3300005563 Ga0068855_100161531 Ga0068855_1001615312 328
509 3300005577 Ga0068857_100001101 Ga0068857_10000110116 328
510 3300005577 Ga0068857_100118656 Ga0068857_1001186564 328
511 3300005578 Ga0068854_100172802 Ga0068854_1001728022 328
512 3300005614 Ga0068856_100000170 Ga0068856_1000001707 328
513 3300005614 Ga0068856_100001226 Ga0068856_10000122617 328
514 3300005614 Ga0068856_100384554 Ga0068856_1003845541 328
515 3300005614 Ga0068856_100441769 Ga0068856_1004417691 328
516 3300005616 Ga0068852_100041580 Ga0068852_1000415802 328
517 3300005616 Ga0068852_100060110 Ga0068852_1000601104 328
518 3300005616 Ga0068852_100275390 Ga0068852_1002753902 328
519 3300005617 Ga0068859_100109037 Ga0068859_1001090373 328
520 3300005719 Ga0068861_100418304 Ga0068861_1004183041 328
521 3300005843 Ga0068860_100000066 Ga0068860_10000006646 328
522 3300005937 Ga0081455_10005493 Ga0081455_1000549313 328
523 3300006175 Ga0070712_100000305 Ga0070712_1000003057 328
524 3300006175 Ga0070712_100000898 Ga0070712_1000008987 328
525 3300006237 Ga0097621_100000226 Ga0097621_1000002264 328
526 3300006237 Ga0097621_100083502 Ga0097621_1000835023 328
527 3300006237 Ga0097621_100217082 Ga0097621_1002170822 328
528 3300006353 Ga0075370_10043910 Ga0075370_100439102 328
529 3300006358 Ga0068871_100000241 Ga0068871_10000024141 328
530 3300006358 Ga0068871_100094818 Ga0068871_1000948182 328
531 3300006358 Ga0068871_100391802 Ga0068871_1003918021 328
532 3300006846 Ga0075430_100078360 Ga0075430_1000783602 328
533 3300006847 Ga0075431_100000703 Ga0075431_10000070311 328
534 3300006880 Ga0075429_100036430 Ga0075429_1000364305 328
535 3300006881 Ga0068865_100039847 Ga0068865_1000398472 328
536 3300006914 Ga0075436_100006299 Ga0075436_1000062993 328
537 3300006931 Ga0097620_100109032 Ga0097620_1001090322 328
538 3300007076 Ga0075435_100043489 Ga0075435_1000434892 328
539 3300009093 Ga0105240_10002036 Ga0105240_100020368 328
540 3300009093 Ga0105240_10007524 Ga0105240_1000752411 328
541 3300009093 Ga0105240_10096941 Ga0105240_100969413 328
542 3300009093 Ga0105240_10135081 Ga0105240_101350812 328
543 3300009093 Ga0105240_10391244 Ga0105240_103912442 328
544 3300009101 Ga0105247_10006342 Ga0105247_100063428 328
545 3300009147 Ga0114129_10010008 Ga0114129_100100088 328
546 3300009148 Ga0105243_10033784 Ga0105243_100337842 328
547 3300009174 Ga0105241_10008983 Ga0105241_100089833 328
548 3300009174 Ga0105241_10023338 Ga0105241_100233383 328
549 3300009174 Ga0105241_10033652 Ga0105241_100336524 328
550 3300009176 Ga0105242_10016623 Ga0105242_100166231 328
551 3300009177 Ga0105248_10000001 Ga0105248_10000001999 328
552 3300009177 Ga0105248_10002936 Ga0105248_100029363 328
553 3300009177 Ga0105248_10675922 Ga0105248_106759221 328
554 3300009545 Ga0105237_10031092 Ga0105237_100310923 328
555 3300009545 Ga0105237_10083697 Ga0105237_100836972 328
556 3300009545 Ga0105237_10087993 Ga0105237_100879933 328
557 3300009551 Ga0105238_10018935 Ga0105238_100189354 328
558 3300009551 Ga0105238_10037968 Ga0105238_100379684 328
559 3300010375 Ga0105239_10005956 Ga0105239_100059569 328
560 3300010375 Ga0105239_10006483 Ga0105239_1000648312 328
561 3300010375 Ga0105239_10099189 Ga0105239_100991893 328
562 3300010375 Ga0105239_10110775 Ga0105239_101107752 328
563 3300010375 Ga0105239_10140208 Ga0105239_101402082 328
564 3300010375 Ga0105239_10165635 Ga0105239_101656353 328
565 3300013100 Ga0157373_10004620 Ga0157373_100046206 328
566 3300013104 Ga0157370_10044307 Ga0157370_100443075 328
567 3300013104 Ga0157370_10067410 Ga0157370_100674102 328
568 3300013104 Ga0157370_10088427 Ga0157370_100884272 328
569 3300013105 Ga0157369_10045513 Ga0157369_100455136 328
570 3300013297 Ga0157378_10004249 Ga0157378_100042495 328
571 3300013306 Ga0163162_10021719 Ga0163162_100217193 328
572 3300013306 Ga0163162_10093349 Ga0163162_100933493 328
573 3300013306 Ga0163162_10094809 Ga0163162_100948093 328
574 3300013307 Ga0157372_10002471 Ga0157372_100024713 328
575 3300013307 Ga0157372_10007637 Ga0157372_100076379 328
576 3300013307 Ga0157372_10039385 Ga0157372_100393853 328
577 3300013307 Ga0157372_10067946 Ga0157372_100679464 328
578 3300013307 Ga0157372_10079051 Ga0157372_100790513 328
579 3300014325 Ga0163163_10000113 Ga0163163_1000011318 328
580 3300014968 Ga0157379_10001157 Ga0157379_1000115726 328
581 3300014968 Ga0157379_10001421 Ga0157379_100014213 328
582 3300014968 Ga0157379_10009555 Ga0157379_100095555 328
583 3300014968 Ga0157379_10065259 Ga0157379_100652593 328
584 3300014968 Ga0157379_10116000 Ga0157379_101160002 328
585 3300014968 Ga0157379_10178548 Ga0157379_101785482 328
586 3300014969 Ga0157376_10361908 Ga0157376_103619082 328
587 3300017792 Ga0163161_10017729 Ga0163161_100177295 328
588 3300021384 Ga0213876_10000498 Ga0213876_1000049815 328
589 3300021384 Ga0213876_10009091 Ga0213876_100090916 328
590 3300025263 Ga0209565_1000172 Ga0209565_100017246 328
591 3300025273 Ga0209673_1000451 Ga0209673_100045114 328
592 3300025292 Ga0209676_1000257 Ga0209676_100025754 328
593 3300025292 Ga0209676_1000316 Ga0209676_100031648 328
594 3300025295 Ga0209564_1002755 Ga0209564_100275513 328
595 3300025295 Ga0209564_1032977 Ga0209564_10329772 328
596 3300025297 Ga0209758_1000008 Ga0209758_10000081178 328
597 3300025297 Ga0209758_1006062 Ga0209758_10060628 328
598 3300025298 Ga0209050_1000604 Ga0209050_100060448 328
599 3300025298 Ga0209050_1001742 Ga0209050_100174227 328
600 3300025298 Ga0209050_1006384 Ga0209050_10063843 328
601 3300025299 Ga0209256_1010638 Ga0209256_10106383 328
602 3300025303 Ga0209051_1003216 Ga0209051_10032169 328
603 3300025304 Ga0209257_1000192 Ga0209257_100019292 328
604 3300025304 Ga0209257_1000541 Ga0209257_100054125 328
605 3300025304 Ga0209257_1005285 Ga0209257_10052858 328
606 3300025321 Ga0207656_10167164 Ga0207656_101671641 328
607 3300025903 Ga0207680_10000525 Ga0207680_100005253 328
608 3300025903 Ga0207680_10025710 Ga0207680_100257103 328
609 3300025906 Ga0207699_10000432 Ga0207699_1000043210 328
610 3300025906 Ga0207699_10092336 Ga0207699_100923362 328
611 3300025909 Ga0207705_10007266 Ga0207705_100072662 328
612 3300025909 Ga0207705_10111901 Ga0207705_101119012 328
613 3300025911 Ga0207654_10012451 Ga0207654_100124515 328
614 3300025911 Ga0207654_10021937 Ga0207654_100219372 328
615 3300025911 Ga0207654_10127802 Ga0207654_101278022 328
616 3300025911 Ga0207654_10135114 Ga0207654_101351142 328
617 3300025912 Ga0207707_10000001 Ga0207707_10000001958 328
618 3300025912 Ga0207707_10267944 Ga0207707_102679442 328
619 3300025913 Ga0207695_10000004 Ga0207695_10000004478 328
620 3300025913 Ga0207695_10077640 Ga0207695_100776404 328
621 3300025913 Ga0207695_10144265 Ga0207695_101442653 328
622 3300025913 Ga0207695_10154981 Ga0207695_101549812 328
623 3300025914 Ga0207671_10063857 Ga0207671_100638571 328
624 3300025914 Ga0207671_10227669 Ga0207671_102276691 328
625 3300025915 Ga0207693_10000116 Ga0207693_1000011650 328
626 3300025915 Ga0207693_10000456 Ga0207693_100004567 328
627 3300025916 Ga0207663_10080892 Ga0207663_100808921 328
628 3300025917 Ga0207660_10000081 Ga0207660_1000008111 328
629 3300025917 Ga0207660_10159395 Ga0207660_101593952 328
630 3300025919 Ga0207657_10000144 Ga0207657_1000014448 328
631 3300025919 Ga0207657_10027165 Ga0207657_100271655 328
632 3300025920 Ga0207649_10000039 Ga0207649_1000003949 328
633 3300025921 Ga0207652_10000413 Ga0207652_1000041330 328
634 3300025921 Ga0207652_10023234 Ga0207652_100232345 328
635 3300025921 Ga0207652_10044041 Ga0207652_100440414 328
636 3300025921 Ga0207652_10096366 Ga0207652_100963662 328
637 3300025922 Ga0207646_10040495 Ga0207646_100404955 328
638 3300025923 Ga0207681_10067785 Ga0207681_100677852 328
639 3300025923 Ga0207681_10197121 Ga0207681_101971212 328
640 3300025924 Ga0207694_10000044 Ga0207694_10000044133 328
641 3300025926 Ga0207659_10058846 Ga0207659_100588462 328
642 3300025927 Ga0207687_10032556 Ga0207687_100325563 328
643 3300025928 Ga0207700_10000015 Ga0207700_1000001566 328
644 3300025929 Ga0207664_10005758 Ga0207664_100057587 328
645 3300025929 Ga0207664_10117111 Ga0207664_101171112 328
646 3300025933 Ga0207706_10056096 Ga0207706_100560964 328
647 3300025934 Ga0207686_10063151 Ga0207686_100631511 328
648 3300025934 Ga0207686_10130542 Ga0207686_101305422 328
649 3300025938 Ga0207704_10032978 Ga0207704_100329782 328
650 3300025940 Ga0207691_10233013 Ga0207691_102330132 328
651 3300025941 Ga0207711_10000001 Ga0207711_10000001872 328
652 3300025941 Ga0207711_10010590 Ga0207711_100105906 328
653 3300025942 Ga0207689_10004156 Ga0207689_100041566 328
654 3300025942 Ga0207689_10246159 Ga0207689_102461592 328
655 3300025944 Ga0207661_10124852 Ga0207661_101248521 328
656 3300025944 Ga0207661_10211564 Ga0207661_102115642 328
657 3300025944 Ga0207661_10291233 Ga0207661_102912331 328
658 3300025949 Ga0207667_10000012 Ga0207667_10000012297 328
659 3300025949 Ga0207667_10056196 Ga0207667_100561962 328
660 3300025949 Ga0207667_10097902 Ga0207667_100979023 328
661 3300025949 Ga0207667_10143162 Ga0207667_101431623 328
662 3300025960 Ga0207651_10024754 Ga0207651_100247544 328
663 3300025960 Ga0207651_10056905 Ga0207651_100569052 328
664 3300025972 Ga0207668_10005036 Ga0207668_100050361 328
665 3300025981 Ga0207640_10142952 Ga0207640_101429522 328
666 3300025986 Ga0207658_10046659 Ga0207658_100466592 328
667 3300025986 Ga0207658_10080268 Ga0207658_100802682 328
668 3300025986 Ga0207658_10314186 Ga0207658_103141862 328
669 3300026023 Ga0207677_10055063 Ga0207677_100550632 328
670 3300026023 Ga0207677_10059509 Ga0207677_100595093 328
671 3300026035 Ga0207703_10134507 Ga0207703_101345071 328
672 3300026041 Ga0207639_10000591 Ga0207639_1000059119 328
673 3300026041 Ga0207639_10056579 Ga0207639_100565792 328
674 3300026041 Ga0207639_10086667 Ga0207639_100866673 328
675 3300026078 Ga0207702_10000011 Ga0207702_1000001161 328
676 3300026078 Ga0207702_10001929 Ga0207702_1000192914 328
677 3300026078 Ga0207702_10071167 Ga0207702_100711673 328
678 3300026089 Ga0207648_10015409 Ga0207648_100154093 328
679 3300026089 Ga0207648_10025889 Ga0207648_100258893 328
680 3300026095 Ga0207676_10220311 Ga0207676_102203112 328
681 3300026095 Ga0207676_10469141 Ga0207676_104691411 328
682 3300026116 Ga0207674_10000002 Ga0207674_1000000261 328
683 3300026116 Ga0207674_10104982 Ga0207674_101049824 328
684 3300026121 Ga0207683_10040442 Ga0207683_100404422 328
685 3300026121 Ga0207683_10122853 Ga0207683_101228532 328
686 3300026142 Ga0207698_10038090 Ga0207698_100380903 328
687 3300028379 Ga0268266_10002387 Ga0268266_1000238715 328
688 3300028379 Ga0268266_10034992 Ga0268266_100349923 328
689 3300028379 Ga0268266_10420615 Ga0268266_104206151 328
690 3300028380 Ga0268265_10026973 Ga0268265_100269736 328
691 3300028381 Ga0268264_10000113 Ga0268264_10000113147 328
692 3300028573 Ga0265334_10017927 Ga0265334_100179273 328
693 3300028794 Ga0307515_10102681 Ga0307515_101026812 328
694 3300028800 Ga0265338_10001143 Ga0265338_1000114338 328
695 3300028800 Ga0265338_10003201 Ga0265338_1000320117 328
696 3300028800 Ga0265338_10020868 Ga0265338_100208687 328
697 3300028800 Ga0265338_10031409 Ga0265338_100314095 328
698 3300028800 Ga0265338_10063560 Ga0265338_100635603 328
699 3300031235 Ga0265330_10008876 Ga0265330_100088762 328
700 3300031238 Ga0265332_10008235 Ga0265332_100082354 328
701 3300031240 Ga0265320_10000331 Ga0265320_1000033133 328
702 3300031241 Ga0265325_10000003 Ga0265325_10000003248 328
703 3300031241 Ga0265325_10001065 Ga0265325_1000106514 328
704 3300031241 Ga0265325_10002405 Ga0265325_100024055 328
705 3300031241 Ga0265325_10012651 Ga0265325_100126515 328
706 3300031241 Ga0265325_10093370 Ga0265325_100933702 328
707 3300031247 Ga0265340_10001586 Ga0265340_100015869 328
708 3300031247 Ga0265340_10003602 Ga0265340_100036023 328
709 3300031247 Ga0265340_10003667 Ga0265340_100036672 328
710 3300031247 Ga0265340_10006838 Ga0265340_100068382 328
711 3300031249 Ga0265339_10001193 Ga0265339_100011938 328
712 3300031249 Ga0265339_10001509 Ga0265339_100015092 328
713 3300031249 Ga0265339_10010902 Ga0265339_100109023 328
714 3300031249 Ga0265339_10025148 Ga0265339_100251483 328
715 3300031249 Ga0265339_10038927 Ga0265339_100389273 328
716 3300031249 Ga0265339_10101783 Ga0265339_101017832 328
717 3300031250 Ga0265331_10000020 Ga0265331_10000020247 328
718 3300031250 Ga0265331_10000702 Ga0265331_1000070212 328
719 3300031250 Ga0265331_10002249 Ga0265331_100022493 328
720 3300031250 Ga0265331_10007852 Ga0265331_100078522 328
721 3300031250 Ga0265331_10009559 Ga0265331_100095595 328
722 3300031251 Ga0265327_10000372 Ga0265327_1000037265 328
723 3300031344 Ga0265316_10022088 Ga0265316_100220884 328
724 3300031344 Ga0265316_10034942 Ga0265316_100349423 328
725 3300031344 Ga0265316_10035427 Ga0265316_100354272 328
726 3300031344 Ga0265316_10095815 Ga0265316_100958153 328
727 3300031344 Ga0265316_10099166 Ga0265316_100991663 328
728 3300031344 Ga0265316_10116988 Ga0265316_101169882 328
729 3300031344 Ga0265316_10172732 Ga0265316_101727322 328
730 3300031595 Ga0265313_10001127 Ga0265313_1000112727 328
731 3300031595 Ga0265313_10003520 Ga0265313_100035207 328
732 3300031595 Ga0265313_10010923 Ga0265313_100109232 328
733 3300031595 Ga0265313_10043654 Ga0265313_100436542 328
734 3300031711 Ga0265314_10007663 Ga0265314_100076635 328
735 3300031711 Ga0265314_10020887 Ga0265314_100208873 328
736 3300031711 Ga0265314_10037359 Ga0265314_100373593 328
737 3300031711 Ga0265314_10157705 Ga0265314_101577052 328
738 3300031712 Ga0265342_10004383 Ga0265342_100043833 328
739 3300031712 Ga0265342_10014737 Ga0265342_100147374 328
740 3300031712 Ga0265342_10016447 Ga0265342_100164474 328
741 3300031712 Ga0265342_10124129 Ga0265342_101241291 328
742 3300031712 Ga0265342_10157430 Ga0265342_101574302 328
743 3300031727 Ga0316576_10013435 Ga0316576_100134353 328
744 3300031727 Ga0316576_10182389 Ga0316576_101823891 328
745 3300031728 Ga0316578_10059583 Ga0316578_100595833 328
746 3300031730 Ga0307516_10031335 Ga0307516_100313353 328
747 3300031730 Ga0307516_10096909 Ga0307516_100969092 328
748 3300031733 Ga0316577_10160350 Ga0316577_101603501 328
749 3300031901 Ga0307406_10250579 Ga0307406_102505791 328
750 3300032133 Ga0316583_10067993 Ga0316583_100679931 328
751 3300035112 Ga0373932_0010088 Ga0373932_0010088_216_1202 328
752 3300035398 Ga0316574_0000352 Ga0316574_0000352_11563_12552 328
753 3300035691 Ga0373931_0077843 Ga0373931_0077843_236_1222 328
754 3300035695 Ga0373927_0164301 Ga0373927_0164301_454_1440 328
755 3300035724 Ga0373933_0105309 Ga0373933_0105309_602_1588 328
756 3300036401 Ga0373937_0064174 Ga0373937_0064174_2005_2991 328
757 3300036712 Ga0316584_0009706 Ga0316584_0009706_2260_3246 328
758 3300037068 Ga0373925_0197132 Ga0373925_0197132_364_1350 328
759 3300037853 Ga0436364_0333080 Ga0436364_0333080_676_1662 328
760 3300039062 Ga0400483_135043 Ga0400483_135043_397_1383 328
761 3300039062 Ga0400483_281108 Ga0400483_281108_296_1309 328
762 3300039437 Ga0436365_0475170 Ga0436365_0475170_17548_18534 328
763 3300039437 Ga0436365_1234622 Ga0436365_1234622_113844_114833 328
764 3300039437 Ga0436365_1288885 Ga0436365_1288885_229_1215 328
765 3300041411 Ga0439466_0021703 Ga0439466_0021703_613_1602 328
766 3300041413 Ga0439465_0017434 Ga0439465_0017434_579_1565 328
767 3300041460 Ga0451802_1844261 Ga0451802_1844261_178_1167 328
768 3300042125 Ga0450923_029762 Ga0450923_029762_29_1018 328
769 3300042156 Ga0439446_0000671 Ga0439446_0000671_5939_6925 328
770 3300042436 Ga0439435_0046552 Ga0439435_0046552_208_1194 328
771 3300042532 Ga0450893_0005691 Ga0450893_0005691_119_1105 328
772 3300045051 Ga0451576_0007428 Ga0451576_0007428_11655_12641 328
773 3300045976 Ga0466967_0029530 Ga0466967_0029530_1251_2255 328
774 3300046453 Ga0495627_000982 Ga0495627_000982_13861_14847 328
775 3300046454 Ga0495592_0060587 Ga0495592_0060587_1718_2704 328
776 3300046460 Ga0495638_0000630 Ga0495638_0000630_34906_35892 328
777 3300046460 Ga0495638_0001553 Ga0495638_0001553_5840_6826 328
778 3300046460 Ga0495638_0004215 Ga0495638_0004215_4517_5503 328
779 3300046460 Ga0495638_0011286 Ga0495638_0011286_34_1020 328
780 3300046460 Ga0495638_0041946 Ga0495638_0041946_1866_2852 328
781 3300046460 Ga0495638_0050719 Ga0495638_0050719_1008_1994 328
782 3300046471 Ga0495650_0000168 Ga0495650_0000168_29264_30250 328
783 3300046472 Ga0495580_0127077 Ga0495580_0127077_72_1058 328
784 3300046473 Ga0495582_0009344 Ga0495582_0009344_2862_3848 328
785 3300046477 Ga0495664_0154767 Ga0495664_0154767_329_1327 328
786 3300046501 Ga0495607_0036129 Ga0495607_0036129_1741_2727 328
787 3300046506 Ga0495583_0000003 Ga0495583_0000003_498355_499341 328
788 3300046507 Ga0495606_0003044 Ga0495606_0003044_6433_7419 328
789 3300046507 Ga0495606_0022055 Ga0495606_0022055_93_1079 328
790 3300046512 Ga0495610_0000304 Ga0495610_0000304_23257_24243 328
791 3300046512 Ga0495610_0000327 Ga0495610_0000327_22600_23586 328
792 3300046513 Ga0495616_0000424 Ga0495616_0000424_2725_3711 328
793 3300046513 Ga0495616_0051868 Ga0495616_0051868_139_1125 328
794 3300046515 Ga0495620_0018490 Ga0495620_0018490_39_1025 328
795 3300046516 Ga0495628_0107137 Ga0495628_0107137_546_1532 328
796 3300046520 Ga0495637_0008163 Ga0495637_0008163_1899_2885 328
797 3300046520 Ga0495637_0015964 Ga0495637_0015964_1716_2702 328
798 3300046522 Ga0495643_0038431 Ga0495643_0038431_1489_2475 328
799 3300046524 Ga0495648_0000107 Ga0495648_0000107_33150_34136 328
800 3300046524 Ga0495648_0116548 Ga0495648_0116548_46_1032 328
801 3300046530 Ga0495654_0000085 Ga0495654_0000085_26879_27865 328
802 3300046536 Ga0495587_0165976 Ga0495587_0165976_257_1243 328
803 3300046537 Ga0495598_0014037 Ga0495598_0014037_856_1842 328
804 3300046543 Ga0495645_0023603 Ga0495645_0023603_665_1657 328
805 3300046543 Ga0495645_0038171 Ga0495645_0038171_1750_2748 328
806 3300046557 Ga0495622_0107712 Ga0495622_0107712_16_1002 328
807 3300046616 Ga0495668_0000746 Ga0495668_0000746_10232_11218 328
808 3300046616 Ga0495668_0003726 Ga0495668_0003726_1272_2258 328
809 3300046616 Ga0495668_0007740 Ga0495668_0007740_2412_3398 328
810 3300046616 Ga0495668_0013478 Ga0495668_0013478_1894_2880 328
811 3300046648 Ga0495611_0105030 Ga0495611_0105030_192_1178 328
812 3300046660 Ga0495625_0000767 Ga0495625_0000767_35821_36807 328
813 3300046660 Ga0495625_0005395 Ga0495625_0005395_9478_10464 328
814 3300046675 Ga0495657_0100059 Ga0495657_0100059_706_1692 328
815 3300046683 Ga0495658_0000599 Ga0495658_0000599_4422_5408 328
816 3300046794 Ga0495589_0001462 Ga0495589_0001462_7368_8354 328
817 3300046809 Ga0495600_0140857 Ga0495600_0140857_51_1037 328
818 3300046810 Ga0495660_0008737 Ga0495660_0008737_1637_2623 328
819 3300047319 Ga0495674_0196351 Ga0495674_0196351_433_1419 328
820 3300047320 Ga0495672_0000928 Ga0495672_0000928_21709_22695 328
821 3300047446 Ga0495679_014899 Ga0495679_014899_1160_2146 328
822 3300047469 Ga0495673_0000341 Ga0495673_0000341_16739_17725 328
823 3300047469 Ga0495673_0001139 Ga0495673_0001139_16680_17666 328
824 3300047469 Ga0495673_0006486 Ga0495673_0006486_4026_5012 328
825 3300047470 Ga0495681_0030152 Ga0495681_0030152_59_1045 328
826 3300047470 Ga0495681_0084494 Ga0495681_0084494_89_1075 328
827 3300047471 Ga0495684_0034555 Ga0495684_0034555_1975_2961 328
828 3300047472 Ga0495686_0000747 Ga0495686_0000747_23804_24790 328
829 3300047472 Ga0495686_0045393 Ga0495686_0045393_1220_2206 328
830 3300048088 Ga0495602_0116136 Ga0495602_0116136_769_1755 328
831 3300048905 Ga0496102_0066409 Ga0496102_0066409_576_1562 328
832 3300048909 Ga0496106_0007117 Ga0496106_0007117_3181_4167 328
833 3300048910 Ga0496107_0000039 Ga0496107_0000039_11200_12186 328
834 3300048913 Ga0496110_0092060 Ga0496110_0092060_1466_2458 328
835 3300048918 Ga0496115_0003347 Ga0496115_0003347_6102_7088 328
836 3300048924 Ga0496121_0000252 Ga0496121_0000252_74692_75678 328
837 3300048924 Ga0496121_0001159 Ga0496121_0001159_41896_42882 328
838 3300048928 Ga0496125_0031112 Ga0496125_0031112_263_1249 328
839 3300048929 Ga0496126_0000727 Ga0496126_0000727_19880_20866 328
840 3300048929 Ga0496126_0013404 Ga0496126_0013404_1765_2751 328
841 3300048929 Ga0496126_0055651 Ga0496126_0055651_2147_3133 328
842 3300049460 Ga0495682_0003930 Ga0495682_0003930_3364_4356 328
843 3300049569 Ga0501032_0002203 Ga0501032_0002203_12107_13093 328
844 3300049569 Ga0501032_0004526 Ga0501032_0004526_2136_3122 328
845 3300049569 Ga0501032_0053915 Ga0501032_0053915_1487_2473 328
846 3300049569 Ga0501032_0058193 Ga0501032_0058193_420_1409 328
847 3300049570 Ga0501033_0015545 Ga0501033_0015545_3433_4419 328
848 3300049570 Ga0501033_0024739 Ga0501033_0024739_680_1669 328
849 3300049570 Ga0501033_0073624 Ga0501033_0073624_535_1524 328
850 3300049570 Ga0501033_0098408 Ga0501033_0098408_781_1767 328
851 3300049570 Ga0501033_0099008 Ga0501033_0099008_902_1888 328
852 3300049570 Ga0501033_0099886 Ga0501033_0099886_1115_2101 328
853 3300049570 Ga0501033_0314467 Ga0501033_0314467_54_1040 328
854 3300049571 Ga0501034_0012600 Ga0501034_0012600_6486_7475 328
855 3300049571 Ga0501034_0022336 Ga0501034_0022336_1012_1998 328
856 3300049572 Ga0501036_0004899 Ga0501036_0004899_8692_9678 328
857 3300049572 Ga0501036_0095668 Ga0501036_0095668_439_1425 328
858 3300049572 Ga0501036_0108701 Ga0501036_0108701_242_1228 328
859 3300049572 Ga0501036_0349105 Ga0501036_0349105_28_1017 328
860 3300049573 Ga0501037_0001959 Ga0501037_0001959_11077_12063 328
861 3300049573 Ga0501037_0002456 Ga0501037_0002456_5283_6269 328
862 3300049573 Ga0501037_0017053 Ga0501037_0017053_4284_5270 328
863 3300049574 Ga0501038_0053379 Ga0501038_0053379_1298_2284 328
864 3300049574 Ga0501038_0103949 Ga0501038_0103949_251_1237 328
865 3300049575 Ga0501039_0011643 Ga0501039_0011643_3834_4820 328
866 3300049576 Ga0501040_0003010 Ga0501040_0003010_3603_4592 328
867 3300049576 Ga0501040_0173452 Ga0501040_0173452_529_1515 328
868 3300049577 Ga0501041_0022145 Ga0501041_0022145_2527_3516 328
869 3300049577 Ga0501041_0103916 Ga0501041_0103916_159_1145 328
870 3300049578 Ga0501042_0039915 Ga0501042_0039915_2049_3035 328
871 3300049578 Ga0501042_0077277 Ga0501042_0077277_29_1021 328
872 3300049579 Ga0501043_0010671 Ga0501043_0010671_805_1791 328
873 3300049579 Ga0501043_0020838 Ga0501043_0020838_1196_2182 328
874 3300049579 Ga0501043_0026335 Ga0501043_0026335_482_1468 328
875 3300049579 Ga0501043_0050934 Ga0501043_0050934_1089_2162 328
876 3300049579 Ga0501043_0053629 Ga0501043_0053629_351_1337 328
877 3300049580 Ga0501046_0003852 Ga0501046_0003852_8418_9404 328
878 3300049580 Ga0501046_0013669 Ga0501046_0013669_4931_5920 328
879 3300049581 Ga0501047_0001266 Ga0501047_0001266_2806_3795 328
880 3300049581 Ga0501047_0010001 Ga0501047_0010001_2637_3623 328
881 3300049581 Ga0501047_0023738 Ga0501047_0023738_4570_5556 328
882 3300049581 Ga0501047_0026727 Ga0501047_0026727_2958_3947 328
883 3300049581 Ga0501047_0088087 Ga0501047_0088087_1393_2382 328
884 3300049581 Ga0501047_0251854 Ga0501047_0251854_568_1554 328
885 3300049582 Ga0501048_0040017 Ga0501048_0040017_2223_3212 328
886 3300049582 Ga0501048_0051198 Ga0501048_0051198_376_1362 328
887 3300049583 Ga0501067_0000085 Ga0501067_0000085_22221_23207 328
888 3300049583 Ga0501067_0001059 Ga0501067_0001059_3777_4763 328
889 3300049583 Ga0501067_0002179 Ga0501067_0002179_5163_6152 328
890 3300049583 Ga0501067_0005948 Ga0501067_0005948_3786_4775 328
891 3300049584 Ga0501068_0005767 Ga0501068_0005767_5407_6393 328
892 3300049585 Ga0501069_0024563 Ga0501069_0024563_1077_2063 328
893 3300049585 Ga0501069_0029058 Ga0501069_0029058_510_1499 328
894 3300049585 Ga0501069_0039452 Ga0501069_0039452_499_1485 328
895 3300049586 Ga0501070_0000025 Ga0501070_0000025_24808_25794 328
896 3300049586 Ga0501070_0014812 Ga0501070_0014812_4579_5565 328
897 3300049586 Ga0501070_0038511 Ga0501070_0038511_591_1577 328
898 3300049586 Ga0501070_0189400 Ga0501070_0189400_454_1440 328
899 3300049587 Ga0501071_0046710 Ga0501071_0046710_1429_2418 328
900 3300049587 Ga0501071_0396737 Ga0501071_0396737_10_996 328
901 3300049588 Ga0501072_0002100 Ga0501072_0002100_3238_4227 328
902 3300049589 Ga0501073_0000007 Ga0501073_0000007_36739_37725 328
903 3300049589 Ga0501073_0001773 Ga0501073_0001773_10470_11459 328
904 3300049589 Ga0501073_0038609 Ga0501073_0038609_1801_2790 328
905 3300049589 Ga0501073_0102649 Ga0501073_0102649_937_1944 328
906 3300049590 Ga0501074_0001440 Ga0501074_0001440_7465_8451 328
907 3300049590 Ga0501074_0027512 Ga0501074_0027512_654_1643 328
908 3300049590 Ga0501074_0232036 Ga0501074_0232036_68_1054 328
909 3300049591 Ga0501075_0053326 Ga0501075_0053326_1784_2773 328
910 3300049592 Ga0501076_0001445 Ga0501076_0001445_13990_14979 328
911 3300049592 Ga0501076_0143471 Ga0501076_0143471_143_1129 328
912 3300049592 Ga0501076_0157297 Ga0501076_0157297_185_1171 328
913 3300049593 Ga0501077_0000003 Ga0501077_0000003_88241_89227 328
914 3300049593 Ga0501077_0006350 Ga0501077_0006350_5737_6726 328
915 3300049741 Ga0501079_0006332 Ga0501079_0006332_3996_4982 328
916 3300049741 Ga0501079_0061751 Ga0501079_0061751_1415_2404 328
917 3300049741 Ga0501079_0366496 Ga0501079_0366496_53_1042 328
918 3300049742 Ga0501080_0004728 Ga0501080_0004728_9058_10044 328
919 3300049742 Ga0501080_0005029 Ga0501080_0005029_6433_7422 328
920 3300049742 Ga0501080_0028987 Ga0501080_0028987_1974_2960 328
921 3300049742 Ga0501080_0084923 Ga0501080_0084923_1665_2654 328
922 3300049743 Ga0501081_0012020 Ga0501081_0012020_504_1493 328
923 3300049744 Ga0501083_0001498 Ga0501083_0001498_6949_7935 328
924 3300049744 Ga0501083_0011721 Ga0501083_0011721_2157_3164 328
925 3300049822 Ga0501035_0001043 Ga0501035_0001043_751_1737 328
926 3300049822 Ga0501035_0092990 Ga0501035_0092990_1042_2031 328
927 3300049822 Ga0501035_0133604 Ga0501035_0133604_14_1000 328
928 3300049822 Ga0501035_0207146 Ga0501035_0207146_672_1658 328
929 3300049823 Ga0501044_0001925 Ga0501044_0001925_102_1088 328
930 3300049823 Ga0501044_0002692 Ga0501044_0002692_14454_15440 328
931 3300049823 Ga0501044_0008454 Ga0501044_0008454_3762_4748 328
932 3300049823 Ga0501044_0012561 Ga0501044_0012561_6709_7698 328
933 3300049823 Ga0501044_0022552 Ga0501044_0022552_1685_2734 328
934 3300049823 Ga0501044_0030305 Ga0501044_0030305_1715_2704 328
935 3300049823 Ga0501044_0034886 Ga0501044_0034886_1815_2801 328
936 3300049823 Ga0501044_0136876 Ga0501044_0136876_651_1637 328
937 3300049823 Ga0501044_0144685 Ga0501044_0144685_311_1297 328
938 3300049823 Ga0501044_0167561 Ga0501044_0167561_597_1583 328
939 3300049824 Ga0501045_0005886 Ga0501045_0005886_7352_8341 328
940 3300049824 Ga0501045_0014128 Ga0501045_0014128_3348_4334 328
941 3300050493 nmdc:mga0k408_15860_c1 nmdc:mga0k408_15860_c1_2178_3164 328
942 3300050507 nmdc:mga05p37_44657_c1 nmdc:mga05p37_44657_c1_722_1711 328
943 3300050508 nmdc:mga09592_42316_c1 nmdc:mga09592_42316_c1_654_1643 328
944 3300050509 nmdc:mga0qj67_114776_c1 nmdc:mga0qj67_114776_c1_767_1756 328
945 3300050510 nmdc:mga06r32_3187_c1 nmdc:mga06r32_3187_c1_4894_5883 328
946 3300050512 nmdc:mga0n895_82729_c1 nmdc:mga0n895_82729_c1_305_1291 328
947 3300050513 nmdc:mga0rr50_20041_c1 nmdc:mga0rr50_20041_c1_368_1354 328
948 3300050514 nmdc:mga08x19_13933_c1 nmdc:mga08x19_13933_c1_1177_2163 328
949 3300050514 nmdc:mga08x19_41_c1 nmdc:mga08x19_41_c1_140934_141920 328
950 3300050516 nmdc:mga0sz30_2619_c1 nmdc:mga0sz30_2619_c1_2429_3415 328
951 3300053086 Ga0500578_0000015 Ga0500578_0000015_27044_28030 328
952 3300053087 Ga0500643_000026 Ga0500643_000026_230227_231213 328
953 3300053087 Ga0500643_001939 Ga0500643_001939_844_1830 328
954 3300053087 Ga0500643_008459 Ga0500643_008459_1472_2458 328
955 3300053088 Ga0500644_0000124 Ga0500644_0000124_32634_33620 328
956 3300053103 Ga0500555_007444 Ga0500555_007444_345_1331 328
957 3300053104 Ga0500556_0000933 Ga0500556_0000933_1562_2548 328
958 3300053116 Ga0500592_008792 Ga0500592_008792_65_1051 328
959 3300053118 Ga0500594_0000058 Ga0500594_0000058_6805_7791 328
960 3300053119 Ga0500595_001957 Ga0500595_001957_9466_10452 328
961 3300053119 Ga0500595_020103 Ga0500595_020103_394_1380 328
962 3300053119 Ga0500595_029456 Ga0500595_029456_84_1070 328
963 3300053122 Ga0500608_000011 Ga0500608_000011_53936_54922 328
964 3300053125 Ga0500618_000159 Ga0500618_000159_49506_50492 328
965 3300053134 Ga0500658_0001176 Ga0500658_0001176_2315_3301 328
966 3300053136 Ga0500559_0000009 Ga0500559_0000009_113113_114099 328
967 3300053136 Ga0500559_0002905 Ga0500559_0002905_551_1537 328
968 3300053136 Ga0500559_0003529 Ga0500559_0003529_4094_5080 328
969 3300053138 Ga0500564_001665 Ga0500564_001665_3058_4044 328
970 3300053139 Ga0500568_0025285 Ga0500568_0025285_435_1421 328
971 3300053140 Ga0500573_0000003 Ga0500573_0000003_35462_36448 328
972 3300053142 Ga0500577_0001234 Ga0500577_0001234_3537_4523 328
973 3300053153 Ga0500616_0005399 Ga0500616_0005399_908_1894 328
974 3300053156 Ga0500622_0000346 Ga0500622_0000346_22610_23596 328
975 3300053156 Ga0500622_0007558 Ga0500622_0007558_1631_2617 328
976 3300053158 Ga0500627_0012815 Ga0500627_0012815_1682_2668 328
977 3300053730 Ga0500645_022433 Ga0500645_022433_200_1186 328
978 3300053731 Ga0500609_002101 Ga0500609_002101_1715_2701 328
979 3300054114 Ga0501084_0000081 Ga0501084_0000081_25080_26069 328
980 3300054114 Ga0501084_0013295 Ga0501084_0013295_1689_2675 328
981 3300054114 Ga0501084_0025519 Ga0501084_0025519_2369_3358 328
982 3300054114 Ga0501084_0051122 Ga0501084_0051122_806_1795 328
983 3300060353 Ga0501082_0002024 Ga0501082_0002024_7434_8423 328
984 3300060353 Ga0501082_0002590 Ga0501082_0002590_9792_10778 328
985 3300060353 Ga0501082_0003567 Ga0501082_0003567_6268_7254 328
986 3300060353 Ga0501082_0006137 Ga0501082_0006137_5012_5998 328
987 3300060353 Ga0501082_0019395 Ga0501082_0019395_1484_2491 328
988 3300060353 Ga0501082_0125797 Ga0501082_0125797_242_1231 328
989 3300061734 Ga0530510_0009847 Ga0530510_0009847_486_1475 328
990 iso_pu_bacteria 2713897090 2715501525 328
991 iso_pu_bacteria 2855020534 2855021430 328
992 iso_pu_bacteria 2899275550 2899275722 328
993 3300005327 Ga0070658_10002784 Ga0070658_100027846 329
994 3300005341 Ga0070691_10041118 Ga0070691_100411183 329
995 3300005344 Ga0070661_100213257 Ga0070661_1002132572 329
996 3300005353 Ga0070669_100242408 Ga0070669_1002424082 329
997 3300005438 Ga0070701_10003193 Ga0070701_100031936 329
998 3300005445 Ga0070708_100016880 Ga0070708_1000168802 329
999 3300005456 Ga0070678_100007819 Ga0070678_1000078195 329
1000 3300005458 Ga0070681_10003070 Ga0070681_100030703 329
1001 3300005467 Ga0070706_100047102 Ga0070706_1000471023 329
1002 3300005471 Ga0070698_100001072 Ga0070698_10000107217 329
1003 3300005530 Ga0070679_100048104 Ga0070679_1000481041 329
1004 3300005548 Ga0070665_100025502 Ga0070665_1000255025 329
1005 3300005548 Ga0070665_100117714 Ga0070665_1001177142 329
1006 3300005563 Ga0068855_100001459 Ga0068855_10000145918 329
1007 3300005563 Ga0068855_100130111 Ga0068855_1001301113 329
1008 3300005563 Ga0068855_100281023 Ga0068855_1002810232 329
1009 3300005578 Ga0068854_100003176 Ga0068854_1000031768 329
1010 3300005614 Ga0068856_100091492 Ga0068856_1000914923 329
1011 3300005616 Ga0068852_100314820 Ga0068852_1003148202 329
1012 3300005617 Ga0068859_100347583 Ga0068859_1003475832 329
1013 3300005618 Ga0068864_100007442 Ga0068864_1000074425 329
1014 3300005842 Ga0068858_100025596 Ga0068858_1000255965 329
1015 3300005844 Ga0068862_100216270 Ga0068862_1002162702 329
1016 3300005937 Ga0081455_10003058 Ga0081455_1000305813 329
1017 3300005937 Ga0081455_10004726 Ga0081455_1000472611 329
1018 3300005937 Ga0081455_10014056 Ga0081455_100140563 329
1019 3300005937 Ga0081455_10045494 Ga0081455_100454944 329
1020 3300005985 Ga0081539_10001293 Ga0081539_1000129345 329
1021 3300005985 Ga0081539_10012018 Ga0081539_100120187 329
1022 3300006028 Ga0070717_10334769 Ga0070717_103347692 329
1023 3300006038 Ga0075365_10045568 Ga0075365_100455682 329
1024 3300006042 Ga0075368_10016233 Ga0075368_100162333 329
1025 3300006163 Ga0070715_10000073 Ga0070715_1000007329 329
1026 3300006175 Ga0070712_100053201 Ga0070712_1000532012 329
1027 3300006177 Ga0075362_10004991 Ga0075362_100049913 329
1028 3300006177 Ga0075362_10041504 Ga0075362_100415042 329
1029 3300006178 Ga0075367_10075222 Ga0075367_100752222 329
1030 3300006186 Ga0075369_10022742 Ga0075369_100227423 329
1031 3300006237 Ga0097621_100027543 Ga0097621_1000275434 329
1032 3300006358 Ga0068871_100019265 Ga0068871_1000192652 329
1033 3300006847 Ga0075431_100065979 Ga0075431_1000659794 329
1034 3300006880 Ga0075429_100017850 Ga0075429_1000178502 329
1035 3300006931 Ga0097620_100347603 Ga0097620_1003476032 329
1036 3300007076 Ga0075435_100049600 Ga0075435_1000496002 329
1037 3300009011 Ga0105251_10059285 Ga0105251_100592852 329
1038 3300009094 Ga0111539_10189306 Ga0111539_101893063 329
1039 3300009098 Ga0105245_10030652 Ga0105245_100306523 329
1040 3300009101 Ga0105247_10001227 Ga0105247_100012276 329
1041 3300009101 Ga0105247_10005586 Ga0105247_100055866 329
1042 3300009147 Ga0114129_10666771 Ga0114129_106667711 329
1043 3300009148 Ga0105243_10000233 Ga0105243_1000023337 329
1044 3300009148 Ga0105243_10203667 Ga0105243_102036672 329
1045 3300009174 Ga0105241_10004949 Ga0105241_1000494910 329
1046 3300009176 Ga0105242_10010792 Ga0105242_100107925 329
1047 3300009177 Ga0105248_10005964 Ga0105248_100059645 329
1048 3300009545 Ga0105237_10000727 Ga0105237_1000072711 329
1049 3300009551 Ga0105238_10016590 Ga0105238_100165906 329
1050 3300009551 Ga0105238_10068965 Ga0105238_100689653 329
1051 3300009553 Ga0105249_10002823 Ga0105249_1000282314 329
1052 3300009553 Ga0105249_10004035 Ga0105249_100040355 329
1053 3300010375 Ga0105239_10016604 Ga0105239_100166043 329
1054 3300011119 Ga0105246_10000058 Ga0105246_1000005811 329
1055 3300011119 Ga0105246_10015807 Ga0105246_100158072 329
1056 3300013102 Ga0157371_10012011 Ga0157371_100120112 329
1057 3300013104 Ga0157370_10021189 Ga0157370_100211892 329
1058 3300013104 Ga0157370_10261644 Ga0157370_102616441 329
1059 3300013105 Ga0157369_10007040 Ga0157369_100070403 329
1060 3300013296 Ga0157374_10015702 Ga0157374_100157022 329
1061 3300013297 Ga0157378_10007733 Ga0157378_100077335 329
1062 3300013306 Ga0163162_10008325 Ga0163162_100083253 329
1063 3300013307 Ga0157372_10002186 Ga0157372_1000218612 329
1064 3300013308 Ga0157375_10000904 Ga0157375_100009043 329
1065 3300013308 Ga0157375_10002641 Ga0157375_100026413 329
1066 3300014325 Ga0163163_10005141 Ga0163163_100051416 329
1067 3300014745 Ga0157377_10035649 Ga0157377_100356492 329
1068 3300014968 Ga0157379_10008980 Ga0157379_100089804 329
1069 3300014969 Ga0157376_10000941 Ga0157376_100009413 329
1070 3300017792 Ga0163161_10004854 Ga0163161_100048545 329
1071 3300021384 Ga0213876_10111848 Ga0213876_101118482 329
1072 3300021441 Ga0213871_10000661 Ga0213871_100006617 329
1073 3300025291 Ga0209675_1000594 Ga0209675_100059422 329
1074 3300025899 Ga0207642_10001307 Ga0207642_100013076 329
1075 3300025900 Ga0207710_10013005 Ga0207710_100130054 329
1076 3300025900 Ga0207710_10026191 Ga0207710_100261913 329
1077 3300025901 Ga0207688_10000068 Ga0207688_1000006834 329
1078 3300025903 Ga0207680_10071001 Ga0207680_100710011 329
1079 3300025904 Ga0207647_10001441 Ga0207647_100014414 329
1080 3300025905 Ga0207685_10008201 Ga0207685_100082014 329
1081 3300025906 Ga0207699_10183040 Ga0207699_101830403 329
1082 3300025909 Ga0207705_10032731 Ga0207705_100327315 329
1083 3300025912 Ga0207707_10010978 Ga0207707_100109786 329
1084 3300025913 Ga0207695_10081108 Ga0207695_100811083 329
1085 3300025914 Ga0207671_10206860 Ga0207671_102068602 329
1086 3300025915 Ga0207693_10000062 Ga0207693_1000006250 329
1087 3300025915 Ga0207693_10036069 Ga0207693_100360694 329
1088 3300025917 Ga0207660_10034446 Ga0207660_100344461 329
1089 3300025918 Ga0207662_10000382 Ga0207662_1000038214 329
1090 3300025919 Ga0207657_10000023 Ga0207657_1000002332 329
1091 3300025919 Ga0207657_10182937 Ga0207657_101829372 329
1092 3300025921 Ga0207652_10035426 Ga0207652_100354263 329
1093 3300025921 Ga0207652_10068847 Ga0207652_100688473 329
1094 3300025923 Ga0207681_10057652 Ga0207681_100576522 329
1095 3300025924 Ga0207694_10080240 Ga0207694_100802401 329
1096 3300025925 Ga0207650_10016010 Ga0207650_100160104 329
1097 3300025926 Ga0207659_10053494 Ga0207659_100534942 329
1098 3300025928 Ga0207700_10063078 Ga0207700_100630781 329
1099 3300025928 Ga0207700_10475639 Ga0207700_104756391 329
1100 3300025931 Ga0207644_10164411 Ga0207644_101644112 329
1101 3300025932 Ga0207690_10061099 Ga0207690_100610993 329
1102 3300025933 Ga0207706_10000019 Ga0207706_1000001939 329
1103 3300025934 Ga0207686_10049259 Ga0207686_100492593 329
1104 3300025935 Ga0207709_10097307 Ga0207709_100973071 329
1105 3300025936 Ga0207670_10118208 Ga0207670_101182082 329
1106 3300025937 Ga0207669_10013806 Ga0207669_100138063 329
1107 3300025939 Ga0207665_10000161 Ga0207665_1000016120 329
1108 3300025941 Ga0207711_10076483 Ga0207711_100764832 329
1109 3300025944 Ga0207661_10130999 Ga0207661_101309992 329
1110 3300025945 Ga0207679_10007069 Ga0207679_100070697 329
1111 3300025949 Ga0207667_10076221 Ga0207667_100762212 329
1112 3300025960 Ga0207651_10037138 Ga0207651_100371384 329
1113 3300025972 Ga0207668_10221841 Ga0207668_102218411 329
1114 3300025981 Ga0207640_10036503 Ga0207640_100365031 329
1115 3300026035 Ga0207703_10078539 Ga0207703_100785391 329
1116 3300026035 Ga0207703_10080579 Ga0207703_100805793 329
1117 3300026041 Ga0207639_10010223 Ga0207639_100102237 329
1118 3300026078 Ga0207702_10251055 Ga0207702_102510552 329
1119 3300026088 Ga0207641_10008603 Ga0207641_100086033 329
1120 3300026089 Ga0207648_10217564 Ga0207648_102175642 329
1121 3300026121 Ga0207683_10000030 Ga0207683_1000003061 329
1122 3300026121 Ga0207683_10005546 Ga0207683_100055465 329
1123 3300026142 Ga0207698_10010246 Ga0207698_100102467 329
1124 3300026142 Ga0207698_10012872 Ga0207698_100128723 329
1125 3300027614 Ga0209970_1011689 Ga0209970_10116892 329
1126 3300027866 Ga0209813_10001922 Ga0209813_100019223 329
1127 3300027907 Ga0207428_10030235 Ga0207428_100302354 329
1128 3300028379 Ga0268266_10018037 Ga0268266_100180375 329
1129 3300028379 Ga0268266_10075974 Ga0268266_100759743 329
1130 3300028379 Ga0268266_10354493 Ga0268266_103544931 329
1131 3300028380 Ga0268265_10014057 Ga0268265_100140574 329
1132 3300028381 Ga0268264_10061091 Ga0268264_100610914 329
1133 3300028381 Ga0268264_10116440 Ga0268264_101164402 329
1134 3300028381 Ga0268264_10210866 Ga0268264_102108661 329
1135 3300031238 Ga0265332_10031370 Ga0265332_100313702 329
1136 3300031456 Ga0307513_10276107 Ga0307513_102761071 329
1137 3300033180 Ga0307510_10104114 Ga0307510_101041143 329
1138 3300035115 Ga0373941_0016579 Ga0373941_0016579_335_1324 329
1139 3300035171 Ga0373946_0006820 Ga0373946_0006820_2304_3293 329
1140 3300035241 Ga0373961_0038739 Ga0373961_0038739_303_1292 329
1141 3300035691 Ga0373931_0003402 Ga0373931_0003402_5343_6332 329
1142 3300035691 Ga0373931_0174984 Ga0373931_0174984_86_1075 329
1143 3300035692 Ga0373935_0006127 Ga0373935_0006127_2600_3589 329
1144 3300035695 Ga0373927_0013002 Ga0373927_0013002_1032_2021 329
1145 3300035724 Ga0373933_0031667 Ga0373933_0031667_112_1107 329
1146 3300035725 Ga0373947_0001758 Ga0373947_0001758_3522_4511 329
1147 3300036401 Ga0373937_0033613 Ga0373937_0033613_1914_2903 329
1148 3300036401 Ga0373937_0389773 Ga0373937_0389773_267_1262 329
1149 3300037068 Ga0373925_0018181 Ga0373925_0018181_2239_3228 329
1150 3300037068 Ga0373925_0036064 Ga0373925_0036064_1361_2356 329
1151 3300037312 Ga0395899_0037418 Ga0395899_0037418_1945_2940 329
1152 3300037312 Ga0395899_0039495 Ga0395899_0039495_447_1442 329
1153 3300037312 Ga0395899_0060349 Ga0395899_0060349_1376_2371 329
1154 3300037418 Ga0395900_0004486 Ga0395900_0004486_9876_10871 329
1155 3300037418 Ga0395900_0006180 Ga0395900_0006180_7810_8799 329
1156 3300037418 Ga0395900_0014278 Ga0395900_0014278_6356_7351 329
1157 3300037466 Ga0395898_0010699 Ga0395898_0010699_7893_8882 329
1158 3300037471 Ga0395905_0001096 Ga0395905_0001096_27550_28539 329
1159 3300038443 Ga0395901_0001359 Ga0395901_0001359_13313_14302 329
1160 3300038443 Ga0395901_0066304 Ga0395901_0066304_716_1711 329
1161 3300038443 Ga0395901_0118182 Ga0395901_0118182_775_1770 329
1162 3300038735 Ga0400485_22443 Ga0400485_22443_148_1137 329
1163 3300039437 Ga0436365_1459791 Ga0436365_1459791_16717_17709 329
1164 3300039438 Ga0436360_0150887 Ga0436360_0150887_2655_3650 329
1165 3300044694 Ga0466963_0087761 Ga0466963_0087761_827_1822 329
1166 3300045976 Ga0466967_0031838 Ga0466967_0031838_3150_4145 329
1167 3300046455 Ga0495603_0000238 Ga0495603_0000238_10137_11126 329
1168 3300046459 Ga0495629_0000781 Ga0495629_0000781_16900_17889 329
1169 3300046461 Ga0495641_0026239 Ga0495641_0026239_1495_2484 329
1170 3300046472 Ga0495580_0000522 Ga0495580_0000522_18118_19107 329
1171 3300046473 Ga0495582_0001486 Ga0495582_0001486_5361_6350 329
1172 3300046475 Ga0495639_0001124 Ga0495639_0001124_9400_10389 329
1173 3300046491 Ga0495584_0028845 Ga0495584_0028845_1535_2524 329
1174 3300046499 Ga0495594_0000025 Ga0495594_0000025_60238_61227 329
1175 3300046517 Ga0495630_0071733 Ga0495630_0071733_496_1485 329
1176 3300046526 Ga0495666_0015200 Ga0495666_0015200_2715_3704 329
1177 3300046531 Ga0495665_0028074 Ga0495665_0028074_1387_2376 329
1178 3300046557 Ga0495622_0000622 Ga0495622_0000622_9383_10372 329
1179 3300046642 Ga0495634_0009966 Ga0495634_0009966_3700_4689 329
1180 3300046674 Ga0495588_0000606 Ga0495588_0000606_11073_12062 329
1181 3300046681 Ga0495647_0006508 Ga0495647_0006508_2208_3197 329
1182 3300046683 Ga0495658_0006747 Ga0495658_0006747_72_1061 329
1183 3300046689 Ga0495613_0000236 Ga0495613_0000236_7611_8600 329
1184 3300047315 Ga0495581_0000730 Ga0495581_0000730_8156_9145 329
1185 3300047321 Ga0495676_0009487 Ga0495676_0009487_5702_6691 329
1186 3300047322 Ga0495680_0014657 Ga0495680_0014657_2456_3445 329
1187 3300047471 Ga0495684_0137770 Ga0495684_0137770_186_1175 329
1188 3300047472 Ga0495686_0099990 Ga0495686_0099990_432_1424 329
1189 3300047673 Ga0495593_0000510 Ga0495593_0000510_8648_9637 329
1190 3300048089 Ga0495614_0018939 Ga0495614_0018939_1527_2516 329
1191 3300048903 Ga0496100_0002607 Ga0496100_0002607_3285_4274 329
1192 3300048903 Ga0496100_0006527 Ga0496100_0006527_2621_3610 329
1193 3300048903 Ga0496100_0113334 Ga0496100_0113334_233_1222 329
1194 3300048904 Ga0496101_0036774 Ga0496101_0036774_287_1276 329
1195 3300048904 Ga0496101_0067439 Ga0496101_0067439_44_1033 329
1196 3300048905 Ga0496102_0012951 Ga0496102_0012951_424_1413 329
1197 3300048905 Ga0496102_0126380 Ga0496102_0126380_278_1366 329
1198 3300048906 Ga0496103_0017970 Ga0496103_0017970_3085_4074 329
1199 3300048906 Ga0496103_0028238 Ga0496103_0028238_2087_3175 329
1200 3300048907 Ga0496104_0047526 Ga0496104_0047526_1580_2569 329
1201 3300048907 Ga0496104_0119660 Ga0496104_0119660_1011_2000 329
1202 3300048907 Ga0496104_0175958 Ga0496104_0175958_182_1171 329
1203 3300048908 Ga0496105_0003994 Ga0496105_0003994_8268_9257 329
1204 3300048908 Ga0496105_0013484 Ga0496105_0013484_1221_2210 329
1205 3300048909 Ga0496106_0002924 Ga0496106_0002924_10956_12044 329
1206 3300048909 Ga0496106_0034967 Ga0496106_0034967_1898_2887 329
1207 3300048909 Ga0496106_0066770 Ga0496106_0066770_44_1033 329
1208 3300048910 Ga0496107_0024954 Ga0496107_0024954_1662_2651 329
1209 3300048910 Ga0496107_0029144 Ga0496107_0029144_86_1174 329
1210 3300048910 Ga0496107_0115612 Ga0496107_0115612_139_1128 329
1211 3300048910 Ga0496107_0203386 Ga0496107_0203386_413_1402 329
1212 3300048911 Ga0496108_0017563 Ga0496108_0017563_1580_2569 329
1213 3300048912 Ga0496109_0061219 Ga0496109_0061219_2028_3017 329
1214 3300048912 Ga0496109_0097975 Ga0496109_0097975_1394_2383 329
1215 3300048912 Ga0496109_0123179 Ga0496109_0123179_1217_2206 329
1216 3300048912 Ga0496109_0165455 Ga0496109_0165455_928_1917 329
1217 3300048913 Ga0496110_0090072 Ga0496110_0090072_278_1267 329
1218 3300048913 Ga0496110_0190602 Ga0496110_0190602_128_1117 329
1219 3300048914 Ga0496111_0038045 Ga0496111_0038045_423_1412 329
1220 3300048914 Ga0496111_0051567 Ga0496111_0051567_523_1512 329
1221 3300048914 Ga0496111_0176431 Ga0496111_0176431_494_1483 329
1222 3300048915 Ga0496112_0004792 Ga0496112_0004792_1437_2426 329
1223 3300048915 Ga0496112_0044902 Ga0496112_0044902_584_1573 329
1224 3300048915 Ga0496112_0119498 Ga0496112_0119498_1321_2310 329
1225 3300048915 Ga0496112_0161637 Ga0496112_0161637_650_1639 329
1226 3300048916 Ga0496113_0008962 Ga0496113_0008962_44_1033 329
1227 3300048916 Ga0496113_0090908 Ga0496113_0090908_1320_2309 329
1228 3300048917 Ga0496114_0037711 Ga0496114_0037711_676_1665 329
1229 3300048917 Ga0496114_0045731 Ga0496114_0045731_1410_2399 329
1230 3300048918 Ga0496115_0017925 Ga0496115_0017925_2951_3940 329
1231 3300048918 Ga0496115_0068425 Ga0496115_0068425_1587_2675 329
1232 3300048918 Ga0496115_0141855 Ga0496115_0141855_258_1247 329
1233 3300048918 Ga0496115_0259935 Ga0496115_0259935_44_1033 329
1234 3300049570 Ga0501033_0196654 Ga0501033_0196654_242_1234 329
1235 3300049571 Ga0501034_0004302 Ga0501034_0004302_10597_11592 329
1236 3300049571 Ga0501034_0008173 Ga0501034_0008173_2957_3952 329
1237 3300049571 Ga0501034_0048228 Ga0501034_0048228_691_1686 329
1238 3300049574 Ga0501038_0037016 Ga0501038_0037016_3277_4266 329
1239 3300049574 Ga0501038_0189203 Ga0501038_0189203_231_1220 329
1240 3300049575 Ga0501039_0138145 Ga0501039_0138145_771_1760 329
1241 3300049578 Ga0501042_0033845 Ga0501042_0033845_2210_3199 329
1242 3300049579 Ga0501043_0138179 Ga0501043_0138179_496_1491 329
1243 3300049579 Ga0501043_0154178 Ga0501043_0154178_39_1028 329
1244 3300049580 Ga0501046_0164987 Ga0501046_0164987_625_1614 329
1245 3300049587 Ga0501071_0026868 Ga0501071_0026868_2493_3482 329
1246 3300049588 Ga0501072_0103105 Ga0501072_0103105_835_1824 329
1247 3300049591 Ga0501075_0058984 Ga0501075_0058984_273_1262 329
1248 3300049592 Ga0501076_0007581 Ga0501076_0007581_6329_7318 329
1249 3300049592 Ga0501076_0011267 Ga0501076_0011267_4998_5987 329
1250 3300049592 Ga0501076_0060163 Ga0501076_0060163_346_1335 329
1251 3300049593 Ga0501077_0079088 Ga0501077_0079088_212_1201 329
1252 3300049741 Ga0501079_0017908 Ga0501079_0017908_580_1569 329
1253 3300049741 Ga0501079_0185611 Ga0501079_0185611_478_1467 329
1254 3300049742 Ga0501080_0205982 Ga0501080_0205982_387_1376 329
1255 3300049743 Ga0501081_0129475 Ga0501081_0129475_768_1757 329
1256 3300049823 Ga0501044_0197105 Ga0501044_0197105_368_1360 329
1257 3300049823 Ga0501044_0345544 Ga0501044_0345544_69_1064 329
1258 3300049824 Ga0501045_0047700 Ga0501045_0047700_1358_2347 329
1259 3300049824 Ga0501045_0135685 Ga0501045_0135685_660_1649 329
1260 3300050489 nmdc:mga03683_34840_c1 nmdc:mga03683_34840_c1_215_1210 329
1261 3300050489 nmdc:mga03683_3506_c1 nmdc:mga03683_3506_c1_1062_2057 329
1262 3300050492 nmdc:mga0yw44_167449_c1 nmdc:mga0yw44_167449_c1_202_1197 329
1263 3300050492 nmdc:mga0yw44_31592_c1 nmdc:mga0yw44_31592_c1_949_1944 329
1264 3300050494 nmdc:mga06z11_31876_c1 nmdc:mga06z11_31876_c1_1306_2295 329
1265 3300050494 nmdc:mga06z11_4172_c1 nmdc:mga06z11_4172_c1_3603_4598 329
1266 3300050495 nmdc:mga04h51_6296_c1 nmdc:mga04h51_6296_c1_596_1585 329
1267 3300050508 nmdc:mga09592_63019_c1 nmdc:mga09592_63019_c1_152_1141 329
1268 3300050510 nmdc:mga06r32_64174_c1 nmdc:mga06r32_64174_c1_1226_2215 329
1269 3300050511 nmdc:mga08y16_437739_c1 nmdc:mga08y16_437739_c1_322_1317 329
1270 3300050513 nmdc:mga0rr50_12405_c1 nmdc:mga0rr50_12405_c1_3569_4558 329
1271 3300050514 nmdc:mga08x19_166604_c1 nmdc:mga08x19_166604_c1_323_1312 329
1272 3300050515 nmdc:mga0a205_19730_c1 nmdc:mga0a205_19730_c1_1279_2268 329
1273 3300050516 nmdc:mga0sz30_113_c1 nmdc:mga0sz30_113_c1_1060_2055 329
1274 3300050516 nmdc:mga0sz30_16001_c1 nmdc:mga0sz30_16001_c1_854_1849 329
1275 3300050516 nmdc:mga0sz30_22710_c1 nmdc:mga0sz30_22710_c1_308_1303 329
1276 3300053085 Ga0495619_0004224 Ga0495619_0004224_6941_7930 329
1277 3300053092 Ga0500583_0105967 Ga0500583_0105967_354_1343 329
1278 3300053096 Ga0500641_0092762 Ga0500641_0092762_170_1159 329
1279 3300053153 Ga0500616_0013996 Ga0500616_0013996_3222_4217 329
1280 3300054114 Ga0501084_0044319 Ga0501084_0044319_2422_3411 329
1281 3300060353 Ga0501082_0040386 Ga0501082_0040386_1560_2549 329
1282 3300060353 Ga0501082_0138708 Ga0501082_0138708_200_1189 329
1283 3300061734 Ga0530510_0022825 Ga0530510_0022825_17_1006 329
1284 iso_pu_bacteria 2508501128 2509150207 329
1285 iso_pu_bacteria 2509276021 2509389053 329
1286 iso_pu_bacteria 2509276033 2509444639 329
1287 iso_pu_bacteria 2510065019 2510135613 329
1288 iso_pu_bacteria 2510461076 2510897083 329
1289 iso_pu_bacteria 2510917028 2511185536 329
1290 iso_pu_bacteria 2510917030 2511194278 329
1291 iso_pu_bacteria 2513237084 2513570776 329
1292 iso_pu_bacteria 2513237085 2513575011 329
1293 iso_pu_bacteria 2513237087 2513590538 329
1294 iso_pu_bacteria 2513237088 2513599544 329
1295 iso_pu_bacteria 2513237093 2513633794 329
1296 iso_pu_bacteria 2513237098 2513677550 329
1297 iso_pu_bacteria 2513237101 2513694256 329
1298 iso_pu_bacteria 2513237103 2513713052 329
1299 iso_pu_bacteria 2513237138 2513868513 329
1300 iso_pu_bacteria 2513237141 2513888895 329
1301 iso_pu_bacteria 2513237144 2513912542 329
1302 iso_pu_bacteria 2513237146 2513924213 329
1303 iso_pu_bacteria 2513237162 2514023622 329
1304 iso_pu_bacteria 2515075009 2515114777 329
1305 iso_pu_bacteria 2515154113 2515638088 329
1306 iso_pu_bacteria 2515154114 2515641483 329
1307 iso_pu_bacteria 2515154116 2515659372 329
1308 iso_pu_bacteria 2515154134 2515741238 329
1309 iso_pu_bacteria 2516653077 2517038392 329
1310 iso_pu_bacteria 2516653085 2517078671 329
1311 iso_pu_bacteria 2517093000 2517097413 329
1312 iso_pu_bacteria 2517287029 2517408867 329
1313 iso_pu_bacteria 2524023210 2524467363 329
1314 iso_pu_bacteria 2582581294 2585201419 329
1315 iso_pu_bacteria 2582581299 2585232320 329
1316 iso_pu_bacteria 2582581304 2585259584 329
1317 iso_pu_bacteria 2582581867 2585405072 329
1318 iso_pu_bacteria 2585427526 2585524014 329
1319 iso_pu_bacteria 2585427528 2585542177 329
1320 iso_pu_bacteria 2585427590 2585825121 329
1321 iso_pu_bacteria 2585427593 2585840627 329
1322 iso_pu_bacteria 2585427594 2585843584 329
1323 iso_pu_bacteria 2599185170 2599419834 329
1324 iso_pu_bacteria 2615840624 2616294014 329
1325 iso_pu_bacteria 2643221599 2644004218 329
1326 iso_pu_bacteria 2643221634 2644191103 329
1327 iso_pu_bacteria 2643221643 2644237847 329
1328 iso_pu_bacteria 2643221651 2644290829 329
1329 iso_pu_bacteria 2718217882 2719183279 329
1330 iso_pu_bacteria 2718217927 2719388036 329
1331 iso_pu_bacteria 2718217997 2719667654 329
1332 iso_pu_bacteria 2718218009 2719733996 329
1333 iso_pu_bacteria 2718218199 2720494074 329
1334 iso_pu_bacteria 2718218232 2720615537 329
1335 iso_pu_bacteria 2718218233 2720622320 329
1336 iso_pu_bacteria 2718218235 2720633674 329
1337 iso_pu_bacteria 2718218269 2720777374 329
1338 iso_pu_bacteria 2718218363 2721149391 329
1339 iso_pu_bacteria 2718218365 2721160794 329
1340 iso_pu_bacteria 2718218366 2721166228 329
1341 iso_pu_bacteria 2718218423 2721401669 329
1342 iso_pu_bacteria 2721755514 2722842398 329
1343 iso_pu_bacteria 2721755556 2723028972 329
1344 iso_pu_bacteria 2721755684 2723562588 329
1345 iso_pu_bacteria 2721755685 2723569281 329
1346 iso_pu_bacteria 2721755755 2723841493 329
1347 iso_pu_bacteria 2721755809 2724040483 329
1348 iso_pu_bacteria 2721755810 2724046752 329
1349 iso_pu_bacteria 2721755819 2724091981 329
1350 iso_pu_bacteria 2721755822 2724106546 329
1351 iso_pu_bacteria 2721755823 2724112353 329
1352 iso_pu_bacteria 2724679232 2725951962 329
1353 iso_pu_bacteria 2728368998 2728750204 329
1354 iso_pu_bacteria 2728369352 2730109908 329
1355 iso_pu_bacteria 2728369365 2730166514 329
1356 iso_pu_bacteria 2728369397 2730300426 329
1357 iso_pu_bacteria 2738541293 2738800662 329
1358 iso_pu_bacteria 2738541333 2739037412 329
1359 iso_pu_bacteria 2765235942 2766067219 329
1360 iso_pu_bacteria 2791355256 2793298404 329
1361 iso_pu_bacteria 2791355259 2793315755 329
1362 iso_pu_bacteria 2791355260 2793323537 329
1363 iso_pu_bacteria 2791355261 2793327515 329
1364 iso_pu_bacteria 2791355262 2793335586 329
1365 iso_pu_bacteria 2791355263 2793340975 329
1366 iso_pu_bacteria 2791355264 2793350340 329
1367 iso_pu_bacteria 2791355265 2793354714 329
1368 iso_pu_bacteria 2791355267 2793369045 329
1369 iso_pu_bacteria 2802429605 2805928964 329
1370 iso_pu_bacteria 2802429606 2805934585 329
1371 iso_pu_bacteria 2802429633 2806047139 329
1372 iso_pu_bacteria 2802429634 2806054862 329
1373 iso_pu_bacteria 2802429635 2806061910 329
1374 iso_pu_bacteria 2802429636 2806069567 329
1375 iso_pu_bacteria 2802429637 2806076062 329
1376 iso_pu_bacteria 2828305725 2828306557 329
1377 iso_pu_bacteria 2834578030 2834581205 329
1378 iso_pu_bacteria 2838016132 2838020884 329
1379 iso_pu_bacteria 2838022645 2838026791 329
1380 iso_pu_bacteria 2838035591 2838039636 329
1381 iso_pu_bacteria 2838042994 2838044914 329
1382 iso_pu_bacteria 2838068647 2838070459 329
1383 iso_pu_bacteria 2838661181 2838663907 329
1384 iso_pu_bacteria 2838668709 2838672591 329
1385 iso_pu_bacteria 2838686498 2838689898 329
1386 iso_pu_bacteria 2838701080 2838705086 329
1387 iso_pu_bacteria 2838729681 2838731406 329
1388 iso_pu_bacteria 2838742623 2838744347 329
1389 iso_pu_bacteria 2841851746 2841852887 329
1390 iso_pu_bacteria 2841864319 2841870266 329
1391 iso_pu_bacteria 2842110456 2842112806 329
1392 iso_pu_bacteria 2842146304 2842150080 329
1393 iso_pu_bacteria 2842156927 2842160214 329
1394 iso_pu_bacteria 2842163707 2842165808 329
1395 iso_pu_bacteria 2842180545 2842184120 329
1396 iso_pu_bacteria 2842192696 2842196425 329
1397 iso_pu_bacteria 2842198810 2842202492 329
1398 iso_pu_bacteria 2842205361 2842208851 329
1399 iso_pu_bacteria 2842217011 2842219484 329
1400 iso_pu_bacteria 2842229732 2842231702 329
1401 iso_pu_bacteria 2842243621 2842245829 329
1402 iso_pu_bacteria 2842250916 2842254766 329
1403 iso_pu_bacteria 2842257432 2842260207 329
1404 iso_pu_bacteria 2842264693 2842267088 329
1405 iso_pu_bacteria 2842271015 2842273618 329
1406 iso_pu_bacteria 2842278818 2842282459 329
1407 iso_pu_bacteria 2842285085 2842290002 329
1408 iso_pu_bacteria 2842304105 2842308530 329
1409 iso_pu_bacteria 2842311132 2842312161 329
1410 iso_pu_bacteria 2842317721 2842321760 329
1411 iso_pu_bacteria 2842341865 2842344717 329
1412 iso_pu_bacteria 2842363717 2842367708 329
1413 iso_pu_bacteria 2842395702 2842397903 329
1414 iso_pu_bacteria 2842402390 2842407611 329
1415 iso_pu_bacteria 2842409023 2842414242 329
1416 iso_pu_bacteria 2842415677 2842420898 329
1417 iso_pu_bacteria 2842422224 2842424073 329
1418 iso_pu_bacteria 2842428310 2842431216 329
1419 iso_pu_bacteria 2842434925 2842437551 329
1420 iso_pu_bacteria 2842441272 2842444366 329
1421 iso_pu_bacteria 2842462802 2842465359 329
1422 iso_pu_bacteria 2842469257 2842472172 329
1423 iso_pu_bacteria 2842489311 2842494048 329
1424 iso_pu_bacteria 2842495871 2842501305 329
1425 iso_pu_bacteria 2844454524 2844456646 329
1426 iso_pu_bacteria 2857516855 2857520943 329
1427 iso_pu_bacteria 2879110137 2879113023 329
1428 iso_pu_bacteria 2885383462 2885389745 329
1429 iso_pu_bacteria 2899259804 2899262175 329
1430 iso_pu_bacteria 2903748898 2903759017 329
1431 iso_pu_bacteria 2903768456 2903773395 329
1432 iso_pu_bacteria 2904690495 2904690652 329
1433 iso_pu_bacteria 2908756301 2908756358 329
1434 iso_pu_bacteria 2919100787 2919101930 329
1435 iso_pu_bacteria 2919450847 2919455166 329
1436 iso_pu_bacteria 2922361189 2922364135 329
1437 iso_pu_bacteria 2923556063 2923561734 329
1438 iso_pu_bacteria 2933570622 2933574979 329
1439 iso_pu_bacteria 2933586486 2933588304 329
1440 iso_pu_bacteria 2933599457 2933601263 329
1441 iso_pu_bacteria 2935901341 2935902267 329
1442 iso_pu_bacteria 2936367885 2936369598 329
1443 iso_pu_bacteria 2936375103 2936380338 329
1444 iso_pu_bacteria 2936381700 2936385197 329
1445 iso_pu_bacteria 2996887358 2996889754 329
1446 iso_pu_bacteria 2996893221 2996897122 329
1447 iso_pu_bacteria 3005409236 3005410538 329
1448 iso_pu_bacteria 3005445848 3005450002 329
1449 iso_pu_bacteria 3005452660 3005456217 329
1450 iso_pu_bacteria 639633055 639646011 329
1451 iso_pu_bacteria 8001845381 8001848175 329
1452 iso_pu_bacteria 8005258706 8005261600 329
1453 iso_pu_bacteria 8005275841 8005278237 329
1454 iso_pu_bacteria 8005282627 8005282735 329
1455 iso_pu_bacteria 8005289223 8005291701 329
1456 iso_pu_bacteria 8005301065 8005305424 329
1457 iso_pu_bacteria 8005307578 8005310197 329
1458 iso_pu_bacteria 8005321885 8005324281 329
1459 iso_pu_bacteria 8005376324 8005378155 329
1460 iso_pu_bacteria 8005382845 8005384163 329
1461 iso_pu_bacteria 8005395548 8005399559 329
1462 iso_pu_bacteria 8005430974 8005432313 329
1463 iso_pu_bacteria 8005460587 8005465472 329
1464 iso_pu_bacteria 8005497431 8005498048 329
1465 iso_pu_bacteria 8005542996 8005543088 329
1466 iso_pu_bacteria 8005556819 8005559918 329
1467 iso_pu_bacteria 8005563573 8005564586 329
1468 iso_pu_bacteria 8005570704 8005571276 329
1469 iso_pu_bacteria 8005619151 8005619262 329
1470 iso_pu_bacteria 8005626139 8005627823 329
1471 iso_pu_bacteria 8005668836 8005669456 329
1472 iso_pu_bacteria 8005688590 8005692824 329
1473 iso_pu_bacteria 8005695170 8005701531 329
1474 iso_pu_bacteria 8006964411 8006969480 329
1475 iso_pu_bacteria 8018127388 8018132482 329
1476 iso_pu_bacteria 8018163183 8018167662 329
1477 iso_pu_bacteria 8018176218 8018176675 329
1478 iso_pu_bacteria 8023680758 8023681327 329
1479 iso_pu_bacteria 8024479707 8024481841 329
1480 iso_pu_bacteria 8024501048 8024506279 329
1481 iso_pu_bacteria 8056375014 8056381249 329
1482 iso_pu_bacteria 8056382006 8056382736 329
1483 iso_pu_bacteria 8056673599 8056675592 329
1484 iso_pu_bacteria 8056681323 8056687538 329
1485 iso_pu_bacteria 8056689827 8056694569 329
1486 iso_pu_bacteria 8057132660 8057133026 329
1487 iso_pu_bacteria 8057874678 8057877176 329
1488 3300005336 Ga0070680_100032161 Ga0070680_1000321613 330
1489 3300005341 Ga0070691_10020657 Ga0070691_100206572 330
1490 3300005441 Ga0070700_100000562 Ga0070700_10000056216 330
1491 3300005444 Ga0070694_100005444 Ga0070694_1000054446 330
1492 3300005455 Ga0070663_100049211 Ga0070663_1000492113 330
1493 3300005468 Ga0070707_100216663 Ga0070707_1002166632 330
1494 3300005471 Ga0070698_100236948 Ga0070698_1002369482 330
1495 3300005518 Ga0070699_100000345 Ga0070699_10000034516 330
1496 3300005545 Ga0070695_100001235 Ga0070695_10000123511 330
1497 3300005546 Ga0070696_100000049 Ga0070696_10000004917 330
1498 3300005547 Ga0070693_100097590 Ga0070693_1000975902 330
1499 3300005549 Ga0070704_100000535 Ga0070704_10000053515 330
1500 3300005577 Ga0068857_100003727 Ga0068857_1000037277 330
1501 3300005617 Ga0068859_100462183 Ga0068859_1004621832 330
1502 3300005843 Ga0068860_100008983 Ga0068860_1000089832 330
1503 3300005844 Ga0068862_100042147 Ga0068862_1000421473 330
1504 3300006871 Ga0075434_100093977 Ga0075434_1000939771 330
1505 3300006931 Ga0097620_100462170 Ga0097620_1004621701 330
1506 3300009148 Ga0105243_10045498 Ga0105243_100454982 330
1507 3300009176 Ga0105242_10390764 Ga0105242_103907642 330
1508 3300010375 Ga0105239_10410635 Ga0105239_104106352 330
1509 3300013105 Ga0157369_10636720 Ga0157369_106367201 330
1510 3300014325 Ga0163163_10094400 Ga0163163_100944002 330
1511 3300014326 Ga0157380_10444161 Ga0157380_104441611 330
1512 3300014968 Ga0157379_10071700 Ga0157379_100717003 330
1513 3300017792 Ga0163161_10074115 Ga0163161_100741152 330
1514 3300025885 Ga0207653_10001781 Ga0207653_100017812 330
1515 3300025915 Ga0207693_10142639 Ga0207693_101426392 330
1516 3300025917 Ga0207660_10128027 Ga0207660_101280272 330
1517 3300025933 Ga0207706_10045695 Ga0207706_100456952 330
1518 3300025935 Ga0207709_10019254 Ga0207709_100192542 330
1519 3300026035 Ga0207703_10175886 Ga0207703_101758862 330
1520 3300026067 Ga0207678_10008827 Ga0207678_100088273 330
1521 3300026067 Ga0207678_10091829 Ga0207678_100918291 330
1522 3300026075 Ga0207708_10000637 Ga0207708_1000063722 330
1523 3300026095 Ga0207676_10082027 Ga0207676_100820272 330
1524 3300026116 Ga0207674_10003060 Ga0207674_1000306015 330
1525 3300026118 Ga0207675_100050882 Ga0207675_1000508825 330
1526 3300026121 Ga0207683_10431356 Ga0207683_104313561 330
1527 3300028380 Ga0268265_10000577 Ga0268265_1000057724 330
1528 3300028380 Ga0268265_10036379 Ga0268265_100363793 330
1529 3300028381 Ga0268264_10001716 Ga0268264_1000171611 330
1530 3300031691 Ga0316579_10002402 Ga0316579_100024022 330
1531 3300031727 Ga0316576_10083452 Ga0316576_100834522 330
1532 3300031733 Ga0316577_10012808 Ga0316577_100128084 330
1533 3300032005 Ga0307411_10412389 Ga0307411_104123891 330
1534 3300032137 Ga0316585_10044309 Ga0316585_100443091 330
1535 3300032139 Ga0316580_10014292 Ga0316580_100142923 330
1536 3300032168 Ga0316593_10012780 Ga0316593_100127802 330
1537 3300033527 Ga0316586_1021179 Ga0316586_10211791 330
1538 3300033528 Ga0316588_1004413 Ga0316588_10044133 330
1539 3300033541 Ga0316596_1010722 Ga0316596_10107222 330
1540 3300035398 Ga0316574_0019520 Ga0316574_0019520_171_1163 330
1541 3300035695 Ga0373927_0074123 Ga0373927_0074123_947_1942 330
1542 3300036401 Ga0373937_0141055 Ga0373937_0141055_73_1065 330
1543 3300036712 Ga0316584_0002299 Ga0316584_0002299_8694_9686 330
1544 3300037588 Ga0316581_0014564 Ga0316581_0014564_292_1284 330
1545 3300039447 Ga0436361_0919750 Ga0436361_0919750_207_1202 330
1546 3300039453 Ga0436362_0186295 Ga0436362_0186295_31_1065 330
1547 3300046472 Ga0495580_0169637 Ga0495580_0169637_192_1187 330
1548 3300046536 Ga0495587_0077617 Ga0495587_0077617_56_1048 330
1549 3300048905 Ga0496102_0043732 Ga0496102_0043732_1872_2867 330
1550 3300048907 Ga0496104_0012424 Ga0496104_0012424_356_1351 330
1551 3300048908 Ga0496105_0005742 Ga0496105_0005742_1863_2858 330
1552 3300048910 Ga0496107_0140979 Ga0496107_0140979_312_1307 330
1553 3300048911 Ga0496108_0099392 Ga0496108_0099392_645_1640 330
1554 3300048912 Ga0496109_0013373 Ga0496109_0013373_5309_6304 330
1555 3300048912 Ga0496109_0052887 Ga0496109_0052887_71_1066 330
1556 3300048913 Ga0496110_0034203 Ga0496110_0034203_2335_3330 330
1557 3300048914 Ga0496111_0053853 Ga0496111_0053853_1656_2651 330
1558 3300048914 Ga0496111_0167155 Ga0496111_0167155_579_1574 330
1559 3300048918 Ga0496115_0000849 Ga0496115_0000849_5362_6357 330
1560 3300048923 Ga0496120_0077221 Ga0496120_0077221_615_1607 330
1561 3300049572 Ga0501036_0041698 Ga0501036_0041698_316_1308 330
1562 3300049582 Ga0501048_0029167 Ga0501048_0029167_1427_2419 330
1563 3300049591 Ga0501075_0020700 Ga0501075_0020700_1881_2873 330
1564 3300049592 Ga0501076_0007516 Ga0501076_0007516_6536_7528 330
1565 3300049592 Ga0501076_0044131 Ga0501076_0044131_2089_3084 330
1566 3300050512 nmdc:mga0n895_395808_c1 nmdc:mga0n895_395808_c1_381_1376 330
1567 3300053077 Ga0495601_0000744 Ga0495601_0000744_1036_2028 330
1568 iso_pu_bacteria 2510065057 2510306976 330
1569 iso_pu_bacteria 2510917026 2511174433 330
1570 iso_pu_bacteria 2511231052 2511498771 330
1571 iso_pu_bacteria 2513237086 2513585616 330
1572 iso_pu_bacteria 2513237091 2513619053 330
1573 iso_pu_bacteria 2513237140 2513880534 330
1574 iso_pu_bacteria 2513237143 2513904326 330
1575 iso_pu_bacteria 2513237159 2514001604 330
1576 iso_pu_bacteria 2515154107 2515607208 330
1577 iso_pu_bacteria 2516653046 2516895050 330
1578 iso_pu_bacteria 2524023207 2524452541 330
1579 iso_pu_bacteria 2537561587 2537877223 330
1580 iso_pu_bacteria 2551306084 2551681320 330
1581 iso_pu_bacteria 2551306085 2551685755 330
1582 iso_pu_bacteria 2551306086 2551691392 330
1583 iso_pu_bacteria 2551306087 2551703333 330
1584 iso_pu_bacteria 2551306089 2551713987 330
1585 iso_pu_bacteria 2551306090 2551716001 330
1586 iso_pu_bacteria 2551306091 2551727570 330
1587 iso_pu_bacteria 2551306092 2551734868 330
1588 iso_pu_bacteria 2551306093 2551742136 330
1589 iso_pu_bacteria 2554235003 2554246118 330
1590 iso_pu_bacteria 2558860242 2559293341 330
1591 iso_pu_bacteria 2582581306 2585264501 330
1592 iso_pu_bacteria 2582581865 2585389865 330
1593 iso_pu_bacteria 2582581866 2585396455 330
1594 iso_pu_bacteria 2599185156 2599332500 330
1595 iso_pu_bacteria 2599185210 2599604224 330
1596 iso_pu_bacteria 2599185352 2600196640 330
1597 iso_pu_bacteria 2600255279 2601609640 330
1598 iso_pu_bacteria 2600255308 2601746415 330
1599 iso_pu_bacteria 2643221557 2643805688 330
1600 iso_pu_bacteria 2643221582 2643920498 330
1601 iso_pu_bacteria 2643221610 2644065863 330
1602 iso_pu_bacteria 2643221618 2644103888 330
1603 iso_pu_bacteria 2643221626 2644144769 330
1604 iso_pu_bacteria 2643221637 2644207407 330
1605 iso_pu_bacteria 2643221655 2644306818 330
1606 iso_pu_bacteria 2643221659 2644331009 330
1607 iso_pu_bacteria 2643221668 2644380168 330
1608 iso_pu_bacteria 2643221675 2644417194 330
1609 iso_pu_bacteria 2643221680 2644450590 330
1610 iso_pu_bacteria 2643221693 2644519693 330
1611 iso_pu_bacteria 2643221698 2644541228 330
1612 iso_pu_bacteria 2643221712 2644612429 330
1613 iso_pu_bacteria 2643221718 2644651055 330
1614 iso_pu_bacteria 2643221723 2644671375 330
1615 iso_pu_bacteria 2643221726 2644692985 330
1616 iso_pu_bacteria 2751185821 2753460030 330
1617 iso_pu_bacteria 2775507049 2776915906 330
1618 iso_pu_bacteria 2791355094 2792637524 330
1619 iso_pu_bacteria 2808606387 2808986890 330
1620 iso_pu_bacteria 2818991439 2819556965 330
1621 iso_pu_bacteria 2838675328 2838677703 330
1622 iso_pu_bacteria 2838714209 2838716592 330
1623 iso_pu_bacteria 2838719591 2838719608 330
1624 iso_pu_bacteria 2838724970 2838727343 330
1625 iso_pu_bacteria 2841846520 2841846537 330
1626 iso_pu_bacteria 2841859092 2841860931 330
1627 iso_pu_bacteria 2842124991 2842127434 330
1628 iso_pu_bacteria 2842130223 2842132596 330
1629 iso_pu_bacteria 2842152218 2842152235 330
1630 iso_pu_bacteria 2842170452 2842172838 330
1631 iso_pu_bacteria 2842175837 2842175854 330
1632 iso_pu_bacteria 2842187318 2842189700 330
1633 iso_pu_bacteria 2842211629 2842214014 330
1634 iso_pu_bacteria 2842224351 2842224368 330
1635 iso_pu_bacteria 2842515876 2842517716 330
1636 iso_pu_bacteria 2842521101 2842527205 330
1637 iso_pu_bacteria 2842922631 2842922772 330
1638 iso_pu_bacteria 2844163670 2844164838 330
1639 iso_pu_bacteria 2855825444 2855827681 330
1640 iso_pu_bacteria 2855839649 2855843058 330
1641 iso_pu_bacteria 2858800743 2858802014 330
1642 iso_pu_bacteria 2896384573 2896386134 330
1643 iso_pu_bacteria 2899792073 2899794244 330
1644 iso_pu_bacteria 2899845264 2899849008 330
1645 iso_pu_bacteria 2915980308 2915983266 330
1646 iso_pu_bacteria 2915986958 2915993123 330
1647 iso_pu_bacteria 2915993759 2915996770 330
1648 iso_pu_bacteria 2916000859 2916005972 330
1649 iso_pu_bacteria 2916007675 2916010840 330
1650 iso_pu_bacteria 2916014648 2916018373 330
1651 iso_pu_bacteria 2916021584 2916027271 330
1652 iso_pu_bacteria 2916028427 2916033141 330
1653 iso_pu_bacteria 2916035215 2916037014 330
1654 iso_pu_bacteria 2916041962 2916042302 330
1655 iso_pu_bacteria 2916048683 2916050027 330
1656 iso_pu_bacteria 2916055098 2916056661 330
1657 iso_pu_bacteria 2916061851 2916063577 330
1658 iso_pu_bacteria 2916076590 2916082412 330
1659 iso_pu_bacteria 2919114240 2919116808 330
1660 iso_pu_bacteria 2920822456 2920822737 330
1661 iso_pu_bacteria 2921201388 2921202096 330
1662 iso_pu_bacteria 2921208531 2921210876 330
1663 iso_pu_bacteria 2921237296 2921241019 330
1664 iso_pu_bacteria 2921244191 2921244442 330
1665 iso_pu_bacteria 2921250672 2921256263 330
1666 iso_pu_bacteria 2921257292 2921258691 330
1667 iso_pu_bacteria 2921263974 2921265899 330
1668 iso_pu_bacteria 2921282425 2921286810 330
1669 iso_pu_bacteria 2921289301 2921296593 330
1670 iso_pu_bacteria 2921296804 2921303141 330
1671 iso_pu_bacteria 2924144063 2924145388 330
1672 iso_pu_bacteria 2924150972 2924151851 330
1673 iso_pu_bacteria 2924158325 2924162387 330
1674 iso_pu_bacteria 2924165586 2924172184 330
1675 iso_pu_bacteria 2924172951 2924177776 330
1676 iso_pu_bacteria 2924179722 2924185142 330
1677 iso_pu_bacteria 2924186466 2924190321 330
1678 iso_pu_bacteria 2924193448 2924197431 330
1679 iso_pu_bacteria 2924200457 2924202073 330
1680 iso_pu_bacteria 2924207177 2924211056 330
1681 iso_pu_bacteria 2924214083 2924220609 330
1682 iso_pu_bacteria 2924221636 2924226487 330
1683 iso_pu_bacteria 2924228884 2924230467 330
1684 iso_pu_bacteria 2926754445 2926754820 330
1685 iso_pu_bacteria 2926760298 2926761986 330
1686 iso_pu_bacteria 2929138655 2929138890 330
1687 iso_pu_bacteria 2933006813 2933006881 330
1688 iso_pu_bacteria 2933011516 2933015528 330
1689 iso_pu_bacteria 2933594066 2933594082 330
1690 iso_pu_bacteria 2936996657 2936998805 330
1691 iso_pu_bacteria 2937002841 2937009029 330
1692 iso_pu_bacteria 2937009748 2937010441 330
1693 iso_pu_bacteria 2937016420 2937017381 330
1694 iso_pu_bacteria 2937023124 2937025605 330
1695 iso_pu_bacteria 2937042894 2937047178 330
1696 iso_pu_bacteria 2937049772 2937053089 330
1697 iso_pu_bacteria 2937056579 2937060756 330
1698 iso_pu_bacteria 2937063883 2937070613 330
1699 iso_pu_bacteria 2937071275 2937076230 330
1700 iso_pu_bacteria 2937091812 2937096101 330
1701 iso_pu_bacteria 2937098957 2937103540 330
1702 iso_pu_bacteria 2937106411 2937112060 330
1703 iso_pu_bacteria 2937113482 2937115813 330
1704 iso_pu_bacteria 2937119839 2937122055 330
1705 iso_pu_bacteria 2937126314 2937130483 330
1706 iso_pu_bacteria 2941499720 2941504123 330
1707 iso_pu_bacteria 2957382221 2957383372 330
1708 iso_pu_bacteria 2957388812 2957390668 330
1709 iso_pu_bacteria 2957395598 2957401575 330
1710 iso_pu_bacteria 2957402308 2957405123 330
1711 iso_pu_bacteria 2957408893 2957410031 330
1712 iso_pu_bacteria 2957415311 2957420724 330
1713 iso_pu_bacteria 2957422303 2957424248 330
1714 iso_pu_bacteria 2957430029 2957430141 330
1715 iso_pu_bacteria 2957443900 2957447690 330
1716 iso_pu_bacteria 2957450854 2957451755 330
1717 iso_pu_bacteria 2957457609 2957461061 330
1718 iso_pu_bacteria 2957464669 2957469301 330
1719 iso_pu_bacteria 2957471148 2957475845 330
1720 iso_pu_bacteria 2957478035 2957482521 330
1721 iso_pu_bacteria 2957484790 2957490894 330
1722 iso_pu_bacteria 2957491536 2957492818 330
1723 iso_pu_bacteria 2957498199 2957502079 330
1724 iso_pu_bacteria 2957505466 2957509282 330
1725 iso_pu_bacteria 2960584000 2960588942 330
1726 iso_pu_bacteria 2960597568 2960601018 330
1727 iso_pu_bacteria 2960603979 2960607669 330
1728 iso_pu_bacteria 2960610863 2960612216 330
1729 iso_pu_bacteria 2960617483 2960620196 330
1730 iso_pu_bacteria 2960624210 2960624648 330
1731 iso_pu_bacteria 2960637947 2960641029 330
1732 iso_pu_bacteria 2960645483 2960650068 330
1733 iso_pu_bacteria 2960652885 2960655502 330
1734 iso_pu_bacteria 2960660292 2960664080 330
1735 iso_pu_bacteria 2960667422 2960671281 330
1736 iso_pu_bacteria 2960674078 2960677755 330
1737 iso_pu_bacteria 2960687367 2960690243 330
1738 iso_pu_bacteria 2964607997 2964612194 330
1739 iso_pu_bacteria 2964615318 2964616431 330
1740 iso_pu_bacteria 2964621998 2964626517 330
1741 iso_pu_bacteria 2964628898 2964632657 330
1742 iso_pu_bacteria 2964636051 2964640714 330
1743 iso_pu_bacteria 2964643177 2964645528 330
1744 iso_pu_bacteria 2964649959 2964651312 330
1745 iso_pu_bacteria 2964656573 2964660160 330
1746 iso_pu_bacteria 2964663802 2964667513 330
1747 iso_pu_bacteria 2964670856 2964674124 330
1748 iso_pu_bacteria 2964678106 2964682086 330
1749 iso_pu_bacteria 2964685014 2964689543 330
1750 iso_pu_bacteria 2964691889 2964694931 330
1751 iso_pu_bacteria 2964698721 2964702912 330
1752 iso_pu_bacteria 2964705432 2964709265 330
1753 iso_pu_bacteria 2964712639 2964716143 330
1754 iso_pu_bacteria 2964719344 2964722121 330
1755 iso_pu_bacteria 2967664464 2967668188 330
1756 iso_pu_bacteria 2967671571 2967674954 330
1757 iso_pu_bacteria 2967678726 2967682784 330
1758 iso_pu_bacteria 2967693043 2967696688 330
1759 iso_pu_bacteria 2967699805 2967705674 330
1760 iso_pu_bacteria 2967706974 2967712202 330
1761 iso_pu_bacteria 2967714385 2967716338 330
1762 iso_pu_bacteria 2967721400 2967726698 330
1763 iso_pu_bacteria 2967735183 2967738292 330
1764 iso_pu_bacteria 2967742019 2967746784 330
1765 iso_pu_bacteria 2967748971 2967751459 330
1766 iso_pu_bacteria 2967755722 2967756381 330
1767 iso_pu_bacteria 2967762386 2967765958 330
1768 iso_pu_bacteria 2967769361 2967771969 330
1769 iso_pu_bacteria 2967775926 2967780111 330
1770 iso_pu_bacteria 2970019648 2970020814 330
1771 iso_pu_bacteria 2970033650 2970036178 330
1772 iso_pu_bacteria 2970040964 2970044288 330
1773 iso_pu_bacteria 2970047711 2970054230 330
1774 iso_pu_bacteria 2970054988 2970055939 330
1775 iso_pu_bacteria 2970061556 2970068363 330
1776 iso_pu_bacteria 2970068827 2970074382 330
1777 iso_pu_bacteria 2970076120 2970077091 330
1778 iso_pu_bacteria 2970082768 2970087586 330
1779 iso_pu_bacteria 2970088815 2970094011 330
1780 iso_pu_bacteria 2970095765 2970101215 330
1781 iso_pu_bacteria 2970102677 2970104322 330
1782 iso_pu_bacteria 2970109326 2970114498 330
1783 iso_pu_bacteria 2970116247 2970119500 330
1784 iso_pu_bacteria 2970129317 2970130981 330
1785 iso_pu_bacteria 2970136068 2970139786 330
1786 iso_pu_bacteria 2970149975 2970154020 330
1787 iso_pu_bacteria 2970156795 2970160777 330
1788 iso_pu_bacteria 2970164137 2970165699 330
1789 iso_pu_bacteria 2970170962 2970174507 330
1790 iso_pu_bacteria 2970177841 2970182745 330
1791 iso_pu_bacteria 2970184632 2970188659 330
1792 iso_pu_bacteria 2970191845 2970194323 330
1793 iso_pu_bacteria 2977516862 2977522279 330
1794 iso_pu_bacteria 2977523885 2977525628 330
1795 iso_pu_bacteria 2977537788 2977538694 330
1796 iso_pu_bacteria 2977551784 2977555919 330
1797 iso_pu_bacteria 2977558990 2977563652 330
1798 iso_pu_bacteria 2977565890 2977569875 330
1799 iso_pu_bacteria 2977572785 2977576895 330
1800 iso_pu_bacteria 2977579622 2977580987 330
1801 iso_pu_bacteria 2979089926 2979092746 330
1802 iso_pu_bacteria 2979095461 2979099864 330
1803 iso_pu_bacteria 2979100975 2979104719 330
1804 iso_pu_bacteria 2984509177 2984513483 330
1805 iso_pu_bacteria 2984518228 2984520148 330
1806 iso_pu_bacteria 2984537506 2984539445 330
1807 iso_pu_bacteria 2984601300 2984601671 330
1808 iso_pu_bacteria 2989771324 2989774590 330
1809 iso_pu_bacteria 643692032 643827681 330
1810 iso_pu_bacteria 648276728 648738207 330
1811 iso_pu_bacteria 650716007 650738576 330
1812 iso_pu_bacteria 8003570095 8003572117 330
1813 iso_pu_bacteria 8003992118 8003995643 330
1814 iso_pu_bacteria 8018150411 8018151079 330
1815 iso_pu_bacteria 8054558443 8054560660 330
1816 iso_pu_bacteria 8056875544 8056878596 330
1817 3300002070 JGI24750J21931_1005547 JGI24750J21931_10055472 331
1818 3300002239 JGI24034J26672_10010561 JGI24034J26672_100105611 331
1819 3300002459 JGI24751J29686_10021714 JGI24751J29686_100217141 331
1820 3300002987 JGI25159J45721_1011714 JGI25159J45721_10117142 331
1821 3300003187 JGI25151J46595_10000090 JGI25151J46595_10000090100 331
1822 3300003578 Ga0006562J51391_1122603 Ga0006562J51391_11226032 331
1823 3300003771 Ga0055526_1001843 Ga0055526_10018438 331
1824 3300003771 Ga0055526_1004342 Ga0055526_100434210 331
1825 3300003775 Ga0055524_1000011 Ga0055524_1000011136 331
1826 3300005262 Ga0065165_1000146 Ga0065165_100014621 331
1827 3300005327 Ga0070658_10339971 Ga0070658_103399711 331
1828 3300005328 Ga0070676_10003148 Ga0070676_100031485 331
1829 3300005329 Ga0070683_100064839 Ga0070683_1000648391 331
1830 3300005330 Ga0070690_100000389 Ga0070690_10000038912 331
1831 3300005331 Ga0070670_100002883 Ga0070670_10000288312 331
1832 3300005335 Ga0070666_10001559 Ga0070666_100015591 331
1833 3300005336 Ga0070680_100003596 Ga0070680_1000035962 331
1834 3300005336 Ga0070680_100005087 Ga0070680_1000050877 331
1835 3300005337 Ga0070682_100005140 Ga0070682_1000051406 331
1836 3300005338 Ga0068868_100010298 Ga0068868_1000102986 331
1837 3300005339 Ga0070660_100007614 Ga0070660_1000076146 331
1838 3300005339 Ga0070660_100171986 Ga0070660_1001719862 331
1839 3300005340 Ga0070689_100000375 Ga0070689_10000037519 331
1840 3300005341 Ga0070691_10000041 Ga0070691_1000004134 331
1841 3300005341 Ga0070691_10081652 Ga0070691_100816521 331
1842 3300005343 Ga0070687_100001858 Ga0070687_1000018587 331
1843 3300005344 Ga0070661_100004833 Ga0070661_1000048337 331
1844 3300005345 Ga0070692_10003517 Ga0070692_100035171 331
1845 3300005347 Ga0070668_100000633 Ga0070668_10000063314 331
1846 3300005353 Ga0070669_100008669 Ga0070669_1000086696 331
1847 3300005354 Ga0070675_100004951 Ga0070675_1000049518 331
1848 3300005355 Ga0070671_100000406 Ga0070671_10000040616 331
1849 3300005356 Ga0070674_100001559 Ga0070674_10000155912 331
1850 3300005356 Ga0070674_100055283 Ga0070674_1000552833 331
1851 3300005364 Ga0070673_100000480 Ga0070673_10000048014 331
1852 3300005364 Ga0070673_100292383 Ga0070673_1002923832 331
1853 3300005365 Ga0070688_100000498 Ga0070688_10000049814 331
1854 3300005366 Ga0070659_100011837 Ga0070659_1000118376 331
1855 3300005367 Ga0070667_100001184 Ga0070667_1000011847 331
1856 3300005367 Ga0070667_100147059 Ga0070667_1001470592 331
1857 3300005434 Ga0070709_10000294 Ga0070709_100002947 331
1858 3300005436 Ga0070713_100001031 Ga0070713_1000010311 331
1859 3300005436 Ga0070713_100221376 Ga0070713_1002213762 331
1860 3300005439 Ga0070711_100000095 Ga0070711_10000009516 331
1861 3300005440 Ga0070705_100002620 Ga0070705_1000026202 331
1862 3300005441 Ga0070700_100002014 Ga0070700_1000020148 331
1863 3300005444 Ga0070694_100002046 Ga0070694_1000020467 331
1864 3300005444 Ga0070694_100084940 Ga0070694_1000849402 331
1865 3300005455 Ga0070663_100001178 Ga0070663_1000011786 331
1866 3300005455 Ga0070663_100022015 Ga0070663_1000220152 331
1867 3300005456 Ga0070678_100000023 Ga0070678_1000000234 331
1868 3300005457 Ga0070662_100001426 Ga0070662_1000014264 331
1869 3300005458 Ga0070681_10282353 Ga0070681_102823532 331
1870 3300005459 Ga0068867_100122661 Ga0068867_1001226611 331
1871 3300005518 Ga0070699_100247295 Ga0070699_1002472952 331
1872 3300005530 Ga0070679_100024710 Ga0070679_1000247107 331
1873 3300005536 Ga0070697_100008494 Ga0070697_1000084945 331
1874 3300005539 Ga0068853_100001678 Ga0068853_10000167812 331
1875 3300005539 Ga0068853_100010092 Ga0068853_1000100922 331
1876 3300005539 Ga0068853_100293268 Ga0068853_1002932682 331
1877 3300005543 Ga0070672_100002661 Ga0070672_1000026617 331
1878 3300005544 Ga0070686_100008353 Ga0070686_1000083535 331
1879 3300005545 Ga0070695_100000122 Ga0070695_1000001229 331
1880 3300005545 Ga0070695_100018662 Ga0070695_1000186625 331
1881 3300005546 Ga0070696_100004629 Ga0070696_1000046295 331
1882 3300005546 Ga0070696_100021655 Ga0070696_1000216552 331
1883 3300005547 Ga0070693_100000781 Ga0070693_10000078111 331
1884 3300005548 Ga0070665_100110634 Ga0070665_1001106342 331
1885 3300005549 Ga0070704_100000417 Ga0070704_10000041714 331
1886 3300005563 Ga0068855_100048648 Ga0068855_1000486482 331
1887 3300005563 Ga0068855_100544684 Ga0068855_1005446841 331
1888 3300005564 Ga0070664_100002837 Ga0070664_10000283711 331
1889 3300005564 Ga0070664_100015702 Ga0070664_1000157026 331
1890 3300005577 Ga0068857_100003027 Ga0068857_1000030279 331
1891 3300005577 Ga0068857_100020464 Ga0068857_1000204644 331
1892 3300005578 Ga0068854_100148740 Ga0068854_1001487402 331
1893 3300005614 Ga0068856_100004965 Ga0068856_1000049655 331
1894 3300005615 Ga0070702_100000010 Ga0070702_10000001034 331
1895 3300005616 Ga0068852_100006707 Ga0068852_1000067075 331
1896 3300005616 Ga0068852_100091596 Ga0068852_1000915963 331
1897 3300005617 Ga0068859_100031468 Ga0068859_1000314685 331
1898 3300005719 Ga0068861_100002394 Ga0068861_1000023947 331
1899 3300005719 Ga0068861_100008440 Ga0068861_1000084404 331
1900 3300005719 Ga0068861_100074139 Ga0068861_1000741393 331
1901 3300005842 Ga0068858_100012529 Ga0068858_1000125293 331
1902 3300005842 Ga0068858_100041806 Ga0068858_1000418065 331
1903 3300005842 Ga0068858_100081391 Ga0068858_1000813911 331
1904 3300005843 Ga0068860_100007555 Ga0068860_1000075554 331
1905 3300005937 Ga0081455_10000041 Ga0081455_1000004178 331
1906 3300005983 Ga0081540_1000091 Ga0081540_100009159 331
1907 3300005985 Ga0081539_10081675 Ga0081539_100816752 331
1908 3300006038 Ga0075365_10003259 Ga0075365_100032595 331
1909 3300006038 Ga0075365_10054088 Ga0075365_100540881 331
1910 3300006042 Ga0075368_10000481 Ga0075368_100004819 331
1911 3300006042 Ga0075368_10010391 Ga0075368_100103913 331
1912 3300006048 Ga0075363_100003259 Ga0075363_1000032593 331
1913 3300006051 Ga0075364_10012655 Ga0075364_100126555 331
1914 3300006173 Ga0070716_100001707 Ga0070716_1000017079 331
1915 3300006175 Ga0070712_100004558 Ga0070712_1000045585 331
1916 3300006175 Ga0070712_100302589 Ga0070712_1003025891 331
1917 3300006178 Ga0075367_10033480 Ga0075367_100334804 331
1918 3300006844 Ga0075428_100019804 Ga0075428_1000198047 331
1919 3300006844 Ga0075428_100025849 Ga0075428_1000258492 331
1920 3300006844 Ga0075428_100131669 Ga0075428_1001316692 331
1921 3300006846 Ga0075430_100010468 Ga0075430_10001046810 331
1922 3300006847 Ga0075431_100000560 Ga0075431_1000005609 331
1923 3300006847 Ga0075431_100000737 Ga0075431_10000073711 331
1924 3300006847 Ga0075431_100001272 Ga0075431_1000012729 331
1925 3300006852 Ga0075433_10140404 Ga0075433_101404043 331
1926 3300006931 Ga0097620_100031471 Ga0097620_1000314715 331
1927 3300007076 Ga0075435_100024962 Ga0075435_1000249626 331
1928 3300009094 Ga0111539_10008743 Ga0111539_100087436 331
1929 3300009094 Ga0111539_10010412 Ga0111539_100104123 331
1930 3300009094 Ga0111539_10108243 Ga0111539_101082432 331
1931 3300009101 Ga0105247_10029065 Ga0105247_100290653 331
1932 3300009147 Ga0114129_10007502 Ga0114129_100075025 331
1933 3300009147 Ga0114129_10041796 Ga0114129_100417964 331
1934 3300009545 Ga0105237_10062665 Ga0105237_100626652 331
1935 3300009551 Ga0105238_10094450 Ga0105238_100944504 331
1936 3300010375 Ga0105239_10072516 Ga0105239_100725163 331
1937 3300010375 Ga0105239_10089625 Ga0105239_100896252 331
1938 3300013105 Ga0157369_10347052 Ga0157369_103470522 331
1939 3300013308 Ga0157375_10124804 Ga0157375_101248043 331
1940 3300014968 Ga0157379_10081188 Ga0157379_100811882 331
1941 3300021358 Ga0213873_10010251 Ga0213873_100102513 331
1942 3300021377 Ga0213874_10004623 Ga0213874_100046232 331
1943 3300021377 Ga0213874_10013371 Ga0213874_100133712 331
1944 3300021384 Ga0213876_10000743 Ga0213876_1000074311 331
1945 3300021384 Ga0213876_10007143 Ga0213876_100071436 331
1946 3300021384 Ga0213876_10028455 Ga0213876_100284552 331
1947 3300021388 Ga0213875_10002092 Ga0213875_100020929 331
1948 3300025284 Ga0209130_1000555 Ga0209130_100055527 331
1949 3300025291 Ga0209675_1000438 Ga0209675_100043816 331
1950 3300025294 Ga0209025_1000010 Ga0209025_1000010514 331
1951 3300025294 Ga0209025_1002335 Ga0209025_100233514 331
1952 3300025295 Ga0209564_1000019 Ga0209564_1000019547 331
1953 3300025295 Ga0209564_1000143 Ga0209564_1000143136 331
1954 3300025299 Ga0209256_1000111 Ga0209256_100011119 331
1955 3300025900 Ga0207710_10019359 Ga0207710_100193593 331
1956 3300025901 Ga0207688_10048311 Ga0207688_100483113 331
1957 3300025904 Ga0207647_10048726 Ga0207647_100487263 331
1958 3300025906 Ga0207699_10002859 Ga0207699_100028596 331
1959 3300025911 Ga0207654_10002071 Ga0207654_100020711 331
1960 3300025915 Ga0207693_10309835 Ga0207693_103098351 331
1961 3300025916 Ga0207663_10000415 Ga0207663_100004157 331
1962 3300025917 Ga0207660_10018909 Ga0207660_100189095 331
1963 3300025919 Ga0207657_10027653 Ga0207657_100276535 331
1964 3300025919 Ga0207657_10051425 Ga0207657_100514254 331
1965 3300025920 Ga0207649_10008903 Ga0207649_100089033 331
1966 3300025926 Ga0207659_10051803 Ga0207659_100518034 331
1967 3300025927 Ga0207687_10005332 Ga0207687_100053321 331
1968 3300025929 Ga0207664_10007283 Ga0207664_100072833 331
1969 3300025932 Ga0207690_10000718 Ga0207690_100007183 331
1970 3300025932 Ga0207690_10014742 Ga0207690_100147425 331
1971 3300025935 Ga0207709_10245624 Ga0207709_102456242 331
1972 3300025937 Ga0207669_10131444 Ga0207669_101314442 331
1973 3300025940 Ga0207691_10011388 Ga0207691_100113882 331
1974 3300025942 Ga0207689_10118379 Ga0207689_101183792 331
1975 3300025944 Ga0207661_10201936 Ga0207661_102019362 331
1976 3300025949 Ga0207667_10297920 Ga0207667_102979201 331
1977 3300025961 Ga0207712_10002201 Ga0207712_100022018 331
1978 3300025961 Ga0207712_10141339 Ga0207712_101413391 331
1979 3300025972 Ga0207668_10002085 Ga0207668_100020857 331
1980 3300025986 Ga0207658_10366610 Ga0207658_103666101 331
1981 3300026023 Ga0207677_10011765 Ga0207677_100117656 331
1982 3300026023 Ga0207677_10246961 Ga0207677_102469611 331
1983 3300026035 Ga0207703_10015627 Ga0207703_100156275 331
1984 3300026041 Ga0207639_10016727 Ga0207639_100167276 331
1985 3300026067 Ga0207678_10000017 Ga0207678_1000001739 331
1986 3300026067 Ga0207678_10001867 Ga0207678_1000186711 331
1987 3300026075 Ga0207708_10000315 Ga0207708_100003158 331
1988 3300026075 Ga0207708_10014237 Ga0207708_100142376 331
1989 3300026088 Ga0207641_10398013 Ga0207641_103980131 331
1990 3300026089 Ga0207648_10149051 Ga0207648_101490512 331
1991 3300026116 Ga0207674_10003796 Ga0207674_1000379611 331
1992 3300026116 Ga0207674_10010629 Ga0207674_100106298 331
1993 3300026118 Ga0207675_100000439 Ga0207675_10000043917 331
1994 3300026118 Ga0207675_100044917 Ga0207675_1000449172 331
1995 3300026118 Ga0207675_100075378 Ga0207675_1000753782 331
1996 3300026121 Ga0207683_10036841 Ga0207683_100368412 331
1997 3300026121 Ga0207683_10106602 Ga0207683_101066021 331
1998 3300027695 Ga0209966_1021065 Ga0209966_10210652 331
1999 3300027907 Ga0207428_10018032 Ga0207428_100180326 331
2000 3300031235 Ga0265330_10036886 Ga0265330_100368862 331
2001 3300031239 Ga0265328_10000095 Ga0265328_1000009549 331
2002 3300031239 Ga0265328_10000874 Ga0265328_100008747 331
2003 3300031239 Ga0265328_10001581 Ga0265328_100015813 331
2004 3300031239 Ga0265328_10028862 Ga0265328_100288623 331
2005 3300031241 Ga0265325_10036289 Ga0265325_100362893 331
2006 3300031241 Ga0265325_10107686 Ga0265325_101076862 331
2007 3300031247 Ga0265340_10022473 Ga0265340_100224733 331
2008 3300031548 Ga0307408_100256897 Ga0307408_1002568971 331
2009 3300031711 Ga0265314_10016122 Ga0265314_100161222 331
2010 3300031727 Ga0316576_10064235 Ga0316576_100642351 331
2011 3300031995 Ga0307409_100091540 Ga0307409_1000915403 331
2012 3300035085 Ga0373929_0011235 Ga0373929_0011235_450_1448 331
2013 3300035091 Ga0373951_0021232 Ga0373951_0021232_367_1365 331
2014 3300035092 Ga0373952_0018511 Ga0373952_0018511_293_1291 331
2015 3300035114 Ga0373939_0004562 Ga0373939_0004562_1106_2104 331
2016 3300035120 Ga0373957_0049650 Ga0373957_0049650_398_1396 331
2017 3300035170 Ga0373943_0057642 Ga0373943_0057642_701_1696 331
2018 3300035241 Ga0373961_0011987 Ga0373961_0011987_586_1584 331
2019 3300035398 Ga0316574_0066066 Ga0316574_0066066_1248_2246 331
2020 3300035691 Ga0373931_0006023 Ga0373931_0006023_3923_4921 331
2021 3300035692 Ga0373935_0291760 Ga0373935_0291760_127_1122 331
2022 3300035725 Ga0373947_0005183 Ga0373947_0005183_4214_5209 331
2023 3300037068 Ga0373925_0035861 Ga0373925_0035861_1319_2314 331
2024 3300037418 Ga0395900_0074478 Ga0395900_0074478_669_1667 331
2025 3300037466 Ga0395898_0052933 Ga0395898_0052933_442_1440 331
2026 3300037853 Ga0436364_0386322 Ga0436364_0386322_3372_4367 331
2027 3300037853 Ga0436364_0470937 Ga0436364_0470937_843_1838 331
2028 3300037853 Ga0436364_0877943 Ga0436364_0877943_718_1713 331
2029 3300039437 Ga0436365_0074789 Ga0436365_0074789_29651_30646 331
2030 3300039437 Ga0436365_0311340 Ga0436365_0311340_15333_16328 331
2031 3300039437 Ga0436365_0580075 Ga0436365_0580075_2484_3479 331
2032 3300039438 Ga0436360_0969337 Ga0436360_0969337_806_1801 331
2033 3300039447 Ga0436361_0499840 Ga0436361_0499840_1027_2022 331
2034 3300039447 Ga0436361_0733426 Ga0436361_0733426_4521_5516 331
2035 3300039447 Ga0436361_0922876 Ga0436361_0922876_833_1828 331
2036 3300039447 Ga0436361_1108765 Ga0436361_1108765_1489_2484 331
2037 3300039450 Ga0436363_0793522 Ga0436363_0793522_204_1199 331
2038 3300039450 Ga0436363_1203604 Ga0436363_1203604_8240_9235 331
2039 3300039453 Ga0436362_1033356 Ga0436362_1033356_959_1954 331
2040 3300039453 Ga0436362_1087921 Ga0436362_1087921_151_1146 331
2041 3300044656 Ga0466969_0130998 Ga0466969_0130998_92_1087 331
2042 3300044684 Ga0466966_0020472 Ga0466966_0020472_579_1574 331
2043 3300045049 Ga0466959_0021240 Ga0466959_0021240_187_1182 331
2044 3300045836 Ga0466958_0101373 Ga0466958_0101373_183_1178 331
2045 3300046475 Ga0495639_0036282 Ga0495639_0036282_1094_2089 331
2046 3300046491 Ga0495584_0017691 Ga0495584_0017691_543_1541 331
2047 3300046536 Ga0495587_0120396 Ga0495587_0120396_173_1171 331
2048 3300046616 Ga0495668_0082495 Ga0495668_0082495_505_1503 331
2049 3300046664 Ga0495659_0048366 Ga0495659_0048366_147_1145 331
2050 3300046691 Ga0495670_0099438 Ga0495670_0099438_163_1167 331
2051 3300046692 Ga0495671_0081660 Ga0495671_0081660_486_1484 331
2052 3300047315 Ga0495581_0026011 Ga0495581_0026011_2228_3223 331
2053 3300047321 Ga0495676_0143913 Ga0495676_0143913_617_1612 331
2054 3300048903 Ga0496100_0077900 Ga0496100_0077900_659_1657 331
2055 3300048903 Ga0496100_0128580 Ga0496100_0128580_451_1446 331
2056 3300048904 Ga0496101_0026294 Ga0496101_0026294_2072_3070 331
2057 3300048904 Ga0496101_0027218 Ga0496101_0027218_929_1927 331
2058 3300048904 Ga0496101_0122476 Ga0496101_0122476_748_1743 331
2059 3300048905 Ga0496102_0006851 Ga0496102_0006851_5091_6089 331
2060 3300048905 Ga0496102_0089933 Ga0496102_0089933_950_1945 331
2061 3300048905 Ga0496102_0415117 Ga0496102_0415117_94_1092 331
2062 3300048905 Ga0496102_0435887 Ga0496102_0435887_77_1075 331
2063 3300048906 Ga0496103_0005254 Ga0496103_0005254_3822_4820 331
2064 3300048907 Ga0496104_0000040 Ga0496104_0000040_69023_70018 331
2065 3300048907 Ga0496104_0000094 Ga0496104_0000094_32989_33987 331
2066 3300048907 Ga0496104_0001082 Ga0496104_0001082_1256_2251 331
2067 3300048907 Ga0496104_0008894 Ga0496104_0008894_4614_5609 331
2068 3300048907 Ga0496104_0182597 Ga0496104_0182597_104_1102 331
2069 3300048907 Ga0496104_0222655 Ga0496104_0222655_298_1293 331
2070 3300048908 Ga0496105_0000082 Ga0496105_0000082_9703_10698 331
2071 3300048908 Ga0496105_0001148 Ga0496105_0001148_11461_12456 331
2072 3300048908 Ga0496105_0011434 Ga0496105_0011434_3738_4733 331
2073 3300048908 Ga0496105_0027207 Ga0496105_0027207_922_1917 331
2074 3300048908 Ga0496105_0047293 Ga0496105_0047293_2277_3275 331
2075 3300048908 Ga0496105_0227949 Ga0496105_0227949_93_1088 331
2076 3300048909 Ga0496106_0007060 Ga0496106_0007060_656_1654 331
2077 3300048909 Ga0496106_0054035 Ga0496106_0054035_1889_2887 331
2078 3300048910 Ga0496107_0015945 Ga0496107_0015945_1756_2754 331
2079 3300048910 Ga0496107_0032513 Ga0496107_0032513_2119_3114 331
2080 3300048911 Ga0496108_0001659 Ga0496108_0001659_8650_9645 331
2081 3300048911 Ga0496108_0099253 Ga0496108_0099253_787_1785 331
2082 3300048911 Ga0496108_0151483 Ga0496108_0151483_492_1487 331
2083 3300048911 Ga0496108_0336010 Ga0496108_0336010_253_1251 331
2084 3300048912 Ga0496109_0005849 Ga0496109_0005849_7330_8328 331
2085 3300048912 Ga0496109_0007315 Ga0496109_0007315_5522_6517 331
2086 3300048913 Ga0496110_0009363 Ga0496110_0009363_3848_4846 331
2087 3300048913 Ga0496110_0033544 Ga0496110_0033544_55_1050 331
2088 3300048913 Ga0496110_0052155 Ga0496110_0052155_1853_2851 331
2089 3300048913 Ga0496110_0172729 Ga0496110_0172729_815_1810 331
2090 3300048914 Ga0496111_0015428 Ga0496111_0015428_1256_2251 331
2091 3300048914 Ga0496111_0027431 Ga0496111_0027431_2198_3193 331
2092 3300048914 Ga0496111_0047398 Ga0496111_0047398_217_1215 331
2093 3300048914 Ga0496111_0215730 Ga0496111_0215730_255_1253 331
2094 3300048915 Ga0496112_0018129 Ga0496112_0018129_1257_2252 331
2095 3300048915 Ga0496112_0020703 Ga0496112_0020703_5007_6005 331
2096 3300048916 Ga0496113_0000418 Ga0496113_0000418_5760_6755 331
2097 3300048916 Ga0496113_0001654 Ga0496113_0001654_879_1877 331
2098 3300048916 Ga0496113_0012570 Ga0496113_0012570_3843_4838 331
2099 3300048917 Ga0496114_0018154 Ga0496114_0018154_783_1778 331
2100 3300048917 Ga0496114_0186406 Ga0496114_0186406_752_1747 331
2101 3300048917 Ga0496114_0213624 Ga0496114_0213624_336_1334 331
2102 3300048918 Ga0496115_0001613 Ga0496115_0001613_8410_9405 331
2103 3300048918 Ga0496115_0014041 Ga0496115_0014041_4564_5562 331
2104 3300048918 Ga0496115_0063009 Ga0496115_0063009_166_1161 331
2105 3300048918 Ga0496115_0116851 Ga0496115_0116851_467_1465 331
2106 3300048918 Ga0496115_0128351 Ga0496115_0128351_309_1304 331
2107 3300048918 Ga0496115_0195810 Ga0496115_0195810_41_1036 331
2108 3300048918 Ga0496115_0257804 Ga0496115_0257804_274_1269 331
2109 3300048921 Ga0496118_0122025 Ga0496118_0122025_264_1259 331
2110 3300048922 Ga0496119_0002688 Ga0496119_0002688_118_1113 331
2111 3300048925 Ga0496122_0027746 Ga0496122_0027746_2311_3306 331
2112 3300048928 Ga0496125_0125602 Ga0496125_0125602_604_1599 331
2113 3300048928 Ga0496125_0126406 Ga0496125_0126406_207_1202 331
2114 3300049569 Ga0501032_0008507 Ga0501032_0008507_6141_7139 331
2115 3300049570 Ga0501033_0190616 Ga0501033_0190616_375_1373 331
2116 3300049571 Ga0501034_0000135 Ga0501034_0000135_36302_37300 331
2117 3300049571 Ga0501034_0429484 Ga0501034_0429484_77_1072 331
2118 3300049572 Ga0501036_0327622 Ga0501036_0327622_81_1076 331
2119 3300049573 Ga0501037_0001178 Ga0501037_0001178_801_1799 331
2120 3300049573 Ga0501037_0038192 Ga0501037_0038192_293_1288 331
2121 3300049574 Ga0501038_0068316 Ga0501038_0068316_34_1032 331
2122 3300049574 Ga0501038_0176711 Ga0501038_0176711_152_1213 331
2123 3300049574 Ga0501038_0349196 Ga0501038_0349196_135_1133 331
2124 3300049575 Ga0501039_0000180 Ga0501039_0000180_12740_13738 331
2125 3300049575 Ga0501039_0104695 Ga0501039_0104695_1138_2133 331
2126 3300049575 Ga0501039_0116888 Ga0501039_0116888_781_1779 331
2127 3300049576 Ga0501040_0073004 Ga0501040_0073004_757_1755 331
2128 3300049577 Ga0501041_0053803 Ga0501041_0053803_869_1867 331
2129 3300049577 Ga0501041_0142635 Ga0501041_0142635_299_1297 331
2130 3300049578 Ga0501042_0105655 Ga0501042_0105655_954_1949 331
2131 3300049578 Ga0501042_0249289 Ga0501042_0249289_256_1254 331
2132 3300049580 Ga0501046_0000108 Ga0501046_0000108_42980_43978 331
2133 3300049580 Ga0501046_0000567 Ga0501046_0000567_32496_33494 331
2134 3300049580 Ga0501046_0077687 Ga0501046_0077687_658_1656 331
2135 3300049580 Ga0501046_0138726 Ga0501046_0138726_555_1553 331
2136 3300049581 Ga0501047_0000435 Ga0501047_0000435_40161_41159 331
2137 3300049582 Ga0501048_0000636 Ga0501048_0000636_17053_18051 331
2138 3300049582 Ga0501048_0047702 Ga0501048_0047702_1330_2328 331
2139 3300049583 Ga0501067_0000586 Ga0501067_0000586_652_1650 331
2140 3300049583 Ga0501067_0005441 Ga0501067_0005441_2362_3360 331
2141 3300049584 Ga0501068_0197790 Ga0501068_0197790_69_1067 331
2142 3300049584 Ga0501068_0214138 Ga0501068_0214138_203_1198 331
2143 3300049586 Ga0501070_0007834 Ga0501070_0007834_2288_3286 331
2144 3300049588 Ga0501072_0044425 Ga0501072_0044425_1501_2499 331
2145 3300049588 Ga0501072_0057518 Ga0501072_0057518_945_1940 331
2146 3300049589 Ga0501073_0030093 Ga0501073_0030093_918_1916 331
2147 3300049589 Ga0501073_0069052 Ga0501073_0069052_382_1377 331
2148 3300049590 Ga0501074_0018091 Ga0501074_0018091_2281_3279 331
2149 3300049590 Ga0501074_0046941 Ga0501074_0046941_1860_2858 331
2150 3300049591 Ga0501075_0106403 Ga0501075_0106403_403_1401 331
2151 3300049592 Ga0501076_0004665 Ga0501076_0004665_930_1928 331
2152 3300049592 Ga0501076_0275687 Ga0501076_0275687_318_1316 331
2153 3300049593 Ga0501077_0014733 Ga0501077_0014733_1923_2921 331
2154 3300049593 Ga0501077_0021865 Ga0501077_0021865_77_1072 331
2155 3300049593 Ga0501077_0025027 Ga0501077_0025027_893_1891 331
2156 3300049593 Ga0501077_0247531 Ga0501077_0247531_118_1116 331
2157 3300049741 Ga0501079_0010340 Ga0501079_0010340_5603_6601 331
2158 3300049741 Ga0501079_0012587 Ga0501079_0012587_3147_4145 331
2159 3300049741 Ga0501079_0303815 Ga0501079_0303815_11_1006 331
2160 3300049742 Ga0501080_0000298 Ga0501080_0000298_223_1221 331
2161 3300049742 Ga0501080_0005719 Ga0501080_0005719_2878_3876 331
2162 3300049742 Ga0501080_0124005 Ga0501080_0124005_1375_2373 331
2163 3300049742 Ga0501080_0236172 Ga0501080_0236172_190_1185 331
2164 3300049743 Ga0501081_0022529 Ga0501081_0022529_2561_3559 331
2165 3300049743 Ga0501081_0039566 Ga0501081_0039566_751_1749 331
2166 3300049743 Ga0501081_0129472 Ga0501081_0129472_336_1331 331
2167 3300049743 Ga0501081_0165825 Ga0501081_0165825_180_1178 331
2168 3300049744 Ga0501083_0014657 Ga0501083_0014657_2135_3133 331
2169 3300049744 Ga0501083_0048703 Ga0501083_0048703_1848_2846 331
2170 3300049822 Ga0501035_0000056 Ga0501035_0000056_36139_37137 331
2171 3300049822 Ga0501035_0165304 Ga0501035_0165304_417_1415 331
2172 3300049823 Ga0501044_0000536 Ga0501044_0000536_9204_10202 331
2173 3300049823 Ga0501044_0071131 Ga0501044_0071131_1064_2062 331
2174 3300049823 Ga0501044_0333203 Ga0501044_0333203_343_1341 331
2175 3300049823 Ga0501044_0441868 Ga0501044_0441868_85_1083 331
2176 3300049824 Ga0501045_0011602 Ga0501045_0011602_3072_4070 331
2177 3300049824 Ga0501045_0013859 Ga0501045_0013859_1641_2639 331
2178 3300049824 Ga0501045_0041862 Ga0501045_0041862_118_1116 331
2179 3300050490 nmdc:mga03n38_46530_c1 nmdc:mga03n38_46530_c1_260_1258 331
2180 3300050490 nmdc:mga03n38_52645_c1 nmdc:mga03n38_52645_c1_767_1765 331
2181 3300050492 nmdc:mga0yw44_41683_c1 nmdc:mga0yw44_41683_c1_691_1689 331
2182 3300050492 nmdc:mga0yw44_7061_c1 nmdc:mga0yw44_7061_c1_1357_2355 331
2183 3300050494 nmdc:mga06z11_40988_c1 nmdc:mga06z11_40988_c1_144_1142 331
2184 3300050495 nmdc:mga04h51_298_c1 nmdc:mga04h51_298_c1_8874_9872 331
2185 3300050495 nmdc:mga04h51_50119_c1 nmdc:mga04h51_50119_c1_105_1103 331
2186 3300050507 nmdc:mga05p37_328770_c1 nmdc:mga05p37_328770_c1_474_1472 331
2187 3300050507 nmdc:mga05p37_79342_c1 nmdc:mga05p37_79342_c1_2014_3012 331
2188 3300050508 nmdc:mga09592_109914_c1 nmdc:mga09592_109914_c1_250_1248 331
2189 3300050508 nmdc:mga09592_13465_c1 nmdc:mga09592_13465_c1_4714_5712 331
2190 3300050509 nmdc:mga0qj67_91582_c1 nmdc:mga0qj67_91582_c1_237_1235 331
2191 3300050510 nmdc:mga06r32_163360_c1 nmdc:mga06r32_163360_c1_819_1817 331
2192 3300050510 nmdc:mga06r32_21058_c1 nmdc:mga06r32_21058_c1_41_1039 331
2193 3300050510 nmdc:mga06r32_29665_c1 nmdc:mga06r32_29665_c1_1373_2371 331
2194 3300050510 nmdc:mga06r32_3592_c1 nmdc:mga06r32_3592_c1_821_1819 331
2195 3300050511 nmdc:mga08y16_110704_c1 nmdc:mga08y16_110704_c1_875_1873 331
2196 3300050511 nmdc:mga08y16_124332_c1 nmdc:mga08y16_124332_c1_672_1670 331
2197 3300050511 nmdc:mga08y16_127409_c1 nmdc:mga08y16_127409_c1_1598_2596 331
2198 3300050511 nmdc:mga08y16_88372_c1 nmdc:mga08y16_88372_c1_2085_3083 331
2199 3300050513 nmdc:mga0rr50_62815_c1 nmdc:mga0rr50_62815_c1_21_1019 331
2200 3300050515 nmdc:mga0a205_14215_c1 nmdc:mga0a205_14215_c1_2651_3649 331
2201 3300053078 Ga0495612_0019274 Ga0495612_0019274_1692_2690 331
2202 3300053084 Ga0495595_0041446 Ga0495595_0041446_655_1653 331
2203 3300053085 Ga0495619_0183492 Ga0495619_0183492_180_1175 331
2204 3300053103 Ga0500555_014936 Ga0500555_014936_636_1691 331
2205 3300053104 Ga0500556_0000054 Ga0500556_0000054_10862_11860 331
2206 3300053153 Ga0500616_0003749 Ga0500616_0003749_674_1672 331
2207 3300053153 Ga0500616_0004603 Ga0500616_0004603_2603_3601 331
2208 3300053153 Ga0500616_0082748 Ga0500616_0082748_503_1501 331
2209 3300054114 Ga0501084_0006864 Ga0501084_0006864_8241_9239 331
2210 3300054114 Ga0501084_0099553 Ga0501084_0099553_965_1963 331
2211 3300054114 Ga0501084_0192381 Ga0501084_0192381_93_1091 331
2212 3300054114 Ga0501084_0217579 Ga0501084_0217579_163_1161 331
2213 3300060353 Ga0501082_0007923 Ga0501082_0007923_26_1024 331
2214 3300060353 Ga0501082_0011270 Ga0501082_0011270_3286_4284 331
2215 3300060353 Ga0501082_0042564 Ga0501082_0042564_2765_3763 331
2216 3300060353 Ga0501082_0044855 Ga0501082_0044855_2351_3346 331
2217 3300060353 Ga0501082_0207907 Ga0501082_0207907_81_1079 331
2218 3300061734 Ga0530510_0025046 Ga0530510_0025046_2764_3762 331
2219 3300061734 Ga0530510_0028153 Ga0530510_0028153_374_1369 331
2220 3300061734 Ga0530510_0170652 Ga0530510_0170652_179_1177 331
2221 3300061734 Ga0530510_0212208 Ga0530510_0212208_203_1198 331
2222 3300005337 Ga0070682_100013397 Ga0070682_1000133973 332
2223 3300005366 Ga0070659_100013043 Ga0070659_1000130433 332
2224 3300005435 Ga0070714_100065139 Ga0070714_1000651393 332
2225 3300005458 Ga0070681_10001010 Ga0070681_1000101020 332
2226 3300005530 Ga0070679_100045565 Ga0070679_1000455654 332
2227 3300005536 Ga0070697_100000586 Ga0070697_10000058624 332
2228 3300005539 Ga0068853_100005846 Ga0068853_1000058465 332
2229 3300005545 Ga0070695_100061908 Ga0070695_1000619082 332
2230 3300005545 Ga0070695_100092379 Ga0070695_1000923792 332
2231 3300005547 Ga0070693_100011657 Ga0070693_1000116572 332
2232 3300005549 Ga0070704_100001522 Ga0070704_1000015224 332
2233 3300005563 Ga0068855_100003400 Ga0068855_10000340015 332
2234 3300005937 Ga0081455_10051679 Ga0081455_100516792 332
2235 3300006846 Ga0075430_100053264 Ga0075430_1000532642 332
2236 3300006914 Ga0075436_100001205 Ga0075436_1000012058 332
2237 3300007076 Ga0075435_100025834 Ga0075435_1000258342 332
2238 3300009174 Ga0105241_10031094 Ga0105241_100310942 332
2239 3300009545 Ga0105237_10083687 Ga0105237_100836872 332
2240 3300009553 Ga0105249_10000366 Ga0105249_1000036612 332
2241 3300013100 Ga0157373_10039283 Ga0157373_100392832 332
2242 3300013104 Ga0157370_10045169 Ga0157370_100451692 332
2243 3300013307 Ga0157372_10001212 Ga0157372_1000121211 332
2244 3300025912 Ga0207707_10005935 Ga0207707_100059356 332
2245 3300025921 Ga0207652_10037808 Ga0207652_100378085 332
2246 3300025949 Ga0207667_10038672 Ga0207667_100386723 332
2247 3300025981 Ga0207640_10205291 Ga0207640_102052912 332
2248 3300026041 Ga0207639_10005685 Ga0207639_100056856 332
2249 3300037466 Ga0395898_0216820 Ga0395898_0216820_578_1576 332
2250 3300042005 Ga0439448_0010399 Ga0439448_0010399_995_1993 332
2251 3300046523 Ga0495644_0010356 Ga0495644_0010356_2312_3310 332
2252 3300048903 Ga0496100_0106511 Ga0496100_0106511_692_1693 332
2253 3300048910 Ga0496107_0018143 Ga0496107_0018143_1580_2581 332
2254 3300048924 Ga0496121_0000865 Ga0496121_0000865_966_1967 332
2255 3300049568 Ga0501031_0066690 Ga0501031_0066690_74_1135 332
2256 3300049569 Ga0501032_0030568 Ga0501032_0030568_1043_2041 332
2257 3300049570 Ga0501033_0070531 Ga0501033_0070531_920_1918 332
2258 3300049571 Ga0501034_0073946 Ga0501034_0073946_187_1185 332
2259 3300049571 Ga0501034_0208446 Ga0501034_0208446_611_1609 332
2260 3300049572 Ga0501036_0023920 Ga0501036_0023920_3379_4377 332
2261 3300049573 Ga0501037_0032784 Ga0501037_0032784_2524_3522 332
2262 3300049574 Ga0501038_0017952 Ga0501038_0017952_4863_5861 332
2263 3300049574 Ga0501038_0165184 Ga0501038_0165184_668_1666 332
2264 3300049579 Ga0501043_0011820 Ga0501043_0011820_3709_4707 332
2265 3300049581 Ga0501047_0010604 Ga0501047_0010604_1631_2629 332
2266 3300049587 Ga0501071_0067680 Ga0501071_0067680_276_1337 332
2267 3300049589 Ga0501073_0008414 Ga0501073_0008414_4345_5343 332
2268 3300049743 Ga0501081_0120659 Ga0501081_0120659_341_1393 332
2269 3300049822 Ga0501035_0089143 Ga0501035_0089143_978_1976 332
2270 3300049823 Ga0501044_0012621 Ga0501044_0012621_3369_4367 332
2271 3300049824 Ga0501045_0060086 Ga0501045_0060086_582_1643 332
2272 3300050509 nmdc:mga0qj67_73354_c1 nmdc:mga0qj67_73354_c1_1123_2121 332
2273 3300050510 nmdc:mga06r32_403952_c1 nmdc:mga06r32_403952_c1_89_1087 332
2274 3300050513 nmdc:mga0rr50_44120_c1 nmdc:mga0rr50_44120_c1_373_1371 332
2275 3300050514 nmdc:mga08x19_18_c1 nmdc:mga08x19_18_c1_310228_311226 332
2276 3300060353 Ga0501082_0080623 Ga0501082_0080623_928_1980 332
2277 3300060353 Ga0501082_0116068 Ga0501082_0116068_853_1851 332
2278 3300000549 LJQas_1003115 LJQas_10031152 333
2279 3300001979 JGI24740J21852_10014701 JGI24740J21852_100147013 333
2280 3300001979 JGI24740J21852_10014902 JGI24740J21852_100149022 333
2281 3300001989 JGI24739J22299_10000950 JGI24739J22299_100009502 333
2282 3300001990 JGI24737J22298_10009769 JGI24737J22298_100097691 333
2283 3300002067 JGI24735J21928_10007692 JGI24735J21928_100076924 333
2284 3300002773 JGI25152J39213_1000674 JGI25152J39213_100067411 333
2285 3300002773 JGI25152J39213_1004074 JGI25152J39213_10040744 333
2286 3300002773 JGI25152J39213_1006456 JGI25152J39213_10064562 333
2287 3300002774 JGI25150J39212_1000203 JGI25150J39212_100020314 333
2288 3300002774 JGI25150J39212_1001315 JGI25150J39212_10013157 333
2289 3300002774 JGI25150J39212_1015565 JGI25150J39212_10155651 333
2290 3300002987 JGI25159J45721_1001355 JGI25159J45721_100135512 333
2291 3300003187 JGI25151J46595_10000439 JGI25151J46595_1000043922 333
2292 3300003187 JGI25151J46595_10002698 JGI25151J46595_1000269810 333
2293 3300003187 JGI25151J46595_10002873 JGI25151J46595_1000287312 333
2294 3300003214 JGI25165J46597_1010025 JGI25165J46597_10100251 333
2295 3300003215 JGI25153J46596_10002927 JGI25153J46596_100029275 333
2296 3300003215 JGI25153J46596_10004444 JGI25153J46596_100044443 333
2297 3300003215 JGI25153J46596_10005348 JGI25153J46596_100053483 333
2298 3300003215 JGI25153J46596_10009107 JGI25153J46596_100091075 333
2299 3300003322 rootL2_10058830 rootL2_100588303 333
2300 3300003354 JGI25160J50197_1001685 JGI25160J50197_100168511 333
2301 3300003354 JGI25160J50197_1018790 JGI25160J50197_10187901 333
2302 3300003374 JGI25161J50226_1000220 JGI25161J50226_100022030 333
2303 3300003374 JGI25161J50226_1000512 JGI25161J50226_10005129 333
2304 3300003374 JGI25161J50226_1001749 JGI25161J50226_10017499 333
2305 3300003659 JGI25404J52841_10003238 JGI25404J52841_100032384 333
2306 3300003771 Ga0055526_1001947 Ga0055526_100194712 333
2307 3300003771 Ga0055526_1002554 Ga0055526_10025545 333
2308 3300003771 Ga0055526_1007620 Ga0055526_10076204 333
2309 3300003771 Ga0055526_1021740 Ga0055526_10217401 333
2310 3300003775 Ga0055524_1002068 Ga0055524_100206815 333
2311 3300003775 Ga0055524_1007822 Ga0055524_10078223 333
2312 3300003775 Ga0055524_1030684 Ga0055524_10306842 333
2313 3300003775 Ga0055524_1032073 Ga0055524_10320732 333
2314 3300003790 Ga0055528_1001428 Ga0055528_100142812 333
2315 3300003790 Ga0055528_1001489 Ga0055528_10014897 333
2316 3300003790 Ga0055528_1002038 Ga0055528_100203812 333
2317 3300003790 Ga0055528_1003532 Ga0055528_10035323 333
2318 3300003790 Ga0055528_1004890 Ga0055528_10048903 333
2319 3300003790 Ga0055528_1006206 Ga0055528_10062062 333
2320 3300003790 Ga0055528_1006729 Ga0055528_10067291 333
2321 3300003792 Ga0055540_1002547 Ga0055540_10025478 333
2322 3300003792 Ga0055540_1018803 Ga0055540_10188032 333
2323 3300004625 Ga0055543_1000069 Ga0055543_100006924 333
2324 3300004625 Ga0055543_1000187 Ga0055543_100018721 333
2325 3300005262 Ga0065165_1003760 Ga0065165_100376010 333
2326 3300005329 Ga0070683_100051341 Ga0070683_1000513415 333
2327 3300005335 Ga0070666_10026321 Ga0070666_100263211 333
2328 3300005336 Ga0070680_100009352 Ga0070680_1000093525 333
2329 3300005336 Ga0070680_100109995 Ga0070680_1001099952 333
2330 3300005336 Ga0070680_100173925 Ga0070680_1001739252 333
2331 3300005338 Ga0068868_100127452 Ga0068868_1001274522 333
2332 3300005339 Ga0070660_100018794 Ga0070660_1000187945 333
2333 3300005341 Ga0070691_10005991 Ga0070691_100059912 333
2334 3300005341 Ga0070691_10140083 Ga0070691_101400831 333
2335 3300005344 Ga0070661_100243789 Ga0070661_1002437892 333
2336 3300005347 Ga0070668_100012224 Ga0070668_1000122243 333
2337 3300005347 Ga0070668_100024237 Ga0070668_1000242373 333
2338 3300005355 Ga0070671_100020442 Ga0070671_1000204424 333
2339 3300005355 Ga0070671_100288600 Ga0070671_1002886001 333
2340 3300005366 Ga0070659_100061535 Ga0070659_1000615353 333
2341 3300005434 Ga0070709_10004705 Ga0070709_100047052 333
2342 3300005435 Ga0070714_100198725 Ga0070714_1001987252 333
2343 3300005436 Ga0070713_100074116 Ga0070713_1000741162 333
2344 3300005436 Ga0070713_100078712 Ga0070713_1000787123 333
2345 3300005436 Ga0070713_100119880 Ga0070713_1001198801 333
2346 3300005436 Ga0070713_100144444 Ga0070713_1001444441 333
2347 3300005436 Ga0070713_100156922 Ga0070713_1001569222 333
2348 3300005437 Ga0070710_10000872 Ga0070710_100008725 333
2349 3300005437 Ga0070710_10065957 Ga0070710_100659572 333
2350 3300005439 Ga0070711_100090510 Ga0070711_1000905102 333
2351 3300005439 Ga0070711_100180844 Ga0070711_1001808441 333
2352 3300005445 Ga0070708_100046475 Ga0070708_1000464752 333
2353 3300005455 Ga0070663_100013916 Ga0070663_1000139164 333
2354 3300005455 Ga0070663_100077368 Ga0070663_1000773683 333
2355 3300005457 Ga0070662_100290964 Ga0070662_1002909641 333
2356 3300005458 Ga0070681_10129396 Ga0070681_101293962 333
2357 3300005458 Ga0070681_10480356 Ga0070681_104803561 333
2358 3300005468 Ga0070707_100301273 Ga0070707_1003012731 333
2359 3300005530 Ga0070679_100041775 Ga0070679_1000417752 333
2360 3300005535 Ga0070684_100066098 Ga0070684_1000660984 333
2361 3300005535 Ga0070684_100147742 Ga0070684_1001477422 333
2362 3300005539 Ga0068853_100010722 Ga0068853_1000107225 333
2363 3300005539 Ga0068853_100031778 Ga0068853_1000317784 333
2364 3300005539 Ga0068853_100049276 Ga0068853_1000492764 333
2365 3300005539 Ga0068853_100063111 Ga0068853_1000631114 333
2366 3300005548 Ga0070665_100284113 Ga0070665_1002841132 333
2367 3300005563 Ga0068855_100034337 Ga0068855_1000343376 333
2368 3300005563 Ga0068855_100037580 Ga0068855_1000375803 333
2369 3300005564 Ga0070664_100103905 Ga0070664_1001039052 333
2370 3300005577 Ga0068857_100002988 Ga0068857_1000029883 333
2371 3300005577 Ga0068857_100008016 Ga0068857_1000080164 333
2372 3300005577 Ga0068857_100015801 Ga0068857_1000158013 333
2373 3300005577 Ga0068857_100146391 Ga0068857_1001463912 333
2374 3300005578 Ga0068854_100000689 Ga0068854_1000006894 333
2375 3300005578 Ga0068854_100053164 Ga0068854_1000531641 333
2376 3300005578 Ga0068854_100387805 Ga0068854_1003878052 333
2377 3300005614 Ga0068856_100000761 Ga0068856_1000007615 333
2378 3300005614 Ga0068856_100041193 Ga0068856_1000411933 333
2379 3300005614 Ga0068856_100091417 Ga0068856_1000914174 333
2380 3300005615 Ga0070702_100141591 Ga0070702_1001415912 333
2381 3300005616 Ga0068852_100140371 Ga0068852_1001403712 333
2382 3300005616 Ga0068852_100159079 Ga0068852_1001590791 333
2383 3300005617 Ga0068859_100113481 Ga0068859_1001134812 333
2384 3300005618 Ga0068864_100010685 Ga0068864_1000106856 333
2385 3300005834 Ga0068851_10033878 Ga0068851_100338781 333
2386 3300005834 Ga0068851_10168022 Ga0068851_101680222 333
2387 3300005842 Ga0068858_100019227 Ga0068858_1000192275 333
2388 3300005842 Ga0068858_100024626 Ga0068858_1000246264 333
2389 3300005937 Ga0081455_10002724 Ga0081455_1000272412 333
2390 3300005937 Ga0081455_10079004 Ga0081455_100790042 333
2391 3300005983 Ga0081540_1002768 Ga0081540_10027684 333
2392 3300005983 Ga0081540_1039990 Ga0081540_10399901 333
2393 3300005983 Ga0081540_1048814 Ga0081540_10488141 333
2394 3300006028 Ga0070717_10003745 Ga0070717_100037458 333
2395 3300006028 Ga0070717_10051071 Ga0070717_100510713 333
2396 3300006028 Ga0070717_10129791 Ga0070717_101297912 333
2397 3300006028 Ga0070717_10163410 Ga0070717_101634103 333
2398 3300006028 Ga0070717_10181087 Ga0070717_101810871 333
2399 3300006038 Ga0075365_10003247 Ga0075365_100032474 333
2400 3300006038 Ga0075365_10009883 Ga0075365_100098835 333
2401 3300006038 Ga0075365_10053769 Ga0075365_100537692 333
2402 3300006038 Ga0075365_10203341 Ga0075365_102033411 333
2403 3300006042 Ga0075368_10013479 Ga0075368_100134793 333
2404 3300006042 Ga0075368_10076908 Ga0075368_100769081 333
2405 3300006048 Ga0075363_100126640 Ga0075363_1001266401 333
2406 3300006163 Ga0070715_10001222 Ga0070715_100012224 333
2407 3300006175 Ga0070712_100009491 Ga0070712_1000094912 333
2408 3300006175 Ga0070712_100079979 Ga0070712_1000799793 333
2409 3300006177 Ga0075362_10001918 Ga0075362_100019181 333
2410 3300006178 Ga0075367_10001874 Ga0075367_100018746 333
2411 3300006178 Ga0075367_10002704 Ga0075367_100027041 333
2412 3300006178 Ga0075367_10040566 Ga0075367_100405663 333
2413 3300006178 Ga0075367_10173441 Ga0075367_101734411 333
2414 3300006186 Ga0075369_10002052 Ga0075369_100020527 333
2415 3300006186 Ga0075369_10039640 Ga0075369_100396402 333
2416 3300006195 Ga0075366_10004158 Ga0075366_100041589 333
2417 3300006237 Ga0097621_100005281 Ga0097621_1000052817 333
2418 3300006237 Ga0097621_100202064 Ga0097621_1002020641 333
2419 3300006353 Ga0075370_10004618 Ga0075370_100046188 333
2420 3300006844 Ga0075428_100106760 Ga0075428_1001067603 333
2421 3300006844 Ga0075428_100124438 Ga0075428_1001244382 333
2422 3300006852 Ga0075433_10464244 Ga0075433_104642441 333
2423 3300006931 Ga0097620_100113485 Ga0097620_1001134852 333
2424 3300006942 Ga0099824_1004995 Ga0099824_10049959 333
2425 3300006943 Ga0099822_1001207 Ga0099822_100120716 333
2426 3300007265 Ga0099794_10122469 Ga0099794_101224691 333
2427 3300007788 Ga0099795_10017573 Ga0099795_100175731 333
2428 3300009011 Ga0105251_10016015 Ga0105251_100160154 333
2429 3300009093 Ga0105240_10007562 Ga0105240_100075624 333
2430 3300009093 Ga0105240_10032680 Ga0105240_100326806 333
2431 3300009098 Ga0105245_10021328 Ga0105245_100213284 333
2432 3300009147 Ga0114129_10015291 Ga0114129_100152917 333
2433 3300009147 Ga0114129_10545783 Ga0114129_105457831 333
2434 3300009174 Ga0105241_10002823 Ga0105241_100028232 333
2435 3300009174 Ga0105241_10037835 Ga0105241_100378353 333
2436 3300009174 Ga0105241_10091921 Ga0105241_100919213 333
2437 3300009177 Ga0105248_10006268 Ga0105248_1000626810 333
2438 3300009177 Ga0105248_10092104 Ga0105248_100921043 333
2439 3300009177 Ga0105248_10104881 Ga0105248_101048811 333
2440 3300009545 Ga0105237_10400753 Ga0105237_104007532 333
2441 3300009551 Ga0105238_10003292 Ga0105238_100032927 333
2442 3300009551 Ga0105238_10023997 Ga0105238_100239972 333
2443 3300009551 Ga0105238_10028229 Ga0105238_100282295 333
2444 3300009551 Ga0105238_10312831 Ga0105238_103128312 333
2445 3300009553 Ga0105249_10043286 Ga0105249_100432863 333
2446 3300009765 Ga0123341_1000017 Ga0123341_100001754 333
2447 3300009766 Ga0123342_1019278 Ga0123342_10192784 333
2448 3300010159 Ga0099796_10001437 Ga0099796_100014374 333
2449 3300010375 Ga0105239_10011356 Ga0105239_100113562 333
2450 3300010375 Ga0105239_10058682 Ga0105239_100586825 333
2451 3300011119 Ga0105246_10058031 Ga0105246_100580314 333
2452 3300011119 Ga0105246_10112681 Ga0105246_101126812 333
2453 3300013104 Ga0157370_10231509 Ga0157370_102315091 333
2454 3300013105 Ga0157369_10014541 Ga0157369_100145416 333
2455 3300013105 Ga0157369_10122600 Ga0157369_101226003 333
2456 3300013296 Ga0157374_10003265 Ga0157374_100032659 333
2457 3300013306 Ga0163162_10087159 Ga0163162_100871594 333
2458 3300013307 Ga0157372_10533403 Ga0157372_105334031 333
2459 3300013308 Ga0157375_10026900 Ga0157375_100269004 333
2460 3300014325 Ga0163163_10052491 Ga0163163_100524912 333
2461 3300014325 Ga0163163_10226316 Ga0163163_102263163 333
2462 3300014326 Ga0157380_10182166 Ga0157380_101821662 333
2463 3300014745 Ga0157377_10123658 Ga0157377_101236582 333
2464 3300014969 Ga0157376_10049317 Ga0157376_100493173 333
2465 3300021358 Ga0213873_10007116 Ga0213873_100071161 333
2466 3300021384 Ga0213876_10005774 Ga0213876_100057745 333
2467 3300021441 Ga0213871_10005961 Ga0213871_100059612 333
2468 3300025208 Ga0209436_100520 Ga0209436_10052012 333
2469 3300025245 Ga0207425_1000052 Ga0207425_100005225 333
2470 3300025245 Ga0207425_1004846 Ga0207425_10048465 333
2471 3300025245 Ga0207425_1008423 Ga0207425_10084232 333
2472 3300025253 Ga0209677_100313 Ga0209677_1003133 333
2473 3300025258 Ga0209129_1000446 Ga0209129_100044622 333
2474 3300025258 Ga0209129_1000512 Ga0209129_100051223 333
2475 3300025258 Ga0209129_1000941 Ga0209129_100094110 333
2476 3300025258 Ga0209129_1001773 Ga0209129_10017739 333
2477 3300025261 Ga0209233_1002747 Ga0209233_10027473 333
2478 3300025261 Ga0209233_1004470 Ga0209233_10044705 333
2479 3300025272 Ga0209455_1012590 Ga0209455_10125902 333
2480 3300025273 Ga0209673_1000024 Ga0209673_10000245 333
2481 3300025273 Ga0209673_1000358 Ga0209673_100035830 333
2482 3300025273 Ga0209673_1000526 Ga0209673_100052622 333
2483 3300025273 Ga0209673_1007086 Ga0209673_10070863 333
2484 3300025273 Ga0209673_1011414 Ga0209673_10114141 333
2485 3300025284 Ga0209130_1000002 Ga0209130_1000002644 333
2486 3300025294 Ga0209025_1000144 Ga0209025_1000144171 333
2487 3300025294 Ga0209025_1000274 Ga0209025_100027496 333
2488 3300025294 Ga0209025_1004395 Ga0209025_10043955 333
2489 3300025294 Ga0209025_1013602 Ga0209025_10136024 333
2490 3300025294 Ga0209025_1013636 Ga0209025_10136365 333
2491 3300025294 Ga0209025_1018691 Ga0209025_10186913 333
2492 3300025294 Ga0209025_1032964 Ga0209025_10329641 333
2493 3300025295 Ga0209564_1001082 Ga0209564_100108211 333
2494 3300025295 Ga0209564_1002120 Ga0209564_100212013 333
2495 3300025295 Ga0209564_1002146 Ga0209564_100214612 333
2496 3300025295 Ga0209564_1008220 Ga0209564_10082201 333
2497 3300025295 Ga0209564_1008892 Ga0209564_10088926 333
2498 3300025295 Ga0209564_1010734 Ga0209564_10107343 333
2499 3300025297 Ga0209758_1000519 Ga0209758_100051923 333
2500 3300025297 Ga0209758_1000753 Ga0209758_100075339 333
2501 3300025297 Ga0209758_1002473 Ga0209758_100247313 333
2502 3300025297 Ga0209758_1003885 Ga0209758_10038855 333
2503 3300025297 Ga0209758_1006314 Ga0209758_10063149 333
2504 3300025297 Ga0209758_1059118 Ga0209758_10591182 333
2505 3300025298 Ga0209050_1009991 Ga0209050_10099913 333
2506 3300025299 Ga0209256_1003426 Ga0209256_10034268 333
2507 3300025299 Ga0209256_1003678 Ga0209256_10036785 333
2508 3300025299 Ga0209256_1003995 Ga0209256_10039955 333
2509 3300025299 Ga0209256_1006241 Ga0209256_10062411 333
2510 3300025299 Ga0209256_1006497 Ga0209256_10064973 333
2511 3300025299 Ga0209256_1007818 Ga0209256_10078185 333
2512 3300025299 Ga0209256_1008478 Ga0209256_10084784 333
2513 3300025302 Ga0207426_1000013 Ga0207426_1000013644 333
2514 3300025302 Ga0207426_1000142 Ga0207426_1000142174 333
2515 3300025302 Ga0207426_1000608 Ga0207426_100060833 333
2516 3300025303 Ga0209051_1000170 Ga0209051_100017023 333
2517 3300025303 Ga0209051_1007592 Ga0209051_10075923 333
2518 3300025303 Ga0209051_1009521 Ga0209051_10095215 333
2519 3300025304 Ga0209257_1020537 Ga0209257_10205373 333
2520 3300025304 Ga0209257_1053623 Ga0209257_10536231 333
2521 3300025898 Ga0207692_10010103 Ga0207692_100101033 333
2522 3300025903 Ga0207680_10034614 Ga0207680_100346143 333
2523 3300025905 Ga0207685_10026807 Ga0207685_100268072 333
2524 3300025906 Ga0207699_10017718 Ga0207699_100177182 333
2525 3300025906 Ga0207699_10045628 Ga0207699_100456282 333
2526 3300025906 Ga0207699_10145086 Ga0207699_101450861 333
2527 3300025906 Ga0207699_10231964 Ga0207699_102319641 333
2528 3300025910 Ga0207684_10091643 Ga0207684_100916432 333
2529 3300025911 Ga0207654_10000250 Ga0207654_1000025025 333
2530 3300025911 Ga0207654_10024384 Ga0207654_100243843 333
2531 3300025912 Ga0207707_10000526 Ga0207707_1000052627 333
2532 3300025912 Ga0207707_10001497 Ga0207707_1000149714 333
2533 3300025912 Ga0207707_10125242 Ga0207707_101252421 333
2534 3300025912 Ga0207707_10163375 Ga0207707_101633752 333
2535 3300025912 Ga0207707_10191269 Ga0207707_101912692 333
2536 3300025913 Ga0207695_10000479 Ga0207695_1000047923 333
2537 3300025913 Ga0207695_10001357 Ga0207695_100013579 333
2538 3300025913 Ga0207695_10005090 Ga0207695_100050906 333
2539 3300025913 Ga0207695_10089217 Ga0207695_100892172 333
2540 3300025913 Ga0207695_10276968 Ga0207695_102769681 333
2541 3300025913 Ga0207695_10384585 Ga0207695_103845851 333
2542 3300025913 Ga0207695_10459809 Ga0207695_104598091 333
2543 3300025914 Ga0207671_10094823 Ga0207671_100948231 333
2544 3300025914 Ga0207671_10133388 Ga0207671_101333881 333
2545 3300025914 Ga0207671_10139264 Ga0207671_101392642 333
2546 3300025915 Ga0207693_10000156 Ga0207693_1000015632 333
2547 3300025915 Ga0207693_10009900 Ga0207693_1000990010 333
2548 3300025915 Ga0207693_10200128 Ga0207693_102001282 333
2549 3300025916 Ga0207663_10000158 Ga0207663_100001586 333
2550 3300025916 Ga0207663_10044460 Ga0207663_100444602 333
2551 3300025917 Ga0207660_10005316 Ga0207660_100053167 333
2552 3300025917 Ga0207660_10114173 Ga0207660_101141731 333
2553 3300025918 Ga0207662_10182934 Ga0207662_101829341 333
2554 3300025919 Ga0207657_10011015 Ga0207657_100110155 333
2555 3300025919 Ga0207657_10114988 Ga0207657_101149882 333
2556 3300025919 Ga0207657_10154860 Ga0207657_101548601 333
2557 3300025921 Ga0207652_10001692 Ga0207652_1000169214 333
2558 3300025921 Ga0207652_10032926 Ga0207652_100329263 333
2559 3300025921 Ga0207652_10146914 Ga0207652_101469141 333
2560 3300025921 Ga0207652_10269421 Ga0207652_102694211 333
2561 3300025922 Ga0207646_10118805 Ga0207646_101188052 333
2562 3300025923 Ga0207681_10149286 Ga0207681_101492862 333
2563 3300025924 Ga0207694_10000662 Ga0207694_1000066225 333
2564 3300025924 Ga0207694_10009782 Ga0207694_100097825 333
2565 3300025927 Ga0207687_10021258 Ga0207687_100212583 333
2566 3300025927 Ga0207687_10021407 Ga0207687_100214073 333
2567 3300025928 Ga0207700_10007816 Ga0207700_100078163 333
2568 3300025928 Ga0207700_10013486 Ga0207700_100134863 333
2569 3300025928 Ga0207700_10033809 Ga0207700_100338094 333
2570 3300025928 Ga0207700_10062912 Ga0207700_100629123 333
2571 3300025928 Ga0207700_10174690 Ga0207700_101746902 333
2572 3300025928 Ga0207700_10179662 Ga0207700_101796622 333
2573 3300025928 Ga0207700_10240234 Ga0207700_102402342 333
2574 3300025929 Ga0207664_10023882 Ga0207664_100238822 333
2575 3300025929 Ga0207664_10056391 Ga0207664_100563911 333
2576 3300025929 Ga0207664_10228167 Ga0207664_102281672 333
2577 3300025931 Ga0207644_10017690 Ga0207644_100176902 333
2578 3300025931 Ga0207644_10281082 Ga0207644_102810822 333
2579 3300025932 Ga0207690_10109928 Ga0207690_101099282 333
2580 3300025937 Ga0207669_10042124 Ga0207669_100421243 333
2581 3300025938 Ga0207704_10100576 Ga0207704_101005762 333
2582 3300025939 Ga0207665_10000767 Ga0207665_1000076715 333
2583 3300025939 Ga0207665_10080449 Ga0207665_100804492 333
2584 3300025940 Ga0207691_10142390 Ga0207691_101423902 333
2585 3300025941 Ga0207711_10145914 Ga0207711_101459141 333
2586 3300025941 Ga0207711_10361160 Ga0207711_103611602 333
2587 3300025942 Ga0207689_10154332 Ga0207689_101543321 333
2588 3300025944 Ga0207661_10000579 Ga0207661_1000057912 333
2589 3300025944 Ga0207661_10166959 Ga0207661_101669592 333
2590 3300025949 Ga0207667_10003118 Ga0207667_1000311815 333
2591 3300025949 Ga0207667_10006730 Ga0207667_100067306 333
2592 3300025949 Ga0207667_10021716 Ga0207667_100217164 333
2593 3300025949 Ga0207667_10030565 Ga0207667_100305655 333
2594 3300025949 Ga0207667_10170312 Ga0207667_101703122 333
2595 3300025960 Ga0207651_10126377 Ga0207651_101263771 333
2596 3300025961 Ga0207712_10041791 Ga0207712_100417913 333
2597 3300025972 Ga0207668_10026389 Ga0207668_100263894 333
2598 3300025972 Ga0207668_10159775 Ga0207668_101597752 333
2599 3300025981 Ga0207640_10002370 Ga0207640_100023705 333
2600 3300026023 Ga0207677_10015264 Ga0207677_100152643 333
2601 3300026023 Ga0207677_10043460 Ga0207677_100434603 333
2602 3300026035 Ga0207703_10030990 Ga0207703_100309903 333
2603 3300026041 Ga0207639_10106888 Ga0207639_101068882 333
2604 3300026041 Ga0207639_10237436 Ga0207639_102374362 333
2605 3300026067 Ga0207678_10005908 Ga0207678_1000590810 333
2606 3300026067 Ga0207678_10034302 Ga0207678_100343025 333
2607 3300026067 Ga0207678_10087496 Ga0207678_100874961 333
2608 3300026075 Ga0207708_10204526 Ga0207708_102045262 333
2609 3300026078 Ga0207702_10000004 Ga0207702_10000004354 333
2610 3300026078 Ga0207702_10000350 Ga0207702_1000035030 333
2611 3300026078 Ga0207702_10082843 Ga0207702_100828433 333
2612 3300026078 Ga0207702_10114386 Ga0207702_101143862 333
2613 3300026078 Ga0207702_10127898 Ga0207702_101278982 333
2614 3300026078 Ga0207702_10129543 Ga0207702_101295431 333
2615 3300026088 Ga0207641_10294005 Ga0207641_102940052 333
2616 3300026095 Ga0207676_10124317 Ga0207676_101243172 333
2617 3300026116 Ga0207674_10002413 Ga0207674_100024139 333
2618 3300026116 Ga0207674_10003431 Ga0207674_100034317 333
2619 3300026116 Ga0207674_10027875 Ga0207674_100278753 333
2620 3300026118 Ga0207675_100063041 Ga0207675_1000630414 333
2621 3300026121 Ga0207683_10112905 Ga0207683_101129052 333
2622 3300026142 Ga0207698_10113042 Ga0207698_101130422 333
2623 3300026142 Ga0207698_10127789 Ga0207698_101277892 333
2624 3300026142 Ga0207698_10361599 Ga0207698_103615991 333
2625 3300027357 Ga0209589_1000046 Ga0209589_100004678 333
2626 3300027361 Ga0209489_100106 Ga0209489_10010678 333
2627 3300027363 Ga0209700_100105 Ga0209700_10010578 333
2628 3300028379 Ga0268266_10001794 Ga0268266_1000179415 333
2629 3300028379 Ga0268266_10003485 Ga0268266_1000348512 333
2630 3300028379 Ga0268266_10052016 Ga0268266_100520163 333
2631 3300028380 Ga0268265_10035766 Ga0268265_100357664 333
2632 3300028380 Ga0268265_10238276 Ga0268265_102382761 333
2633 3300028381 Ga0268264_10095375 Ga0268264_100953752 333
2634 3300028573 Ga0265334_10005796 Ga0265334_100057963 333
2635 3300028786 Ga0307517_10000748 Ga0307517_1000074846 333
2636 3300028794 Ga0307515_10000068 Ga0307515_10000068145 333
2637 3300031235 Ga0265330_10031382 Ga0265330_100313822 333
2638 3300031235 Ga0265330_10092408 Ga0265330_100924081 333
2639 3300031241 Ga0265325_10015457 Ga0265325_100154574 333
2640 3300031242 Ga0265329_10028734 Ga0265329_100287342 333
2641 3300031247 Ga0265340_10030891 Ga0265340_100308913 333
2642 3300031249 Ga0265339_10000971 Ga0265339_1000097118 333
2643 3300031249 Ga0265339_10033359 Ga0265339_100333591 333
2644 3300031250 Ga0265331_10028196 Ga0265331_100281962 333
2645 3300031344 Ga0265316_10133451 Ga0265316_101334512 333
2646 3300031456 Ga0307513_10000264 Ga0307513_1000026456 333
2647 3300031507 Ga0307509_10165626 Ga0307509_101656261 333
2648 3300031616 Ga0307508_10000002 Ga0307508_10000002198 333
2649 3300031616 Ga0307508_10069065 Ga0307508_100690652 333
2650 3300031711 Ga0265314_10002643 Ga0265314_100026433 333
2651 3300031711 Ga0265314_10032706 Ga0265314_100327061 333
2652 3300031711 Ga0265314_10045746 Ga0265314_100457463 333
2653 3300031712 Ga0265342_10025508 Ga0265342_100255082 333
2654 3300031712 Ga0265342_10053622 Ga0265342_100536221 333
2655 3300031712 Ga0265342_10091287 Ga0265342_100912872 333
2656 3300031730 Ga0307516_10010347 Ga0307516_100103475 333
2657 3300031730 Ga0307516_10057865 Ga0307516_100578653 333
2658 3300031731 Ga0307405_10000276 Ga0307405_1000027614 333
2659 3300031901 Ga0307406_10102388 Ga0307406_101023881 333
2660 3300031995 Ga0307409_100432530 Ga0307409_1004325302 333
2661 3300032002 Ga0307416_100246548 Ga0307416_1002465482 333
2662 3300032005 Ga0307411_10043818 Ga0307411_100438182 333
2663 3300032005 Ga0307411_10173590 Ga0307411_101735902 333
2664 3300033180 Ga0307510_10024095 Ga0307510_100240956 333
2665 3300033442 Ga0315911_1000013 Ga0315911_1000013129 333
2666 3300035083 Ga0373926_0029899 Ga0373926_0029899_184_1185 333
2667 3300035086 Ga0373934_0063644 Ga0373934_0063644_429_1430 333
2668 3300035111 Ga0373923_0001479 Ga0373923_0001479_1736_2737 333
2669 3300035116 Ga0373945_0005952 Ga0373945_0005952_114_1115 333
2670 3300035117 Ga0373953_0005379 Ga0373953_0005379_2215_3216 333
2671 3300035118 Ga0373954_0000303 Ga0373954_0000303_14670_15671 333
2672 3300035118 Ga0373954_0003408 Ga0373954_0003408_5693_6694 333
2673 3300035118 Ga0373954_0031321 Ga0373954_0031321_687_1757 333
2674 3300035119 Ga0373956_0001298 Ga0373956_0001298_5634_6635 333
2675 3300035119 Ga0373956_0021820 Ga0373956_0021820_35_1036 333
2676 3300035120 Ga0373957_0001076 Ga0373957_0001076_1871_2872 333
2677 3300035170 Ga0373943_0032651 Ga0373943_0032651_1444_2445 333
2678 3300035171 Ga0373946_0000876 Ga0373946_0000876_8412_9413 333
2679 3300035171 Ga0373946_0114993 Ga0373946_0114993_18_1019 333
2680 3300035172 Ga0373955_0000243 Ga0373955_0000243_3081_4082 333
2681 3300035172 Ga0373955_0000648 Ga0373955_0000648_4102_5103 333
2682 3300035241 Ga0373961_0021948 Ga0373961_0021948_641_1642 333
2683 3300035410 Ga0373924_0000619 Ga0373924_0000619_2580_3581 333
2684 3300035410 Ga0373924_0012332 Ga0373924_0012332_843_1844 333
2685 3300035410 Ga0373924_0024969 Ga0373924_0024969_274_1275 333
2686 3300035692 Ga0373935_0000506 Ga0373935_0000506_2720_3721 333
2687 3300035695 Ga0373927_0006818 Ga0373927_0006818_2381_3382 333
2688 3300035695 Ga0373927_0143555 Ga0373927_0143555_177_1178 333
2689 3300035695 Ga0373927_0310268 Ga0373927_0310268_21_1022 333
2690 3300035724 Ga0373933_0000655 Ga0373933_0000655_14258_15259 333
2691 3300035724 Ga0373933_0000698 Ga0373933_0000698_7085_8086 333
2692 3300035724 Ga0373933_0001045 Ga0373933_0001045_12776_13777 333
2693 3300035724 Ga0373933_0086290 Ga0373933_0086290_420_1421 333
2694 3300035725 Ga0373947_0000626 Ga0373947_0000626_871_1872 333
2695 3300036401 Ga0373937_0000081 Ga0373937_0000081_25613_26614 333
2696 3300036401 Ga0373937_0014799 Ga0373937_0014799_5661_6662 333
2697 3300036458 Ga0310112_013850 Ga0310112_013850_18_1019 333
2698 3300037068 Ga0373925_0000285 Ga0373925_0000285_40381_41382 333
2699 3300037068 Ga0373925_0073342 Ga0373925_0073342_474_1475 333
2700 3300037068 Ga0373925_0104373 Ga0373925_0104373_591_1592 333
2701 3300037068 Ga0373925_0105854 Ga0373925_0105854_1095_2096 333
2702 3300037068 Ga0373925_0132280 Ga0373925_0132280_376_1377 333
2703 3300037466 Ga0395898_0400819 Ga0395898_0400819_77_1078 333
2704 3300038443 Ga0395901_0024984 Ga0395901_0024984_2985_3986 333
2705 3300039437 Ga0436365_0712113 Ga0436365_0712113_293_1294 333
2706 3300039437 Ga0436365_0758504 Ga0436365_0758504_8153_9154 333
2707 3300039438 Ga0436360_0638350 Ga0436360_0638350_13_1014 333
2708 3300039447 Ga0436361_0145263 Ga0436361_0145263_848_1849 333
2709 3300039450 Ga0436363_0083698 Ga0436363_0083698_551_1552 333
2710 3300039450 Ga0436363_0177116 Ga0436363_0177116_405_1406 333
2711 3300039450 Ga0436363_0728332 Ga0436363_0728332_22_1023 333
2712 3300039453 Ga0436362_0646312 Ga0436362_0646312_3230_4231 333
2713 3300041406 Ga0439439_0007134 Ga0439439_0007134_536_1537 333
2714 3300041413 Ga0439465_0011602 Ga0439465_0011602_195_1196 333
2715 3300041413 Ga0439465_0021688 Ga0439465_0021688_51_1052 333
2716 3300041441 Ga0451787_438214 Ga0451787_438214_1200_2201 333
2717 3300041492 Ga0451835_0541654 Ga0451835_0541654_360_1361 333
2718 3300041498 Ga0451841_0245447 Ga0451841_0245447_106_1107 333
2719 3300041501 Ga0451845_0148773 Ga0451845_0148773_1422_2423 333
2720 3300041503 Ga0451847_0231608 Ga0451847_0231608_1021_2022 333
2721 3300041505 Ga0451849_0272602 Ga0451849_0272602_56_1057 333
2722 3300041509 Ga0451843_0225826 Ga0451843_0225826_351_1352 333
2723 3300041512 Ga0451853_1970376 Ga0451853_1970376_68_1069 333
2724 3300042007 Ga0439449_0056365 Ga0439449_0056365_113_1114 333
2725 3300044684 Ga0466966_0034745 Ga0466966_0034745_1294_2295 333
2726 3300044694 Ga0466963_0051367 Ga0466963_0051367_406_1407 333
2727 3300044694 Ga0466963_0160937 Ga0466963_0160937_60_1061 333
2728 3300044719 Ga0466971_0058732 Ga0466971_0058732_265_1266 333
2729 3300044842 Ga0466957_0039448 Ga0466957_0039448_31_1035 333
2730 3300045049 Ga0466959_0064246 Ga0466959_0064246_1388_2389 333
2731 3300045976 Ga0466967_0041810 Ga0466967_0041810_1719_2720 333
2732 3300045976 Ga0466967_0165547 Ga0466967_0165547_596_1597 333
2733 3300045976 Ga0466967_0177197 Ga0466967_0177197_33_1034 333
2734 3300046454 Ga0495592_0000107 Ga0495592_0000107_38170_39171 333
2735 3300046454 Ga0495592_0000614 Ga0495592_0000614_9512_10513 333
2736 3300046455 Ga0495603_0034333 Ga0495603_0034333_718_1719 333
2737 3300046459 Ga0495629_0000849 Ga0495629_0000849_10582_11583 333
2738 3300046459 Ga0495629_0014047 Ga0495629_0014047_2153_3154 333
2739 3300046459 Ga0495629_0118839 Ga0495629_0118839_540_1541 333
2740 3300046462 Ga0495651_0000331 Ga0495651_0000331_26788_27789 333
2741 3300046462 Ga0495651_0001002 Ga0495651_0001002_7661_8662 333
2742 3300046462 Ga0495651_0037559 Ga0495651_0037559_1718_2719 333
2743 3300046462 Ga0495651_0074998 Ga0495651_0074998_537_1538 333
2744 3300046463 Ga0495653_0000054 Ga0495653_0000054_66580_67581 333
2745 3300046463 Ga0495653_0001956 Ga0495653_0001956_612_1613 333
2746 3300046472 Ga0495580_0006567 Ga0495580_0006567_1906_2907 333
2747 3300046473 Ga0495582_0033966 Ga0495582_0033966_1784_2785 333
2748 3300046473 Ga0495582_0089212 Ga0495582_0089212_368_1369 333
2749 3300046475 Ga0495639_0037746 Ga0495639_0037746_625_1626 333
2750 3300046475 Ga0495639_0058181 Ga0495639_0058181_228_1229 333
2751 3300046475 Ga0495639_0059627 Ga0495639_0059627_253_1254 333
2752 3300046476 Ga0495662_0035464 Ga0495662_0035464_237_1238 333
2753 3300046477 Ga0495664_0000020 Ga0495664_0000020_114533_115534 333
2754 3300046492 Ga0495585_0004801 Ga0495585_0004801_5893_6894 333
2755 3300046492 Ga0495585_0031581 Ga0495585_0031581_235_1236 333
2756 3300046492 Ga0495585_0040474 Ga0495585_0040474_670_1671 333
2757 3300046501 Ga0495607_0020727 Ga0495607_0020727_770_1771 333
2758 3300046501 Ga0495607_0170290 Ga0495607_0170290_56_1057 333
2759 3300046507 Ga0495606_0000676 Ga0495606_0000676_44073_45074 333
2760 3300046507 Ga0495606_0035760 Ga0495606_0035760_1231_2232 333
2761 3300046511 Ga0495608_0000024 Ga0495608_0000024_123116_124117 333
2762 3300046511 Ga0495608_0001026 Ga0495608_0001026_13088_14089 333
2763 3300046511 Ga0495608_0214350 Ga0495608_0214350_58_1059 333
2764 3300046514 Ga0495618_0000020 Ga0495618_0000020_35216_36217 333
2765 3300046516 Ga0495628_0000015 Ga0495628_0000015_162688_163689 333
2766 3300046516 Ga0495628_0331303 Ga0495628_0331303_32_1033 333
2767 3300046517 Ga0495630_0000748 Ga0495630_0000748_9789_10790 333
2768 3300046517 Ga0495630_0158978 Ga0495630_0158978_175_1176 333
2769 3300046519 Ga0495632_0092428 Ga0495632_0092428_387_1388 333
2770 3300046524 Ga0495648_0001769 Ga0495648_0001769_4821_5822 333
2771 3300046524 Ga0495648_0012437 Ga0495648_0012437_4486_5487 333
2772 3300046529 Ga0495652_0000006 Ga0495652_0000006_423481_424482 333
2773 3300046529 Ga0495652_0014151 Ga0495652_0014151_4493_5494 333
2774 3300046531 Ga0495665_0062444 Ga0495665_0062444_254_1255 333
2775 3300046533 Ga0495640_0000002 Ga0495640_0000002_610222_611223 333
2776 3300046533 Ga0495640_0035514 Ga0495640_0035514_1891_2892 333
2777 3300046533 Ga0495640_0148767 Ga0495640_0148767_337_1338 333
2778 3300046535 Ga0495586_0054322 Ga0495586_0054322_771_1772 333
2779 3300046536 Ga0495587_0000001 Ga0495587_0000001_682678_683679 333
2780 3300046536 Ga0495587_0002314 Ga0495587_0002314_11565_12566 333
2781 3300046539 Ga0495621_0087310 Ga0495621_0087310_145_1146 333
2782 3300046543 Ga0495645_0000013 Ga0495645_0000013_35208_36209 333
2783 3300046558 Ga0495633_0028328 Ga0495633_0028328_742_1743 333
2784 3300046559 Ga0495667_0000030 Ga0495667_0000030_40252_41253 333
2785 3300046559 Ga0495667_0001358 Ga0495667_0001358_5507_6508 333
2786 3300046615 Ga0495656_0010435 Ga0495656_0010435_2077_3078 333
2787 3300046616 Ga0495668_0053871 Ga0495668_0053871_481_1482 333
2788 3300046642 Ga0495634_0000264 Ga0495634_0000264_23596_24597 333
2789 3300046642 Ga0495634_0005995 Ga0495634_0005995_5011_6012 333
2790 3300046648 Ga0495611_0049150 Ga0495611_0049150_643_1644 333
2791 3300046660 Ga0495625_0090981 Ga0495625_0090981_29_1030 333
2792 3300046663 Ga0495635_0000001 Ga0495635_0000001_668489_669490 333
2793 3300046663 Ga0495635_0000809 Ga0495635_0000809_11923_12924 333
2794 3300046675 Ga0495657_0000028 Ga0495657_0000028_23384_24385 333
2795 3300046675 Ga0495657_0006732 Ga0495657_0006732_1179_2180 333
2796 3300046678 Ga0495599_0000056 Ga0495599_0000056_35208_36209 333
2797 3300046678 Ga0495599_0000513 Ga0495599_0000513_13139_14140 333
2798 3300046679 Ga0495623_0000013 Ga0495623_0000013_13086_14087 333
2799 3300046680 Ga0495646_0000003 Ga0495646_0000003_246477_247478 333
2800 3300046680 Ga0495646_0001869 Ga0495646_0001869_7254_8255 333
2801 3300046681 Ga0495647_0021934 Ga0495647_0021934_906_1907 333
2802 3300046683 Ga0495658_0061625 Ga0495658_0061625_924_1925 333
2803 3300046689 Ga0495613_0012903 Ga0495613_0012903_1118_2119 333
2804 3300046690 Ga0495624_0050529 Ga0495624_0050529_741_1742 333
2805 3300046692 Ga0495671_0068261 Ga0495671_0068261_402_1403 333
2806 3300046694 Ga0495649_0035101 Ga0495649_0035101_191_1192 333
2807 3300046809 Ga0495600_0000002 Ga0495600_0000002_22984_23985 333
2808 3300046809 Ga0495600_0000981 Ga0495600_0000981_1569_2570 333
2809 3300047315 Ga0495581_0011869 Ga0495581_0011869_2870_3871 333
2810 3300047315 Ga0495581_0106650 Ga0495581_0106650_105_1106 333
2811 3300047317 Ga0495604_0000001 Ga0495604_0000001_545040_546041 333
2812 3300047317 Ga0495604_0001709 Ga0495604_0001709_12798_13799 333
2813 3300047319 Ga0495674_0000018 Ga0495674_0000018_40420_41421 333
2814 3300047319 Ga0495674_0011448 Ga0495674_0011448_6903_7904 333
2815 3300047319 Ga0495674_0197883 Ga0495674_0197883_92_1093 333
2816 3300047320 Ga0495672_0017769 Ga0495672_0017769_1532_2533 333
2817 3300047321 Ga0495676_0060257 Ga0495676_0060257_930_1931 333
2818 3300047321 Ga0495676_0113460 Ga0495676_0113460_931_1932 333
2819 3300047322 Ga0495680_0000628 Ga0495680_0000628_23962_24963 333
2820 3300047322 Ga0495680_0002243 Ga0495680_0002243_6134_7135 333
2821 3300047322 Ga0495680_0289550 Ga0495680_0289550_117_1118 333
2822 3300047443 Ga0495687_020327 Ga0495687_020327_1325_2326 333
2823 3300047444 Ga0495675_0000331 Ga0495675_0000331_7122_8123 333
2824 3300047444 Ga0495675_0000978 Ga0495675_0000978_9577_10578 333
2825 3300047445 Ga0495677_0050334 Ga0495677_0050334_434_1435 333
2826 3300047471 Ga0495684_0000010 Ga0495684_0000010_35333_36334 333
2827 3300047471 Ga0495684_0000081 Ga0495684_0000081_50491_51492 333
2828 3300047471 Ga0495684_0033429 Ga0495684_0033429_2721_3722 333
2829 3300047673 Ga0495593_0000335 Ga0495593_0000335_4022_5023 333
2830 3300048088 Ga0495602_0000016 Ga0495602_0000016_35118_36119 333
2831 3300048088 Ga0495602_0002985 Ga0495602_0002985_10708_11709 333
2832 3300048088 Ga0495602_0329473 Ga0495602_0329473_35_1036 333
2833 3300048904 Ga0496101_0003628 Ga0496101_0003628_5241_6242 333
2834 3300048904 Ga0496101_0067053 Ga0496101_0067053_1388_2389 333
2835 3300048905 Ga0496102_0004361 Ga0496102_0004361_8340_9341 333
2836 3300048905 Ga0496102_0053706 Ga0496102_0053706_217_1218 333
2837 3300048907 Ga0496104_0140278 Ga0496104_0140278_1054_2055 333
2838 3300048907 Ga0496104_0204865 Ga0496104_0204865_39_1040 333
2839 3300048908 Ga0496105_0122557 Ga0496105_0122557_553_1554 333
2840 3300048909 Ga0496106_0009342 Ga0496106_0009342_664_1665 333
2841 3300048909 Ga0496106_0011693 Ga0496106_0011693_2444_3445 333
2842 3300048909 Ga0496106_0026408 Ga0496106_0026408_617_1618 333
2843 3300048909 Ga0496106_0046946 Ga0496106_0046946_1062_2063 333
2844 3300048910 Ga0496107_0051167 Ga0496107_0051167_1667_2668 333
2845 3300048910 Ga0496107_0130664 Ga0496107_0130664_74_1075 333
2846 3300048911 Ga0496108_0000803 Ga0496108_0000803_10602_11603 333
2847 3300048911 Ga0496108_0029498 Ga0496108_0029498_3406_4407 333
2848 3300048911 Ga0496108_0081576 Ga0496108_0081576_1340_2371 333
2849 3300048911 Ga0496108_0153998 Ga0496108_0153998_115_1116 333
2850 3300048911 Ga0496108_0163987 Ga0496108_0163987_491_1492 333
2851 3300048912 Ga0496109_0001236 Ga0496109_0001236_15939_16940 333
2852 3300048913 Ga0496110_0016949 Ga0496110_0016949_605_1606 333
2853 3300048913 Ga0496110_0027403 Ga0496110_0027403_2399_3400 333
2854 3300048913 Ga0496110_0193557 Ga0496110_0193557_543_1544 333
2855 3300048913 Ga0496110_0295645 Ga0496110_0295645_423_1424 333
2856 3300048915 Ga0496112_0000015 Ga0496112_0000015_169127_170128 333
2857 3300048915 Ga0496112_0002678 Ga0496112_0002678_219_1220 333
2858 3300048915 Ga0496112_0019376 Ga0496112_0019376_971_1972 333
2859 3300048915 Ga0496112_0024342 Ga0496112_0024342_3960_4961 333
2860 3300048915 Ga0496112_0084711 Ga0496112_0084711_1561_2562 333
2861 3300048915 Ga0496112_0096124 Ga0496112_0096124_270_1271 333
2862 3300048916 Ga0496113_0006745 Ga0496113_0006745_239_1240 333
2863 3300048917 Ga0496114_0030749 Ga0496114_0030749_1231_2232 333
2864 3300048917 Ga0496114_0040487 Ga0496114_0040487_1608_2609 333
2865 3300048917 Ga0496114_0164860 Ga0496114_0164860_62_1063 333
2866 3300048918 Ga0496115_0009727 Ga0496115_0009727_2255_3256 333
2867 3300048918 Ga0496115_0034663 Ga0496115_0034663_2363_3364 333
2868 3300048918 Ga0496115_0044070 Ga0496115_0044070_1157_2158 333
2869 3300048918 Ga0496115_0050314 Ga0496115_0050314_840_1841 333
2870 3300048918 Ga0496115_0064821 Ga0496115_0064821_301_1302 333
2871 3300048919 Ga0496116_0012271 Ga0496116_0012271_3556_4557 333
2872 3300048919 Ga0496116_0012404 Ga0496116_0012404_2454_3455 333
2873 3300048919 Ga0496116_0137234 Ga0496116_0137234_91_1092 333
2874 3300048920 Ga0496117_0093970 Ga0496117_0093970_168_1169 333
2875 3300048921 Ga0496118_0008020 Ga0496118_0008020_3605_4606 333
2876 3300048921 Ga0496118_0024457 Ga0496118_0024457_3079_4080 333
2877 3300048921 Ga0496118_0033608 Ga0496118_0033608_292_1293 333
2878 3300048922 Ga0496119_0001157 Ga0496119_0001157_19937_20938 333
2879 3300048924 Ga0496121_0000786 Ga0496121_0000786_20753_21754 333
2880 3300048924 Ga0496121_0030552 Ga0496121_0030552_1136_2137 333
2881 3300048924 Ga0496121_0045261 Ga0496121_0045261_33_1034 333
2882 3300048924 Ga0496121_0071616 Ga0496121_0071616_606_1616 333
2883 3300048924 Ga0496121_0088411 Ga0496121_0088411_503_1507 333
2884 3300048924 Ga0496121_0094774 Ga0496121_0094774_1288_2289 333
2885 3300048924 Ga0496121_0168226 Ga0496121_0168226_317_1318 333
2886 3300048925 Ga0496122_0008471 Ga0496122_0008471_8790_9791 333
2887 3300048925 Ga0496122_0014922 Ga0496122_0014922_1442_2443 333
2888 3300048925 Ga0496122_0053512 Ga0496122_0053512_733_1734 333
2889 3300048925 Ga0496122_0085537 Ga0496122_0085537_1119_2120 333
2890 3300048926 Ga0496123_0019128 Ga0496123_0019128_4072_5073 333
2891 3300048926 Ga0496123_0096283 Ga0496123_0096283_672_1673 333
2892 3300048927 Ga0496124_0009881 Ga0496124_0009881_3499_4500 333
2893 3300048927 Ga0496124_0009914 Ga0496124_0009914_118_1119 333
2894 3300048927 Ga0496124_0044547 Ga0496124_0044547_1730_2731 333
2895 3300048928 Ga0496125_0010293 Ga0496125_0010293_4299_5300 333
2896 3300048928 Ga0496125_0024228 Ga0496125_0024228_1923_2924 333
2897 3300048928 Ga0496125_0136349 Ga0496125_0136349_610_1620 333
2898 3300048929 Ga0496126_0003797 Ga0496126_0003797_2295_3296 333
2899 3300048929 Ga0496126_0008016 Ga0496126_0008016_4303_5304 333
2900 3300048929 Ga0496126_0018058 Ga0496126_0018058_1163_2164 333
2901 3300048929 Ga0496126_0028295 Ga0496126_0028295_3110_4111 333
2902 3300048929 Ga0496126_0037453 Ga0496126_0037453_1672_2673 333
2903 3300048929 Ga0496126_0121758 Ga0496126_0121758_293_1294 333
2904 3300048929 Ga0496126_0231379 Ga0496126_0231379_259_1260 333
2905 3300048929 Ga0496126_0249812 Ga0496126_0249812_76_1077 333
2906 3300049568 Ga0501031_0114326 Ga0501031_0114326_202_1203 333
2907 3300049571 Ga0501034_0044925 Ga0501034_0044925_2115_3116 333
2908 3300049574 Ga0501038_0164561 Ga0501038_0164561_723_1724 333
2909 3300049574 Ga0501038_0210793 Ga0501038_0210793_405_1406 333
2910 3300049580 Ga0501046_0207401 Ga0501046_0207401_340_1341 333
2911 3300049581 Ga0501047_0010641 Ga0501047_0010641_152_1153 333
2912 3300049581 Ga0501047_0103297 Ga0501047_0103297_994_1995 333
2913 3300049586 Ga0501070_0106087 Ga0501070_0106087_1075_2076 333
2914 3300049586 Ga0501070_0197684 Ga0501070_0197684_454_1455 333
2915 3300049744 Ga0501083_0227939 Ga0501083_0227939_202_1203 333
2916 3300049822 Ga0501035_0074363 Ga0501035_0074363_1223_2224 333
2917 3300049823 Ga0501044_0059132 Ga0501044_0059132_1393_2394 333
2918 3300049824 Ga0501045_0250386 Ga0501045_0250386_83_1171 333
2919 3300050489 nmdc:mga03683_6861_c1 nmdc:mga03683_6861_c1_2881_3882 333
2920 3300050489 nmdc:mga03683_97317_c1 nmdc:mga03683_97317_c1_271_1272 333
2921 3300050490 nmdc:mga03n38_40529_c2 nmdc:mga03n38_40529_c2_392_1393 333
2922 3300050490 nmdc:mga03n38_46970_c1 nmdc:mga03n38_46970_c1_439_1440 333
2923 3300050490 nmdc:mga03n38_59834_c1 nmdc:mga03n38_59834_c1_582_1583 333
2924 3300050491 nmdc:mga00v17_126411_c1 nmdc:mga00v17_126411_c1_223_1224 333
2925 3300050491 nmdc:mga00v17_149998_c1 nmdc:mga00v17_149998_c1_267_1268 333
2926 3300050492 nmdc:mga0yw44_201398_c1 nmdc:mga0yw44_201398_c1_227_1228 333
2927 3300050492 nmdc:mga0yw44_20997_c1 nmdc:mga0yw44_20997_c1_1251_2252 333
2928 3300050492 nmdc:mga0yw44_55610_c1 nmdc:mga0yw44_55610_c1_1108_2109 333
2929 3300050494 nmdc:mga06z11_13229_c1 nmdc:mga06z11_13229_c1_1136_2137 333
2930 3300050496 nmdc:mga07m45_1693_c2 nmdc:mga07m45_1693_c2_5288_6289 333
2931 3300050507 nmdc:mga05p37_106683_c1 nmdc:mga05p37_106683_c1_409_1410 333
2932 3300050512 nmdc:mga0n895_171433_c1 nmdc:mga0n895_171433_c1_602_1603 333
2933 3300053077 Ga0495601_0000021 Ga0495601_0000021_35198_36199 333
2934 3300053077 Ga0495601_0004544 Ga0495601_0004544_2158_3159 333
2935 3300053077 Ga0495601_0133706 Ga0495601_0133706_490_1491 333
2936 3300053078 Ga0495612_0000018 Ga0495612_0000018_35209_36210 333
2937 3300053084 Ga0495595_0000042 Ga0495595_0000042_30858_31859 333
2938 3300053084 Ga0495595_0000924 Ga0495595_0000924_6323_7324 333
2939 3300053084 Ga0495595_0032580 Ga0495595_0032580_1263_2264 333
2940 3300053084 Ga0495595_0103699 Ga0495595_0103699_301_1302 333
2941 3300053085 Ga0495619_0000006 Ga0495619_0000006_260663_261664 333
2942 3300053085 Ga0495619_0000761 Ga0495619_0000761_2345_3346 333
2943 3300053085 Ga0495619_0012457 Ga0495619_0012457_3178_4179 333
2944 3300053091 Ga0500647_0097732 Ga0500647_0097732_226_1227 333
2945 3300053094 Ga0500566_0000054 Ga0500566_0000054_24331_25332 333
2946 3300053094 Ga0500566_0000670 Ga0500566_0000670_53_1054 333
2947 3300053094 Ga0500566_0006619 Ga0500566_0006619_2947_3948 333
2948 3300053095 Ga0500640_024388 Ga0500640_024388_112_1113 333
2949 3300053096 Ga0500641_0001365 Ga0500641_0001365_2622_3623 333
2950 3300053104 Ga0500556_0000309 Ga0500556_0000309_34573_35574 333
2951 3300053111 Ga0500572_000348 Ga0500572_000348_12985_13986 333
2952 3300053119 Ga0500595_000345 Ga0500595_000345_7876_8877 333
2953 3300053119 Ga0500595_005080 Ga0500595_005080_4472_5473 333
2954 3300053134 Ga0500658_0017375 Ga0500658_0017375_138_1139 333
2955 3300053134 Ga0500658_0018494 Ga0500658_0018494_979_1980 333
2956 3300053136 Ga0500559_0000305 Ga0500559_0000305_28995_29996 333
2957 3300053139 Ga0500568_0006864 Ga0500568_0006864_3994_4995 333
2958 3300053139 Ga0500568_0020450 Ga0500568_0020450_1494_2495 333
2959 3300053142 Ga0500577_0114231 Ga0500577_0114231_76_1077 333
2960 3300053150 Ga0500603_000444 Ga0500603_000444_8139_9140 333
2961 3300053153 Ga0500616_0000038 Ga0500616_0000038_40416_41420 333
2962 3300053153 Ga0500616_0109240 Ga0500616_0109240_294_1295 333
2963 3300053156 Ga0500622_0005433 Ga0500622_0005433_5931_6932 333
2964 3300053158 Ga0500627_0123005 Ga0500627_0123005_18_1019 333
2965 3300053162 Ga0500638_046784 Ga0500638_046784_845_1846 333
2966 3300053178 Ga0500637_0000053 Ga0500637_0000053_9184_10185 333
2967 3300053178 Ga0500637_0000221 Ga0500637_0000221_7424_8425 333
2968 3300053735 Ga0500596_000229 Ga0500596_000229_2747_3748 333
2969 3300055283 Ga0500661_000122 Ga0500661_000122_6859_7860 333
2970 3300060353 Ga0501082_0085123 Ga0501082_0085123_1388_2389 333
2971 3300060353 Ga0501082_0255043 Ga0501082_0255043_462_1463 333
2972 2010549000 RicEn_C1066 RicEn_19740 334
2973 3300003354 JGI25160J50197_1000061 JGI25160J50197_100006171 334
2974 3300003374 JGI25161J50226_1000772 JGI25161J50226_10007723 334
2975 3300003775 Ga0055524_1007314 Ga0055524_10073142 334
2976 3300003781 Ga0055536_1006935 Ga0055536_10069355 334
2977 3300004625 Ga0055543_1000488 Ga0055543_100048812 334
2978 3300005262 Ga0065165_1000047 Ga0065165_100004750 334
2979 3300005983 Ga0081540_1060822 Ga0081540_10608221 334
2980 3300005985 Ga0081539_10071497 Ga0081539_100714972 334
2981 3300006038 Ga0075365_10026369 Ga0075365_100263693 334
2982 3300006042 Ga0075368_10060715 Ga0075368_100607151 334
2983 3300006177 Ga0075362_10068988 Ga0075362_100689882 334
2984 3300006178 Ga0075367_10016557 Ga0075367_100165574 334
2985 3300006195 Ga0075366_10005341 Ga0075366_100053415 334
2986 3300006195 Ga0075366_10006147 Ga0075366_100061475 334
2987 3300006195 Ga0075366_10037847 Ga0075366_100378471 334
2988 3300006948 Ga0099826_10000728 Ga0099826_100007281 334
2989 3300006948 Ga0099826_10011894 Ga0099826_100118941 334
2990 3300009148 Ga0105243_10007941 Ga0105243_100079417 334
2991 3300013100 Ga0157373_10003148 Ga0157373_100031486 334
2992 3300013102 Ga0157371_10000004 Ga0157371_1000000417 334
2993 3300013104 Ga0157370_10001986 Ga0157370_100019869 334
2994 3300013249 Ga0171463_1001 Ga0171463_10011351 334
2995 3300014497 Ga0182008_10011324 Ga0182008_100113243 334
2996 3300015690 Ga0183363_1300 Ga0183363_13004 334
2997 3300022739 Ga0228711_1000006 Ga0228711_1000006121 334
2998 3300022740 Ga0228710_1000004 Ga0228710_1000004172 334
2999 3300025208 Ga0209436_100222 Ga0209436_10022216 334
3000 3300025284 Ga0209130_1000005 Ga0209130_1000005549 334
3001 3300025292 Ga0209676_1005091 Ga0209676_10050914 334
3002 3300025294 Ga0209025_1000777 Ga0209025_100077747 334
3003 3300025295 Ga0209564_1000590 Ga0209564_10005908 334
3004 3300025297 Ga0209758_1002068 Ga0209758_100206820 334
3005 3300025298 Ga0209050_1002878 Ga0209050_10028784 334
3006 3300025299 Ga0209256_1000989 Ga0209256_100098922 334
3007 3300025302 Ga0207426_1000015 Ga0207426_100001550 334
3008 3300025303 Ga0209051_1004235 Ga0209051_10042357 334
3009 3300025304 Ga0209257_1002111 Ga0209257_10021114 334
3010 3300027111 Ga0209281_1000102 Ga0209281_1000102104 334
3011 3300027111 Ga0209281_1000571 Ga0209281_100057130 334
3012 3300027312 Ga0209371_1000009 Ga0209371_1000009976 334
3013 3300027312 Ga0209371_1000942 Ga0209371_10009426 334
3014 3300027666 Ga0209282_1000013 Ga0209282_1000013139 334
3015 3300027666 Ga0209282_1000274 Ga0209282_100027419 334
3016 3300027666 Ga0209282_1119567 Ga0209282_11195671 334
3017 3300027866 Ga0209813_10003182 Ga0209813_100031823 334
3018 3300027866 Ga0209813_10053647 Ga0209813_100536472 334
3019 3300028379 Ga0268266_10012625 Ga0268266_100126252 334
3020 3300030500 Ga0268256_1000010 Ga0268256_1000010975 334
3021 3300030500 Ga0268256_1002122 Ga0268256_10021225 334
3022 3300031241 Ga0265325_10000061 Ga0265325_1000006144 334
3023 3300031548 Ga0307408_100092939 Ga0307408_1000929393 334
3024 3300031616 Ga0307508_10067883 Ga0307508_100678833 334
3025 3300031967 Ga0315914_1000004 Ga0315914_1000004174 334
3026 3300031995 Ga0307409_100115574 Ga0307409_1001155741 334
3027 3300033430 Ga0315913_1000011 Ga0315913_100001117 334
3028 3300033464 Ga0315915_1000003 Ga0315915_1000003281 334
3029 3300041404 Ga0439436_0021919 Ga0439436_0021919_144_1148 334
3030 3300041405 Ga0439438_007078 Ga0439438_007078_482_1486 334
3031 3300046522 Ga0495643_0029728 Ga0495643_0029728_1281_2285 334
3032 3300047470 Ga0495681_0008191 Ga0495681_0008191_408_1412 334
3033 3300048915 Ga0496112_0267603 Ga0496112_0267603_192_1196 334
3034 3300048920 Ga0496117_0000002 Ga0496117_0000002_2467209_2468213 334
3035 3300048921 Ga0496118_0002959 Ga0496118_0002959_5120_6124 334
3036 3300048922 Ga0496119_0010578 Ga0496119_0010578_1906_2910 334
3037 3300048922 Ga0496119_0074669 Ga0496119_0074669_507_1574 334
3038 3300048923 Ga0496120_0002040 Ga0496120_0002040_5263_6267 334
3039 3300048923 Ga0496120_0007537 Ga0496120_0007537_1146_2213 334
3040 3300048924 Ga0496121_0000001 Ga0496121_0000001_334633_335700 334
3041 3300048924 Ga0496121_0285294 Ga0496121_0285294_21_1028 334
3042 3300048925 Ga0496122_0000001 Ga0496122_0000001_1811217_1812221 334
3043 3300048926 Ga0496123_0000001 Ga0496123_0000001_1814948_1815952 334
3044 3300048926 Ga0496123_0050827 Ga0496123_0050827_555_1622 334
3045 3300048927 Ga0496124_0000855 Ga0496124_0000855_9376_10380 334
3046 3300048927 Ga0496124_0006759 Ga0496124_0006759_8218_9222 334
3047 3300048927 Ga0496124_0058676 Ga0496124_0058676_392_1459 334
3048 3300048927 Ga0496124_0146766 Ga0496124_0146766_716_1720 334
3049 3300048928 Ga0496125_0000001 Ga0496125_0000001_446662_447729 334
3050 3300048929 Ga0496126_0001398 Ga0496126_0001398_32056_33060 334
3051 3300048929 Ga0496126_0025336 Ga0496126_0025336_3674_4678 334
3052 3300050489 nmdc:mga03683_10305_c1 nmdc:mga03683_10305_c1_1925_2929 334
3053 3300050491 nmdc:mga00v17_102_c1 nmdc:mga00v17_102_c1_15599_16603 334
3054 3300050491 nmdc:mga00v17_22034_c1 nmdc:mga00v17_22034_c1_2330_3397 334
3055 3300050493 nmdc:mga0k408_38736_c1 nmdc:mga0k408_38736_c1_73_1077 334
3056 3300050495 nmdc:mga04h51_2504_c1 nmdc:mga04h51_2504_c1_2390_3394 334
3057 3300050516 nmdc:mga0sz30_223_c1 nmdc:mga0sz30_223_c1_7457_8461 334
3058 3300053137 Ga0500561_0000491 Ga0500561_0000491_550_1554 334
3059 3300053153 Ga0500616_0001964 Ga0500616_0001964_6198_7202 334
3060 3300053157 Ga0500624_000799 Ga0500624_000799_5740_6744 334
3061 iso_pu_bacteria 2512875026 2512973267 334
3062 iso_pu_bacteria 2513237089 2513603623 334
3063 iso_pu_bacteria 2513237156 2513983328 334
3064 iso_pu_bacteria 2513237160 2514005863 334
3065 iso_pu_bacteria 2517487022 2517571732 334
3066 iso_pu_bacteria 2802428858 2802721197 334
3067 iso_pu_bacteria 2802428859 2802724510 334
3068 iso_pu_bacteria 2802428860 2802729824 334
3069 iso_pu_bacteria 2802428861 2802737169 334
3070 iso_pu_bacteria 2802428862 2802746818 334
3071 iso_pu_bacteria 2802428863 2802751786 334
3072 iso_pu_bacteria 2937029754 2937030648 334
3073 iso_pu_bacteria 2937036028 2937039118 334
3074 iso_pu_bacteria 2937078374 2937083989 334
3075 iso_pu_bacteria 2937084907 2937089699 334
3076 iso_pu_bacteria 2957375807 2957378083 334
3077 iso_pu_bacteria 2957437181 2957439430 334
3078 iso_pu_bacteria 2960591022 2960593102 334
3079 iso_pu_bacteria 2960631154 2960635438 334
3080 iso_pu_bacteria 2960680706 2960683873 334
3081 iso_pu_bacteria 2960693952 2960697509 334
3082 iso_pu_bacteria 2967686174 2967688387 334
3083 iso_pu_bacteria 2967728569 2967733880 334
3084 iso_pu_bacteria 2970026789 2970032040 334
3085 iso_pu_bacteria 2970122695 2970122843 334
3086 iso_pu_bacteria 2970143518 2970145368 334
3087 iso_pu_bacteria 2977530762 2977530835 334
3088 iso_pu_bacteria 2977544691 2977546863 334
3089 iso_pu_bacteria 8003999396 8004003401 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00389

2-Hacid_dh

D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain

54

372

0.95

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

159

340

0.95

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

200

316

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dbq-assembly1.cif.gz_A crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with nadp (i41) 0.949 6 332
4g2n-assembly1.cif.gz_A crystal structure of putative d-isomer specific 2-hydroxyacid dehydrogenase, nad-binding from polaromonas sp. js6 66 0.9485 6 330
6bii-assembly1.cif.gz_B crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with nadp and malonate (re-refinement of 5aow) 0.9468 6 329
1gdh-assembly1.cif.gz_B crystal structure of a nad-dependent d-glycerate dehydrogenase at 2.4 angstroms resolution 0.9456 6 330
6rj6-assembly1.cif.gz_B crystal structure of phgdh in complex with bi-4924 0.9442 101 319
ID Description Score Start End Superfamily
af_Q2FVW4_141_284_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9741 149 296 3.40.50.720
1gdhB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.968 106 294 3.40.50.720
af_Q2FVW4_100_283_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9653 106 296 3.40.50.720
af_Q7XRA3_150_294_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9646 149 301 3.40.50.720
4g2nB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9638 107 293 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3S1CSH3-F1-model_v4 D-glycerate dehydrogenase 0.995 155 293 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A3S1CSH3-F1-model_v4 D-glycerate dehydrogenase 0.9879 155 293 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A1T4RQ34-F1-model_v4 Glyoxylate reductase 0.9874 1 334 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A839LP99-F1-model_v4 deleted 0.982 12 334
AF-A0A1H2XJJ0-F1-model_v4 Glyoxylate reductase 0.9818 23 334 GO:0005829
GO:0016618
GO:0030267
GO:0051287

Feature Viewer

pLDDT pTM Quality
94.95 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map