F497186

General Info

Members Datasets Scaffolds Average Seq Length
3006 1596 6012 959

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2902405164|2902408998
Length 1054
Sequence QAGSRAGTGAGARAGASKAAPKTVSETNLKTTPKASSGPKAGPKAVPAAGVASEAAPPKPTRVKAGMPVARAAAAEAAVDAKLEALFDAAPASAHDRRVIAVRGAREHNLKNVDLTIPRDKLVVFTGLSGSGKSSLAFDTIYAEGQRRYVESLSAYARQFLEMMSKPDVDQIDGLSPAISIEQKTTSKNPRSTVGTVTEIYDYMRLLWARVGIPYSPATGLPIESQTVQQMVDRVLELPEKTRLYLLAPVVRGRKGEYRKEIAEYQKKGFQRLRVNGEYYAIDDVPKLDKKFKHDIDVVVDRIVVRADIAARLADSFETALELADGISEIVFADAPEGEAPRTITFSSRFACPVSGFTIAEIEPRLFSFNNPFGACPTCSGIGHEMRIDPELVISDPALSLKRGAVGPWAKSTSPYYGQTLDALAEHFGFKTGVAWQGLSETARAIVLYGSGNQSIRFAYDDGLRKYTVTKPFEGVIPNLERRYKESDSDAVREEIGRFMSETPCATCGGKRLKPEALAVKVAMADIADVTALSVSEAHRWFSELPDKLTAKQNAIAVRILKEIRDRLSFLVDVGLEYLTLARGSGSLSGGESQRIRLASQIGSGLTGVLYVLDEPSIGLHQRDNERLLGTLKRLRDLGNSVIVVEHDEDAILQADYVVDVGPGAGIHGGEIIAQGTPAEVLANPASLTAKYLTGEMAVRTPTARRKGRKGKLGLFGARGNNLKDVDVEIPLGTFTCITGVSGGGKSTLVIDTLYKAIAKKLNGALEHPAPYGRLEGLEHLDKVIDIDQSPIGRTPRSNPATYIGAFTPIRDWFAGLPEAKARGYQPGRFSFNVKGGRCEACSGDGVIKIEMHFLPDVYVTCDVCKGKRYDRETLEVKYRGKSIADVLDSTVEEAAELFKAVPAIRDKLETLKRVGLHYVHVGQQATTLSGGEAQRVKLSKELSKRATGRTLYILDEPTTGLHFHDVAKLMEVLHELVDQGNTVVVIEHNLEVIKTADWVIDMGPEGGDGGGKVVAQGTPEEIARAKASHTGRFLREVLARRPAAPASRGRAAE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
65 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
66 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
67 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
68 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
75 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
76 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
77 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
80 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
93 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
102 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
103 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
104 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
105 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
108 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
109 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
110 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
111 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
112 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
113 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
118 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
119 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
120 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
121 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
124 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
126 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
127 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
128 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
129 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
130 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
131 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
132 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
134 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
136 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
137 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
138 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
139 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
140 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
141 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
142 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
143 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
144 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
145 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
146 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
147 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
148 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
149 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
150 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
156 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
157 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
158 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
159 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
160 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
161 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
162 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
163 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
164 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
165 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
166 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
167 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
168 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
169 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
170 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
171 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
172 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
173 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
174 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
175 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
177 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
178 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
180 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
181 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
182 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
185 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
186 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
187 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
190 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
193 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
195 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
198 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
256 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
257 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
259 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
260 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
261 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
262 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
264 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
265 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
269 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
270 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
271 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
272 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
273 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
274 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
275 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
276 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
277 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
278 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
279 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
280 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
281 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
282 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
283 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
284 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
285 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
286 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
287 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
288 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
289 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
290 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
291 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
292 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
293 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
294 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
295 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
296 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
297 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
298 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
299 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
300 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
301 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
302 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
303 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
304 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
305 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
306 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
307 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
308 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
309 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
310 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
311 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
312 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
313 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
314 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
315 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
316 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
317 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
318 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
319 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
320 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
321 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
322 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
323 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
324 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
325 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
326 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
327 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
328 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
329 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
330 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
331 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
332 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
333 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
334 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
335 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
336 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
337 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
338 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
339 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
340 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
341 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
342 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
343 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
344 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
345 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
346 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
347 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
348 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
349 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
350 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
351 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
352 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
353 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
354 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
355 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
356 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
357 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
358 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
359 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
360 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
361 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
362 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
363 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
364 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
365 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
366 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
367 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
368 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
369 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
370 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
371 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
372 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
373 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
374 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
375 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
376 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
377 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
378 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
379 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
380 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
381 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
382 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
383 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
384 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
385 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
386 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
387 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
388 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
389 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
390 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
391 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
392 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
393 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
394 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
395 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
396 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
397 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
398 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
399 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
400 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
401 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
402 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
403 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
404 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
405 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
406 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
407 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
408 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
409 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
410 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
411 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
412 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
413 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
414 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
415 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
416 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
417 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
418 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
419 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
420 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
421 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
422 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
423 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
424 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
425 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
426 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
427 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
428 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
429 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
430 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
431 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
432 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
433 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
434 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
435 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
436 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
437 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
438 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
439 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
440 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
441 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
442 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
443 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
444 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
445 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
446 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
447 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
448 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
449 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
450 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
451 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
452 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
453 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
454 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
455 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
456 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
457 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
458 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
459 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
460 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
461 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
462 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
463 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
468 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
471 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
472 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
473 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
474 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
475 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
476 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
478 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
479 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
480 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
481 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
482 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
483 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
484 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
485 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
486 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
487 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
488 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
489 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
490 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
491 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
492 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
493 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
494 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
495 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
496 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
497 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
498 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
499 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
500 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
501 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
502 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
503 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
504 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
505 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
506 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
507 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
508 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
509 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
510 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
511 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
512 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
513 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
514 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
515 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
516 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
517 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
518 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
519 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
520 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
521 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
522 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
523 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
524 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
525 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
526 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
527 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
528 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
529 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
530 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
531 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
532 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
533 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
534 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
535 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
536 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
537 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
538 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
539 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
540 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
541 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
542 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
543 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
544 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
545 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
546 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
547 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
548 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
549 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
550 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
551 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
552 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
553 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
554 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
555 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
556 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
557 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
558 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
559 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
560 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
561 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
562 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
563 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
564 2508501050 Microvirga lupini Lut6 Isolate Nodule
565 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
566 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
567 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
568 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
569 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
570 2509276019 Ensifer aridi TW10 Isolate Nodule
571 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
572 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
573 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
574 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
575 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
576 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
577 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
578 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
579 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
580 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
581 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
582 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
583 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
584 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
585 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
586 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
587 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
588 2512875024
589 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
590 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
591 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
592 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
593 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
594 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
595 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
596 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
597 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
598 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
599 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
600 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
601 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
602 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
603 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
604 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
605 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
606 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
607 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
608 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
609 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
610 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
611 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
612 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
613 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
614 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
615 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
616 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
617 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
618 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
619 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
620 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
621 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
622 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
623 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
624 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
625 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
626 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
627 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
628 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
629 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
630 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
631 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
632 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
633 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
634 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
635 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
636 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
637 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
638 2534681786 Brucella suis 92/29 Isolate Unclassified
639 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
640 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
641 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
642 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
643 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
644 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
645 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
646 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
647 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
648 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
649 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
650 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
651 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
652 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
653 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
654 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
655 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
656 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
657 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
658 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
659 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
660 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
661 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
662 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
663 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
664 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
665 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
666 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
667 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
668 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
669 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
670 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
671 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
672 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
673 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
674 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
675 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
676 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
677 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
678 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
679 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
680 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
681 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
682 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
683 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
684 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
685 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
686 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
687 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
688 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
689 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
690 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
691 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
692 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
693 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
694 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
695 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
696 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
697 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
698 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
699 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
700 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
701 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
702 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
703 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
704 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
705 2643221557 Ensifer sp. Root558 Isolate Unclassified
706 2643221558 Rhizobium sp. Root149 Isolate Unclassified
707 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
708 2643221568 Rhizobium sp. Root564 Isolate Unclassified
709 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
710 2643221582 Rhizobium sp. Root651 Isolate Unclassified
711 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
712 2643221599 Rhizobium sp. Root708 Isolate Unclassified
713 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
714 2643221607 Rhizobium sp. Root73 Isolate Unclassified
715 2643221610 Ensifer sp. Root74 Isolate Unclassified
716 2643221618 Ensifer sp. Root231 Isolate Unclassified
717 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
718 2643221626 Ensifer sp. Root31 Isolate Unclassified
719 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
720 2643221629 Devosia sp. Root105 Isolate Unclassified
721 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
722 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
723 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
724 2643221640 Caulobacter sp. Root342 Isolate Unclassified
725 2643221642 Caulobacter sp. Root343 Isolate Unclassified
726 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
727 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
728 2643221655 Ensifer sp. Root1252 Isolate Unclassified
729 2643221659 Ensifer sp. Root127 Isolate Unclassified
730 2643221662 Devosia sp. Root413D1 Isolate Unclassified
731 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
732 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
733 2643221668 Ensifer sp. Root423 Isolate Unclassified
734 2643221675 Ensifer sp. Root1298 Isolate Unclassified
735 2643221680 Ensifer sp. Root1312 Isolate Unclassified
736 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
737 2643221688 Rhizobium sp. Root482 Isolate Unclassified
738 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
739 2643221693 Rhizobium sp. Root491 Isolate Unclassified
740 2643221698 Ensifer sp. Root142 Isolate Unclassified
741 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
742 2643221712 Ensifer sp. Root258 Isolate Unclassified
743 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
744 2643221718 Rhizobium sp. Root268 Isolate Unclassified
745 2643221719 Rhizobium sp. Root274 Isolate Unclassified
746 2643221723 Ensifer sp. Root278 Isolate Unclassified
747 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
748 2643221726 Ensifer sp. Root954 Isolate Unclassified
749 2643221733 Bosea sp. Root381 Isolate Unclassified
750 2643221734 Bosea sp. Root670 Isolate Unclassified
751 2643221736 Bosea sp. Root483D1 Isolate Unclassified
752 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
753 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
754 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
755 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
756 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
757 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
758 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
759 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
760 2718217882 Rhizobium sp. N741 Isolate Nodule
761 2718217927 Rhizobium sp. N324 Isolate Nodule
762 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
763 2718218009 Rhizobium sp. N561 Isolate Nodule
764 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
765 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
766 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
767 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
768 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
769 2718218363 Rhizobium sp. N113 Isolate Nodule
770 2718218365 Rhizobium sp. N731 Isolate Nodule
771 2718218366 Rhizobium sp. N621 Isolate Nodule
772 2718218423 Rhizobium sp. N941 Isolate Nodule
773 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
774 2721755514 Rhizobium sp. N6212 Isolate Nodule
775 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
776 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
777 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
778 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
779 2721755809 Rhizobium sp. N541 Isolate Nodule
780 2721755810 Rhizobium sp. N871 Isolate Nodule
781 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
782 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
783 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
784 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
785 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
786 2728369365 Rhizobium sp. N1341 Isolate Nodule
787 2728369397 Rhizobium sp. N1314 Isolate Nodule
788 2738541278 Niastella sp. CF465 Isolate Unclassified
789 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
790 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
791 2738541283 Pedobacter sp. OK701 Isolate Unclassified
792 2738541284 Pedobacter sp. YR016 Isolate Unclassified
793 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
794 2738541293 Rhizobium sp. GV031 Isolate Unclassified
795 2738541302 Pedobacter sp. CF074 Isolate Unclassified
796 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
797 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
798 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
799 2738543023 Pedobacter sp. OK628 Isolate Unclassified
800 2738543024 Aminobacter sp. AP02 Isolate Unclassified
801 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
802 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
803 2739367651 Pedobacter sp. OK291 Isolate Unclassified
804 2739367656 Pedobacter sp. CF523 Isolate Unclassified
805 2739367663 Pedobacter sp. YR510 Isolate Unclassified
806 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
807 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
808 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
809 2751185800 Brucella pituitosa AA2 Isolate Unclassified
810 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
811 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
812 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
813 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
814 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
815 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
816 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
817 2773857925 Microvirga vignae BR3299 Isolate Unclassified
818 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
819 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
820 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
821 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
822 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
823 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
824 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
825 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
826 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
827 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
828 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
829 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
830 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
831 2791355256 Rhizobium sp. M10 Isolate Nodule
832 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
833 2791355260 Rhizobium sp. L9 Isolate Nodule
834 2791355261 Rhizobium sp. J15 Isolate Nodule
835 2791355262 Rhizobium sp. M1 Isolate Nodule
836 2791355263 Rhizobium chutanense C5 Isolate Nodule
837 2791355264 Rhizobium sp. S9 Isolate Nodule
838 2791355265 Rhizobium sp. H4 Isolate Nodule
839 2791355266 Rhizobium sp. L43 Isolate Nodule
840 2791355267 Rhizobium sp. L18 Isolate Nodule
841 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
842 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
843 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
844 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
845 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
846 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
847 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
848 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
849 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
850 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
851 2802429633 Rhizobium anhuiense J3 Isolate Nodule
852 2802429634 Rhizobium anhuiense S10 Isolate Nodule
853 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
854 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
855 2802429637 Rhizobium anhuiense C15 Isolate Nodule
856 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
857 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
858 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
859 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
860 2818991437 Pedobacter terrae 518 Isolate Unclassified
861 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
862 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
863 2818991444 Filimonas endophytica 3197 Isolate Unclassified
864 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
865 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
866 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
867 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
868 2818991467 Bosea vestrisii 3192 Isolate Unclassified
869 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
870 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
871 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
872 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
873 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
874 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
875 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
876 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
877 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
878 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
879 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
880 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
881 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
882 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
883 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
884 2838048938 Rhizobium pisi 27/80 Isolate Nodule
885 2838061910 Rhizobium phaseoli L15 Isolate Nodule
886 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
887 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
888 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
889 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
890 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
891 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
892 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
893 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
894 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
895 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
896 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
897 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
898 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
899 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
900 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
901 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
902 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
903 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
904 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
905 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
906 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
907 2841760612 Bosea sp. Tri-49 Isolate Nodule
908 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
909 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
910 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
911 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
912 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
913 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
914 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
915 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
916 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
917 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
918 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
919 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
920 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
921 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
922 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
923 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
924 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
925 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
926 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
927 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
928 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
929 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
930 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
931 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
932 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
933 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
934 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
935 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
936 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
937 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
938 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
939 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
940 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
941 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
942 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
943 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
944 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
945 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
946 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
947 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
948 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
949 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
950 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
951 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
952 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
953 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
954 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
955 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
956 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
957 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
958 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
959 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
960 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
961 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
962 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
963 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
964 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
965 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
966 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
967 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
968 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
969 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
970 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
971 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
972 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
973 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
974 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
975 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
976 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
977 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
978 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
979 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
980 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
981 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
982 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
983 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
984 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
985 2844104063 Bosea sp. Tri-39 Isolate Nodule
986 2844163670 Ensifer sp. 1H6 Isolate Unclassified
987 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
988 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
989 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
990 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
991 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
992 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
993 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
994 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
995 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
996 2849560528 Caulobacter zeae 410 Isolate Unclassified
997 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
998 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
999 2851153111 Caulobacter radicis 736 Isolate Unclassified
1000 2851182111 Bosea sp. Tri-44 Isolate Nodule
1001 2851246043 Bosea sp. Tri-54 Isolate Nodule
1002 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
1003 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
1004 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
1005 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
1006 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
1007 2854911287 Brucella lupini LUP21 Isolate Unclassified
1008 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
1009 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
1010 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
1011 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
1012 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
1013 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
1014 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
1015 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
1016 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
1017 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
1018 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
1019 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
1020 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
1021 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
1022 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
1023 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
1024 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
1025 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
1026 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
1027 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
1028 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
1029 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
1030 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
1031 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
1032 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
1033 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
1034 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
1035 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
1036 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
1037 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
1038 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
1039 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
1040 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
1041 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
1042 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
1043 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
1044 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
1045 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
1046 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
1047 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
1048 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
1049 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
1050 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
1051 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
1052 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
1053 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
1054 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
1055 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
1056 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
1057 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
1058 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
1059 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
1060 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
1061 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
1062 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
1063 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
1064 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
1065 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
1066 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
1067 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
1068 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
1069 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
1070 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
1071 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
1072 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
1073 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
1074 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
1075 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
1076 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
1077 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
1078 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
1079 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
1080 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
1081 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
1082 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
1083 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
1084 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
1085 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
1086 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
1087 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
1088 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
1089 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
1090 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
1091 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
1092 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
1093 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
1094 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
1095 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
1096 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
1097 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
1098 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
1099 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
1100 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
1101 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
1102 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
1103 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
1104 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
1105 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
1106 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
1107 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
1108 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
1109 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
1110 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
1111 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
1112 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
1113 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
1114 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
1115 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
1116 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
1117 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
1118 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
1119 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
1120 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
1121 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
1122 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
1123 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
1124 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
1125 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
1126 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
1127 2902330777 Methylobacterium sp. 2A Isolate Unclassified
1128 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
1129 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
1130 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
1131 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
1132 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
1133 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
1134 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
1135 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
1136 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
1137 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
1138 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
1139 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
1140 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
1141 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
1142 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
1143 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
1144 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
1145 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
1146 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
1147 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
1148 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
1149 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
1150 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
1151 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
1152 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
1153 2909042592 Labrys sp. LIt4 Isolate Nodule
1154 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
1155 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
1156 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
1157 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
1158 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
1159 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
1160 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
1161 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
1162 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
1163 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
1164 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
1165 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
1166 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
1167 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
1168 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
1169 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
1170 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
1171 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
1172 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
1173 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
1174 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
1175 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
1176 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
1177 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
1178 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
1179 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
1180 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
1181 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
1182 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
1183 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
1184 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
1185 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
1186 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
1187 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
1188 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
1189 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
1190 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
1191 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
1192 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
1193 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
1194 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
1195 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
1196 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
1197 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
1198 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
1199 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
1200 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
1201 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
1202 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
1203 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
1204 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
1205 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
1206 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
1207 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
1208 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
1209 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
1210 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
1211 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
1212 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
1213 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
1214 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
1215 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
1216 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
1217 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
1218 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
1219 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
1220 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
1221 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
1222 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
1223 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
1224 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
1225 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
1226 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
1227 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
1228 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
1229 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
1230 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
1231 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
1232 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
1233 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
1234 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
1235 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
1236 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
1237 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
1238 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
1239 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
1240 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
1241 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
1242 2933599457 Rhizobium phaseoli M3 Isolate Nodule
1243 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
1244 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
1245 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
1246 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
1247 2936381700 Rhizobium chutanense C16 Isolate Unclassified
1248 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
1249 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
1250 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
1251 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
1252 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
1253 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
1254 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
1255 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
1256 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
1257 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
1258 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
1259 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
1260 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
1261 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
1262 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
1263 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
1264 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
1265 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
1266 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
1267 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
1268 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
1269 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
1270 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
1271 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
1272 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
1273 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
1274 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
1275 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
1276 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
1277 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
1278 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
1279 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
1280 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
1281 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
1282 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
1283 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
1284 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
1285 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
1286 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
1287 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
1288 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
1289 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
1290 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
1291 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
1292 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
1293 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
1294 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
1295 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
1296 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
1297 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
1298 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
1299 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
1300 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
1301 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
1302 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
1303 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
1304 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
1305 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
1306 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
1307 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
1308 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
1309 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
1310 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
1311 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
1312 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
1313 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
1314 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
1315 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
1316 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
1317 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
1318 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
1319 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
1320 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
1321 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
1322 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
1323 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
1324 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
1325 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
1326 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
1327 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
1328 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
1329 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
1330 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
1331 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
1332 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
1333 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
1334 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
1335 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
1336 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
1337 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
1338 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
1339 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
1340 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
1341 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
1342 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
1343 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
1344 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
1345 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
1346 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
1347 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
1348 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
1349 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
1350 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
1351 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
1352 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
1353 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
1354 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
1355 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
1356 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
1357 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
1358 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
1359 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
1360 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
1361 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
1362 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
1363 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
1364 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
1365 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
1366 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
1367 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
1368 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
1369 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
1370 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
1371 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
1372 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
1373 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
1374 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
1375 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
1376 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
1377 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
1378 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
1379 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
1380 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
1381 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
1382 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
1383 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
1384 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
1385 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
1386 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
1387 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
1388 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
1389 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
1390 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
1391 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
1392 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
1393 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
1394 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
1395 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
1396 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
1397 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
1398 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
1399 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
1400 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
1401 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
1402 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
1403 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
1404 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
1405 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
1406 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
1407 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
1408 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
1409 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
1410 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
1411 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
1412 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
1413 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
1414 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
1415 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
1416 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
1417 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
1418 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
1419 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
1420 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
1421 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
1422 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
1423 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
1424 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
1425 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
1426 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
1427 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
1428 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
1429 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
1430 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
1431 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
1432 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
1433 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
1434 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
1435 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
1436 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
1437 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
1438 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
1439 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
1440 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
1441 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
1442 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
1443 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
1444 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
1445 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
1446 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
1447 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
1448 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
1449 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
1450 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
1451 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
1452 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
1453 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
1454 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
1455 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
1456 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
1457 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
1458 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
1459 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
1460 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
1461 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
1462 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
1463 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
1464 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
1465 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
1466 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
1467 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
1468 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
1469 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
1470 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
1471 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
1472 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
1473 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
1474 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
1475 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
1476 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
1477 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
1478 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
1479 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
1480 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
1481 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
1482 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
1483 2996887358 Rhizobium sp. R711 Isolate Nodule
1484 2996893221 Rhizobium sp. R635 Isolate Nodule
1485 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
1486 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
1487 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
1488 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
1489 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
1490 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
1491 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
1492 3004167301 Mesorhizobium loti 582 Isolate Unclassified
1493 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
1494 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
1495 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
1496 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
1497 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
1498 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
1499 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
1500 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
1501 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
1502 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
1503 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
1504 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
1505 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
1506 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
1507 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
1508 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
1509 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
1510 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1511 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1512 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
1513 641522639 Methylobacterium sp. 4-46 Isolate Nodule
1514 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
1515 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
1516 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1517 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1518 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1519 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1520 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
1521 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1522 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
1523 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1524 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1525 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1526 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1527 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1528 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1529 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1530 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1531 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1532 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1533 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1534 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1535 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1536 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1537 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1538 8005258706 Rhizobium sp. R693 Isolate Nodule
1539 8005275841 Rhizobium sp. N4311 Isolate Nodule
1540 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1541 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1542 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1543 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1544 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1545 8005321885 Rhizobium sp. R72 Isolate Nodule
1546 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1547 8005382845 Rhizobium sp. R634 Isolate Nodule
1548 8005395548 Rhizobium sp. R339 Isolate Nodule
1549 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1550 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1551 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1552 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1553 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1554 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1555 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1556 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1557 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1558 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1559 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1560 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1561 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1562 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1563 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1564 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1565 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1566 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1567 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1568 8018176218 Rhizobium sp. N122 Isolate Nodule
1569 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
1570 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
1571 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1572 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1573 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1574 8024501048 Rhizobium sp. H4 Isolate Nodule
1575 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
1576 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
1577 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1578 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1579 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
1580 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
1581 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1582 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1583 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
1584 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
1585 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1586 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
1587 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1588 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
1589 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
1590 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1591 8056382006 Rhizobium croatiense 13T Isolate Nodule
1592 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere
1593 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1594 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
1595 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1596 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 65.44
Metatranscriptomes 0.03
Isolates 34.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 8.22
Nodule 22.49
Rhizoplane 3.06
Rhizosphere 53.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663468 2162886007 Bacteria 272152
2 SwRhRL2b_contig_522317 2162886007 Bacteria 7005
3 JGI24740J21852_10002792 3300001979 Bacteria 7815
4 JGI24739J22299_10000436 3300001989 Bacteria 14504
5 JGI24737J22298_10001296 3300001990 Bacteria 8857
6 JGI24735J21928_10000017 3300002067 Bacteria 114440
7 JGI24751J29686_10003345 3300002459 Bacteria 3233
8 JGI25155J39150_1000011 3300002704 Bacteria 207685
9 JGI25156J39149_1000030 3300002705 Bacteria 126029
10 JGI25162J39368_1000008 3300002737 Bacteria 397212
11 JGI25162J39368_1000596 3300002737 Bacteria 26217
12 JGI25162J39368_1001595 3300002737 Bacteria 11426
13 JGI25162J39368_1002599 3300002737 Bacteria 6769
14 JGI25154J39366_1000002 3300002738 Bacteria 466942
15 JGI25154J39366_1000289 3300002738 Bacteria 30213
16 JGI25157J39369_1000010 3300002741 Bacteria 207685
17 JGI25157J39369_1000136 3300002741 Bacteria 61418
18 JGI25152J39213_1000345 3300002773 Bacteria 29225
19 JGI25152J39213_1002282 3300002773 Bacteria 7396
20 JGI25152J39213_1003413 3300002773 Bacteria 5436
21 JGI25150J39212_1000011 3300002774 Bacteria 195312
22 JGI25150J39212_1000137 3300002774 Bacteria 41263
23 JGI25159J45721_1000029 3300002987 Bacteria 105868
24 JGI25159J45721_1000368 3300002987 Bacteria 20866
25 JGI25159J45721_1001807 3300002987 Bacteria 8580
26 JGI25159J45721_1002381 3300002987 Bacteria 7169
27 JGI25151J46595_10000033 3300003187 Bacteria 195312
28 JGI25151J46595_10000221 3300003187 Bacteria 67231
29 JGI25151J46595_10000300 3300003187 Bacteria 54213
30 JGI25406J46586_10000467 3300003203 Bacteria 18878
31 JGI25406J46586_10001590 3300003203 Bacteria 10727
32 JGI25406J46586_10014259 3300003203 Bacteria 3385
33 JGI25165J46597_1000087 3300003214 Bacteria 170335
34 JGI25165J46597_1000139 3300003214 Bacteria 121216
35 JGI25165J46597_1000658 3300003214 Bacteria 28305
36 JGI25165J46597_1001769 3300003214 Bacteria 9373
37 JGI25165J46597_1001805 3300003214 Bacteria 9083
38 JGI25165J46597_1003550 3300003214 Bacteria 3807
39 JGI25153J46596_10000052 3300003215 Bacteria 139303
40 JGI25153J46596_10000148 3300003215 Bacteria 70861
41 JGI25153J46596_10001493 3300003215 Bacteria 13955
42 JGI25153J46596_10003972 3300003215 Bacteria 8090
43 JGI25153J46596_10008367 3300003215 Bacteria 4953
44 rootH1_10000450 3300003316 Bacteria 53148
45 rootH2_10001503 3300003320 Bacteria 76614
46 rootH2_10024240 3300003320 Bacteria 36961
47 rootL2_10001124 3300003322 Bacteria 72110
48 rootL2_10012151 3300003322 Bacteria 12936
49 rootH1_10003667 3300003323 Bacteria 128566
50 rootH1_10005217 3300003323 Bacteria 6490
51 rootH1_10005219 3300003323 Bacteria 10732
52 rootH1_10005386 3300003323 Bacteria 37172
53 rootH1_10005865 3300003323 Bacteria 31302
54 rootH1_10006071 3300003323 Bacteria 12892
55 JGI25160J50197_1000004 3300003354 Bacteria 419797
56 JGI25160J50197_1000011 3300003354 Bacteria 275577
57 JGI25160J50197_1007676 3300003354 Bacteria 4196
58 JGI25160J50197_1009700 3300003354 Bacteria 3546
59 JGI25161J50226_1000003 3300003374 Bacteria 413345
60 JGI25161J50226_1000152 3300003374 Bacteria 47933
61 JGI25161J50226_1000180 3300003374 Bacteria 42402
62 Ga0055542_1000775 3300003762 Bacteria 24034
63 Ga0055526_1000454 3300003771 Bacteria 32661
64 Ga0055526_1003639 3300003771 Bacteria 9654
65 Ga0055526_1008941 3300003771 Bacteria 4908
66 Ga0055526_1009079 3300003771 Bacteria 4851
67 Ga0055536_1000016 3300003781 Bacteria 222134
68 Ga0055536_1000287 3300003781 Bacteria 38244
69 Ga0055536_1001173 3300003781 Bacteria 16345
70 Ga0055528_1000128 3300003790 Bacteria 61180
71 Ga0055528_1000862 3300003790 Bacteria 20563
72 Ga0055528_1002605 3300003790 Bacteria 9547
73 Ga0055530_10000896 3300003791 Bacteria 24516
74 Ga0055530_10002157 3300003791 Bacteria 13040
75 Ga0055540_1003866 3300003792 Bacteria 7030
76 Ga0055531_10000014 3300003794 Bacteria 184532
77 Ga0055531_10000058 3300003794 Bacteria 121538
78 Ga0055531_10000667 3300003794 Bacteria 29334
79 Ga0055531_10005305 3300003794 Bacteria 7564
80 Ga0058692_1002103 3300003856 Bacteria 6879
81 Ga0055543_1000001 3300004625 Bacteria 419949
82 Ga0055543_1000097 3300004625 Bacteria 75364
83 Ga0055543_1000255 3300004625 Bacteria 40071
84 Ga0055543_1001277 3300004625 Bacteria 10363
85 Ga0065165_1000018 3300005262 Bacteria 275082
86 Ga0065165_1000049 3300005262 Bacteria 195588
87 Ga0065165_1000185 3300005262 Bacteria 108984
88 Ga0065165_1000258 3300005262 Bacteria 91861
89 Ga0065165_1000667 3300005262 Bacteria 49547
90 Ga0065714_10002205 3300005288 Bacteria 57702
91 Ga0065714_10002764 3300005288 Bacteria 25876
92 Ga0065714_10003429 3300005288 Bacteria 8285
93 Ga0065704_10000703 3300005289 Bacteria 23928
94 Ga0065704_10070133 3300005289 Bacteria 1266035
95 Ga0065704_10070225 3300005289 Bacteria 60561
96 Ga0065704_10072414 3300005289 Bacteria 8564
97 Ga0065715_10100275 3300005293 Bacteria 3313
98 Ga0070658_10000236 3300005327 Bacteria 48963
99 Ga0070658_10000565 3300005327 Bacteria 32188
100 Ga0070658_10000893 3300005327 Bacteria 25540
101 Ga0070658_10001887 3300005327 Bacteria 17678
102 Ga0070658_10017314 3300005327 Bacteria 5768
103 Ga0070676_10000133 3300005328 Bacteria 28281
104 Ga0070676_10001210 3300005328 Bacteria 12934
105 Ga0070676_10010902 3300005328 Bacteria 4937
106 Ga0070683_100000356 3300005329 Bacteria 31602
107 Ga0070670_100001069 3300005331 Bacteria 21735
108 Ga0070670_100056639 3300005331 Bacteria 3364
109 Ga0068869_100027880 3300005334 Bacteria 3941
110 Ga0070666_10001123 3300005335 Bacteria 16300
111 Ga0070680_100000555 3300005336 Bacteria 25565
112 Ga0070680_100003300 3300005336 Bacteria 12040
113 Ga0070680_100007469 3300005336 Bacteria 8335
114 Ga0070680_100012337 3300005336 Bacteria 6635
115 Ga0070680_100017121 3300005336 Bacteria 5709
116 Ga0070680_100049331 3300005336 Bacteria 3431
117 Ga0070682_100006568 3300005337 Bacteria 6524
118 Ga0070682_100016402 3300005337 Bacteria 4305
119 Ga0070682_100025133 3300005337 Bacteria 3552
120 Ga0068868_100009669 3300005338 Bacteria 6959
121 Ga0068868_100011355 3300005338 Bacteria 6486
122 Ga0070660_100007015 3300005339 Bacteria 7821
123 Ga0070660_100008118 3300005339 Bacteria 7337
124 Ga0070660_100010259 3300005339 Bacteria 6611
125 Ga0070689_100011666 3300005340 Bacteria 6303
126 Ga0070691_10000336 3300005341 Bacteria 16662
127 Ga0070691_10001047 3300005341 Bacteria 11397
128 Ga0070661_100005059 3300005344 Bacteria 9095
129 Ga0070692_10002489 3300005345 Bacteria 7168
130 Ga0070668_100003081 3300005347 Bacteria 12319
131 Ga0070668_100019514 3300005347 Bacteria 5103
132 Ga0070669_100008200 3300005353 Bacteria 7461
133 Ga0070669_100017834 3300005353 Bacteria 5067
134 Ga0070675_100007173 3300005354 Bacteria 8590
135 Ga0070671_100005575 3300005355 Bacteria 10026
136 Ga0070671_100066045 3300005355 Bacteria 3015
137 Ga0070674_100001299 3300005356 Bacteria 13128
138 Ga0070674_100003617 3300005356 Bacteria 8697
139 Ga0070674_100012974 3300005356 Bacteria 5133
140 Ga0070674_100031662 3300005356 Bacteria 3506
141 Ga0070674_100035938 3300005356 Bacteria 3322
142 Ga0070673_100002145 3300005364 Bacteria 11952
143 Ga0070673_100021316 3300005364 Bacteria 4695
144 Ga0070688_100018548 3300005365 Bacteria 4017
145 Ga0070659_100000094 3300005366 Bacteria 66823
146 Ga0070659_100005816 3300005366 Bacteria 8882
147 Ga0070659_100018027 3300005366 Bacteria 5324
148 Ga0070659_100021309 3300005366 Bacteria 4934
149 Ga0070659_100030076 3300005366 Bacteria 4201
150 Ga0070667_100003052 3300005367 Bacteria 14391
151 Ga0070667_100010337 3300005367 Bacteria 7707
152 Ga0070709_10000046 3300005434 Bacteria 100297
153 Ga0070709_10000439 3300005434 Bacteria 25188
154 Ga0070709_10003395 3300005434 Bacteria 8555
155 Ga0070714_100000364 3300005435 Bacteria 33964
156 Ga0070714_100016008 3300005435 Bacteria 6045
157 Ga0070713_100000003 3300005436 Bacteria 245840
158 Ga0070713_100000236 3300005436 Bacteria 36563
159 Ga0070711_100000064 3300005439 Bacteria 63101
160 Ga0070711_100019691 3300005439 Bacteria 4333
161 Ga0070705_100000220 3300005440 Bacteria 33993
162 Ga0070705_100006889 3300005440 Bacteria 5583
163 Ga0070705_100013402 3300005440 Bacteria 4193
164 Ga0070700_100001090 3300005441 Bacteria 13418
165 Ga0070700_100007596 3300005441 Bacteria 5864
166 Ga0070694_100000670 3300005444 Bacteria 18973
167 Ga0070694_100002481 3300005444 Bacteria 10889
168 Ga0070694_100003885 3300005444 Bacteria 8929
169 Ga0070694_100020057 3300005444 Bacteria 4257
170 Ga0070708_100002927 3300005445 Bacteria 13283
171 Ga0070708_100013776 3300005445 Bacteria 6635
172 Ga0070708_100037645 3300005445 Bacteria 4222
173 Ga0070663_100002118 3300005455 Bacteria 11122
174 Ga0070678_100008273 3300005456 Bacteria 6224
175 Ga0070662_100000003 3300005457 Bacteria 239813
176 Ga0070662_100005503 3300005457 Bacteria 8096
177 Ga0070662_100011018 3300005457 Bacteria 5955
178 Ga0070681_10000001 3300005458 Bacteria 946857
179 Ga0070681_10000486 3300005458 Bacteria 32401
180 Ga0070681_10001680 3300005458 Bacteria 19775
181 Ga0070681_10003095 3300005458 Bacteria 15444
182 Ga0070681_10003922 3300005458 Bacteria 14023
183 Ga0070681_10008137 3300005458 Bacteria 10264
184 Ga0070681_10011609 3300005458 Bacteria 8721
185 Ga0070681_10018719 3300005458 Bacteria 6930
186 Ga0070681_10022794 3300005458 Bacteria 6293
187 Ga0070681_10028845 3300005458 Bacteria 5576
188 Ga0070681_10044695 3300005458 Bacteria 4434
189 Ga0070681_10048166 3300005458 Bacteria 4259
190 Ga0068867_100000624 3300005459 Bacteria 23370
191 Ga0068867_100010519 3300005459 Bacteria 6528
192 Ga0070706_100021386 3300005467 Bacteria 5959
193 Ga0070706_100043544 3300005467 Bacteria 4148
194 Ga0070707_100001529 3300005468 Bacteria 22508
195 Ga0070707_100002641 3300005468 Bacteria 17051
196 Ga0070707_100003141 3300005468 Bacteria 15631
197 Ga0070707_100007839 3300005468 Bacteria 9915
198 Ga0070707_100019849 3300005468 Bacteria 6335
199 Ga0070707_100022687 3300005468 Bacteria 5934
200 Ga0070707_100027125 3300005468 Bacteria 5446
201 Ga0070698_100001624 3300005471 Bacteria 25040
202 Ga0070698_100001984 3300005471 Bacteria 22716
203 Ga0070698_100007258 3300005471 Bacteria 12005
204 Ga0070698_100009066 3300005471 Bacteria 10695
205 Ga0070698_100021234 3300005471 Bacteria 6803
206 Ga0070698_100037793 3300005471 Bacteria 4977
207 Ga0070699_100000998 3300005518 Bacteria 26316
208 Ga0070699_100001841 3300005518 Bacteria 19259
209 Ga0070699_100002193 3300005518 Bacteria 17667
210 Ga0070699_100008369 3300005518 Bacteria 8962
211 Ga0070699_100017920 3300005518 Bacteria 6082
212 Ga0070699_100048558 3300005518 Bacteria 3673
213 Ga0070679_100000096 3300005530 Bacteria 67304
214 Ga0070679_100001044 3300005530 Bacteria 24138
215 Ga0070679_100003574 3300005530 Bacteria 14234
216 Ga0070679_100009019 3300005530 Bacteria 9408
217 Ga0070679_100010444 3300005530 Bacteria 8808
218 Ga0070679_100021714 3300005530 Bacteria 6269
219 Ga0070679_100059968 3300005530 Bacteria 3792
220 Ga0070679_100083236 3300005530 Bacteria 3188
221 Ga0070684_100001070 3300005535 Bacteria 19608
222 Ga0070697_100014630 3300005536 Bacteria 6161
223 Ga0068853_100006484 3300005539 Bacteria 9307
224 Ga0068853_100018883 3300005539 Bacteria 5710
225 Ga0068853_100019285 3300005539 Bacteria 5653
226 Ga0070672_100019459 3300005543 Bacteria 4927
227 Ga0070672_100055086 3300005543 Bacteria 3115
228 Ga0070695_100001100 3300005545 Bacteria 14793
229 Ga0070695_100001787 3300005545 Bacteria 12110
230 Ga0070695_100007052 3300005545 Bacteria 6661
231 Ga0070695_100008369 3300005545 Bacteria 6138
232 Ga0070696_100001400 3300005546 Bacteria 15767
233 Ga0070696_100001483 3300005546 Bacteria 15363
234 Ga0070696_100001728 3300005546 Bacteria 14314
235 Ga0070696_100008171 3300005546 Bacteria 7002
236 Ga0070696_100021087 3300005546 Bacteria 4416
237 Ga0070693_100003495 3300005547 Bacteria 7331
238 Ga0070693_100006109 3300005547 Bacteria 5834
239 Ga0070665_100000008 3300005548 Bacteria 606341
240 Ga0070665_100000212 3300005548 Bacteria 100019
241 Ga0070665_100004001 3300005548 Bacteria 15544
242 Ga0070665_100010246 3300005548 Bacteria 9485
243 Ga0070665_100011564 3300005548 Bacteria 8923
244 Ga0070665_100012139 3300005548 Bacteria 8688
245 Ga0070665_100013761 3300005548 Bacteria 8140
246 Ga0070665_100020182 3300005548 Bacteria 6689
247 Ga0070665_100063075 3300005548 Bacteria 3716
248 Ga0070704_100000433 3300005549 Bacteria 19573
249 Ga0070704_100002024 3300005549 Bacteria 11238
250 Ga0070704_100007785 3300005549 Bacteria 6387
251 Ga0070704_100043869 3300005549 Bacteria 3103
252 Ga0068855_100000010 3300005563 Bacteria 246022
253 Ga0068855_100000109 3300005563 Bacteria 102724
254 Ga0068855_100000329 3300005563 Bacteria 58994
255 Ga0068855_100000406 3300005563 Bacteria 53320
256 Ga0068855_100004552 3300005563 Bacteria 16933
257 Ga0068855_100009640 3300005563 Bacteria 11651
258 Ga0068855_100009709 3300005563 Bacteria 11616
259 Ga0068855_100014582 3300005563 Bacteria 9466
260 Ga0068855_100030380 3300005563 Bacteria 6463
261 Ga0068855_100032225 3300005563 Bacteria 6258
262 Ga0068855_100036925 3300005563 Bacteria 5813
263 Ga0068855_100058200 3300005563 Bacteria 4527
264 Ga0068855_100092907 3300005563 Bacteria 3479
265 Ga0070664_100008260 3300005564 Bacteria 8420
266 Ga0070664_100011221 3300005564 Bacteria 7268
267 Ga0068857_100000666 3300005577 Bacteria 25433
268 Ga0068857_100004345 3300005577 Bacteria 11963
269 Ga0068857_100011157 3300005577 Bacteria 7814
270 Ga0068857_100020120 3300005577 Bacteria 5866
271 Ga0068857_100028795 3300005577 Bacteria 4901
272 Ga0068856_100000036 3300005614 Bacteria 121468
273 Ga0068856_100001113 3300005614 Bacteria 28416
274 Ga0068856_100002129 3300005614 Bacteria 20542
275 Ga0068856_100005235 3300005614 Bacteria 12797
276 Ga0068856_100006102 3300005614 Bacteria 11833
277 Ga0068856_100012641 3300005614 Bacteria 8174
278 Ga0068856_100027191 3300005614 Bacteria 5581
279 Ga0070702_100017369 3300005615 Bacteria 3710
280 Ga0068852_100060330 3300005616 Bacteria 3292
281 Ga0068859_100003480 3300005617 Bacteria 16024
282 Ga0068859_100010680 3300005617 Bacteria 9241
283 Ga0068859_100018383 3300005617 Bacteria 7026
284 Ga0068859_100036337 3300005617 Bacteria 4945
285 Ga0068864_100000472 3300005618 Bacteria 34898
286 Ga0068864_100000705 3300005618 Bacteria 28096
287 Ga0068861_100000975 3300005719 Bacteria 17448
288 Ga0068861_100006015 3300005719 Bacteria 8247
289 Ga0068863_100004848 3300005841 Bacteria 13253
290 Ga0068863_100014948 3300005841 Bacteria 7455
291 Ga0068858_100000098 3300005842 Bacteria 90747
292 Ga0068858_100015424 3300005842 Bacteria 7186
293 Ga0068860_100000059 3300005843 Bacteria 196400
294 Ga0068860_100000583 3300005843 Bacteria 43765
295 Ga0068860_100004744 3300005843 Bacteria 13853
296 Ga0068860_100007317 3300005843 Bacteria 11038
297 Ga0068860_100007646 3300005843 Bacteria 10811
298 Ga0068860_100013563 3300005843 Bacteria 7988
299 Ga0068860_100025603 3300005843 Bacteria 5690
300 Ga0068860_100050353 3300005843 Bacteria 3966
301 Ga0068862_100002044 3300005844 Bacteria 18246
302 Ga0068862_100003140 3300005844 Bacteria 14372
303 Ga0068862_100015567 3300005844 Bacteria 6317
304 Ga0081455_10003041 3300005937 Bacteria 19554
305 Ga0081455_10005147 3300005937 Bacteria 14405
306 Ga0081455_10005435 3300005937 Bacteria 13979
307 Ga0081455_10007330 3300005937 Bacteria 11633
308 Ga0081455_10025694 3300005937 Bacteria 5431
309 Ga0081538_10002367 3300005981 Bacteria 18532
310 Ga0081540_1001919 3300005983 Bacteria 17424
311 Ga0081539_10000030 3300005985 Bacteria 317236
312 Ga0081539_10001207 3300005985 Bacteria 46468
313 Ga0081539_10008581 3300005985 Bacteria 8841
314 Ga0081539_10012887 3300005985 Bacteria 6367
315 Ga0070717_10009533 3300006028 Bacteria 7300
316 Ga0070717_10010135 3300006028 Bacteria 7097
317 Ga0070717_10011987 3300006028 Bacteria 6599
318 Ga0075365_10002781 3300006038 Bacteria 8748
319 Ga0075365_10007994 3300006038 Bacteria 5969
320 Ga0075365_10015412 3300006038 Bacteria 4625
321 Ga0075368_10000570 3300006042 Bacteria 11059
322 Ga0075368_10002583 3300006042 Bacteria 5938
323 Ga0075364_10000043 3300006051 Bacteria 44079
324 Ga0075364_10016211 3300006051 Bacteria 4635
325 Ga0070716_100006801 3300006173 Bacteria 5605
326 Ga0070712_100000031 3300006175 Bacteria 72694
327 Ga0070712_100000248 3300006175 Bacteria 30414
328 Ga0070712_100009197 3300006175 Bacteria 6223
329 Ga0070712_100022976 3300006175 Bacteria 4112
330 Ga0075367_10017275 3300006178 Bacteria 3957
331 Ga0075369_10011000 3300006186 Bacteria 3549
332 Ga0075366_10000026 3300006195 Bacteria 51752
333 Ga0075366_10003487 3300006195 Bacteria 8312
334 Ga0075366_10008377 3300006195 Bacteria 5744
335 Ga0097621_100000004 3300006237 Bacteria 144414
336 Ga0097621_100000205 3300006237 Bacteria 38617
337 Ga0097621_100004540 3300006237 Bacteria 9683
338 Ga0097621_100007006 3300006237 Bacteria 8027
339 Ga0097621_100021472 3300006237 Bacteria 4995
340 Ga0075370_10020141 3300006353 Bacteria 3642
341 Ga0068871_100000159 3300006358 Bacteria 44727
342 Ga0068871_100000162 3300006358 Bacteria 44419
343 Ga0068871_100009633 3300006358 Bacteria 7015
344 Ga0068871_100022142 3300006358 Bacteria 4898
345 Ga0075428_100000633 3300006844 Bacteria 36066
346 Ga0075428_100003545 3300006844 Bacteria 17097
347 Ga0075428_100006657 3300006844 Bacteria 12851
348 Ga0075428_100014015 3300006844 Bacteria 8923
349 Ga0075430_100001414 3300006846 Bacteria 19526
350 Ga0075430_100034830 3300006846 Bacteria 4274
351 Ga0075430_100056105 3300006846 Bacteria 3312
352 Ga0075431_100003737 3300006847 Bacteria 14791
353 Ga0075431_100005571 3300006847 Bacteria 12433
354 Ga0075431_100012801 3300006847 Bacteria 8469
355 Ga0075431_100013457 3300006847 Bacteria 8262
356 Ga0075431_100020742 3300006847 Bacteria 6715
357 Ga0075431_100032278 3300006847 Bacteria 5396
358 Ga0075434_100004162 3300006871 Bacteria 12965
359 Ga0075434_100005907 3300006871 Bacteria 11193
360 Ga0075434_100008538 3300006871 Bacteria 9527
361 Ga0075434_100030731 3300006871 Bacteria 5291
362 Ga0075434_100062219 3300006871 Bacteria 3715
363 Ga0075429_100006546 3300006880 Bacteria 10085
364 Ga0075429_100014989 3300006880 Bacteria 6723
365 Ga0068865_100000075 3300006881 Bacteria 51751
366 Ga0068865_100002203 3300006881 Bacteria 11489
367 Ga0068865_100028501 3300006881 Bacteria 3698
368 Ga0075436_100001425 3300006914 Bacteria 16245
369 Ga0075436_100005029 3300006914 Bacteria 9090
370 Ga0075436_100009569 3300006914 Bacteria 6634
371 Ga0075436_100009612 3300006914 Bacteria 6620
372 Ga0075436_100012404 3300006914 Bacteria 5842
373 Ga0097620_100003480 3300006931 Bacteria 16024
374 Ga0097620_100010683 3300006931 Bacteria 9241
375 Ga0097620_100018383 3300006931 Bacteria 7026
376 Ga0097620_100036337 3300006931 Bacteria 4945
377 Ga0099824_1000378 3300006942 Bacteria 50161
378 Ga0079104_1000022 3300006946 Bacteria 223522
379 Ga0079104_1000108 3300006946 Bacteria 122180
380 Ga0099826_10000091 3300006948 Bacteria 44824
381 Ga0099826_10000322 3300006948 Bacteria 21747
382 Ga0099826_10012587 3300006948 Bacteria 6373
383 Ga0075435_100001974 3300007076 Bacteria 13382
384 Ga0099794_10000080 3300007265 Bacteria 35768
385 Ga0105244_10000099 3300009036 Bacteria 90288
386 Ga0105240_10000005 3300009093 Bacteria 702630
387 Ga0105240_10000176 3300009093 Bacteria 130109
388 Ga0105240_10000189 3300009093 Bacteria 125396
389 Ga0105240_10000231 3300009093 Bacteria 110451
390 Ga0105240_10002181 3300009093 Bacteria 31963
391 Ga0105240_10008492 3300009093 Bacteria 14688
392 Ga0105240_10008796 3300009093 Bacteria 14383
393 Ga0105240_10011563 3300009093 Bacteria 12282
394 Ga0105240_10012030 3300009093 Bacteria 11996
395 Ga0105240_10015516 3300009093 Bacteria 10357
396 Ga0105240_10017464 3300009093 Bacteria 9667
397 Ga0105240_10022519 3300009093 Bacteria 8349
398 Ga0105240_10053787 3300009093 Bacteria 5051
399 Ga0105240_10057880 3300009093 Bacteria 4839
400 Ga0105240_10119455 3300009093 Bacteria 3175
401 Ga0111539_10002036 3300009094 Bacteria 27011
402 Ga0111539_10006433 3300009094 Bacteria 15147
403 Ga0111539_10009980 3300009094 Bacteria 11970
404 Ga0105245_10014119 3300009098 Bacteria 6958
405 Ga0114129_10000088 3300009147 Bacteria 86607
406 Ga0114129_10003252 3300009147 Bacteria 22804
407 Ga0114129_10003306 3300009147 Bacteria 22637
408 Ga0114129_10009496 3300009147 Bacteria 13870
409 Ga0114129_10019621 3300009147 Bacteria 9623
410 Ga0114129_10049982 3300009147 Bacteria 5874
411 Ga0114129_10083838 3300009147 Bacteria 4425
412 Ga0114129_10089597 3300009147 Bacteria 4265
413 Ga0114129_10115113 3300009147 Bacteria 3707
414 Ga0105243_10000003 3300009148 Bacteria 712931
415 Ga0105243_10006875 3300009148 Bacteria 8770
416 Ga0105243_10031070 3300009148 Bacteria 4117
417 Ga0105241_10002920 3300009174 Bacteria 12766
418 Ga0105241_10003766 3300009174 Bacteria 11245
419 Ga0105241_10004614 3300009174 Bacteria 10191
420 Ga0105241_10007817 3300009174 Bacteria 7863
421 Ga0105242_10004738 3300009176 Bacteria 10532
422 Ga0105242_10009599 3300009176 Bacteria 7416
423 Ga0105248_10000001 3300009177 Bacteria 1881304
424 Ga0105248_10022963 3300009177 Bacteria 6928
425 Ga0105248_10032351 3300009177 Bacteria 5846
426 Ga0105248_10060257 3300009177 Bacteria 4261
427 Ga0105248_10093710 3300009177 Bacteria 3382
428 Ga0105237_10000082 3300009545 Bacteria 127340
429 Ga0105237_10000221 3300009545 Bacteria 80262
430 Ga0105237_10000402 3300009545 Bacteria 61603
431 Ga0105237_10000620 3300009545 Bacteria 49579
432 Ga0105237_10000773 3300009545 Bacteria 43739
433 Ga0105237_10000808 3300009545 Bacteria 42764
434 Ga0105237_10001293 3300009545 Bacteria 33289
435 Ga0105237_10002622 3300009545 Bacteria 22142
436 Ga0105237_10003033 3300009545 Bacteria 20261
437 Ga0105237_10003784 3300009545 Bacteria 17795
438 Ga0105237_10010022 3300009545 Bacteria 10112
439 Ga0105237_10010500 3300009545 Bacteria 9839
440 Ga0105237_10011710 3300009545 Bacteria 9275
441 Ga0105237_10018206 3300009545 Bacteria 7270
442 Ga0105237_10050424 3300009545 Bacteria 4182
443 Ga0105237_10070821 3300009545 Bacteria 3482
444 Ga0105238_10000588 3300009551 Bacteria 38151
445 Ga0105238_10002426 3300009551 Bacteria 18699
446 Ga0105238_10013213 3300009551 Bacteria 8330
447 Ga0105249_10000580 3300009553 Bacteria 33471
448 Ga0105249_10002037 3300009553 Bacteria 17526
449 Ga0105249_10038522 3300009553 Bacteria 4338
450 Ga0123341_1000049 3300009765 Bacteria 49561
451 Ga0123342_1009349 3300009766 Bacteria 11779
452 Ga0105239_10000014 3300010375 Bacteria 325391
453 Ga0105239_10000045 3300010375 Bacteria 186314
454 Ga0105239_10000068 3300010375 Bacteria 144666
455 Ga0105239_10002348 3300010375 Bacteria 24115
456 Ga0105239_10002485 3300010375 Bacteria 23480
457 Ga0105239_10002598 3300010375 Bacteria 22856
458 Ga0105239_10002839 3300010375 Bacteria 21676
459 Ga0105239_10004008 3300010375 Bacteria 17836
460 Ga0105239_10008015 3300010375 Bacteria 12058
461 Ga0105239_10018891 3300010375 Bacteria 7615
462 Ga0105239_10020539 3300010375 Bacteria 7285
463 Ga0105239_10045948 3300010375 Bacteria 4786
464 Ga0105239_10047140 3300010375 Bacteria 4723
465 Ga0105239_10098691 3300010375 Bacteria 3229
466 Ga0157373_10000001 3300013100 Bacteria 864756
467 Ga0157373_10009355 3300013100 Bacteria 7241
468 Ga0157373_10010934 3300013100 Bacteria 6682
469 Ga0157373_10013765 3300013100 Bacteria 5931
470 Ga0157373_10030288 3300013100 Bacteria 3894
471 Ga0157373_10035318 3300013100 Bacteria 3589
472 Ga0157371_10000015 3300013102 Bacteria 339838
473 Ga0157371_10000297 3300013102 Bacteria 65919
474 Ga0157371_10000503 3300013102 Bacteria 47159
475 Ga0157371_10000874 3300013102 Bacteria 34176
476 Ga0157371_10001360 3300013102 Bacteria 25648
477 Ga0157371_10001871 3300013102 Bacteria 21063
478 Ga0157371_10004356 3300013102 Bacteria 12394
479 Ga0157371_10005700 3300013102 Bacteria 10444
480 Ga0157371_10007371 3300013102 Bacteria 8912
481 Ga0157371_10007854 3300013102 Bacteria 8563
482 Ga0157371_10013290 3300013102 Bacteria 6260
483 Ga0157370_10000084 3300013104 Bacteria 104159
484 Ga0157370_10000402 3300013104 Bacteria 54601
485 Ga0157370_10000434 3300013104 Bacteria 52185
486 Ga0157370_10001291 3300013104 Bacteria 31304
487 Ga0157370_10001737 3300013104 Bacteria 26833
488 Ga0157370_10002291 3300013104 Bacteria 23191
489 Ga0157370_10003013 3300013104 Bacteria 20000
490 Ga0157370_10014904 3300013104 Bacteria 7929
491 Ga0157370_10026995 3300013104 Bacteria 5664
492 Ga0157370_10036100 3300013104 Bacteria 4799
493 Ga0157370_10098178 3300013104 Bacteria 2747
494 Ga0157369_10000285 3300013105 Bacteria 67687
495 Ga0157369_10001051 3300013105 Bacteria 34842
496 Ga0157369_10002378 3300013105 Bacteria 22612
497 Ga0157369_10007950 3300013105 Bacteria 12187
498 Ga0171463_1008 3300013249 Bacteria 299022
499 Ga0171462_1028 3300013250 Bacteria 110760
500 Ga0157374_10000009 3300013296 Bacteria 564330
501 Ga0157374_10002136 3300013296 Bacteria 16661
502 Ga0157378_10004145 3300013297 Bacteria 12799
503 Ga0157378_10009182 3300013297 Bacteria 8610
504 Ga0157378_10016280 3300013297 Bacteria 6512
505 Ga0157378_10017250 3300013297 Bacteria 6331
506 Ga0163162_10000041 3300013306 Bacteria 132375
507 Ga0163162_10000073 3300013306 Bacteria 91871
508 Ga0163162_10000164 3300013306 Bacteria 60866
509 Ga0163162_10000413 3300013306 Bacteria 39230
510 Ga0163162_10001761 3300013306 Bacteria 20290
511 Ga0163162_10005322 3300013306 Bacteria 12417
512 Ga0163162_10007653 3300013306 Bacteria 10523
513 Ga0163162_10057127 3300013306 Bacteria 3930
514 Ga0163162_10065516 3300013306 Bacteria 3680
515 Ga0157372_10000009 3300013307 Bacteria 302051
516 Ga0157372_10002480 3300013307 Bacteria 19998
517 Ga0157372_10007125 3300013307 Bacteria 11906
518 Ga0157372_10010575 3300013307 Bacteria 9816
519 Ga0157372_10011190 3300013307 Bacteria 9542
520 Ga0157372_10015796 3300013307 Bacteria 8098
521 Ga0157372_10018426 3300013307 Bacteria 7504
522 Ga0157375_10016954 3300013308 Bacteria 6564
523 Ga0157375_10030589 3300013308 Bacteria 5079
524 Ga0157375_10045700 3300013308 Bacteria 4264
525 Ga0163163_10000111 3300014325 Bacteria 86620
526 Ga0163163_10001622 3300014325 Bacteria 18926
527 Ga0163163_10006611 3300014325 Bacteria 10152
528 Ga0163163_10058285 3300014325 Bacteria 3818
529 Ga0157380_10000807 3300014326 Bacteria 19612
530 Ga0157380_10015149 3300014326 Bacteria 5660
531 Ga0157380_10019985 3300014326 Bacteria 4999
532 Ga0182008_10000002 3300014497 Bacteria 480216
533 Ga0182008_10000112 3300014497 Bacteria 62174
534 Ga0182008_10000749 3300014497 Bacteria 22858
535 Ga0157379_10005202 3300014968 Bacteria 11175
536 Ga0157379_10009194 3300014968 Bacteria 8606
537 Ga0157379_10011124 3300014968 Bacteria 7846
538 Ga0157379_10013482 3300014968 Bacteria 7162
539 Ga0157379_10013695 3300014968 Bacteria 7107
540 Ga0157379_10020579 3300014968 Bacteria 5836
541 Ga0157379_10054674 3300014968 Bacteria 3567
542 Ga0157376_10002437 3300014969 Bacteria 12579
543 Ga0157376_10003625 3300014969 Bacteria 10658
544 Ga0157376_10007147 3300014969 Bacteria 7933
545 Ga0157376_10021134 3300014969 Bacteria 5051
546 Ga0157376_10022247 3300014969 Bacteria 4938
547 Ga0157376_10026262 3300014969 Bacteria 4599
548 Ga0182006_1000209 3300015261 Bacteria 58193
549 Ga0182006_1000236 3300015261 Bacteria 52217
550 Ga0182006_1000291 3300015261 Bacteria 44110
551 Ga0182006_1002055 3300015261 Bacteria 11279
552 Ga0182007_10000016 3300015262 Bacteria 202375
553 Ga0182007_10000618 3300015262 Bacteria 20687
554 Ga0182005_1000124 3300015265 Bacteria 54958
555 Ga0183373_1011 3300015682 Bacteria 138873
556 Ga0183363_1112 3300015690 Bacteria 22207
557 Ga0163161_10000023 3300017792 Bacteria 205048
558 Ga0163161_10001065 3300017792 Bacteria 20800
559 Ga0163161_10001282 3300017792 Bacteria 18770
560 Ga0163161_10002775 3300017792 Bacteria 12418
561 Ga0163161_10003492 3300017792 Bacteria 11009
562 Ga0163161_10005043 3300017792 Bacteria 9184
563 Ga0163161_10018108 3300017792 Bacteria 4938
564 Ga0214544_1000051 3300021320 Bacteria 134645
565 Ga0214544_1000129 3300021320 Bacteria 108948
566 Ga0214542_1000828 3300021321 Bacteria 59640
567 Ga0214543_1000010 3300021327 Bacteria 364844
568 Ga0214543_1000134 3300021327 Bacteria 102056
569 Ga0213872_10001151 3300021361 Bacteria 17979
570 Ga0213876_10000554 3300021384 Bacteria 27960
571 Ga0213876_10000954 3300021384 Bacteria 19009
572 Ga0213876_10001191 3300021384 Bacteria 16434
573 Ga0213876_10001849 3300021384 Bacteria 12750
574 Ga0213875_10000023 3300021388 Bacteria 213455
575 Ga0213875_10000673 3300021388 Bacteria 26870
576 Ga0213875_10000901 3300021388 Bacteria 21598
577 Ga0213875_10001289 3300021388 Bacteria 16741
578 Ga0213875_10003793 3300021388 Bacteria 8498
579 Ga0213875_10003886 3300021388 Bacteria 8360
580 Ga0213875_10010207 3300021388 Bacteria 4714
581 Ga0228710_1000006 3300022740 Bacteria 209134
582 Ga0209435_100022 3300025206 Bacteria 207766
583 Ga0209672_103566 3300025228 Bacteria 3166
584 Ga0207427_100109 3300025231 Bacteria 116061
585 Ga0209437_100030 3300025233 Bacteria 532466
586 Ga0209437_100096 3300025233 Bacteria 233558
587 Ga0209437_100122 3300025233 Bacteria 201364
588 Ga0209437_100160 3300025233 Bacteria 149451
589 Ga0209258_100029 3300025242 Bacteria 490648
590 Ga0207425_1000003 3300025245 Bacteria 1145342
591 Ga0207425_1000024 3300025245 Bacteria 328978
592 Ga0209646_1000005 3300025246 Bacteria 717627
593 Ga0209646_1000078 3300025246 Bacteria 207766
594 Ga0209026_1000002 3300025250 Bacteria 1136158
595 Ga0209026_1000065 3300025250 Bacteria 207766
596 Ga0209026_1000169 3300025250 Bacteria 100088
597 Ga0209026_1000225 3300025250 Bacteria 77234
598 Ga0209677_101260 3300025253 Bacteria 11373
599 Ga0209148_1000072 3300025254 Bacteria 325292
600 Ga0209148_1000230 3300025254 Bacteria 91940
601 Ga0209148_1000564 3300025254 Bacteria 34794
602 Ga0209759_1000055 3300025256 Bacteria 207766
603 Ga0209759_1000238 3300025256 Bacteria 81844
604 Ga0209129_1000076 3300025258 Bacteria 195353
605 Ga0209129_1000127 3300025258 Bacteria 133263
606 Ga0209129_1000133 3300025258 Bacteria 126018
607 Ga0209129_1001307 3300025258 Bacteria 14157
608 Ga0209129_1002184 3300025258 Bacteria 9843
609 Ga0209233_1000013 3300025261 Bacteria 1013785
610 Ga0209233_1000027 3300025261 Bacteria 652089
611 Ga0209233_1000029 3300025261 Bacteria 641642
612 Ga0209233_1000168 3300025261 Bacteria 149312
613 Ga0209233_1000269 3300025261 Bacteria 74071
614 Ga0209233_1000317 3300025261 Bacteria 53589
615 Ga0209455_1000133 3300025272 Bacteria 155670
616 Ga0209455_1002330 3300025272 Bacteria 7422
617 Ga0209673_1000049 3300025273 Bacteria 286207
618 Ga0209673_1000068 3300025273 Bacteria 245891
619 Ga0209673_1000139 3300025273 Bacteria 157765
620 Ga0209673_1002394 3300025273 Bacteria 13149
621 Ga0209673_1006996 3300025273 Bacteria 5311
622 Ga0209130_1000012 3300025284 Bacteria 421329
623 Ga0209130_1000029 3300025284 Bacteria 323399
624 Ga0209130_1000097 3300025284 Bacteria 143750
625 Ga0209130_1000697 3300025284 Bacteria 30036
626 Ga0209130_1001730 3300025284 Bacteria 13050
627 Ga0209130_1005472 3300025284 Bacteria 4386
628 Ga0209675_1002373 3300025291 Bacteria 9713
629 Ga0209676_1000061 3300025292 Bacteria 332674
630 Ga0209676_1000106 3300025292 Bacteria 222576
631 Ga0209676_1000128 3300025292 Bacteria 188099
632 Ga0209676_1000151 3300025292 Bacteria 167307
633 Ga0209676_1000438 3300025292 Bacteria 71339
634 Ga0209676_1001376 3300025292 Bacteria 23744
635 Ga0209025_1000007 3300025294 Bacteria 1145109
636 Ga0209025_1000014 3300025294 Bacteria 865448
637 Ga0209025_1000033 3300025294 Bacteria 414511
638 Ga0209025_1000050 3300025294 Bacteria 331531
639 Ga0209025_1000094 3300025294 Bacteria 241080
640 Ga0209025_1000225 3300025294 Bacteria 133040
641 Ga0209025_1000358 3300025294 Bacteria 97655
642 Ga0209025_1000563 3300025294 Bacteria 68086
643 Ga0209025_1001703 3300025294 Bacteria 26799
644 Ga0209025_1003210 3300025294 Bacteria 15848
645 Ga0209025_1005486 3300025294 Bacteria 10321
646 Ga0209025_1007933 3300025294 Bacteria 7772
647 Ga0209564_1000017 3300025295 Bacteria 594063
648 Ga0209564_1000187 3300025295 Bacteria 146950
649 Ga0209564_1000275 3300025295 Bacteria 107884
650 Ga0209564_1000331 3300025295 Bacteria 91919
651 Ga0209564_1000986 3300025295 Bacteria 35645
652 Ga0209564_1002989 3300025295 Bacteria 12148
653 Ga0209564_1006002 3300025295 Bacteria 6711
654 Ga0209758_1000036 3300025297 Bacteria 441671
655 Ga0209758_1000083 3300025297 Bacteria 257283
656 Ga0209758_1000114 3300025297 Bacteria 199324
657 Ga0209758_1000505 3300025297 Bacteria 63185
658 Ga0209758_1000775 3300025297 Bacteria 45897
659 Ga0209758_1000805 3300025297 Bacteria 44274
660 Ga0209758_1000927 3300025297 Bacteria 39649
661 Ga0209758_1001745 3300025297 Bacteria 24202
662 Ga0209758_1002972 3300025297 Bacteria 16255
663 Ga0209758_1004666 3300025297 Bacteria 11205
664 Ga0209758_1010537 3300025297 Bacteria 5514
665 Ga0209050_1000174 3300025298 Bacteria 148871
666 Ga0209050_1000272 3300025298 Bacteria 110636
667 Ga0209050_1000516 3300025298 Bacteria 64933
668 Ga0209050_1000796 3300025298 Bacteria 44614
669 Ga0209050_1001101 3300025298 Bacteria 32754
670 Ga0209050_1003098 3300025298 Bacteria 12758
671 Ga0209256_1000055 3300025299 Bacteria 295530
672 Ga0209256_1000146 3300025299 Bacteria 149440
673 Ga0209256_1000218 3300025299 Bacteria 106228
674 Ga0209256_1000299 3300025299 Bacteria 86909
675 Ga0209256_1003182 3300025299 Bacteria 11896
676 Ga0209256_1004524 3300025299 Bacteria 8675
677 Ga0207426_1000003 3300025302 Bacteria 1063212
678 Ga0207426_1000010 3300025302 Bacteria 796003
679 Ga0207426_1000026 3300025302 Bacteria 515228
680 Ga0207426_1000074 3300025302 Bacteria 323399
681 Ga0207426_1000113 3300025302 Bacteria 228304
682 Ga0207426_1000233 3300025302 Bacteria 127848
683 Ga0207426_1000290 3300025302 Bacteria 99519
684 Ga0207426_1000661 3300025302 Bacteria 42239
685 Ga0207426_1001867 3300025302 Bacteria 15450
686 Ga0207426_1003540 3300025302 Bacteria 8355
687 Ga0209051_1000125 3300025303 Bacteria 142863
688 Ga0209051_1001225 3300025303 Bacteria 23074
689 Ga0209051_1001494 3300025303 Bacteria 19577
690 Ga0209051_1003443 3300025303 Bacteria 10367
691 Ga0209051_1011303 3300025303 Bacteria 4419
692 Ga0209257_1000004 3300025304 Bacteria 1678347
693 Ga0209257_1000007 3300025304 Bacteria 1564415
694 Ga0209257_1000199 3300025304 Bacteria 148045
695 Ga0209257_1000413 3300025304 Bacteria 82516
696 Ga0209257_1000448 3300025304 Bacteria 77551
697 Ga0209257_1000569 3300025304 Bacteria 62370
698 Ga0209257_1002998 3300025304 Bacteria 15303
699 Ga0207697_10001867 3300025315 Bacteria 11248
700 Ga0207655_1000239 3300025728 Bacteria 90288
701 Ga0207653_10000231 3300025885 Bacteria 37241
702 Ga0207653_10001404 3300025885 Bacteria 7810
703 Ga0207642_10005925 3300025899 Bacteria 4028
704 Ga0207647_10000698 3300025904 Bacteria 26307
705 Ga0207647_10012113 3300025904 Bacteria 6018
706 Ga0207699_10000044 3300025906 Bacteria 116342
707 Ga0207699_10000114 3300025906 Bacteria 56878
708 Ga0207699_10008359 3300025906 Bacteria 5103
709 Ga0207699_10009848 3300025906 Bacteria 4775
710 Ga0207645_10000014 3300025907 Bacteria 117512
711 Ga0207645_10000093 3300025907 Bacteria 64854
712 Ga0207645_10000865 3300025907 Bacteria 25176
713 Ga0207645_10000909 3300025907 Bacteria 24558
714 Ga0207645_10002020 3300025907 Bacteria 16293
715 Ga0207645_10014224 3300025907 Bacteria 5330
716 Ga0207705_10000092 3300025909 Bacteria 109488
717 Ga0207705_10000111 3300025909 Bacteria 92842
718 Ga0207705_10002319 3300025909 Bacteria 14715
719 Ga0207705_10003960 3300025909 Bacteria 11260
720 Ga0207705_10008381 3300025909 Bacteria 7547
721 Ga0207705_10041113 3300025909 Bacteria 3316
722 Ga0207684_10053018 3300025910 Bacteria 3443
723 Ga0207654_10014049 3300025911 Bacteria 4131
724 Ga0207707_10000001 3300025912 Bacteria 1212482
725 Ga0207707_10002120 3300025912 Bacteria 17961
726 Ga0207707_10004556 3300025912 Bacteria 12184
727 Ga0207707_10005965 3300025912 Bacteria 10658
728 Ga0207707_10007247 3300025912 Bacteria 9649
729 Ga0207707_10008261 3300025912 Bacteria 9038
730 Ga0207707_10035633 3300025912 Bacteria 4350
731 Ga0207707_10061935 3300025912 Bacteria 3255
732 Ga0207695_10000003 3300025913 Bacteria 1368691
733 Ga0207695_10000011 3300025913 Bacteria 910221
734 Ga0207695_10000051 3300025913 Bacteria 399641
735 Ga0207695_10000056 3300025913 Bacteria 382433
736 Ga0207695_10000081 3300025913 Bacteria 284797
737 Ga0207695_10000102 3300025913 Bacteria 257838
738 Ga0207695_10000117 3300025913 Bacteria 237982
739 Ga0207695_10000984 3300025913 Bacteria 50625
740 Ga0207695_10002069 3300025913 Bacteria 30582
741 Ga0207695_10004268 3300025913 Bacteria 19631
742 Ga0207695_10006064 3300025913 Bacteria 15777
743 Ga0207695_10007128 3300025913 Bacteria 14312
744 Ga0207695_10011358 3300025913 Bacteria 10795
745 Ga0207695_10016689 3300025913 Bacteria 8580
746 Ga0207695_10020605 3300025913 Bacteria 7549
747 Ga0207695_10052952 3300025913 Bacteria 4248
748 Ga0207695_10070414 3300025913 Bacteria 3575
749 Ga0207671_10000189 3300025914 Bacteria 95291
750 Ga0207671_10000253 3300025914 Bacteria 80240
751 Ga0207671_10000701 3300025914 Bacteria 43166
752 Ga0207671_10000899 3300025914 Bacteria 37624
753 Ga0207671_10002346 3300025914 Bacteria 20402
754 Ga0207671_10002696 3300025914 Bacteria 18616
755 Ga0207671_10005379 3300025914 Bacteria 11828
756 Ga0207671_10030838 3300025914 Bacteria 3996
757 Ga0207693_10000964 3300025915 Bacteria 25831
758 Ga0207693_10002143 3300025915 Bacteria 17220
759 Ga0207693_10003609 3300025915 Bacteria 13211
760 Ga0207693_10004795 3300025915 Bacteria 11375
761 Ga0207693_10016584 3300025915 Bacteria 5885
762 Ga0207663_10000043 3300025916 Bacteria 72356
763 Ga0207663_10004463 3300025916 Bacteria 6963
764 Ga0207663_10005578 3300025916 Bacteria 6353
765 Ga0207663_10018721 3300025916 Bacteria 3888
766 Ga0207660_10000542 3300025917 Bacteria 25359
767 Ga0207660_10004115 3300025917 Bacteria 9471
768 Ga0207660_10007077 3300025917 Bacteria 7266
769 Ga0207660_10007123 3300025917 Bacteria 7244
770 Ga0207657_10000568 3300025919 Bacteria 39225
771 Ga0207657_10001148 3300025919 Bacteria 28154
772 Ga0207657_10001874 3300025919 Bacteria 22755
773 Ga0207657_10007527 3300025919 Bacteria 11158
774 Ga0207657_10011118 3300025919 Bacteria 8948
775 Ga0207657_10016022 3300025919 Bacteria 7235
776 Ga0207657_10017189 3300025919 Bacteria 6948
777 Ga0207657_10062563 3300025919 Bacteria 3186
778 Ga0207649_10000073 3300025920 Bacteria 86636
779 Ga0207649_10002800 3300025920 Bacteria 9620
780 Ga0207649_10007894 3300025920 Bacteria 5791
781 Ga0207649_10010294 3300025920 Bacteria 5134
782 Ga0207649_10022624 3300025920 Bacteria 3632
783 Ga0207652_10000051 3300025921 Bacteria 120327
784 Ga0207652_10000154 3300025921 Bacteria 74554
785 Ga0207652_10000201 3300025921 Bacteria 63129
786 Ga0207652_10000892 3300025921 Bacteria 28252
787 Ga0207652_10004044 3300025921 Bacteria 11972
788 Ga0207652_10012985 3300025921 Bacteria 6740
789 Ga0207646_10002318 3300025922 Bacteria 22569
790 Ga0207646_10003009 3300025922 Bacteria 19424
791 Ga0207646_10005879 3300025922 Bacteria 12814
792 Ga0207646_10022052 3300025922 Bacteria 5874
793 Ga0207646_10022138 3300025922 Bacteria 5862
794 Ga0207646_10032034 3300025922 Bacteria 4757
795 Ga0207681_10000591 3300025923 Bacteria 24668
796 Ga0207694_10000011 3300025924 Bacteria 417640
797 Ga0207694_10001957 3300025924 Bacteria 17049
798 Ga0207694_10028447 3300025924 Bacteria 4261
799 Ga0207694_10028660 3300025924 Bacteria 4245
800 Ga0207650_10001142 3300025925 Bacteria 19506
801 Ga0207650_10006695 3300025925 Bacteria 7857
802 Ga0207700_10000010 3300025928 Bacteria 298473
803 Ga0207700_10001717 3300025928 Bacteria 12440
804 Ga0207700_10002856 3300025928 Bacteria 9944
805 Ga0207700_10018532 3300025928 Bacteria 4681
806 Ga0207700_10025014 3300025928 Bacteria 4140
807 Ga0207644_10004434 3300025931 Bacteria 9111
808 Ga0207690_10000536 3300025932 Bacteria 24761
809 Ga0207690_10000856 3300025932 Bacteria 19516
810 Ga0207690_10031508 3300025932 Bacteria 3394
811 Ga0207706_10000009 3300025933 Bacteria 200607
812 Ga0207706_10000025 3300025933 Bacteria 150958
813 Ga0207706_10002035 3300025933 Bacteria 19832
814 Ga0207706_10002555 3300025933 Bacteria 17740
815 Ga0207706_10002738 3300025933 Bacteria 17152
816 Ga0207706_10036553 3300025933 Bacteria 4363
817 Ga0207686_10004076 3300025934 Bacteria 7842
818 Ga0207709_10000008 3300025935 Bacteria 713099
819 Ga0207669_10004280 3300025937 Bacteria 6270
820 Ga0207669_10006828 3300025937 Bacteria 5247
821 Ga0207669_10015250 3300025937 Bacteria 3871
822 Ga0207704_10011401 3300025938 Bacteria 4376
823 Ga0207665_10000511 3300025939 Bacteria 26217
824 Ga0207665_10001958 3300025939 Bacteria 13849
825 Ga0207665_10008095 3300025939 Bacteria 6939
826 Ga0207691_10003945 3300025940 Bacteria 14408
827 Ga0207691_10027453 3300025940 Bacteria 5336
828 Ga0207691_10032800 3300025940 Bacteria 4839
829 Ga0207691_10078422 3300025940 Bacteria 2974
830 Ga0207711_10000002 3300025941 Bacteria 1228676
831 Ga0207711_10013186 3300025941 Bacteria 6866
832 Ga0207711_10030147 3300025941 Bacteria 4575
833 Ga0207689_10002271 3300025942 Bacteria 18009
834 Ga0207689_10005278 3300025942 Bacteria 11580
835 Ga0207689_10008419 3300025942 Bacteria 8983
836 Ga0207689_10009549 3300025942 Bacteria 8367
837 Ga0207661_10009778 3300025944 Bacteria 6888
838 Ga0207661_10018620 3300025944 Bacteria 5161
839 Ga0207679_10015337 3300025945 Bacteria 5060
840 Ga0207667_10000093 3300025949 Bacteria 145814
841 Ga0207667_10000154 3300025949 Bacteria 102734
842 Ga0207667_10000171 3300025949 Bacteria 95554
843 Ga0207667_10000324 3300025949 Bacteria 66282
844 Ga0207667_10003468 3300025949 Bacteria 19461
845 Ga0207667_10003974 3300025949 Bacteria 18167
846 Ga0207667_10007060 3300025949 Bacteria 13571
847 Ga0207667_10028072 3300025949 Bacteria 6114
848 Ga0207667_10031656 3300025949 Bacteria 5708
849 Ga0207667_10046274 3300025949 Bacteria 4607
850 Ga0207667_10047564 3300025949 Bacteria 4540
851 Ga0207651_10002339 3300025960 Bacteria 9038
852 Ga0207712_10000596 3300025961 Bacteria 28910
853 Ga0207712_10003696 3300025961 Bacteria 9653
854 Ga0207712_10004390 3300025961 Bacteria 8912
855 Ga0207712_10006367 3300025961 Bacteria 7451
856 Ga0207668_10012248 3300025972 Bacteria 5244
857 Ga0207640_10005289 3300025981 Bacteria 7031
858 Ga0207658_10025482 3300025986 Bacteria 4142
859 Ga0207703_10000086 3300026035 Bacteria 107307
860 Ga0207703_10002958 3300026035 Bacteria 14408
861 Ga0207639_10000307 3300026041 Bacteria 34634
862 Ga0207639_10007716 3300026041 Bacteria 7347
863 Ga0207639_10016229 3300026041 Bacteria 5264
864 Ga0207639_10018779 3300026041 Bacteria 4918
865 Ga0207678_10005373 3300026067 Bacteria 11475
866 Ga0207678_10010652 3300026067 Bacteria 8078
867 Ga0207708_10000305 3300026075 Bacteria 38789
868 Ga0207708_10002051 3300026075 Bacteria 14854
869 Ga0207708_10003269 3300026075 Bacteria 11948
870 Ga0207702_10000013 3300026078 Bacteria 257468
871 Ga0207702_10000088 3300026078 Bacteria 105505
872 Ga0207702_10005456 3300026078 Bacteria 11126
873 Ga0207702_10035561 3300026078 Bacteria 4166
874 Ga0207702_10043500 3300026078 Bacteria 3771
875 Ga0207641_10000012 3300026088 Bacteria 375486
876 Ga0207641_10003961 3300026088 Bacteria 12936
877 Ga0207641_10011049 3300026088 Bacteria 7407
878 Ga0207648_10000269 3300026089 Bacteria 56592
879 Ga0207648_10000963 3300026089 Bacteria 32564
880 Ga0207648_10002818 3300026089 Bacteria 18431
881 Ga0207648_10003702 3300026089 Bacteria 16002
882 Ga0207648_10004739 3300026089 Bacteria 13898
883 Ga0207648_10009820 3300026089 Bacteria 9140
884 Ga0207648_10026033 3300026089 Bacteria 5202
885 Ga0207648_10047527 3300026089 Bacteria 3762
886 Ga0207676_10000445 3300026095 Bacteria 35000
887 Ga0207676_10017994 3300026095 Bacteria 5130
888 Ga0207676_10022739 3300026095 Bacteria 4614
889 Ga0207674_10000450 3300026116 Bacteria 53632
890 Ga0207674_10005103 3300026116 Bacteria 15673
891 Ga0207674_10008341 3300026116 Bacteria 11989
892 Ga0207674_10011187 3300026116 Bacteria 10088
893 Ga0207674_10031601 3300026116 Bacteria 5559
894 Ga0207674_10050104 3300026116 Bacteria 4268
895 Ga0207675_100000599 3300026118 Bacteria 35195
896 Ga0207675_100002519 3300026118 Bacteria 18126
897 Ga0207683_10000572 3300026121 Bacteria 34101
898 Ga0207683_10016727 3300026121 Bacteria 6242
899 Ga0207698_10000733 3300026142 Bacteria 19000
900 Ga0207698_10014592 3300026142 Bacteria 5230
901 Ga0207698_10025538 3300026142 Bacteria 4164
902 Ga0207698_10031398 3300026142 Bacteria 3833
903 Ga0207698_10037709 3300026142 Bacteria 3563
904 Ga0209281_1000036 3300027111 Bacteria 369415
905 Ga0209281_1000047 3300027111 Bacteria 326514
906 Ga0209281_1000208 3300027111 Bacteria 132254
907 Ga0209281_1000268 3300027111 Bacteria 100508
908 Ga0209389_1000041 3300027296 Bacteria 123983
909 Ga0209389_1000174 3300027296 Bacteria 51376
910 Ga0209371_1000021 3300027312 Bacteria 555864
911 Ga0209371_1000229 3300027312 Bacteria 71827
912 Ga0209589_1000621 3300027357 Bacteria 51376
913 Ga0209489_100178 3300027361 Bacteria 99953
914 Ga0209489_101570 3300027361 Bacteria 47095
915 Ga0209489_116584 3300027361 Bacteria 3851
916 Ga0209700_100010 3300027363 Bacteria 395269
917 Ga0209282_1000251 3300027666 Bacteria 26915
918 Ga0209282_1000462 3300027666 Bacteria 19855
919 Ga0209282_1010352 3300027666 Bacteria 5900
920 Ga0209588_1000242 3300027671 Bacteria 14533
921 Ga0209813_10000405 3300027866 Bacteria 10578
922 Ga0207428_10000059 3300027907 Bacteria 156543
923 Ga0268266_10000016 3300028379 Bacteria 629101
924 Ga0268266_10000177 3300028379 Bacteria 114318
925 Ga0268266_10000474 3300028379 Bacteria 57849
926 Ga0268266_10001386 3300028379 Bacteria 29145
927 Ga0268266_10002680 3300028379 Bacteria 18712
928 Ga0268266_10005907 3300028379 Bacteria 11323
929 Ga0268266_10014879 3300028379 Bacteria 6681
930 Ga0268266_10016036 3300028379 Bacteria 6407
931 Ga0268266_10043497 3300028379 Bacteria 3839
932 Ga0268265_10001955 3300028380 Bacteria 16360
933 Ga0268265_10008320 3300028380 Bacteria 7004
934 Ga0268265_10009229 3300028380 Bacteria 6666
935 Ga0268264_10000015 3300028381 Bacteria 508501
936 Ga0268264_10002904 3300028381 Bacteria 14888
937 Ga0268264_10004404 3300028381 Bacteria 12012
938 Ga0268264_10008069 3300028381 Bacteria 8759
939 Ga0268264_10012719 3300028381 Bacteria 6925
940 Ga0265337_1000301 3300028556 Bacteria 26365
941 Ga0265319_1003891 3300028563 Bacteria 7611
942 Ga0265334_10001248 3300028573 Bacteria 12410
943 Ga0265318_10000018 3300028577 Bacteria 173038
944 Ga0265318_10007465 3300028577 Bacteria 4942
945 Ga0265336_10000676 3300028666 Bacteria 18479
946 Ga0307517_10000553 3300028786 Bacteria 63892
947 Ga0307517_10000685 3300028786 Bacteria 58217
948 Ga0307515_10000010 3300028794 Bacteria 651586
949 Ga0307515_10000057 3300028794 Bacteria 261695
950 Ga0307515_10000233 3300028794 Bacteria 137311
951 Ga0307515_10000514 3300028794 Bacteria 92292
952 Ga0307515_10000523 3300028794 Bacteria 91316
953 Ga0307515_10000569 3300028794 Bacteria 87068
954 Ga0307515_10001565 3300028794 Bacteria 51101
955 Ga0307515_10015653 3300028794 Bacteria 13957
956 Ga0307515_10017926 3300028794 Bacteria 12858
957 Ga0307515_10082977 3300028794 Bacteria 4137
958 Ga0265338_10000014 3300028800 Bacteria 378751
959 Ga0265338_10003602 3300028800 Bacteria 21622
960 Ga0265338_10004226 3300028800 Bacteria 19550
961 Ga0265338_10014160 3300028800 Bacteria 8912
962 Ga0265338_10016452 3300028800 Bacteria 8048
963 Ga0265338_10018269 3300028800 Bacteria 7512
964 Ga0265338_10018585 3300028800 Bacteria 7428
965 Ga0265338_10023084 3300028800 Bacteria 6408
966 Ga0265338_10030858 3300028800 Bacteria 5267
967 Ga0265338_10049339 3300028800 Bacteria 3817
968 Ga0265324_10008071 3300029957 Bacteria 4217
969 Ga0268256_1000020 3300030500 Bacteria 557873
970 Ga0268256_1006987 3300030500 Bacteria 4110
971 Ga0307511_10024238 3300030521 Bacteria 5629
972 Ga0265330_10000050 3300031235 Bacteria 103087
973 Ga0265332_10000332 3300031238 Bacteria 36001
974 Ga0265328_10000023 3300031239 Bacteria 123873
975 Ga0265328_10000055 3300031239 Bacteria 72155
976 Ga0265328_10000132 3300031239 Bacteria 35090
977 Ga0265328_10002139 3300031239 Bacteria 8921
978 Ga0265328_10011197 3300031239 Bacteria 3590
979 Ga0265320_10000496 3300031240 Bacteria 30651
980 Ga0265320_10010437 3300031240 Bacteria 5534
981 Ga0265325_10000001 3300031241 Bacteria 726814
982 Ga0265325_10002717 3300031241 Bacteria 11818
983 Ga0265329_10007739 3300031242 Bacteria 4129
984 Ga0265340_10000071 3300031247 Bacteria 48537
985 Ga0265340_10008609 3300031247 Bacteria 5500
986 Ga0265339_10000135 3300031249 Bacteria 60639
987 Ga0265339_10002142 3300031249 Bacteria 14375
988 Ga0265339_10011527 3300031249 Bacteria 5437
989 Ga0265331_10000006 3300031250 Bacteria 418907
990 Ga0265331_10000007 3300031250 Bacteria 331074
991 Ga0265331_10000687 3300031250 Bacteria 29037
992 Ga0265331_10000823 3300031250 Bacteria 25431
993 Ga0265331_10001725 3300031250 Bacteria 15738
994 Ga0265331_10002129 3300031250 Bacteria 13620
995 Ga0265327_10000022 3300031251 Bacteria 402724
996 Ga0265327_10000038 3300031251 Bacteria 292416
997 Ga0265327_10000074 3300031251 Bacteria 214435
998 Ga0265327_10000239 3300031251 Bacteria 109804
999 Ga0265327_10000381 3300031251 Bacteria 83617
1000 Ga0265327_10001320 3300031251 Bacteria 32294
1001 Ga0265327_10001725 3300031251 Bacteria 25910
1002 Ga0265327_10009324 3300031251 Bacteria 7102
1003 Ga0265327_10011392 3300031251 Bacteria 6128
1004 Ga0265327_10014482 3300031251 Bacteria 5156
1005 Ga0265316_10000238 3300031344 Bacteria 63443
1006 Ga0265316_10001622 3300031344 Bacteria 23975
1007 Ga0265316_10002070 3300031344 Bacteria 21121
1008 Ga0265316_10009265 3300031344 Bacteria 9065
1009 Ga0265316_10012382 3300031344 Bacteria 7653
1010 Ga0265316_10025676 3300031344 Bacteria 4913
1011 Ga0265316_10030652 3300031344 Bacteria 4405
1012 Ga0307513_10057270 3300031456 Bacteria 4154
1013 Ga0307509_10010135 3300031507 Bacteria 11603
1014 Ga0307408_100000882 3300031548 Bacteria 23602
1015 Ga0307408_100001015 3300031548 Bacteria 21589
1016 Ga0307408_100002166 3300031548 Bacteria 14056
1017 Ga0307408_100003500 3300031548 Bacteria 10702
1018 Ga0307408_100004580 3300031548 Bacteria 9363
1019 Ga0307408_100015144 3300031548 Bacteria 5132
1020 Ga0307408_100022412 3300031548 Bacteria 4291
1021 Ga0265313_10000124 3300031595 Bacteria 77104
1022 Ga0265313_10000660 3300031595 Bacteria 35564
1023 Ga0265313_10001721 3300031595 Bacteria 20164
1024 Ga0265313_10002264 3300031595 Bacteria 16918
1025 Ga0265313_10003794 3300031595 Bacteria 11981
1026 Ga0265313_10005016 3300031595 Bacteria 9886
1027 Ga0265313_10010277 3300031595 Bacteria 5947
1028 Ga0307508_10000763 3300031616 Bacteria 38032
1029 Ga0316575_10012098 3300031665 Bacteria 3203
1030 Ga0316579_10006075 3300031691 Bacteria 4908
1031 Ga0316579_10015360 3300031691 Bacteria 3323
1032 Ga0265314_10000112 3300031711 Bacteria 124291
1033 Ga0265314_10002612 3300031711 Bacteria 18208
1034 Ga0265314_10002986 3300031711 Bacteria 16750
1035 Ga0265314_10008440 3300031711 Bacteria 8827
1036 Ga0265314_10016157 3300031711 Bacteria 5909
1037 Ga0265314_10018580 3300031711 Bacteria 5417
1038 Ga0265342_10000242 3300031712 Bacteria 61326
1039 Ga0265342_10012218 3300031712 Bacteria 5824
1040 Ga0265342_10015773 3300031712 Bacteria 4960
1041 Ga0265342_10023832 3300031712 Bacteria 3868
1042 Ga0307516_10000004 3300031730 Bacteria 367451
1043 Ga0307516_10001316 3300031730 Bacteria 34466
1044 Ga0307405_10000002 3300031731 Bacteria 575196
1045 Ga0307405_10000023 3300031731 Bacteria 141450
1046 Ga0307405_10000833 3300031731 Bacteria 12137
1047 Ga0307405_10001789 3300031731 Bacteria 9193
1048 Ga0316577_10021382 3300031733 Bacteria 3590
1049 Ga0307413_10000047 3300031824 Bacteria 31403
1050 Ga0307410_10001530 3300031852 Bacteria 10528
1051 Ga0307406_10000271 3300031901 Bacteria 30940
1052 Ga0307406_10002859 3300031901 Bacteria 9405
1053 Ga0307406_10004978 3300031901 Bacteria 7240
1054 Ga0307406_10006264 3300031901 Bacteria 6556
1055 Ga0307406_10020534 3300031901 Bacteria 3892
1056 Ga0307407_10000059 3300031903 Bacteria 48015
1057 Ga0307407_10000264 3300031903 Bacteria 15438
1058 Ga0307407_10000770 3300031903 Bacteria 10555
1059 Ga0307407_10015720 3300031903 Bacteria 3750
1060 Ga0307412_10000085 3300031911 Bacteria 88692
1061 Ga0307412_10001216 3300031911 Bacteria 14637
1062 Ga0307412_10015803 3300031911 Bacteria 4481
1063 Ga0315914_1000008 3300031967 Bacteria 209133
1064 Ga0307409_100000857 3300031995 Bacteria 14042
1065 Ga0307409_100002475 3300031995 Bacteria 9674
1066 Ga0307409_100018147 3300031995 Bacteria 4716
1067 Ga0307409_100035000 3300031995 Bacteria 3676
1068 Ga0307416_100000116 3300032002 Bacteria 47978
1069 Ga0307416_100002388 3300032002 Bacteria 10758
1070 Ga0307416_100002723 3300032002 Bacteria 10247
1071 Ga0307416_100004451 3300032002 Bacteria 8449
1072 Ga0307416_100008001 3300032002 Bacteria 6772
1073 Ga0307414_10000008 3300032004 Bacteria 375832
1074 Ga0307414_10000040 3300032004 Bacteria 148876
1075 Ga0307414_10000510 3300032004 Bacteria 20231
1076 Ga0307414_10001132 3300032004 Bacteria 13647
1077 Ga0307414_10002298 3300032004 Bacteria 9988
1078 Ga0307414_10005505 3300032004 Bacteria 6981
1079 Ga0307414_10006841 3300032004 Bacteria 6378
1080 Ga0307414_10008370 3300032004 Bacteria 5861
1081 Ga0307414_10016057 3300032004 Bacteria 4540
1082 Ga0307414_10021364 3300032004 Bacteria 4060
1083 Ga0307411_10000018 3300032005 Bacteria 87365
1084 Ga0307411_10001125 3300032005 Bacteria 10452
1085 Ga0307411_10001647 3300032005 Bacteria 9322
1086 Ga0307411_10001969 3300032005 Bacteria 8804
1087 Ga0307411_10005674 3300032005 Bacteria 6161
1088 Ga0307415_100003514 3300032126 Bacteria 7991
1089 Ga0307415_100009470 3300032126 Bacteria 5464
1090 Ga0307415_100015276 3300032126 Bacteria 4540
1091 Ga0307507_10000111 3300033179 Bacteria 134722
1092 Ga0307510_10000172 3300033180 Bacteria 54812
1093 Ga0315915_1000058 3300033464 Bacteria 72461
1094 Ga0373934_0001914 3300035086 Bacteria 7634
1095 Ga0373944_0002568 3300035089 Bacteria 4620
1096 Ga0373923_0002718 3300035111 Bacteria 5515
1097 Ga0373945_0002662 3300035116 Bacteria 5598
1098 Ga0373953_0000896 3300035117 Bacteria 8336
1099 Ga0373943_0002368 3300035170 Bacteria 8552
1100 Ga0373943_0011306 3300035170 Bacteria 4016
1101 Ga0373955_0000996 3300035172 Bacteria 12010
1102 Ga0373961_0002656 3300035241 Bacteria 4587
1103 Ga0373924_0003776 3300035410 Bacteria 5237
1104 Ga0373931_0007351 3300035691 Bacteria 5185
1105 Ga0373935_0001925 3300035692 Bacteria 11677
1106 Ga0373935_0014319 3300035692 Bacteria 4787
1107 Ga0373927_0001008 3300035695 Bacteria 21456
1108 Ga0373927_0014464 3300035695 Bacteria 5222
1109 Ga0373933_0000104 3300035724 Bacteria 53573
1110 Ga0373933_0002019 3300035724 Bacteria 11689
1111 Ga0373933_0005899 3300035724 Bacteria 6662
1112 Ga0373947_0000102 3300035725 Bacteria 42788
1113 Ga0373947_0001616 3300035725 Bacteria 13819
1114 Ga0373947_0009500 3300035725 Bacteria 5585
1115 Ga0373937_0000161 3300036401 Bacteria 64761
1116 Ga0373937_0002128 3300036401 Bacteria 16559
1117 Ga0373937_0003351 3300036401 Bacteria 13446
1118 Ga0373937_0005514 3300036401 Bacteria 10848
1119 Ga0373937_0008903 3300036401 Bacteria 8714
1120 Ga0373937_0021950 3300036401 Bacteria 5732
1121 Ga0373937_0022933 3300036401 Bacteria 5613
1122 Ga0373937_0024827 3300036401 Bacteria 5409
1123 Ga0373937_0048173 3300036401 Bacteria 3900
1124 Ga0316584_0011620 3300036712 Bacteria 6192
1125 Ga0373925_0000385 3300037068 Bacteria 45502
1126 Ga0373925_0001478 3300037068 Bacteria 20172
1127 Ga0373925_0038884 3300037068 Bacteria 3519
1128 Ga0395899_0000017 3300037312 Bacteria 440179
1129 Ga0395899_0000144 3300037312 Bacteria 108386
1130 Ga0395899_0000327 3300037312 Bacteria 60343
1131 Ga0395899_0001120 3300037312 Bacteria 23944
1132 Ga0395899_0005015 3300037312 Bacteria 10300
1133 Ga0395899_0006095 3300037312 Bacteria 9348
1134 Ga0395899_0007469 3300037312 Bacteria 8443
1135 Ga0395899_0009740 3300037312 Bacteria 7375
1136 Ga0395899_0014068 3300037312 Bacteria 6107
1137 Ga0395899_0020499 3300037312 Bacteria 5011
1138 Ga0395899_0031979 3300037312 Bacteria 3952
1139 Ga0395900_0000027 3300037418 Bacteria 285957
1140 Ga0395900_0000609 3300037418 Bacteria 48753
1141 Ga0395900_0000658 3300037418 Bacteria 46240
1142 Ga0395900_0001116 3300037418 Bacteria 34004
1143 Ga0395900_0017170 3300037418 Bacteria 7387
1144 Ga0395900_0020556 3300037418 Bacteria 6741
1145 Ga0395900_0029013 3300037418 Bacteria 5675
1146 Ga0395900_0032688 3300037418 Bacteria 5350
1147 Ga0395900_0051543 3300037418 Bacteria 4238
1148 Ga0395900_0078357 3300037418 Bacteria 3395
1149 Ga0395900_0082153 3300037418 Bacteria 3310
1150 Ga0395898_0000043 3300037466 Bacteria 301783
1151 Ga0395898_0001697 3300037466 Bacteria 29404
1152 Ga0395898_0004808 3300037466 Bacteria 14701
1153 Ga0395898_0005830 3300037466 Bacteria 13257
1154 Ga0395898_0014764 3300037466 Bacteria 8017
1155 Ga0395898_0016879 3300037466 Bacteria 7455
1156 Ga0395898_0019572 3300037466 Bacteria 6887
1157 Ga0395898_0021331 3300037466 Bacteria 6570
1158 Ga0395898_0031800 3300037466 Bacteria 5271
1159 Ga0395898_0036144 3300037466 Bacteria 4906
1160 Ga0395898_0039265 3300037466 Bacteria 4686
1161 Ga0395898_0059251 3300037466 Bacteria 3726
1162 Ga0395905_0000003 3300037471 Bacteria 1347396
1163 Ga0395905_0000032 3300037471 Bacteria 285932
1164 Ga0395905_0000130 3300037471 Bacteria 123719
1165 Ga0395905_0003812 3300037471 Bacteria 15940
1166 Ga0395905_0006809 3300037471 Bacteria 11448
1167 Ga0395905_0007047 3300037471 Bacteria 11236
1168 Ga0395905_0010878 3300037471 Bacteria 8814
1169 Ga0395905_0015420 3300037471 Bacteria 7264
1170 Ga0395905_0027049 3300037471 Bacteria 5409
1171 Ga0395905_0043585 3300037471 Bacteria 4209
1172 Ga0395905_0067064 3300037471 Bacteria 3361
1173 Ga0436364_0173332 3300037853 Bacteria 20937
1174 Ga0436364_0397135 3300037853 Bacteria 10337
1175 Ga0436364_0630944 3300037853 Bacteria 60832
1176 Ga0436364_0661460 3300037853 Bacteria 4408
1177 Ga0436364_0730045 3300037853 Bacteria 11874
1178 Ga0436364_0936398 3300037853 Bacteria 6213
1179 Ga0436364_1080787 3300037853 Bacteria 39578
1180 Ga0436364_1149172 3300037853 Bacteria 4222
1181 Ga0436364_1371986 3300037853 Bacteria 6490
1182 Ga0395901_0000056 3300038443 Bacteria 154356
1183 Ga0395901_0000847 3300038443 Bacteria 33661
1184 Ga0395901_0001146 3300038443 Bacteria 28080
1185 Ga0395901_0001153 3300038443 Bacteria 28037
1186 Ga0395901_0001159 3300038443 Bacteria 28002
1187 Ga0395901_0001784 3300038443 Bacteria 22196
1188 Ga0395901_0002123 3300038443 Bacteria 20307
1189 Ga0395901_0003003 3300038443 Bacteria 17017
1190 Ga0395901_0004430 3300038443 Bacteria 14164
1191 Ga0395901_0005265 3300038443 Bacteria 13063
1192 Ga0395901_0014098 3300038443 Bacteria 8136
1193 Ga0395901_0014399 3300038443 Bacteria 8051
1194 Ga0395901_0016457 3300038443 Bacteria 7533
1195 Ga0395901_0019720 3300038443 Bacteria 6894
1196 Ga0395901_0020578 3300038443 Bacteria 6752
1197 Ga0395901_0021881 3300038443 Bacteria 6553
1198 Ga0395901_0027308 3300038443 Bacteria 5863
1199 Ga0395901_0030629 3300038443 Bacteria 5544
1200 Ga0395901_0038427 3300038443 Bacteria 4950
1201 Ga0395901_0059142 3300038443 Bacteria 3987
1202 Ga0400483_158932 3300039062 Bacteria 3537
1203 Ga0400483_237362 3300039062 Bacteria 7130
1204 Ga0400489_11051 3300039093 Bacteria 23618
1205 Ga0436365_0114166 3300039437 Bacteria 25992
1206 Ga0436365_0269340 3300039437 Bacteria 68150
1207 Ga0436365_0279987 3300039437 Bacteria 10073
1208 Ga0436365_0286964 3300039437 Bacteria 64806
1209 Ga0436365_0605653 3300039437 Bacteria 55706
1210 Ga0436365_1242987 3300039437 Bacteria 27013
1211 Ga0436365_1486271 3300039437 Bacteria 6715
1212 Ga0436365_1889064 3300039437 Bacteria 17551
1213 Ga0436360_0862127 3300039438 Bacteria 4973
1214 Ga0436361_0014949 3300039447 Bacteria 18584
1215 Ga0436361_0064193 3300039447 Bacteria 30959
1216 Ga0436361_1159520 3300039447 Bacteria 26518
1217 Ga0436363_0117045 3300039450 Bacteria 7073
1218 Ga0436363_0580065 3300039450 Bacteria 40060
1219 Ga0436362_0754150 3300039453 Bacteria 32997
1220 Ga0439447_001533 3300041407 Bacteria 8450
1221 Ga0439466_0001335 3300041411 Bacteria 9620
1222 Ga0439449_0009693 3300042007 Bacteria 3645
1223 Ga0439457_000505 3300042014 Bacteria 11309
1224 Ga0451577_0000329 3300042876 Bacteria 88404
1225 Ga0451577_0002681 3300042876 Bacteria 20776
1226 Ga0451577_0009219 3300042876 Bacteria 9517
1227 Ga0466969_0000637 3300044656 Bacteria 18936
1228 Ga0466972_0000050 3300044658 Bacteria 118759
1229 Ga0466972_0000095 3300044658 Bacteria 77981
1230 Ga0466972_0020555 3300044658 Bacteria 3298
1231 Ga0453683_0018146 3300044673 Bacteria 4519
1232 Ga0466966_0011169 3300044684 Bacteria 5957
1233 Ga0466961_0004101 3300044693 Bacteria 9093
1234 Ga0466963_0001045 3300044694 Bacteria 14369
1235 Ga0466963_0013100 3300044694 Bacteria 5086
1236 Ga0466963_0013338 3300044694 Bacteria 5045
1237 Ga0466963_0020358 3300044694 Bacteria 4171
1238 Ga0466964_0002702 3300044706 Bacteria 6358
1239 Ga0466964_0003993 3300044706 Bacteria 5423
1240 Ga0453684_0000006 3300044712 Bacteria 1364191
1241 Ga0453684_0001753 3300044712 Bacteria 58019
1242 Ga0453684_0002341 3300044712 Bacteria 46360
1243 Ga0453684_0002621 3300044712 Bacteria 42985
1244 Ga0453684_0006249 3300044712 Bacteria 22819
1245 Ga0453684_0011091 3300044712 Bacteria 15209
1246 Ga0453684_0053245 3300044712 Bacteria 5284
1247 Ga0453684_0079514 3300044712 Bacteria 4099
1248 Ga0453684_0107090 3300044712 Bacteria 3405
1249 Ga0466971_0006207 3300044719 Bacteria 5194
1250 Ga0466971_0009054 3300044719 Bacteria 4350
1251 Ga0466968_0001213 3300044735 Bacteria 9130
1252 Ga0466957_0000044 3300044842 Bacteria 46388
1253 Ga0466957_0000078 3300044842 Bacteria 38776
1254 Ga0466959_0003250 3300045049 Bacteria 10581
1255 Ga0466959_0006351 3300045049 Bacteria 8179
1256 Ga0466959_0010280 3300045049 Bacteria 6683
1257 Ga0451576_0000015 3300045051 Bacteria 579908
1258 Ga0451576_0003258 3300045051 Bacteria 22524
1259 Ga0451576_0003475 3300045051 Bacteria 21574
1260 Ga0451576_0005560 3300045051 Bacteria 15750
1261 Ga0451576_0007229 3300045051 Bacteria 13374
1262 Ga0451576_0007700 3300045051 Bacteria 12810
1263 Ga0451576_0008205 3300045051 Bacteria 12294
1264 Ga0451576_0013390 3300045051 Bacteria 9176
1265 Ga0451576_0024297 3300045051 Bacteria 6547
1266 Ga0451576_0079635 3300045051 Bacteria 3409
1267 Ga0451576_0086952 3300045051 Bacteria 3251
1268 Ga0466958_0001517 3300045836 Bacteria 11119
1269 Ga0466958_0005472 3300045836 Bacteria 6842
1270 Ga0466958_0005937 3300045836 Bacteria 6602
1271 Ga0466967_0007564 3300045976 Bacteria 7851
1272 Ga0466967_0008675 3300045976 Bacteria 7478
1273 Ga0466967_0015169 3300045976 Bacteria 6032
1274 Ga0466967_0019623 3300045976 Bacteria 5441
1275 Ga0466967_0022134 3300045976 Bacteria 5179
1276 Ga0466967_0024185 3300045976 Bacteria 4990
1277 Ga0495592_0001615 3300046454 Bacteria 15792
1278 Ga0495592_0008572 3300046454 Bacteria 7676
1279 Ga0495592_0025320 3300046454 Bacteria 4505
1280 Ga0495603_0000774 3300046455 Bacteria 18264
1281 Ga0495603_0024815 3300046455 Bacteria 3627
1282 Ga0495629_0006901 3300046459 Bacteria 8375
1283 Ga0495629_0024664 3300046459 Bacteria 4281
1284 Ga0495629_0038417 3300046459 Bacteria 3372
1285 Ga0495638_0000004 3300046460 Bacteria 700795
1286 Ga0495638_0002602 3300046460 Bacteria 14568
1287 Ga0495641_0002094 3300046461 Bacteria 16133
1288 Ga0495641_0006293 3300046461 Bacteria 7725
1289 Ga0495641_0010223 3300046461 Bacteria 5464
1290 Ga0495651_0000001 3300046462 Bacteria 210544
1291 Ga0495651_0000077 3300046462 Bacteria 71891
1292 Ga0495651_0001379 3300046462 Bacteria 18839
1293 Ga0495651_0003563 3300046462 Bacteria 11940
1294 Ga0495651_0016939 3300046462 Bacteria 5644
1295 Ga0495653_0000153 3300046463 Bacteria 57262
1296 Ga0495653_0000668 3300046463 Bacteria 26201
1297 Ga0495653_0003014 3300046463 Bacteria 13499
1298 Ga0495653_0033114 3300046463 Bacteria 4096
1299 Ga0495650_0000050 3300046471 Bacteria 318894
1300 Ga0495580_0000048 3300046472 Bacteria 68571
1301 Ga0495580_0014257 3300046472 Bacteria 6035
1302 Ga0495580_0022217 3300046472 Bacteria 4671
1303 Ga0495580_0024529 3300046472 Bacteria 4413
1304 Ga0495582_0000293 3300046473 Bacteria 27593
1305 Ga0495582_0000805 3300046473 Bacteria 17419
1306 Ga0495582_0002103 3300046473 Bacteria 11137
1307 Ga0495639_0001257 3300046475 Bacteria 11428
1308 Ga0495639_0001937 3300046475 Bacteria 9191
1309 Ga0495662_0001462 3300046476 Bacteria 11693
1310 Ga0495662_0001675 3300046476 Bacteria 11049
1311 Ga0495664_0020843 3300046477 Bacteria 3784
1312 Ga0495585_0000560 3300046492 Bacteria 35150
1313 Ga0495585_0000785 3300046492 Bacteria 28010
1314 Ga0495594_0006467 3300046499 Bacteria 6030
1315 Ga0495607_0007348 3300046501 Bacteria 7633
1316 Ga0495583_0000001 3300046506 Bacteria 811973
1317 Ga0495606_0003576 3300046507 Bacteria 16385
1318 Ga0495606_0004238 3300046507 Bacteria 14505
1319 Ga0495606_0029963 3300046507 Bacteria 3811
1320 Ga0495608_0000166 3300046511 Bacteria 46948
1321 Ga0495608_0000448 3300046511 Bacteria 28730
1322 Ga0495608_0015811 3300046511 Bacteria 5224
1323 Ga0495608_0022609 3300046511 Bacteria 4312
1324 Ga0495608_0023427 3300046511 Bacteria 4231
1325 Ga0495610_0000098 3300046512 Bacteria 101620
1326 Ga0495610_0000119 3300046512 Bacteria 89692
1327 Ga0495610_0003768 3300046512 Bacteria 11592
1328 Ga0495616_0000296 3300046513 Bacteria 40157
1329 Ga0495618_0000834 3300046514 Bacteria 21394
1330 Ga0495628_0000243 3300046516 Bacteria 48123
1331 Ga0495628_0000500 3300046516 Bacteria 35932
1332 Ga0495628_0013327 3300046516 Bacteria 6918
1333 Ga0495628_0016087 3300046516 Bacteria 6242
1334 Ga0495628_0020409 3300046516 Bacteria 5465
1335 Ga0495630_0002510 3300046517 Bacteria 12721
1336 Ga0495630_0002942 3300046517 Bacteria 11835
1337 Ga0495630_0005371 3300046517 Bacteria 9039
1338 Ga0495630_0017680 3300046517 Bacteria 5226
1339 Ga0495630_0042326 3300046517 Bacteria 3401
1340 Ga0495631_0003853 3300046518 Bacteria 8127
1341 Ga0495643_0000288 3300046522 Bacteria 72023
1342 Ga0495643_0012095 3300046522 Bacteria 5217
1343 Ga0495648_0000834 3300046524 Bacteria 32511
1344 Ga0495648_0011726 3300046524 Bacteria 6577
1345 Ga0495666_0003840 3300046526 Bacteria 7601
1346 Ga0495652_0001211 3300046529 Bacteria 28906
1347 Ga0495652_0002951 3300046529 Bacteria 17113
1348 Ga0495665_0000002 3300046531 Bacteria 128983
1349 Ga0495665_0008043 3300046531 Bacteria 5720
1350 Ga0495640_0018032 3300046533 Bacteria 5247
1351 Ga0495586_0003187 3300046535 Bacteria 8822
1352 Ga0495586_0015716 3300046535 Bacteria 4027
1353 Ga0495586_0017974 3300046535 Bacteria 3760
1354 Ga0495587_0000036 3300046536 Bacteria 117570
1355 Ga0495587_0000452 3300046536 Bacteria 28656
1356 Ga0495587_0000999 3300046536 Bacteria 18595
1357 Ga0495609_0002045 3300046538 Bacteria 12713
1358 Ga0495609_0016736 3300046538 Bacteria 3415
1359 Ga0495645_0000039 3300046543 Bacteria 94569
1360 Ga0495645_0000471 3300046543 Bacteria 27874
1361 Ga0495645_0000661 3300046543 Bacteria 23778
1362 Ga0495645_0000982 3300046543 Bacteria 19437
1363 Ga0495645_0011164 3300046543 Bacteria 6317
1364 Ga0495622_0002923 3300046557 Bacteria 8149
1365 Ga0495622_0007362 3300046557 Bacteria 5107
1366 Ga0495633_0000083 3300046558 Bacteria 125035
1367 Ga0495633_0000869 3300046558 Bacteria 26201
1368 Ga0495633_0001189 3300046558 Bacteria 20896
1369 Ga0495633_0003455 3300046558 Bacteria 10505
1370 Ga0495667_0006482 3300046559 Bacteria 7945
1371 Ga0495667_0012323 3300046559 Bacteria 5795
1372 Ga0495668_0000037 3300046616 Bacteria 233981
1373 Ga0495668_0000055 3300046616 Bacteria 199412
1374 Ga0495668_0000057 3300046616 Bacteria 196557
1375 Ga0495625_0000077 3300046660 Bacteria 163166
1376 Ga0495625_0000284 3300046660 Bacteria 78635
1377 Ga0495625_0001180 3300046660 Bacteria 33548
1378 Ga0495625_0002142 3300046660 Bacteria 21952
1379 Ga0495625_0008307 3300046660 Bacteria 8873
1380 Ga0495625_0017000 3300046660 Bacteria 5704
1381 Ga0495625_0025252 3300046660 Bacteria 4508
1382 Ga0495635_0000048 3300046663 Bacteria 79393
1383 Ga0495635_0009983 3300046663 Bacteria 6635
1384 Ga0495659_0006037 3300046664 Bacteria 3828
1385 Ga0495661_0023189 3300046665 Bacteria 4030
1386 Ga0495588_0000368 3300046674 Bacteria 27477
1387 Ga0495657_0001010 3300046675 Bacteria 24781
1388 Ga0495657_0017938 3300046675 Bacteria 5133
1389 Ga0495657_0023561 3300046675 Bacteria 4397
1390 Ga0495599_0000055 3300046678 Bacteria 79065
1391 Ga0495599_0000215 3300046678 Bacteria 36967
1392 Ga0495599_0000314 3300046678 Bacteria 28981
1393 Ga0495599_0000409 3300046678 Bacteria 24585
1394 Ga0495599_0015440 3300046678 Bacteria 4739
1395 Ga0495623_0000110 3300046679 Bacteria 50112
1396 Ga0495646_0001458 3300046680 Bacteria 14066
1397 Ga0495647_0000084 3300046681 Bacteria 23165
1398 Ga0495647_0004709 3300046681 Bacteria 4450
1399 Ga0495658_0000017 3300046683 Bacteria 93346
1400 Ga0495658_0000537 3300046683 Bacteria 20683
1401 Ga0495669_0000001 3300046684 Bacteria 291866
1402 Ga0495624_0004436 3300046690 Bacteria 10268
1403 Ga0495649_0000011 3300046694 Bacteria 416695
1404 Ga0495600_0000158 3300046809 Bacteria 39122
1405 Ga0495600_0014319 3300046809 Bacteria 4997
1406 Ga0495600_0023016 3300046809 Bacteria 4006
1407 Ga0495600_0039098 3300046809 Bacteria 3089
1408 Ga0495660_0018968 3300046810 Bacteria 3949
1409 Ga0495581_0000623 3300047315 Bacteria 18526
1410 Ga0495581_0001805 3300047315 Bacteria 11965
1411 Ga0495581_0002026 3300047315 Bacteria 11393
1412 Ga0495581_0009590 3300047315 Bacteria 5599
1413 Ga0495604_0000004 3300047317 Bacteria 456385
1414 Ga0495604_0000017 3300047317 Bacteria 192029
1415 Ga0495604_0003568 3300047317 Bacteria 12404
1416 Ga0495604_0018292 3300047317 Bacteria 5612
1417 Ga0495604_0025278 3300047317 Bacteria 4733
1418 Ga0495604_0034107 3300047317 Bacteria 4027
1419 Ga0495636_0000031 3300047318 Bacteria 59312
1420 Ga0495674_0001283 3300047319 Bacteria 24435
1421 Ga0495674_0004367 3300047319 Bacteria 13587
1422 Ga0495674_0006945 3300047319 Bacteria 10828
1423 Ga0495672_0032067 3300047320 Bacteria 3273
1424 Ga0495676_0007953 3300047321 Bacteria 9719
1425 Ga0495676_0010472 3300047321 Bacteria 8408
1426 Ga0495680_0003419 3300047322 Bacteria 15661
1427 Ga0495680_0003455 3300047322 Bacteria 15561
1428 Ga0495680_0010071 3300047322 Bacteria 8452
1429 Ga0495680_0010203 3300047322 Bacteria 8388
1430 Ga0495680_0011609 3300047322 Bacteria 7785
1431 Ga0495687_000004 3300047443 Bacteria 779298
1432 Ga0495687_001849 3300047443 Bacteria 18503
1433 Ga0495687_008901 3300047443 Bacteria 5684
1434 Ga0495675_0000250 3300047444 Bacteria 38818
1435 Ga0495675_0002559 3300047444 Bacteria 10890
1436 Ga0495675_0015662 3300047444 Bacteria 4793
1437 Ga0495675_0017253 3300047444 Bacteria 4574
1438 Ga0495684_0000118 3300047471 Bacteria 57785
1439 Ga0495684_0008116 3300047471 Bacteria 8118
1440 Ga0495686_0000174 3300047472 Bacteria 122221
1441 Ga0495686_0000341 3300047472 Bacteria 76751
1442 Ga0495686_0000729 3300047472 Bacteria 44005
1443 Ga0495686_0001275 3300047472 Bacteria 28512
1444 Ga0495686_0002662 3300047472 Bacteria 16445
1445 Ga0495593_0000009 3300047673 Bacteria 85608
1446 Ga0495593_0004331 3300047673 Bacteria 8448
1447 Ga0495593_0007169 3300047673 Bacteria 6535
1448 Ga0495602_0000159 3300048088 Bacteria 62801
1449 Ga0495602_0000891 3300048088 Bacteria 28810
1450 Ga0495602_0004186 3300048088 Bacteria 15012
1451 Ga0495602_0011104 3300048088 Bacteria 9325
1452 Ga0495614_0000005 3300048089 Bacteria 74692
1453 Ga0495614_0000112 3300048089 Bacteria 27892
1454 Ga0495614_0007687 3300048089 Bacteria 4789
1455 Ga0496100_0007619 3300048903 Bacteria 5987
1456 Ga0496101_0001173 3300048904 Bacteria 15695
1457 Ga0496101_0008298 3300048904 Bacteria 6787
1458 Ga0496101_0010839 3300048904 Bacteria 6030
1459 Ga0496101_0014166 3300048904 Bacteria 5356
1460 Ga0496101_0025312 3300048904 Bacteria 4116
1461 Ga0496101_0027767 3300048904 Bacteria 3946
1462 Ga0496102_0009287 3300048905 Bacteria 8440
1463 Ga0496102_0019285 3300048905 Bacteria 6008
1464 Ga0496102_0020239 3300048905 Bacteria 5878
1465 Ga0496102_0024902 3300048905 Bacteria 5323
1466 Ga0496103_0009617 3300048906 Bacteria 5723
1467 Ga0496104_0000035 3300048907 Bacteria 181792
1468 Ga0496104_0000274 3300048907 Bacteria 45916
1469 Ga0496104_0001176 3300048907 Bacteria 22469
1470 Ga0496104_0001420 3300048907 Bacteria 20751
1471 Ga0496104_0001625 3300048907 Bacteria 19405
1472 Ga0496104_0008025 3300048907 Bacteria 9362
1473 Ga0496104_0012719 3300048907 Bacteria 7581
1474 Ga0496105_0000359 3300048908 Bacteria 30130
1475 Ga0496105_0000930 3300048908 Bacteria 19941
1476 Ga0496105_0000997 3300048908 Bacteria 19549
1477 Ga0496105_0004795 3300048908 Bacteria 10214
1478 Ga0496105_0026638 3300048908 Bacteria 4719
1479 Ga0496105_0033326 3300048908 Bacteria 4229
1480 Ga0496106_0002074 3300048909 Bacteria 15012
1481 Ga0496106_0007232 3300048909 Bacteria 8200
1482 Ga0496106_0011347 3300048909 Bacteria 6594
1483 Ga0496106_0024297 3300048909 Bacteria 4504
1484 Ga0496106_0024330 3300048909 Bacteria 4501
1485 Ga0496106_0036051 3300048909 Bacteria 3700
1486 Ga0496107_0008786 3300048910 Bacteria 7000
1487 Ga0496107_0013750 3300048910 Bacteria 5660
1488 Ga0496107_0020259 3300048910 Bacteria 4695
1489 Ga0496108_0002409 3300048911 Bacteria 14948
1490 Ga0496108_0005547 3300048911 Bacteria 10211
1491 Ga0496108_0005935 3300048911 Bacteria 9893
1492 Ga0496108_0031155 3300048911 Bacteria 4423
1493 Ga0496108_0039784 3300048911 Bacteria 3918
1494 Ga0496108_0041001 3300048911 Bacteria 3862
1495 Ga0496109_0001756 3300048912 Bacteria 18034
1496 Ga0496109_0002119 3300048912 Bacteria 16507
1497 Ga0496109_0004789 3300048912 Bacteria 11299
1498 Ga0496109_0007052 3300048912 Bacteria 9481
1499 Ga0496109_0008874 3300048912 Bacteria 8561
1500 Ga0496109_0010104 3300048912 Bacteria 8051
1501 Ga0496109_0015662 3300048912 Bacteria 6614
1502 Ga0496109_0016734 3300048912 Bacteria 6415
1503 Ga0496109_0026500 3300048912 Bacteria 5169
1504 Ga0496109_0041540 3300048912 Bacteria 4165
1505 Ga0496109_0043006 3300048912 Bacteria 4094
1506 Ga0496110_0000168 3300048913 Bacteria 40052
1507 Ga0496110_0004153 3300048913 Bacteria 11192
1508 Ga0496110_0007078 3300048913 Bacteria 8927
1509 Ga0496110_0013147 3300048913 Bacteria 6834
1510 Ga0496110_0016291 3300048913 Bacteria 6205
1511 Ga0496111_0001062 3300048914 Bacteria 15146
1512 Ga0496111_0001490 3300048914 Bacteria 13408
1513 Ga0496111_0002831 3300048914 Bacteria 10579
1514 Ga0496111_0004797 3300048914 Bacteria 8574
1515 Ga0496111_0006216 3300048914 Bacteria 7737
1516 Ga0496111_0010182 3300048914 Bacteria 6296
1517 Ga0496111_0035272 3300048914 Bacteria 3574
1518 Ga0496112_0000189 3300048915 Bacteria 39765
1519 Ga0496112_0001216 3300048915 Bacteria 19358
1520 Ga0496112_0002743 3300048915 Bacteria 14271
1521 Ga0496112_0025054 3300048915 Bacteria 5723
1522 Ga0496112_0085083 3300048915 Bacteria 3129
1523 Ga0496113_0001127 3300048916 Bacteria 14520
1524 Ga0496113_0001158 3300048916 Bacteria 14379
1525 Ga0496113_0006699 3300048916 Bacteria 7333
1526 Ga0496113_0042300 3300048916 Bacteria 3366
1527 Ga0496114_0000948 3300048917 Bacteria 21709
1528 Ga0496114_0012610 3300048917 Bacteria 6770
1529 Ga0496114_0018228 3300048917 Bacteria 5673
1530 Ga0496114_0027359 3300048917 Bacteria 4670
1531 Ga0496115_0001171 3300048918 Bacteria 18799
1532 Ga0496115_0002222 3300048918 Bacteria 13918
1533 Ga0496115_0045337 3300048918 Bacteria 3509
1534 Ga0496116_0000004 3300048919 Bacteria 839841
1535 Ga0496116_0000232 3300048919 Bacteria 103015
1536 Ga0496116_0002152 3300048919 Bacteria 20972
1537 Ga0496116_0010331 3300048919 Bacteria 7839
1538 Ga0496116_0010338 3300048919 Bacteria 7836
1539 Ga0496117_0000002 3300048920 Bacteria 2483758
1540 Ga0496117_0002900 3300048920 Bacteria 20753
1541 Ga0496117_0015755 3300048920 Bacteria 6420
1542 Ga0496118_0003956 3300048921 Bacteria 18115
1543 Ga0496118_0012823 3300048921 Bacteria 8001
1544 Ga0496118_0014843 3300048921 Bacteria 7258
1545 Ga0496118_0041979 3300048921 Bacteria 3615
1546 Ga0496119_0008982 3300048922 Bacteria 8675
1547 Ga0496119_0016570 3300048922 Bacteria 5598
1548 Ga0496119_0043904 3300048922 Bacteria 2820
1549 Ga0496120_0000941 3300048923 Bacteria 40051
1550 Ga0496120_0020104 3300048923 Bacteria 4253
1551 Ga0496121_0000001 3300048924 Bacteria 1830318
1552 Ga0496121_0000008 3300048924 Bacteria 843593
1553 Ga0496121_0000009 3300048924 Bacteria 836971
1554 Ga0496121_0002309 3300048924 Bacteria 29564
1555 Ga0496121_0005949 3300048924 Bacteria 15422
1556 Ga0496121_0013658 3300048924 Bacteria 8705
1557 Ga0496122_0000001 3300048925 Bacteria 1827766
1558 Ga0496122_0000025 3300048925 Bacteria 362915
1559 Ga0496122_0000837 3300048925 Bacteria 58147
1560 Ga0496122_0000957 3300048925 Bacteria 52113
1561 Ga0496122_0006612 3300048925 Bacteria 13221
1562 Ga0496122_0009402 3300048925 Bacteria 10312
1563 Ga0496122_0009860 3300048925 Bacteria 9958
1564 Ga0496122_0015790 3300048925 Bacteria 7194
1565 Ga0496123_0000001 3300048926 Bacteria 1831497
1566 Ga0496123_0000032 3300048926 Bacteria 285282
1567 Ga0496123_0000043 3300048926 Bacteria 253752
1568 Ga0496123_0001255 3300048926 Bacteria 36486
1569 Ga0496123_0011635 3300048926 Bacteria 7595
1570 Ga0496124_0001936 3300048927 Bacteria 28381
1571 Ga0496124_0004955 3300048927 Bacteria 15261
1572 Ga0496124_0008685 3300048927 Bacteria 10565
1573 Ga0496125_0000082 3300048928 Bacteria 227300
1574 Ga0496125_0000311 3300048928 Bacteria 95568
1575 Ga0496125_0000382 3300048928 Bacteria 82312
1576 Ga0496125_0000401 3300048928 Bacteria 80953
1577 Ga0496125_0001837 3300048928 Bacteria 29288
1578 Ga0496125_0018059 3300048928 Bacteria 6704
1579 Ga0496125_0018917 3300048928 Bacteria 6519
1580 Ga0496125_0022738 3300048928 Bacteria 5812
1581 Ga0496126_0000624 3300048929 Bacteria 66411
1582 Ga0496126_0000703 3300048929 Bacteria 61100
1583 Ga0496126_0001375 3300048929 Bacteria 38456
1584 Ga0496126_0005679 3300048929 Bacteria 14157
1585 Ga0496126_0006355 3300048929 Bacteria 13179
1586 Ga0496126_0019171 3300048929 Bacteria 6744
1587 Ga0495682_0002385 3300049460 Bacteria 8913
1588 Ga0501031_0000014 3300049568 Bacteria 127199
1589 Ga0501031_0001303 3300049568 Bacteria 15297
1590 Ga0501031_0002127 3300049568 Bacteria 12497
1591 Ga0501031_0003110 3300049568 Bacteria 10631
1592 Ga0501031_0021253 3300049568 Bacteria 4230
1593 Ga0501032_0000015 3300049569 Bacteria 176755
1594 Ga0501032_0000064 3300049569 Bacteria 91971
1595 Ga0501032_0000759 3300049569 Bacteria 26207
1596 Ga0501032_0000789 3300049569 Bacteria 25632
1597 Ga0501032_0007565 3300049569 Bacteria 7932
1598 Ga0501033_0000023 3300049570 Bacteria 176725
1599 Ga0501033_0000030 3300049570 Bacteria 157953
1600 Ga0501033_0000190 3300049570 Bacteria 58924
1601 Ga0501033_0000330 3300049570 Bacteria 44983
1602 Ga0501033_0001698 3300049570 Bacteria 19273
1603 Ga0501033_0026347 3300049570 Bacteria 4376
1604 Ga0501033_0034430 3300049570 Bacteria 3799
1605 Ga0501033_0053681 3300049570 Bacteria 2984
1606 Ga0501034_0000073 3300049571 Bacteria 176737
1607 Ga0501034_0000095 3300049571 Bacteria 161919
1608 Ga0501034_0000111 3300049571 Bacteria 150159
1609 Ga0501034_0000167 3300049571 Bacteria 122702
1610 Ga0501034_0000174 3300049571 Bacteria 119615
1611 Ga0501034_0000176 3300049571 Bacteria 119228
1612 Ga0501034_0000242 3300049571 Bacteria 101072
1613 Ga0501034_0000993 3300049571 Bacteria 40734
1614 Ga0501034_0004022 3300049571 Bacteria 16492
1615 Ga0501034_0005481 3300049571 Bacteria 13853
1616 Ga0501034_0006569 3300049571 Bacteria 12488
1617 Ga0501034_0029994 3300049571 Bacteria 5528
1618 Ga0501034_0034282 3300049571 Bacteria 5146
1619 Ga0501034_0041681 3300049571 Bacteria 4645
1620 Ga0501034_0069828 3300049571 Bacteria 3524
1621 Ga0501034_0093991 3300049571 Bacteria 2995
1622 Ga0501036_0000002 3300049572 Bacteria 293106
1623 Ga0501036_0000399 3300049572 Bacteria 30550
1624 Ga0501036_0001149 3300049572 Bacteria 20161
1625 Ga0501036_0004049 3300049572 Bacteria 11785
1626 Ga0501036_0005277 3300049572 Bacteria 10454
1627 Ga0501036_0007566 3300049572 Bacteria 8865
1628 Ga0501036_0009648 3300049572 Bacteria 7942
1629 Ga0501036_0010097 3300049572 Bacteria 7781
1630 Ga0501036_0020665 3300049572 Bacteria 5530
1631 Ga0501037_0000048 3300049573 Bacteria 113375
1632 Ga0501037_0000163 3300049573 Bacteria 62625
1633 Ga0501037_0002141 3300049573 Bacteria 14291
1634 Ga0501037_0004859 3300049573 Bacteria 9780
1635 Ga0501037_0009724 3300049573 Bacteria 7058
1636 Ga0501037_0016825 3300049573 Bacteria 5380
1637 Ga0501037_0019510 3300049573 Bacteria 5002
1638 Ga0501037_0027870 3300049573 Bacteria 4174
1639 Ga0501037_0037188 3300049573 Bacteria 3588
1640 Ga0501038_0000002 3300049574 Bacteria 330446
1641 Ga0501038_0000031 3300049574 Bacteria 132231
1642 Ga0501038_0003688 3300049574 Bacteria 14266
1643 Ga0501038_0008287 3300049574 Bacteria 9569
1644 Ga0501038_0009490 3300049574 Bacteria 8927
1645 Ga0501038_0010393 3300049574 Bacteria 8509
1646 Ga0501038_0012451 3300049574 Bacteria 7773
1647 Ga0501038_0013075 3300049574 Bacteria 7571
1648 Ga0501038_0016000 3300049574 Bacteria 6814
1649 Ga0501038_0019090 3300049574 Bacteria 6182
1650 Ga0501038_0032064 3300049574 Bacteria 4640
1651 Ga0501038_0036451 3300049574 Bacteria 4316
1652 Ga0501039_0000002 3300049575 Bacteria 375152
1653 Ga0501039_0000057 3300049575 Bacteria 89756
1654 Ga0501039_0001400 3300049575 Bacteria 17721
1655 Ga0501039_0008090 3300049575 Bacteria 8011
1656 Ga0501039_0010525 3300049575 Bacteria 7048
1657 Ga0501039_0011534 3300049575 Bacteria 6726
1658 Ga0501039_0017768 3300049575 Bacteria 5455
1659 Ga0501039_0030404 3300049575 Bacteria 4164
1660 Ga0501039_0031749 3300049575 Bacteria 4072
1661 Ga0501040_0001732 3300049576 Bacteria 14007
1662 Ga0501040_0004461 3300049576 Bacteria 9087
1663 Ga0501040_0010974 3300049576 Bacteria 5923
1664 Ga0501040_0012436 3300049576 Bacteria 5577
1665 Ga0501041_0003283 3300049577 Bacteria 9299
1666 Ga0501042_0002873 3300049578 Bacteria 10682
1667 Ga0501042_0014373 3300049578 Bacteria 5403
1668 Ga0501042_0030086 3300049578 Bacteria 3834
1669 Ga0501043_0000048 3300049579 Bacteria 109146
1670 Ga0501043_0000298 3300049579 Bacteria 44905
1671 Ga0501043_0000945 3300049579 Bacteria 25773
1672 Ga0501043_0005914 3300049579 Bacteria 9840
1673 Ga0501043_0007673 3300049579 Bacteria 8546
1674 Ga0501043_0009189 3300049579 Bacteria 7769
1675 Ga0501043_0031471 3300049579 Bacteria 4170
1676 Ga0501043_0046147 3300049579 Bacteria 3426
1677 Ga0501046_0000045 3300049580 Bacteria 144492
1678 Ga0501046_0000128 3300049580 Bacteria 81258
1679 Ga0501046_0002196 3300049580 Bacteria 18436
1680 Ga0501046_0002389 3300049580 Bacteria 17641
1681 Ga0501046_0002587 3300049580 Bacteria 16920
1682 Ga0501046_0004119 3300049580 Bacteria 13250
1683 Ga0501046_0005116 3300049580 Bacteria 11763
1684 Ga0501046_0010509 3300049580 Bacteria 7940
1685 Ga0501046_0012007 3300049580 Bacteria 7389
1686 Ga0501046_0048191 3300049580 Bacteria 3375
1687 Ga0501047_0000102 3300049581 Bacteria 104950
1688 Ga0501047_0000352 3300049581 Bacteria 52110
1689 Ga0501047_0000691 3300049581 Bacteria 35230
1690 Ga0501047_0001024 3300049581 Bacteria 28185
1691 Ga0501047_0003691 3300049581 Bacteria 14416
1692 Ga0501047_0009082 3300049581 Bacteria 9389
1693 Ga0501047_0015553 3300049581 Bacteria 7250
1694 Ga0501047_0016911 3300049581 Bacteria 6973
1695 Ga0501047_0028087 3300049581 Bacteria 5423
1696 Ga0501047_0051845 3300049581 Bacteria 3965
1697 Ga0501048_0001595 3300049582 Bacteria 17213
1698 Ga0501048_0001739 3300049582 Bacteria 16573
1699 Ga0501048_0001795 3300049582 Bacteria 16316
1700 Ga0501048_0002095 3300049582 Bacteria 15206
1701 Ga0501048_0003618 3300049582 Bacteria 11771
1702 Ga0501048_0006875 3300049582 Bacteria 8644
1703 Ga0501048_0011824 3300049582 Bacteria 6508
1704 Ga0501048_0031179 3300049582 Bacteria 3857
1705 Ga0501067_0000351 3300049583 Bacteria 25118
1706 Ga0501067_0000693 3300049583 Bacteria 18123
1707 Ga0501067_0000802 3300049583 Bacteria 16920
1708 Ga0501067_0000957 3300049583 Bacteria 15468
1709 Ga0501067_0002120 3300049583 Bacteria 10922
1710 Ga0501067_0003475 3300049583 Bacteria 8660
1711 Ga0501067_0005672 3300049583 Bacteria 6930
1712 Ga0501067_0006668 3300049583 Bacteria 6407
1713 Ga0501067_0006878 3300049583 Bacteria 6310
1714 Ga0501068_0000575 3300049584 Bacteria 18663
1715 Ga0501068_0001665 3300049584 Bacteria 11879
1716 Ga0501068_0002682 3300049584 Bacteria 9432
1717 Ga0501069_0000154 3300049585 Bacteria 30836
1718 Ga0501069_0000931 3300049585 Bacteria 13956
1719 Ga0501069_0001773 3300049585 Bacteria 10784
1720 Ga0501069_0011785 3300049585 Bacteria 4636
1721 Ga0501070_0000109 3300049586 Bacteria 72583
1722 Ga0501070_0000302 3300049586 Bacteria 45611
1723 Ga0501070_0002159 3300049586 Bacteria 17293
1724 Ga0501070_0003350 3300049586 Bacteria 13904
1725 Ga0501070_0006716 3300049586 Bacteria 9798
1726 Ga0501070_0007693 3300049586 Bacteria 9139
1727 Ga0501070_0012884 3300049586 Bacteria 7045
1728 Ga0501070_0016801 3300049586 Bacteria 6143
1729 Ga0501070_0017922 3300049586 Bacteria 5945
1730 Ga0501070_0039643 3300049586 Bacteria 3928
1731 Ga0501070_0068337 3300049586 Bacteria 2941
1732 Ga0501071_0000180 3300049587 Bacteria 27987
1733 Ga0501071_0009592 3300049587 Bacteria 6457
1734 Ga0501071_0009851 3300049587 Bacteria 6379
1735 Ga0501071_0014218 3300049587 Bacteria 5443
1736 Ga0501072_0000003 3300049588 Bacteria 298632
1737 Ga0501072_0000171 3300049588 Bacteria 46807
1738 Ga0501072_0001994 3300049588 Bacteria 15210
1739 Ga0501072_0003052 3300049588 Bacteria 12622
1740 Ga0501072_0008559 3300049588 Bacteria 7759
1741 Ga0501072_0017576 3300049588 Bacteria 5498
1742 Ga0501072_0021826 3300049588 Bacteria 4965
1743 Ga0501073_0000214 3300049589 Bacteria 37634
1744 Ga0501073_0000392 3300049589 Bacteria 29676
1745 Ga0501073_0001168 3300049589 Bacteria 19173
1746 Ga0501073_0002127 3300049589 Bacteria 14843
1747 Ga0501073_0003472 3300049589 Bacteria 11830
1748 Ga0501073_0006501 3300049589 Bacteria 8695
1749 Ga0501073_0006932 3300049589 Bacteria 8435
1750 Ga0501073_0010704 3300049589 Bacteria 6718
1751 Ga0501074_0000268 3300049590 Bacteria 29703
1752 Ga0501074_0000923 3300049590 Bacteria 18852
1753 Ga0501074_0001743 3300049590 Bacteria 14872
1754 Ga0501074_0014167 3300049590 Bacteria 5799
1755 Ga0501074_0037984 3300049590 Bacteria 3490
1756 Ga0501074_0045770 3300049590 Bacteria 3164
1757 Ga0501075_0001625 3300049591 Bacteria 14750
1758 Ga0501075_0008137 3300049591 Bacteria 7296
1759 Ga0501075_0024706 3300049591 Bacteria 4410
1760 Ga0501075_0042007 3300049591 Bacteria 3428
1761 Ga0501076_0003574 3300049592 Bacteria 10918
1762 Ga0501076_0012577 3300049592 Bacteria 6332
1763 Ga0501217_000521 3300049661 Bacteria 6391
1764 Ga0501223_000643 3300049663 Bacteria 8388
1765 Ga0501223_001780 3300049663 Bacteria 4882
1766 Ga0501249_000219 3300049679 Bacteria 17315
1767 Ga0501259_000187 3300049688 Bacteria 9415
1768 Ga0501259_001431 3300049688 Bacteria 3973
1769 Ga0501219_000009 3300049703 Bacteria 29200
1770 Ga0501221_000072 3300049704 Bacteria 11181
1771 Ga0501079_0001965 3300049741 Bacteria 14735
1772 Ga0501079_0004284 3300049741 Bacteria 10585
1773 Ga0501079_0005467 3300049741 Bacteria 9465
1774 Ga0501079_0011655 3300049741 Bacteria 6715
1775 Ga0501079_0014923 3300049741 Bacteria 5921
1776 Ga0501079_0020109 3300049741 Bacteria 5100
1777 Ga0501079_0025949 3300049741 Bacteria 4494
1778 Ga0501079_0028612 3300049741 Bacteria 4277
1779 Ga0501079_0054436 3300049741 Bacteria 3086
1780 Ga0501080_0000041 3300049742 Bacteria 81554
1781 Ga0501080_0002319 3300049742 Bacteria 16609
1782 Ga0501080_0004634 3300049742 Bacteria 12254
1783 Ga0501080_0006682 3300049742 Bacteria 10380
1784 Ga0501080_0007596 3300049742 Bacteria 9801
1785 Ga0501080_0009084 3300049742 Bacteria 9043
1786 Ga0501080_0009816 3300049742 Bacteria 8747
1787 Ga0501080_0016454 3300049742 Bacteria 6829
1788 Ga0501080_0035878 3300049742 Bacteria 4629
1789 Ga0501080_0037062 3300049742 Bacteria 4553
1790 Ga0501080_0041110 3300049742 Bacteria 4310
1791 Ga0501081_0003579 3300049743 Bacteria 9934
1792 Ga0501081_0003652 3300049743 Bacteria 9852
1793 Ga0501081_0010438 3300049743 Bacteria 6058
1794 Ga0501081_0016882 3300049743 Bacteria 4824
1795 Ga0501081_0029908 3300049743 Bacteria 3683
1796 Ga0501083_0000093 3300049744 Bacteria 60300
1797 Ga0501083_0000353 3300049744 Bacteria 29037
1798 Ga0501083_0000401 3300049744 Bacteria 27580
1799 Ga0501083_0001882 3300049744 Bacteria 14423
1800 Ga0501083_0002364 3300049744 Bacteria 12916
1801 Ga0501083_0005468 3300049744 Bacteria 8996
1802 Ga0501083_0014835 3300049744 Bacteria 5448
1803 Ga0501083_0019754 3300049744 Bacteria 4689
1804 Ga0501264_000187 3300049761 Bacteria 9940
1805 Ga0501266_000030 3300049763 Bacteria 42664
1806 Ga0501268_001534 3300049765 Bacteria 2896
1807 Ga0501035_0000020 3300049822 Bacteria 221605
1808 Ga0501035_0000022 3300049822 Bacteria 208622
1809 Ga0501035_0000036 3300049822 Bacteria 165008
1810 Ga0501035_0000198 3300049822 Bacteria 73523
1811 Ga0501035_0001475 3300049822 Bacteria 24081
1812 Ga0501035_0008202 3300049822 Bacteria 9734
1813 Ga0501035_0008394 3300049822 Bacteria 9618
1814 Ga0501035_0009199 3300049822 Bacteria 9186
1815 Ga0501035_0046568 3300049822 Bacteria 3901
1816 Ga0501035_0056363 3300049822 Bacteria 3506
1817 Ga0501044_0000002 3300049823 Bacteria 375152
1818 Ga0501044_0000007 3300049823 Bacteria 283429
1819 Ga0501044_0000011 3300049823 Bacteria 257385
1820 Ga0501044_0000503 3300049823 Bacteria 47547
1821 Ga0501044_0001090 3300049823 Bacteria 32375
1822 Ga0501044_0005359 3300049823 Bacteria 14252
1823 Ga0501044_0007248 3300049823 Bacteria 12192
1824 Ga0501044_0011217 3300049823 Bacteria 9717
1825 Ga0501044_0012477 3300049823 Bacteria 9202
1826 Ga0501044_0023653 3300049823 Bacteria 6533
1827 Ga0501044_0028128 3300049823 Bacteria 5934
1828 Ga0501044_0031826 3300049823 Bacteria 5548
1829 Ga0501044_0039914 3300049823 Bacteria 4894
1830 Ga0501044_0044965 3300049823 Bacteria 4579
1831 Ga0501044_0072844 3300049823 Bacteria 3492
1832 Ga0501045_0002779 3300049824 Bacteria 11954
1833 Ga0501045_0005477 3300049824 Bacteria 8783
1834 Ga0501045_0011364 3300049824 Bacteria 6250
1835 Ga0501212_000748 3300049851 Bacteria 3341
1836 Ga0501284_00008 3300050005 Bacteria 143517
1837 nmdc:mga03683_925_c1 3300050489 Bacteria 8485
1838 nmdc:mga00v17_12600_c1 3300050491 Bacteria 4669
1839 nmdc:mga00v17_203_c1 3300050491 Bacteria 35824
1840 nmdc:mga00v17_6_c1 3300050491 Bacteria 179509
1841 nmdc:mga0yw44_4652_c1 3300050492 Bacteria 6337
1842 nmdc:mga0k408_26_c4 3300050493 Bacteria 51744
1843 nmdc:mga0k408_31211_c1 3300050493 Bacteria 3041
1844 nmdc:mga0k408_4005_c1 3300050493 Bacteria 7815
1845 nmdc:mga0k408_696_c1 3300050493 Bacteria 18424
1846 nmdc:mga04h51_341_c1 3300050495 Bacteria 11685
1847 nmdc:mga07m45_1617_c1 3300050496 Bacteria 10375
1848 nmdc:mga07m45_25589_c1 3300050496 Bacteria 3238
1849 nmdc:mga05p37_10057_c1 3300050507 Bacteria 11227
1850 nmdc:mga05p37_2028_c1 3300050507 Bacteria 23614
1851 nmdc:mga05p37_20570_c1 3300050507 Bacteria 7986
1852 nmdc:mga05p37_21244_c1 3300050507 Bacteria 7858
1853 nmdc:mga05p37_2260_c1 3300050507 Bacteria 22440
1854 nmdc:mga05p37_23177_c1 3300050507 Bacteria 7532
1855 nmdc:mga05p37_32934_c1 3300050507 Bacteria 6344
1856 nmdc:mga05p37_77737_c1 3300050507 Bacteria 4086
1857 nmdc:mga09592_51896_c1 3300050508 Bacteria 3460
1858 nmdc:mga0qj67_26823_c1 3300050509 Bacteria 4461
1859 nmdc:mga0qj67_37512_c1 3300050509 Bacteria 3797
1860 nmdc:mga0qj67_382_c1 3300050509 Bacteria 30484
1861 nmdc:mga0qj67_4730_c1 3300050509 Bacteria 9889
1862 nmdc:mga06r32_10583_c1 3300050510 Bacteria 8317
1863 nmdc:mga06r32_12428_c1 3300050510 Bacteria 7683
1864 nmdc:mga06r32_14053_c1 3300050510 Bacteria 7259
1865 nmdc:mga06r32_6186_c1 3300050510 Bacteria 10745
1866 nmdc:mga06r32_7631_c1 3300050510 Bacteria 9728
1867 nmdc:mga08y16_11384_c1 3300050511 Bacteria 9348
1868 nmdc:mga08y16_16_c1 3300050511 Bacteria 386948
1869 nmdc:mga08y16_4059_c1 3300050511 Bacteria 15284
1870 nmdc:mga08y16_5732_c1 3300050511 Bacteria 13017
1871 nmdc:mga0n895_1505_c1 3300050512 Bacteria 17484
1872 nmdc:mga0n895_15139_c1 3300050512 Bacteria 7028
1873 nmdc:mga0n895_19306_c1 3300050512 Bacteria 6333
1874 nmdc:mga0n895_31745_c1 3300050512 Bacteria 5061
1875 nmdc:mga0n895_3482_c1 3300050512 Bacteria 12703
1876 nmdc:mga0n895_44889_c1 3300050512 Bacteria 4310
1877 nmdc:mga0n895_7603_c1 3300050512 Bacteria 9318
1878 nmdc:mga0rr50_26779_c1 3300050513 Bacteria 4029
1879 nmdc:mga0rr50_612_c1 3300050513 Bacteria 19119
1880 nmdc:mga0rr50_6599_c1 3300050513 Bacteria 7090
1881 nmdc:mga08x19_140_c1 3300050514 Bacteria 64178
1882 nmdc:mga08x19_5811_c1 3300050514 Bacteria 7295
1883 nmdc:mga08x19_7970_c1 3300050514 Bacteria 6294
1884 nmdc:mga08x19_819_c1 3300050514 Bacteria 19748
1885 nmdc:mga0a205_12737_c1 3300050515 Bacteria 7796
1886 nmdc:mga0a205_3328_c1 3300050515 Bacteria 14310
1887 nmdc:mga0sz30_215_c2 3300050516 Bacteria 16156
1888 Ga0495601_0000183 3300053077 Bacteria 33204
1889 Ga0495601_0025316 3300053077 Bacteria 3659
1890 Ga0500635_0001070 3300053080 Bacteria 6543
1891 Ga0495595_0010590 3300053084 Bacteria 3835
1892 Ga0495619_0001430 3300053085 Bacteria 15694
1893 Ga0495619_0017238 3300053085 Bacteria 4574
1894 Ga0500578_0000119 3300053086 Bacteria 95584
1895 Ga0500643_000014 3300053087 Bacteria 318249
1896 Ga0500643_001389 3300053087 Bacteria 14012
1897 Ga0500644_0000569 3300053088 Bacteria 14427
1898 Ga0500646_0001071 3300053090 Bacteria 7448
1899 Ga0500583_0000010 3300053092 Bacteria 160546
1900 Ga0500651_0000312 3300053093 Bacteria 27929
1901 Ga0500641_0000009 3300053096 Bacteria 173260
1902 Ga0500641_0000084 3300053096 Bacteria 37445
1903 Ga0500641_0000389 3300053096 Bacteria 16329
1904 Ga0500641_0001643 3300053096 Bacteria 7969
1905 Ga0500556_0000503 3300053104 Bacteria 26921
1906 Ga0500562_000030 3300053108 Bacteria 92407
1907 Ga0500569_000107 3300053109 Bacteria 12988
1908 Ga0500595_003261 3300053119 Bacteria 7662
1909 Ga0500608_000032 3300053122 Bacteria 64445
1910 Ga0500618_000021 3300053125 Bacteria 160813
1911 Ga0500618_000084 3300053125 Bacteria 76331
1912 Ga0500652_000401 3300053131 Bacteria 15537
1913 Ga0500652_001726 3300053131 Bacteria 6623
1914 Ga0500658_0000061 3300053134 Bacteria 53519
1915 Ga0500658_0005500 3300053134 Bacteria 4715
1916 Ga0500559_0005113 3300053136 Bacteria 6068
1917 Ga0500561_0000326 3300053137 Bacteria 8008
1918 Ga0500564_000051 3300053138 Bacteria 30326
1919 Ga0500568_0000641 3300053139 Bacteria 25249
1920 Ga0500568_0000776 3300053139 Bacteria 22565
1921 Ga0500568_0001723 3300053139 Bacteria 13587
1922 Ga0500573_0000003 3300053140 Bacteria 355643
1923 Ga0500590_019376 3300053148 Bacteria 3526
1924 Ga0500604_0000119 3300053151 Bacteria 23992
1925 Ga0500616_0000091 3300053153 Bacteria 184945
1926 Ga0500616_0000703 3300053153 Bacteria 38838
1927 Ga0500616_0002822 3300053153 Bacteria 13969
1928 Ga0500616_0002976 3300053153 Bacteria 13425
1929 Ga0500616_0007663 3300053153 Bacteria 6819
1930 Ga0500616_0011166 3300053153 Bacteria 5329
1931 Ga0500622_0000075 3300053156 Bacteria 109513
1932 Ga0500622_0000435 3300053156 Bacteria 39609
1933 Ga0500622_0000455 3300053156 Bacteria 38833
1934 Ga0500622_0001236 3300053156 Bacteria 20943
1935 Ga0500622_0007482 3300053156 Bacteria 6200
1936 Ga0500624_000603 3300053157 Bacteria 9830
1937 Ga0500634_0000169 3300053161 Bacteria 21622
1938 Ga0500636_0000153 3300053177 Bacteria 35853
1939 Ga0500636_0010431 3300053177 Bacteria 5421
1940 Ga0500637_0008126 3300053178 Bacteria 5279
1941 Ga0500584_010263 3300053726 Bacteria 4189
1942 Ga0500611_000020 3300053727 Bacteria 105250
1943 Ga0500645_000197 3300053730 Bacteria 46814
1944 Ga0501084_0000141 3300054114 Bacteria 54348
1945 Ga0501084_0000158 3300054114 Bacteria 52272
1946 Ga0501084_0000713 3300054114 Bacteria 25334
1947 Ga0501084_0001258 3300054114 Bacteria 19952
1948 Ga0501084_0001416 3300054114 Bacteria 19004
1949 Ga0501084_0003039 3300054114 Bacteria 13595
1950 Ga0501084_0004422 3300054114 Bacteria 11469
1951 Ga0501084_0006701 3300054114 Bacteria 9469
1952 Ga0501084_0020699 3300054114 Bacteria 5487
1953 Ga0501084_0032729 3300054114 Bacteria 4350
1954 Ga0501084_0042936 3300054114 Bacteria 3782
1955 Ga0590071_000552 3300059421 Bacteria 10832
1956 Ga0587072_000662 3300059643 Bacteria 3703
1957 Ga0501082_0000253 3300060353 Bacteria 46904
1958 Ga0501082_0002732 3300060353 Bacteria 15414
1959 Ga0501082_0006508 3300060353 Bacteria 10128
1960 Ga0501082_0007331 3300060353 Bacteria 9520
1961 Ga0501082_0019271 3300060353 Bacteria 5881
1962 Ga0501082_0030261 3300060353 Bacteria 4666
1963 Ga0501082_0032630 3300060353 Bacteria 4492
1964 Ga0501082_0035947 3300060353 Bacteria 4268
1965 Ga0501082_0036504 3300060353 Bacteria 4234
1966 Ga0501082_0036890 3300060353 Bacteria 4211
1967 Ga0530510_0001012 3300061734 Bacteria 18654
1968 Ga0530510_0011284 3300061734 Bacteria 6270
1969 2902408998 2902405164 Bacteria 6784948
1970 2503202219 2503198000 Bacteria 6884444
1971 2508728379 2508501050 Bacteria 9633614
1972 2509078478 2508501114 Bacteria 7082538
1973 2509107622 2508501122 Bacteria 6292184
1974 2509117026 2508501123 Bacteria 6283661
1975 2509140634 2508501127 Bacteria 7037543
1976 2509370704 2509276018 Bacteria 6910194
1977 2509375955 2509276019 Bacteria 6802256
1978 2509386931 2509276021 Bacteria 7634384
1979 2509396867 2509276022 Bacteria 6200534
1980 2509442458 2509276033 Bacteria 7180565
1981 2510133042 2510065019 Bacteria 6903379
1982 2510306225 2510065057 Bacteria 6649661
1983 2510317495 2510065059 Bacteria 6847884
1984 2510840400 2510461069 Bacteria 5505000
1985 2510894402 2510461076 Bacteria 8618824
1986 2510899427 2510461076 Bacteria 8618824
1987 2511134917 2510917022 Bacteria 6504556
1988 2511172598 2510917026 Bacteria 7046020
1989 2511183756 2510917028 Bacteria 6185411
1990 2511193375 2510917030 Bacteria 7460662
1991 2511389433 2511231027 Bacteria 5013807
1992 2511501475 2511231052 Bacteria 6974333
1993 2512033237 2511231221 Bacteria 6846400
1994 2512532898 2512047086 Bacteria 6850303
1995 2512930882 2512875016 Bacteria 6529530
1996 2512958607 2512875024 Bacteria 7195110
1997 2512971773 2512875026 Bacteria 6861065
1998 2513235124 2513020052 Bacteria 5120511
1999 2513569877 2513237084 Bacteria 7231967
2000 2513575145 2513237085 Bacteria 7695351
2001 2513583018 2513237086 Bacteria 7265287
2002 2513591784 2513237087 Bacteria 5817514
2003 2513594401 2513237088 Bacteria 6927906
2004 2513605236 2513237089 Bacteria 6553624
2005 2513609919 2513237090 Bacteria 7096802
2006 2513617928 2513237091 Bacteria 6900273
2007 2513626870 2513237092 Bacteria 8341956
2008 2513635614 2513237093 Bacteria 7545552
2009 2513646878 2513237095 Bacteria 8976980
2010 2513713934 2513237103 Bacteria 7647401
2011 2513722532 2513237104 Bacteria 10034502
2012 2513866984 2513237138 Bacteria 7368160
2013 2513884914 2513237140 Bacteria 7076289
2014 2513905926 2513237143 Bacteria 6664116
2015 2513909850 2513237144 Bacteria 7530820
2016 2513926627 2513237146 Bacteria 7166346
2017 2513986861 2513237156 Bacteria 6402557
2018 2513997333 2513237159 Bacteria 6810126
2019 2514005324 2513237160 Bacteria 6650282
2020 2514021846 2513237162 Bacteria 7468464
2021 2514034977 2513237164 Bacteria 7563725
2022 2514418939 2513237305 Bacteria 7293571
2023 2514589916 2513237351 Bacteria 6968952
2024 2515111992 2515075009 Bacteria 7288508
2025 2515611386 2515154107 Bacteria 6795637
2026 2515633788 2515154113 Bacteria 7807172
2027 2515645047 2515154114 Bacteria 7848616
2028 2515660192 2515154116 Bacteria 7552979
2029 2515738826 2515154134 Bacteria 7220242
2030 2516892790 2516653046 Bacteria 6989037
2031 2517035728 2516653077 Bacteria 7555578
2032 2517076152 2516653085 Bacteria 7346596
2033 2517094895 2517093000 Bacteria 7412387
2034 2517101786 2517093001 Bacteria 9002274
2035 2517406525 2517287029 Bacteria 6905599
2036 2517569564 2517487022 Bacteria 7227575
2037 2520881705 2519899754 Bacteria 5336938
2038 2522552779 2522125168 Bacteria 7376607
2039 2523102824 2522572158 Bacteria 6514390
2040 2523466311 2523231067 Bacteria 5230452
2041 2524436793 2524023205 Bacteria 8918781
2042 2524453624 2524023207 Bacteria 6813453
2043 2524460449 2524023209 Bacteria 6679728
2044 2524611809 2524023250 Bacteria 5457705
2045 2530645292 2529292951 Bacteria 6916614
2046 2535484830 2534681786 Bacteria 3308809
2047 2535516286 2534681796 Bacteria 7146037
2048 2537877734 2537561587 Bacteria 5425293
2049 2545677751 2545555834 Bacteria 8130841
2050 2551674221 2551306084 Bacteria 8942552
2051 2551680373 2551306084 Bacteria 8942552
2052 2551687018 2551306085 Bacteria 7347181
2053 2551695020 2551306086 Bacteria 6843938
2054 2551697228 2551306087 Bacteria 7351905
2055 2551709717 2551306089 Bacteria 7162724
2056 2551719890 2551306090 Bacteria 7953713
2057 2551726587 2551306091 Bacteria 7086830
2058 2551735056 2551306092 Bacteria 6992595
2059 2551745210 2551306093 Bacteria 7064773
2060 2554247602 2554235003 Bacteria 5877155
2061 2558868230 2558860100 Bacteria 8458965
2062 2559294733 2558860242 Bacteria 5568029
2063 2561466383 2558860983 Bacteria 4133860
2064 2585149988 2582581279 Bacteria 4980720
2065 2585168461 2582581283 Bacteria 6030556
2066 2585199972 2582581294 Bacteria 6626667
2067 2585225806 2582581298 Bacteria 7315509
2068 2585229975 2582581299 Bacteria 6518058
2069 2585254518 2582581304 Bacteria 5831370
2070 2585270026 2582581306 Bacteria 6450535
2071 2585270657 2582581307 Bacteria 6597605
2072 2585276999 2582581308 Bacteria 7413247
2073 2585323995 2582581315 Bacteria 7318924
2074 2585333608 2582581316 Bacteria 7774528
2075 2585389731 2582581865 Bacteria 6644329
2076 2585393729 2582581866 Bacteria 6859583
2077 2585403464 2582581867 Bacteria 7184437
2078 2585528307 2585427526 Bacteria 7258840
2079 2585537009 2585427527 Bacteria 7273426
2080 2585540485 2585427528 Bacteria 6842387
2081 2585546766 2585427529 Bacteria 7395659
2082 2585551860 2585427530 Bacteria 7383882
2083 2585558360 2585427531 Bacteria 6992870
2084 2585819568 2585427590 Bacteria 6824633
2085 2585838701 2585427593 Bacteria 7141551
2086 2585846750 2585427594 Bacteria 6180594
2087 2585897755 2585427608 Bacteria 6544331
2088 2585904651 2585427609 Bacteria 6667127
2089 2585995865 2585427633 Bacteria 6413184
2090 2586000429 2585427634 Bacteria 6455027
2091 2586210611 2585427687 Bacteria 5544917
2092 2587919216 2585428106 Bacteria 5179711
2093 2587980233 2585428125 Bacteria 6662905
2094 2588516561 2588253730 Bacteria 6881675
2095 2596376501 2595698237 Bacteria 6712432
2096 2599106293 2597490356 Bacteria 7030811
2097 2599331347 2599185156 Bacteria 5403036
2098 2599417944 2599185170 Bacteria 7295545
2099 2599480700 2599185184 Bacteria 6430550
2100 2599604001 2599185210 Bacteria 5624189
2101 2599721491 2599185236 Bacteria 6875203
2102 2599938072 2599185301 Bacteria 6161860
2103 2600197160 2599185352 Bacteria 7228948
2104 2600375819 2600254933 Bacteria 4750527
2105 2601608271 2600255279 Bacteria 5605316
2106 2601745045 2600255308 Bacteria 5611129
2107 2616292695 2615840624 Bacteria 6557588
2108 2616308373 2615840626 Bacteria 7921970
2109 2616556559 2615840698 Bacteria 7319877
2110 2617385862 2617270742 Bacteria 6808054
2111 2643772010 2643221550 Bacteria 4619371
2112 2643775529 2643221551 Bacteria 3750538
2113 2643793975 2643221555 Bacteria 3749717
2114 2643808687 2643221557 Bacteria 7184309
2115 2643811990 2643221558 Bacteria 5460675
2116 2643840485 2643221564 Bacteria 4193379
2117 2643857653 2643221568 Bacteria 5187270
2118 2643883670 2643221574 Bacteria 2789653
2119 2643919224 2643221582 Bacteria 5804683
2120 2643989395 2643221595 Bacteria 6565519
2121 2644003780 2643221599 Bacteria 6292121
2122 2644008973 2643221600 Bacteria 5530138
2123 2644049373 2643221607 Bacteria 6314006
2124 2644066291 2643221610 Bacteria 7480339
2125 2644107939 2643221618 Bacteria 7717186
2126 2644132091 2643221623 Bacteria 5239945
2127 2644148389 2643221626 Bacteria 8069654
2128 2644152967 2643221627 Bacteria 6761570
2129 2644166835 2643221629 Bacteria 5850260
2130 2644192756 2643221634 Bacteria 6705461
2131 2644204288 2643221636 Bacteria 6583769
2132 2644210493 2643221637 Bacteria 5345260
2133 2644225046 2643221640 Bacteria 5258820
2134 2644232354 2643221642 Bacteria 5357871
2135 2644239396 2643221643 Bacteria 5749658
2136 2644300643 2643221653 Bacteria 4569637
2137 2644309333 2643221655 Bacteria 7722067
2138 2644333159 2643221659 Bacteria 7890716
2139 2644349349 2643221662 Bacteria 5851492
2140 2644352167 2643221663 Bacteria 3425771
2141 2644372181 2643221667 Bacteria 5627472
2142 2644377833 2643221668 Bacteria 7306521
2143 2644415496 2643221675 Bacteria 7473456
2144 2644450102 2643221680 Bacteria 7473610
2145 2644482407 2643221686 Bacteria 6310811
2146 2644494438 2643221688 Bacteria 5260751
2147 2644502060 2643221689 Bacteria 6042950
2148 2644522128 2643221693 Bacteria 5513853
2149 2644545669 2643221698 Bacteria 7756764
2150 2644551794 2643221699 Bacteria 5731501
2151 2644615275 2643221712 Bacteria 7729434
2152 2644640188 2643221716 Bacteria 4986332
2153 2644654045 2643221718 Bacteria 5345506
2154 2644658703 2643221719 Bacteria 4568197
2155 2644673586 2643221723 Bacteria 7095460
2156 2644683295 2643221725 Bacteria 5087956
2157 2644687659 2643221726 Bacteria 7455827
2158 2644729160 2643221733 Bacteria 5690728
2159 2644735848 2643221734 Bacteria 5365412
2160 2644746766 2643221736 Bacteria 6608466
2161 2657683848 2657244999 Bacteria 5946535
2162 2671115773 2667528174 Bacteria 6435400
2163 2671692678 2671180139 Bacteria 4196045
2164 2688599419 2687453392 Bacteria 6880454
2165 2692316055 2690316117 Bacteria 6800650
2166 2694632205 2693429783 Bacteria 7019804
2167 2694634387 2693429784 Bacteria 7241525
2168 2715499660 2713897090 Bacteria 3353799
2169 2719180948 2718217882 Bacteria 6556348
2170 2719385550 2718217927 Bacteria 6972593
2171 2719665372 2718217997 Bacteria 6740740
2172 2719731697 2718218009 Bacteria 6478651
2173 2720491792 2718218199 Bacteria 6740745
2174 2720613061 2718218232 Bacteria 6720332
2175 2720619914 2718218233 Bacteria 6662049
2176 2720631340 2718218235 Bacteria 6630699
2177 2720775067 2718218269 Bacteria 6906114
2178 2721147042 2718218363 Bacteria 6524337
2179 2721158571 2718218365 Bacteria 6274507
2180 2721163960 2718218366 Bacteria 6425255
2181 2721399298 2718218423 Bacteria 6438183
2182 2722730819 2721755487 Bacteria 6357185
2183 2722840130 2721755514 Bacteria 6424414
2184 2723026704 2721755556 Bacteria 6745503
2185 2723560321 2721755684 Bacteria 6859907
2186 2723566887 2721755685 Bacteria 6704835
2187 2723576379 2721755686 Bacteria 7343952
2188 2724038111 2721755809 Bacteria 6438790
2189 2724044453 2721755810 Bacteria 6479005
2190 2724089674 2721755819 Bacteria 6906405
2191 2724104152 2721755822 Bacteria 6726041
2192 2724109961 2721755823 Bacteria 6752556
2193 2725949928 2724679232 Bacteria 7646494
2194 2730107640 2728369352 Bacteria 6745171
2195 2730164185 2728369365 Bacteria 6555560
2196 2730298203 2728369397 Bacteria 6274511
2197 2738729020 2738541278 Bacteria 9755573
2198 2738734264 2738541279 Bacteria 6149495
2199 2738743739 2738541281 Bacteria 5112672
2200 2738758888 2738541283 Bacteria 7222293
2201 2738762023 2738541284 Bacteria 5199923
2202 2738767022 2738541285 Bacteria 6150075
2203 2738802070 2738541293 Bacteria 7065685
2204 2738856726 2738541302 Bacteria 5944758
2205 2738945580 2738541317 Bacteria 5340176
2206 2739037981 2738541333 Bacteria 7106503
2207 2739215845 2738543007 Bacteria 6149845
2208 2739302003 2738543023 Bacteria 6767879
2209 2739307904 2738543024 Bacteria 5603683
2210 2739350705 2738543031 Bacteria 5769731
2211 2739352646 2738543032 Bacteria 5115625
2212 2739587412 2739367651 Bacteria 6359826
2213 2739614437 2739367656 Bacteria 5152243
2214 2739646604 2739367663 Bacteria 5040914
2215 2740002086 2739367857 Bacteria 5433684
2216 2740006902 2739367858 Bacteria 5432813
2217 2745080269 2744054633 Bacteria 8678936
2218 2753359449 2751185800 Bacteria 5467370
2219 2753458300 2751185821 Bacteria 6189929
2220 2756675889 2756170246 Bacteria 7451806
2221 2757572054 2757320392 Bacteria 3737298
2222 2758641709 2758568016 Bacteria 5645291
2223 2765465573 2765235802 Bacteria 5618596
2224 2766062920 2765235942 Bacteria 7445910
2225 2770195596 2767802442 Bacteria 5747986
2226 2774873377 2773857925 Bacteria 6472445
2227 2776259688 2775506901 Bacteria 9631051
2228 2776271541 2775506902 Bacteria 6208009
2229 2776279948 2775506904 Bacteria 5954060
2230 2776615332 2775506987 Bacteria 5373360
2231 2776913365 2775507049 Bacteria 6284736
2232 2778176513 2775507266 Bacteria 7392367
2233 2792459904 2791355048 Bacteria 5832535
2234 2792580721 2791355082 Bacteria 5973319
2235 2792619953 2791355091 Bacteria 6135441
2236 2792626629 2791355092 Bacteria 6248105
2237 2792639565 2791355094 Bacteria 7011481
2238 2792748532 2791355123 Bacteria 8049106
2239 2793279718 2791355253 Bacteria 5171699
2240 2793298272 2791355256 Bacteria 6798008
2241 2793313753 2791355259 Bacteria 7254731
2242 2793324335 2791355260 Bacteria 6598818
2243 2793326452 2791355261 Bacteria 6661293
2244 2793337038 2791355262 Bacteria 6774204
2245 2793341289 2791355263 Bacteria 6872478
2246 2793347534 2791355264 Bacteria 6429314
2247 2793352396 2791355265 Bacteria 6539969
2248 2793361408 2791355266 Bacteria 7116587
2249 2793369678 2791355267 Bacteria 7222458
2250 2802652820 2802428842 Bacteria 4926114
2251 2802718771 2802428858 Bacteria 6636079
2252 2802726384 2802428859 Bacteria 6667919
2253 2802732927 2802428860 Bacteria 6525526
2254 2802738282 2802428861 Bacteria 6534206
2255 2802744612 2802428862 Bacteria 6633353
2256 2802751182 2802428863 Bacteria 6410669
2257 2804752110 2802429268 Bacteria 6094027
2258 2805927730 2802429605 Bacteria 6875453
2259 2805935636 2802429606 Bacteria 6346811
2260 2806045395 2802429633 Bacteria 7341974
2261 2806055413 2802429634 Bacteria 7083200
2262 2806061456 2802429635 Bacteria 7650140
2263 2806068029 2802429636 Bacteria 7597525
2264 2806072622 2802429637 Bacteria 7067217
2265 2808985494 2808606387 Bacteria 5697198
2266 2817416986 2816332280 Bacteria 5109718
2267 2818242717 2816332527 Bacteria 8933356
2268 2819241903 2818991272 Bacteria 4622173
2269 2819550249 2818991437 Bacteria 5805520
2270 2819559965 2818991439 Bacteria 6907412
2271 2819576691 2818991442 Bacteria 8318214
2272 2819587900 2818991444 Bacteria 6968812
2273 2819610372 2818991448 Bacteria 6772224
2274 2819638112 2818991453 Bacteria 7181617
2275 2819677444 2818991460 Bacteria 7595395
2276 2819684703 2818991461 Bacteria 7026071
2277 2819718223 2818991467 Bacteria 5893227
2278 2821127913 2821123053 Bacteria 7836056
2279 2821143081 2821136567 Bacteria 8080116
2280 2821446675 2821443989 Bacteria 7658172
2281 2824681276 2824679649 Bacteria 8248951
2282 2824750061 2824746037 Bacteria 7911610
2283 2829748666 2829745981 Bacteria 5406054
2284 2833643753 2833640130 Bacteria 4858325
2285 2834579913 2834578030 Bacteria 3530182
2286 2835314007 2835312727 Bacteria 7413381
2287 2837653055 2837651117 Bacteria 3772164
2288 2838021154 2838016132 Bacteria 6577831
2289 2838025384 2838022645 Bacteria 6494267
2290 2838034563 2838029111 Bacteria 6603031
2291 2838041541 2838035591 Bacteria 7166484
2292 2838043196 2838042994 Bacteria 6046894
2293 2838054210 2838048938 Bacteria 6044578
2294 2838067843 2838061910 Bacteria 6794874
2295 2838071473 2838068647 Bacteria 6208656
2296 2838078788 2838074704 Bacteria 6785777
2297 2838666287 2838661181 Bacteria 7385261
2298 2838670178 2838668709 Bacteria 6671819
2299 2838676342 2838675328 Bacteria 4909118
2300 2838682472 2838680041 Bacteria 6545511
2301 2838689224 2838686498 Bacteria 7807632
2302 2838697043 2838694306 Bacteria 6853137
2303 2838702549 2838701080 Bacteria 6669771
2304 2838709716 2838707686 Bacteria 6619912
2305 2838715225 2838714209 Bacteria 5525906
2306 2838720975 2838719591 Bacteria 5523910
2307 2838725983 2838724970 Bacteria 4908691
2308 2838730572 2838729681 Bacteria 7400765
2309 2838738337 2838736955 Bacteria 5760694
2310 2838743513 2838742623 Bacteria 7396178
2311 2839995558 2839993093 Bacteria 5512535
2312 2840678250 2840677318 Bacteria 2664183
2313 2840768058 2840764183 Bacteria 6358399
2314 2840879336 2840878972 Bacteria 5483153
2315 2841740020 2841734538 Bacteria 6784580
2316 2841762591 2841760612 Bacteria 6454112
2317 2841841293 2841840854 Bacteria 5761912
2318 2841847933 2841846520 Bacteria 5345850
2319 2841854811 2841851746 Bacteria 7532261
2320 2841859515 2841859092 Bacteria 5436171
2321 2841864802 2841864319 Bacteria 6742987
2322 2841913542 2841911363 Bacteria 6173697
2323 2841919289 2841917233 Bacteria 6173500
2324 2841958198 2841957949 Bacteria 8652217
2325 2842077890 2842077413 Bacteria 6508645
2326 2842110756 2842110456 Bacteria 7656360
2327 2842119602 2842118031 Bacteria 7033875
2328 2842126037 2842124991 Bacteria 5346824
2329 2842131236 2842130223 Bacteria 4909145
2330 2842141071 2842140634 Bacteria 5759631
2331 2842146906 2842146304 Bacteria 5957337
2332 2842153594 2842152218 Bacteria 4908957
2333 2842157674 2842156927 Bacteria 6894975
2334 2842164871 2842163707 Bacteria 6916235
2335 2842171468 2842170452 Bacteria 5525737
2336 2842177214 2842175837 Bacteria 4908771
2337 2842180741 2842180545 Bacteria 6888678
2338 2842188333 2842187318 Bacteria 5524014
2339 2842196889 2842192696 Bacteria 6147454
2340 2842200952 2842198810 Bacteria 6608673
2341 2842206287 2842205361 Bacteria 6340321
2342 2842212644 2842211629 Bacteria 5523832
2343 2842222979 2842217011 Bacteria 7497767
2344 2842225737 2842224351 Bacteria 5524473
2345 2842231207 2842229732 Bacteria 7475766
2346 2842239129 2842237096 Bacteria 6620661
2347 2842244692 2842243621 Bacteria 7421798
2348 2842251971 2842250916 Bacteria 6579627
2349 2842258505 2842257432 Bacteria 7401195
2350 2842268031 2842264693 Bacteria 6472963
2351 2842273244 2842271015 Bacteria 7807131
2352 2842279744 2842278818 Bacteria 6340002
2353 2842287389 2842285085 Bacteria 6011953
2354 2842291552 2842291075 Bacteria 7076806
2355 2842301799 2842298080 Bacteria 6123127
2356 2842310094 2842304105 Bacteria 7023636
2357 2842313675 2842311132 Bacteria 6616990
2358 2842318155 2842317721 Bacteria 6793725
2359 2842333587 2842333319 Bacteria 8899485
2360 2842347265 2842341865 Bacteria 7003929
2361 2842357282 2842357229 Bacteria 6485165
2362 2842366550 2842363717 Bacteria 6844742
2363 2842373039 2842370503 Bacteria 7038661
2364 2842377948 2842377471 Bacteria 7140707
2365 2842386111 2842384541 Bacteria 7057858
2366 2842397414 2842395702 Bacteria 6780583
2367 2842405081 2842402390 Bacteria 6681310
2368 2842411664 2842409023 Bacteria 6687331
2369 2842417886 2842415677 Bacteria 6596907
2370 2842424869 2842422224 Bacteria 6239196
2371 2842431764 2842428310 Bacteria 6767288
2372 2842438307 2842434925 Bacteria 6502746
2373 2842444938 2842441272 Bacteria 6769273
2374 2842452257 2842447887 Bacteria 6754142
2375 2842466103 2842462802 Bacteria 6588055
2376 2842472924 2842469257 Bacteria 6752936
2377 2842481310 2842475841 Bacteria 6603183
2378 2842487096 2842482326 Bacteria 7212537
2379 2842492880 2842489311 Bacteria 6620893
2380 2842496425 2842495871 Bacteria 6820686
2381 2842508210 2842502639 Bacteria 6604161
2382 2842510247 2842509118 Bacteria 6850950
2383 2842516300 2842515876 Bacteria 5436280
2384 2842522422 2842521101 Bacteria 6569494
2385 2842700720 2842698319 Bacteria 5190321
2386 2842726854 2842722452 Bacteria 6263924
2387 2842776248 2842775625 Bacteria 5587290
2388 2842872754 2842871566 Bacteria 4827117
2389 2842911698 2842909656 Bacteria 6185908
2390 2842923741 2842922631 Bacteria 5824079
2391 2843744504 2843744320 Bacteria 5659202
2392 2844006445 2844002411 Bacteria 7168230
2393 2844014697 2844009547 Bacteria 6728125
2394 2844110401 2844104063 Bacteria 6440972
2395 2844167327 2844163670 Bacteria 7266046
2396 2844459421 2844454524 Bacteria 7952546
2397 2844536426 2844533157 Bacteria 7517899
2398 2846956091 2846952575 Bacteria 6587527
2399 2847418879 2847417321 Bacteria 6913799
2400 2847676302 2847670302 Bacteria 6165597
2401 2847692954 2847686936 Bacteria 6278406
2402 2848861723 2848858292 Bacteria 7391279
2403 2848993914 2848992105 Bacteria 6810864
2404 2849285039 2849281842 Bacteria 6065644
2405 2849565090 2849560528 Bacteria 5393480
2406 2849575586 2849573788 Bacteria 5421256
2407 2850081928 2850079185 Bacteria 6848280
2408 2851155984 2851153111 Bacteria 5542585
2409 2851187039 2851182111 Bacteria 6047226
2410 2851252063 2851246043 Bacteria 6439203
2411 2852389665 2852387548 Bacteria 8025568
2412 2852625732 2852623160 Bacteria 4376875
2413 2852628945 2852627209 Bacteria 5896285
2414 2854681912 2854681122 Bacteria 4548679
2415 2854899236 2854896431 Bacteria 5869725
2416 2854911918 2854911287 Bacteria 5582813
2417 2854918737 2854916844 Bacteria 5725939
2418 2855825571 2855825444 Bacteria 6785811
2419 2855840948 2855839649 Bacteria 7135830
2420 2855876549 2855872281 Bacteria 6964271
2421 2856316086 2856314179 Bacteria 6477897
2422 2856325851 2856320880 Bacteria 7263508
2423 2856328971 2856328259 Bacteria 6528202
2424 2856340031 2856334872 Bacteria 7037011
2425 2856343703 2856342000 Bacteria 7176905
2426 2856351930 2856349417 Bacteria 6230045
2427 2856363663 2856356410 Bacteria 6297484
2428 2856368829 2856364286 Bacteria 6939991
2429 2857350200 2857349434 Bacteria 7926032
2430 2857368571 2857367948 Bacteria 6965560
2431 2857507550 2857504554 Bacteria 5369913
2432 2857513792 2857509624 Bacteria 7472071
2433 2857518458 2857516855 Bacteria 7787325
2434 2857534346 2857531043 Bacteria 6754041
2435 2857618081 2857613821 Bacteria 4917088
2436 2857623014 2857618242 Bacteria 5635925
2437 2857631611 2857627736 Bacteria 5625397
2438 2858801487 2858800743 Bacteria 6603254
2439 2861694432 2861691609 Bacteria 5628931
2440 2869165270 2869162929 Bacteria 6399702
2441 2869174784 2869169390 Bacteria 6659796
2442 2869247159 2869242130 Bacteria 6609239
2443 2869253174 2869249662 Bacteria 6868783
2444 2869262528 2869256925 Bacteria 6981691
2445 2869274749 2869271264 Bacteria 6908218
2446 2869278631 2869278585 Bacteria 7077053
2447 2869291324 2869285874 Bacteria 6901219
2448 2871433604 2871429161 Bacteria 6547891
2449 2871438320 2871435913 Bacteria 6880295
2450 2871458153 2871451962 Bacteria 7336357
2451 2871466354 2871459585 Bacteria 6866887
2452 2871475314 2871474448 Bacteria 6806570
2453 2871495777 2871488783 Bacteria 6929816
2454 2871500741 2871495908 Bacteria 6935695
2455 2874111769 2874109183 Bacteria 6517025
2456 2874117792 2874116593 Bacteria 6674494
2457 2874125990 2874123672 Bacteria 7238285
2458 2874132045 2874131515 Bacteria 6820270
2459 2874145217 2874139085 Bacteria 7021506
2460 2874153205 2874146452 Bacteria 7533118
2461 2874160470 2874155637 Bacteria 6724144
2462 2874167271 2874162495 Bacteria 6174670
2463 2874176207 2874168670 Bacteria 8062617
2464 2874616306 2874612657 Bacteria 8252029
2465 2876365446 2876363079 Bacteria 6544991
2466 2876386074 2876386047 Bacteria 6698674
2467 2876394978 2876392853 Bacteria 6660880
2468 2876405868 2876399893 Bacteria 6927900
2469 2876407650 2876406927 Bacteria 6191900
2470 2876419496 2876413966 Bacteria 6831344
2471 2876426503 2876420981 Bacteria 6687741
2472 2878040354 2878035449 Bacteria 6555736
2473 2878743414 2878738818 Bacteria 7136951
2474 2878751215 2878745973 Bacteria 6867388
2475 2878753424 2878753008 Bacteria 6922523
2476 2878764830 2878760144 Bacteria 6823465
2477 2878771931 2878767105 Bacteria 6898628
2478 2878774799 2878774303 Bacteria 6108671
2479 2878786312 2878781027 Bacteria 6834456
2480 2878795666 2878788777 Bacteria 6567085
2481 2881152856 2881147464 Bacteria 7779814
2482 2881156353 2881155292 Bacteria 6461656
2483 2881168317 2881161766 Bacteria 7127907
2484 2881248175 2881247448 Bacteria 3717788
2485 2881362578 2881359912 Bacteria 4935907
2486 2881851156 2881845957 Bacteria 6611900
2487 2881857161 2881853255 Bacteria 6698367
2488 2881867370 2881861095 Bacteria 7128710
2489 2882458260 2882456835 Bacteria 6863978
2490 2882633850 2882632389 Bacteria 8154593
2491 2882915626 2882912400 Bacteria 6801539
2492 2883070559 2883068021 Bacteria 6192739
2493 2883294542 2883291878 Bacteria 5894118
2494 2883356949 2883354860 Bacteria 5865246
2495 2883580054 2883577096 Bacteria 4709178
2496 2884300358 2884298095 Bacteria 3823049
2497 2884635987 2884634485 Bacteria 3928637
2498 2884797370 2884791551 Bacteria 8511252
2499 2884935743 2884933994 Bacteria 4535041
2500 2884960867 2884960567 Bacteria 5437054
2501 2885310314 2885305155 Bacteria 7348390
2502 2885317123 2885312484 Bacteria 6415165
2503 2885347900 2885342637 Bacteria 7011821
2504 2885355087 2885350715 Bacteria 6787678
2505 2888340147 2888337043 Bacteria 6629336
2506 2888347472 2888343758 Bacteria 6611049
2507 2888356558 2888350351 Bacteria 7372807
2508 2888383547 2888378607 Bacteria 9652610
2509 2889011463 2889010040 Bacteria 6749192
2510 2889016806 2889016732 Bacteria 6700763
2511 2889312325 2889306138 Bacteria 6358934
2512 2889793549 2889790730 Bacteria 5689708
2513 2889918686 2889914905 Bacteria 5702301
2514 2890737751 2890737413 Bacteria 4269751
2515 2891051524 2891048133 Bacteria 4447501
2516 2891093096 2891088606 Bacteria 4762464
2517 2891374134 2891373044 Bacteria 5202277
2518 2894235758 2894232714 Bacteria 8834183
2519 2894654271 2894652903 Bacteria 4587256
2520 2894772594 2894772417 Bacteria 5305674
2521 2894818334 2894817345 Bacteria 4892941
2522 2896086067 2896085136 Bacteria 6129793
2523 2896115379 2896109856 Bacteria 7140722
2524 2896255580 2896253425 Bacteria 3418029
2525 2896321417 2896317667 Bacteria 4606601
2526 2896346103 2896344016 Bacteria 3811746
2527 2896390657 2896384573 Bacteria 7700774
2528 2897809204 2897803580 Bacteria 7000062
2529 2898331649 2898329390 Bacteria 5168154
2530 2898713699 2898713307 Bacteria 4110805
2531 2898796317 2898795034 Bacteria 4294459
2532 2899796312 2899792073 Bacteria 4926588
2533 2899808874 2899803654 Bacteria 5577784
2534 2899849480 2899845264 Bacteria 5672268
2535 2902049799 2902048731 Bacteria 4976191
2536 2902333624 2902330777 Bacteria 6395352
2537 2903455612 2903448605 Bacteria 7357801
2538 2903495279 2903492973 Bacteria 13473544
2539 2903501713 2903492973 Bacteria 13473544
2540 2903517958 2903513507 Bacteria 6344008
2541 2903522802 2903521522 Bacteria 6525694
2542 2903532992 2903528002 Bacteria 6586099
2543 2903545554 2903540706 Bacteria 7062119
2544 2903899529 2903895155 Bacteria 5258610
2545 2904423853 2904419702 Bacteria 5166287
2546 2904448856 2904445276 Bacteria 5310396
2547 2904470801 2904467357 Bacteria 8057758
2548 2904560500 2904555929 Bacteria 5218588
2549 2904583197 2904578770 Bacteria 5302906
2550 2904661609 2904659560 Bacteria 6685615
2551 2904783192 2904780799 Bacteria 5840761
2552 2906313156 2906308376 Bacteria 6841989
2553 2906325867 2906321335 Bacteria 6579571
2554 2906335298 2906328253 Bacteria 6585166
2555 2906365859 2906363423 Bacteria 6856682
2556 2906373940 2906370794 Bacteria 6881062
2557 2906385637 2906378014 Bacteria 6911440
2558 2906402993 2906401398 Bacteria 6693206
2559 2906412649 2906408224 Bacteria 6162342
2560 2906416223 2906414383 Bacteria 6580790
2561 2906433171 2906427513 Bacteria 6375796
2562 2906644735 2906643746 Bacteria 8722424
2563 2909045914 2909042592 Bacteria 6499737
2564 2909401593 2909399089 Bacteria 3922598
2565 2911139025 2911138879 Bacteria 5811561
2566 2913301074 2913295892 Bacteria 6333755
2567 2913310288 2913308742 Bacteria 5350706
2568 2915651829 2915650412 Bacteria 4288180
2569 2915985310 2915980308 Bacteria 6624279
2570 2915992803 2915986958 Bacteria 6739310
2571 2915994707 2915993759 Bacteria 7016183
2572 2916012110 2916007675 Bacteria 6898660
2573 2916016795 2916014648 Bacteria 6946486
2574 2916025100 2916021584 Bacteria 6854472
2575 2916029049 2916028427 Bacteria 6748433
2576 2916041705 2916035215 Bacteria 6755766
2577 2916044108 2916041962 Bacteria 6820487
2578 2916054145 2916048683 Bacteria 6543552
2579 2916061663 2916055098 Bacteria 6758838
2580 2916062347 2916061851 Bacteria 6737736
2581 2916077596 2916076590 Bacteria 6596108
2582 2917699831 2917699015 Bacteria 7043791
2583 2919107860 2919100787 Bacteria 7710546
2584 2919115317 2919114240 Bacteria 5700270
2585 2919123846 2919119836 Bacteria 5208557
2586 2919167833 2919166419 Bacteria 4952238
2587 2919175103 2919171160 Bacteria 6499771
2588 2919180800 2919177583 Bacteria 5641607
2589 2919188999 2919186247 Bacteria 6244071
2590 2919191586 2919191525 Bacteria 5765973
2591 2919409827 2919408235 Bacteria 6149349
2592 2919439867 2919437846 Bacteria 6199444
2593 2919682494 2919679072 Bacteria 4629602
2594 2919687825 2919683626 Bacteria 5534354
2595 2919696612 2919692658 Bacteria 5943958
2596 2920765949 2920760137 Bacteria 7427611
2597 2920824479 2920822456 Bacteria 6897201
2598 2921213544 2921208531 Bacteria 6745326
2599 2921239070 2921237296 Bacteria 6876710
2600 2921250376 2921244191 Bacteria 6568419
2601 2921253957 2921250672 Bacteria 6677771
2602 2921257408 2921257292 Bacteria 6808382
2603 2921264632 2921263974 Bacteria 6864552
2604 2921283061 2921282425 Bacteria 6826397
2605 2921293249 2921289301 Bacteria 7316391
2606 2921299250 2921296804 Bacteria 7176999
2607 2922157455 2922151315 Bacteria 6902399
2608 2922177100 2922172374 Bacteria 6167644
2609 2922187723 2922185730 Bacteria 7113964
2610 2922395843 2922393267 Bacteria 8285685
2611 2923560820 2923556063 Bacteria 6793593
2612 2924149632 2924144063 Bacteria 6883928
2613 2924156010 2924150972 Bacteria 7169444
2614 2924159022 2924158325 Bacteria 7188855
2615 2924167787 2924165586 Bacteria 7260590
2616 2924175475 2924172951 Bacteria 6749356
2617 2924182206 2924179722 Bacteria 6843264
2618 2924187568 2924186466 Bacteria 6876637
2619 2924198916 2924193448 Bacteria 6955718
2620 2924205384 2924200457 Bacteria 6757188
2621 2924213835 2924207177 Bacteria 6917007
2622 2924217111 2924214083 Bacteria 7080103
2623 2924225453 2924221636 Bacteria 7113495
2624 2924234329 2924228884 Bacteria 6633132
2625 2924723819 2924718760 Bacteria 6331356
2626 2924729863 2924726620 Bacteria 6271473
2627 2924736244 2924733363 Bacteria 7574837
2628 2924746296 2924741084 Bacteria 6661321
2629 2924768975 2924762789 Bacteria 6561353
2630 2924781226 2924776078 Bacteria 7492003
2631 2924789661 2924784321 Bacteria 7416538
2632 2926756363 2926754445 Bacteria 5964435
2633 2926760585 2926760298 Bacteria 5505990
2634 2928081593 2928078545 Bacteria 6534839
2635 2928125907 2928125067 Bacteria 5937560
2636 2928150378 2928147474 Bacteria 6512076
2637 2928523237 2928521798 Bacteria 4960112
2638 2928972629 2928972540 Bacteria 3058286
2639 2929140305 2929138655 Bacteria 5810547
2640 2929154261 2929150217 Bacteria 5462483
2641 2929183517 2929177148 Bacteria 7883697
2642 2929203153 2929199973 Bacteria 7260745
2643 2929239581 2929239360 Bacteria 7745570
2644 2929921217 2929921140 Bacteria 8649150
2645 2932085203 2932082852 Bacteria 6563563
2646 2933008237 2933006813 Bacteria 4912075
2647 2933013058 2933011516 Bacteria 5439334
2648 2933018292 2933016740 Bacteria 6355406
2649 2933576545 2933570622 Bacteria 7023390
2650 2933586781 2933586486 Bacteria 7667493
2651 2933597743 2933594066 Bacteria 5594265
2652 2933602272 2933599457 Bacteria 5858799
2653 2935899091 2935894831 Bacteria 6620579
2654 2935904483 2935901341 Bacteria 7341747
2655 2936372996 2936367885 Bacteria 7324495
2656 2936381147 2936375103 Bacteria 6652732
2657 2936386040 2936381700 Bacteria 7006523
2658 2936997981 2936996657 Bacteria 6298727
2659 2937007402 2937002841 Bacteria 6934057
2660 2937012618 2937009748 Bacteria 6746052
2661 2937019756 2937016420 Bacteria 6782579
2662 2937029313 2937023124 Bacteria 6815156
2663 2937032667 2937029754 Bacteria 6424026
2664 2937038467 2937036028 Bacteria 6846469
2665 2937049676 2937042894 Bacteria 6741576
2666 2937055326 2937049772 Bacteria 6757901
2667 2937057749 2937056579 Bacteria 7107896
2668 2937069504 2937063883 Bacteria 7199456
2669 2937076508 2937071275 Bacteria 6984483
2670 2937082607 2937078374 Bacteria 6610289
2671 2937098363 2937091812 Bacteria 6979387
2672 2937100158 2937098957 Bacteria 7249374
2673 2937107401 2937106411 Bacteria 6947143
2674 2937118375 2937113482 Bacteria 6505872
2675 2937122388 2937119839 Bacteria 6597547
2676 2937130373 2937126314 Bacteria 6771275
2677 2937820693 2937813078 Bacteria 7783518
2678 2937827294 2937822353 Bacteria 7290551
2679 2937837775 2937836603 Bacteria 6811263
2680 2937845916 2937843397 Bacteria 5256375
2681 2937849129 2937848649 Bacteria 6983481
2682 2937866856 2937861824 Bacteria 6660327
2683 2937874344 2937868953 Bacteria 6639878
2684 2937878987 2937877337 Bacteria 7246526
2685 2937892885 2937891427 Bacteria 6357007
2686 2937975267 2937972304 Bacteria 7532020
2687 2937999404 2937994558 Bacteria 7036190
2688 2938020532 2938014810 Bacteria 6700592
2689 2939666846 2939664404 Bacteria 6364494
2690 2941488581 2941485952 Bacteria 3591484
2691 2941505003 2941499720 Bacteria 7599444
2692 2945979480 2945977869 Bacteria 7777518
2693 2946002819 2945997725 Bacteria 6404843
2694 2946014651 2946013367 Bacteria 7766675
2695 2954015507 2954011201 Bacteria 4762601
2696 2954019691 2954016120 Bacteria 6446024
2697 2957378677 2957375807 Bacteria 6425588
2698 2957386402 2957382221 Bacteria 6737050
2699 2957389800 2957388812 Bacteria 6778072
2700 2957399941 2957395598 Bacteria 6822399
2701 2957406786 2957402308 Bacteria 6741770
2702 2957410179 2957408893 Bacteria 6558585
2703 2957420249 2957415311 Bacteria 6991633
2704 2957424908 2957422303 Bacteria 7172205
2705 2957433074 2957430029 Bacteria 7022557
2706 2957441071 2957437181 Bacteria 6568994
2707 2957445492 2957443900 Bacteria 6869977
2708 2957453853 2957450854 Bacteria 6765715
2709 2957459776 2957457609 Bacteria 6967680
2710 2957465769 2957464669 Bacteria 6568877
2711 2957474403 2957471148 Bacteria 6797643
2712 2957478581 2957478035 Bacteria 6756658
2713 2957490055 2957484790 Bacteria 6703082
2714 2957494814 2957491536 Bacteria 6695180
2715 2957502549 2957498199 Bacteria 7126688
2716 2957511717 2957505466 Bacteria 7253085
2717 2958034747 2958034702 Bacteria 6989922
2718 2958043125 2958041894 Bacteria 13082850
2719 2958066997 2958064165 Bacteria 7158582
2720 2958077514 2958071322 Bacteria 6815895
2721 2958086161 2958084443 Bacteria 7312792
2722 2958106752 2958100919 Bacteria 6800575
2723 2958112119 2958108152 Bacteria 6681128
2724 2958122259 2958115193 Bacteria 6923548
2725 2958135724 2958130278 Bacteria 6897202
2726 2958160341 2958158011 Bacteria 6058449
2727 2958169878 2958165035 Bacteria 6906348
2728 2958173157 2958172287 Bacteria 6716688
2729 2958185215 2958179912 Bacteria 6874908
2730 2958461648 2958458903 Bacteria 5301041
2731 2958512909 2958512119 Bacteria 4528530
2732 2960588898 2960584000 Bacteria 6864594
2733 2960596249 2960591022 Bacteria 6622873
2734 2960600988 2960597568 Bacteria 6550735
2735 2960605332 2960603979 Bacteria 6898737
2736 2960616496 2960610863 Bacteria 6691244
2737 2960618846 2960617483 Bacteria 6727748
2738 2960629642 2960624210 Bacteria 6875384
2739 2960632680 2960631154 Bacteria 6732508
2740 2960645163 2960637947 Bacteria 7296468
2741 2960648560 2960645483 Bacteria 7211087
2742 2960655236 2960652885 Bacteria 7083688
2743 2960664184 2960660292 Bacteria 7041660
2744 2960669562 2960667422 Bacteria 6763020
2745 2960679530 2960674078 Bacteria 6609048
2746 2960686941 2960680706 Bacteria 6624464
2747 2960688793 2960687367 Bacteria 6535474
2748 2960700609 2960693952 Bacteria 6749742
2749 2961083482 2961077736 Bacteria 7079850
2750 2961116762 2961114664 Bacteria 6680456
2751 2961132805 2961127735 Bacteria 7196641
2752 2961137638 2961136820 Bacteria 6775228
2753 2961168338 2961163497 Bacteria 6901077
2754 2961177868 2961170736 Bacteria 7072258
2755 2963648343 2963644680 Bacteria 6530403
2756 2964614063 2964607997 Bacteria 7101408
2757 2964616119 2964615318 Bacteria 6809089
2758 2964627559 2964621998 Bacteria 6834995
2759 2964632129 2964628898 Bacteria 7083044
2760 2964639276 2964636051 Bacteria 7091832
2761 2964648858 2964643177 Bacteria 6820887
2762 2964652119 2964649959 Bacteria 6675118
2763 2964665064 2964663802 Bacteria 7019362
2764 2964677342 2964670856 Bacteria 6851364
2765 2964682392 2964678106 Bacteria 6792020
2766 2964686053 2964685014 Bacteria 6839111
2767 2964694664 2964691889 Bacteria 6802758
2768 2964704117 2964698721 Bacteria 6765331
2769 2964708986 2964705432 Bacteria 7114648
2770 2964716173 2964712639 Bacteria 6695970
2771 2965023157 2965018300 Bacteria 6883036
2772 2965029520 2965025482 Bacteria 6532201
2773 2965037535 2965032056 Bacteria 6887443
2774 2965065583 2965062239 Bacteria 7412989
2775 2965095803 2965089291 Bacteria 6866420
2776 2967667108 2967664464 Bacteria 6948836
2777 2967672945 2967671571 Bacteria 7021409
2778 2967683866 2967678726 Bacteria 7264382
2779 2967687259 2967686174 Bacteria 6678622
2780 2967693543 2967693043 Bacteria 6804451
2781 2967706068 2967699805 Bacteria 6854538
2782 2967711674 2967706974 Bacteria 7186053
2783 2967715681 2967714385 Bacteria 7000047
2784 2967726824 2967721400 Bacteria 7073753
2785 2967734386 2967728569 Bacteria 6641507
2786 2967736482 2967735183 Bacteria 6827012
2787 2967746923 2967742019 Bacteria 6794534
2788 2967749994 2967748971 Bacteria 6733771
2789 2967761046 2967755722 Bacteria 6814706
2790 2967763567 2967762386 Bacteria 6923502
2791 2967770647 2967769361 Bacteria 6587838
2792 2967780829 2967775926 Bacteria 6738189
2793 2968003135 2967996073 Bacteria 6787468
2794 2968003961 2968003550 Bacteria 6929263
2795 2968017845 2968016561 Bacteria 7022047
2796 2968084856 2968083720 Bacteria 7351627
2797 2968091798 2968091066 Bacteria 6052692
2798 2968103157 2968097103 Bacteria 6107094
2799 2968112669 2968110612 Bacteria 6814636
2800 2968123098 2968117919 Bacteria 6536078
2801 2968129860 2968128360 Bacteria 6270294
2802 2968176738 2968171901 Bacteria 6894245
2803 2970022498 2970019648 Bacteria 7072033
2804 2970029282 2970026789 Bacteria 6785236
2805 2970039668 2970033650 Bacteria 7118744
2806 2970041856 2970040964 Bacteria 6731123
2807 2970061331 2970054988 Bacteria 6611507
2808 2970062472 2970061556 Bacteria 7099761
2809 2970074707 2970068827 Bacteria 7123112
2810 2970077359 2970076120 Bacteria 6697332
2811 2970085202 2970082768 Bacteria 6183754
2812 2970092221 2970088815 Bacteria 6933825
2813 2970102370 2970095765 Bacteria 6936963
2814 2970104219 2970102677 Bacteria 6812532
2815 2970113419 2970109326 Bacteria 6863976
2816 2970120133 2970116247 Bacteria 6501857
2817 2970124619 2970122695 Bacteria 6625855
2818 2970130242 2970129317 Bacteria 6806560
2819 2970138493 2970136068 Bacteria 7207982
2820 2970148617 2970143518 Bacteria 6446480
2821 2970153180 2970149975 Bacteria 6779706
2822 2970170475 2970164137 Bacteria 6861252
2823 2970172143 2970170962 Bacteria 6876229
2824 2970181593 2970177841 Bacteria 6768001
2825 2970185042 2970184632 Bacteria 7054431
2826 2970193890 2970191845 Bacteria 7032787
2827 2970471980 2970469710 Bacteria 6969209
2828 2970495828 2970489779 Bacteria 6517260
2829 2970510544 2970503327 Bacteria 7099517
2830 2970512676 2970510686 Bacteria 7006402
2831 2970531719 2970524798 Bacteria 6840927
2832 2970544285 2970540015 Bacteria 6977556
2833 2970550042 2970547951 Bacteria 6931819
2834 2970559677 2970554993 Bacteria 6814252
2835 2970593227 2970593180 Bacteria 7073582
2836 2970621106 2970619444 Bacteria 6986144
2837 2970631146 2970627176 Bacteria 6680862
2838 2977235558 2977232053 Bacteria 5485925
2839 2977242408 2977240413 Bacteria 3191065
2840 2977271081 2977268062 Bacteria 5243061
2841 2977521149 2977516862 Bacteria 6940108
2842 2977526770 2977523885 Bacteria 6960446
2843 2977535733 2977530762 Bacteria 6951399
2844 2977541748 2977537788 Bacteria 6929320
2845 2977550475 2977544691 Bacteria 6875412
2846 2977554457 2977551784 Bacteria 7125765
2847 2977562599 2977558990 Bacteria 6863948
2848 2977571114 2977565890 Bacteria 6901543
2849 2977577351 2977572785 Bacteria 6763888
2850 2977583661 2977579622 Bacteria 6772100
2851 2977822636 2977821940 Bacteria 6906439
2852 2977833935 2977828996 Bacteria 7007971
2853 2977848991 2977843712 Bacteria 6753583
2854 2977858088 2977851361 Bacteria 6694324
2855 2977872518 2977864932 Bacteria 7534097
2856 2977875405 2977872689 Bacteria 7270173
2857 2977923092 2977922695 Bacteria 6956781
2858 2977941411 2977935797 Bacteria 6252826
2859 2977948240 2977942078 Bacteria 7570577
2860 2977952629 2977950692 Bacteria 6893264
2861 2977958995 2977957713 Bacteria 6877875
2862 2977974045 2977971508 Bacteria 7472917
2863 2977989092 2977986579 Bacteria 6581278
2864 2978974283 2978969890 Bacteria 5400756
2865 2979094135 2979089926 Bacteria 5670289
2866 2979098484 2979095461 Bacteria 5669583
2867 2979106101 2979100975 Bacteria 5423623
2868 2979713352 2979710463 Bacteria 6785254
2869 2979743202 2979742915 Bacteria 7301278
2870 2979773499 2979772303 Bacteria 6618277
2871 2979780314 2979779861 Bacteria 6219781
2872 2979815418 2979808191 Bacteria 7179355
2873 2984512109 2984509177 Bacteria 5274802
2874 2984521529 2984518228 Bacteria 5277463
2875 2984540823 2984537506 Bacteria 5277481
2876 2984589625 2984587000 Bacteria 5263363
2877 2984603091 2984601300 Bacteria 5455244
2878 2987637388 2987636660 Bacteria 8088555
2879 2987648693 2987645492 Bacteria 6117018
2880 2987653989 2987652177 Bacteria 6969023
2881 2987664352 2987659509 Bacteria 6966464
2882 2987670653 2987666974 Bacteria 6509233
2883 2987675126 2987673487 Bacteria 6884027
2884 2989353118 2989349275 Bacteria 6349068
2885 2989776108 2989771324 Bacteria 5605128
2886 2989778808 2989776772 Bacteria 4843317
2887 2995393614 2995392953 Bacteria 4539380
2888 2996310997 2996310559 Bacteria 6357320
2889 2996337830 2996336353 Bacteria 5511628
2890 2996344988 2996341866 Bacteria 6643098
2891 2996350913 2996348954 Bacteria 7239054
2892 2996392572 2996386984 Bacteria 6978667
2893 2996889922 2996887358 Bacteria 5795980
2894 2996898369 2996893221 Bacteria 5823108
2895 3000018721 3000017691 Bacteria 3772574
2896 3000138482 3000135777 Bacteria 6891109
2897 3000408419 3000405567 Bacteria 3779330
2898 3002143912 3002141150 Bacteria 5254435
2899 3003234959 3003233435 Bacteria 4458031
2900 3003668023 3003665799 Bacteria 7279786
2901 3003933472 3003930520 Bacteria 5667563
2902 3004169593 3004167301 Bacteria 8330599
2903 3004193407 3004188549 Bacteria 6952365
2904 3004197937 3004195979 Bacteria 6776956
2905 3004206215 3004203850 Bacteria 7307914
2906 3004211678 3004211236 Bacteria 7417683
2907 3004218925 3004218560 Bacteria 7421728
2908 3004238888 3004232784 Bacteria 6662140
2909 3004242637 3004239961 Bacteria 6892290
2910 3004275206 3004268573 Bacteria 7043476
2911 3004277611 3004275668 Bacteria 7114440
2912 3004340996 3004334049 Bacteria 8449246
2913 3005409582 3005409236 Bacteria 7188837
2914 3005420309 3005416602 Bacteria 7064308
2915 3005447307 3005445848 Bacteria 6906074
2916 3005454231 3005452660 Bacteria 5889319
2917 3005489649 3005483717 Bacteria 7877331
2918 3005590018 3005587118 Bacteria 7794411
2919 3005721849 3005718088 Bacteria 8283608
2920 637073928 637000159 Bacteria 7596297
2921 639648279 639633055 Bacteria 7751309
2922 641336273 641228493 Bacteria 3999591
2923 641642718 641522639 Bacteria 7737025
2924 643390070 643348555 Bacteria 3914947
2925 643599933 643348564 Bacteria 8839022
2926 643825760 643692032 Bacteria 6891900
2927 648738945 648276728 Bacteria 6968865
2928 649873923 649633066 Bacteria 6690028
2929 650739937 650716007 Bacteria 5573770
2930 8002062704 8002060224 Bacteria 4026565
2931 8002286118 8002285264 Bacteria 6717907
2932 8003152508 8003151029 Bacteria 8187759
2933 8003570985 8003570095 Bacteria 5747666
2934 8003993441 8003992118 Bacteria 7266902
2935 8004000702 8003999396 Bacteria 7063185
2936 8004303250 8004300914 Bacteria 6132239
2937 8004314616 8004312739 Bacteria 7444653
2938 8004363785 8004361976 Bacteria 6858373
2939 8004374996 8004374579 Bacteria 6898112
2940 8004394120 8004387939 Bacteria 7049250
2941 8004445771 8004445564 Bacteria 6322258
2942 8004634069 8004633249 Bacteria 6723080
2943 8004646683 8004640170 Bacteria 6723001
2944 8004713693 8004703790 Bacteria 8006957
2945 8004719413 8004714634 Bacteria 6776161
2946 8004731746 8004727605 Bacteria 6643904
2947 8005248358 8005246636 Bacteria 4933972
2948 8005261642 8005258706 Bacteria 6184835
2949 8005280324 8005275841 Bacteria 6929066
2950 8005288392 8005282627 Bacteria 6675747
2951 8005294901 8005289223 Bacteria 6634003
2952 8005306933 8005301065 Bacteria 6614431
2953 8005314270 8005307578 Bacteria 7395396
2954 8005317260 8005314921 Bacteria 7072929
2955 8005324449 8005321885 Bacteria 5795980
2956 8005378926 8005376324 Bacteria 6590079
2957 8005388109 8005382845 Bacteria 6732062
2958 8005396934 8005395548 Bacteria 6806915
2959 8005434608 8005430974 Bacteria 6689030
2960 8005462651 8005460587 Bacteria 7157962
2961 8005486677 8005484373 Bacteria 6297373
2962 8005500015 8005497431 Bacteria 6477605
2963 8005544933 8005542996 Bacteria 7077758
2964 8005557993 8005556819 Bacteria 6908598
2965 8005569165 8005563573 Bacteria 7153261
2966 8005575552 8005570704 Bacteria 6957481
2967 8005621384 8005619151 Bacteria 7030230
2968 8005631329 8005626139 Bacteria 6534237
2969 8005646183 8005645114 Bacteria 6950293
2970 8005659376 8005658619 Bacteria 4500593
2971 8005671431 8005668836 Bacteria 6953162
2972 8005686311 8005682033 Bacteria 6726518
2973 8005694851 8005688590 Bacteria 6610080
2974 8005696029 8005695170 Bacteria 6912330
2975 8018129669 8018127388 Bacteria 7351159
2976 8018155429 8018150411 Bacteria 5549903
2977 8018168225 8018163183 Bacteria 7277977
2978 8018178000 8018176218 Bacteria 6896178
2979 8019601645 8019597564 Bacteria 10041141
2980 8019627549 8019619141 Bacteria 9218857
2981 8023681087 8023680758 Bacteria 7729763
2982 8024485880 8024479707 Bacteria 6954785
2983 8024492626 8024486573 Bacteria 6540512
2984 8024505342 8024501048 Bacteria 6427847
2985 8036738141 8036736890 Bacteria 2944828
2986 8045865380 8045864390 Bacteria 5043873
2987 8046772726 8046767195 Bacteria 7547379
2988 8049294650 8049293176 Bacteria 6128433
2989 8054002315 8054002106 Bacteria 7987183
2990 8054311125 8054307821 Bacteria 5212224
2991 8054462322 8054460903 Bacteria 4872905
2992 8054561556 8054558443 Bacteria 5204801
2993 8054568814 8054563764 Bacteria 5592885
2994 8055422576 8055419101 Bacteria 5289643
2995 8055435160 8055431914 Bacteria 4551896
2996 8055595571 8055592153 Bacteria 5961247
2997 8055621536 8055617313 Bacteria 7548464
2998 8055633172 8055632911 Bacteria 5283357
2999 8055915597 8055909800 Bacteria 7278581
3000 8056377176 8056375014 Bacteria 7006639
3001 8056388324 8056382006 Bacteria 6408074
3002 8056443993 8056440228 Bacteria 4946504
3003 8056877647 8056875544 Bacteria 4355797
3004 8057535349 8057529695 Bacteria 6306553
3005 8057578315 8057575449 Bacteria 7367519
3006 8057875352 8057874678 Bacteria 7494653
3007 SwRhRL2b_contig_1663468
3008 SwRhRL2b_contig_522317
3009 JGI24740J21852_10002792
3010 JGI24739J22299_10000436
3011 JGI24737J22298_10001296
3012 JGI24735J21928_10000017
3013 JGI24751J29686_10003345
3014 JGI25155J39150_1000011
3015 JGI25156J39149_1000030
3016 JGI25162J39368_1000008
3017 JGI25162J39368_1000596
3018 JGI25162J39368_1001595
3019 JGI25162J39368_1002599
3020 JGI25154J39366_1000002
3021 JGI25154J39366_1000289
3022 JGI25157J39369_1000010
3023 JGI25157J39369_1000136
3024 JGI25152J39213_1000345
3025 JGI25152J39213_1002282
3026 JGI25152J39213_1003413
3027 JGI25150J39212_1000011
3028 JGI25150J39212_1000137
3029 JGI25159J45721_1000029
3030 JGI25159J45721_1000368
3031 JGI25159J45721_1001807
3032 JGI25159J45721_1002381
3033 JGI25151J46595_10000033
3034 JGI25151J46595_10000221
3035 JGI25151J46595_10000300
3036 JGI25406J46586_10000467
3037 JGI25406J46586_10001590
3038 JGI25406J46586_10014259
3039 JGI25165J46597_1000087
3040 JGI25165J46597_1000139
3041 JGI25165J46597_1000658
3042 JGI25165J46597_1001769
3043 JGI25165J46597_1001805
3044 JGI25165J46597_1003550
3045 JGI25153J46596_10000052
3046 JGI25153J46596_10000148
3047 JGI25153J46596_10001493
3048 JGI25153J46596_10003972
3049 JGI25153J46596_10008367
3050 rootH1_10000450
3051 rootH2_10001503
3052 rootH2_10024240
3053 rootL2_10001124
3054 rootL2_10012151
3055 rootH1_10003667
3056 rootH1_10005217
3057 rootH1_10005219
3058 rootH1_10005386
3059 rootH1_10005865
3060 rootH1_10006071
3061 JGI25160J50197_1000004
3062 JGI25160J50197_1000011
3063 JGI25160J50197_1007676
3064 JGI25160J50197_1009700
3065 JGI25161J50226_1000003
3066 JGI25161J50226_1000152
3067 JGI25161J50226_1000180
3068 Ga0055542_1000775
3069 Ga0055526_1000454
3070 Ga0055526_1003639
3071 Ga0055526_1008941
3072 Ga0055526_1009079
3073 Ga0055536_1000016
3074 Ga0055536_1000287
3075 Ga0055536_1001173
3076 Ga0055528_1000128
3077 Ga0055528_1000862
3078 Ga0055528_1002605
3079 Ga0055530_10000896
3080 Ga0055530_10002157
3081 Ga0055540_1003866
3082 Ga0055531_10000014
3083 Ga0055531_10000058
3084 Ga0055531_10000667
3085 Ga0055531_10005305
3086 Ga0058692_1002103
3087 Ga0055543_1000001
3088 Ga0055543_1000097
3089 Ga0055543_1000255
3090 Ga0055543_1001277
3091 Ga0065165_1000018
3092 Ga0065165_1000049
3093 Ga0065165_1000185
3094 Ga0065165_1000258
3095 Ga0065165_1000667
3096 Ga0065714_10002205
3097 Ga0065714_10002764
3098 Ga0065714_10003429
3099 Ga0065704_10000703
3100 Ga0065704_10070133
3101 Ga0065704_10070225
3102 Ga0065704_10072414
3103 Ga0065715_10100275
3104 Ga0070658_10000236
3105 Ga0070658_10000565
3106 Ga0070658_10000893
3107 Ga0070658_10001887
3108 Ga0070658_10017314
3109 Ga0070676_10000133
3110 Ga0070676_10001210
3111 Ga0070676_10010902
3112 Ga0070683_100000356
3113 Ga0070670_100001069
3114 Ga0070670_100056639
3115 Ga0068869_100027880
3116 Ga0070666_10001123
3117 Ga0070680_100000555
3118 Ga0070680_100003300
3119 Ga0070680_100007469
3120 Ga0070680_100012337
3121 Ga0070680_100017121
3122 Ga0070680_100049331
3123 Ga0070682_100006568
3124 Ga0070682_100016402
3125 Ga0070682_100025133
3126 Ga0068868_100009669
3127 Ga0068868_100011355
3128 Ga0070660_100007015
3129 Ga0070660_100008118
3130 Ga0070660_100010259
3131 Ga0070689_100011666
3132 Ga0070691_10000336
3133 Ga0070691_10001047
3134 Ga0070661_100005059
3135 Ga0070692_10002489
3136 Ga0070668_100003081
3137 Ga0070668_100019514
3138 Ga0070669_100008200
3139 Ga0070669_100017834
3140 Ga0070675_100007173
3141 Ga0070671_100005575
3142 Ga0070671_100066045
3143 Ga0070674_100001299
3144 Ga0070674_100003617
3145 Ga0070674_100012974
3146 Ga0070674_100031662
3147 Ga0070674_100035938
3148 Ga0070673_100002145
3149 Ga0070673_100021316
3150 Ga0070688_100018548
3151 Ga0070659_100000094
3152 Ga0070659_100005816
3153 Ga0070659_100018027
3154 Ga0070659_100021309
3155 Ga0070659_100030076
3156 Ga0070667_100003052
3157 Ga0070667_100010337
3158 Ga0070709_10000046
3159 Ga0070709_10000439
3160 Ga0070709_10003395
3161 Ga0070714_100000364
3162 Ga0070714_100016008
3163 Ga0070713_100000003
3164 Ga0070713_100000236
3165 Ga0070711_100000064
3166 Ga0070711_100019691
3167 Ga0070705_100000220
3168 Ga0070705_100006889
3169 Ga0070705_100013402
3170 Ga0070700_100001090
3171 Ga0070700_100007596
3172 Ga0070694_100000670
3173 Ga0070694_100002481
3174 Ga0070694_100003885
3175 Ga0070694_100020057
3176 Ga0070708_100002927
3177 Ga0070708_100013776
3178 Ga0070708_100037645
3179 Ga0070663_100002118
3180 Ga0070678_100008273
3181 Ga0070662_100000003
3182 Ga0070662_100005503
3183 Ga0070662_100011018
3184 Ga0070681_10000001
3185 Ga0070681_10000486
3186 Ga0070681_10001680
3187 Ga0070681_10003095
3188 Ga0070681_10003922
3189 Ga0070681_10008137
3190 Ga0070681_10011609
3191 Ga0070681_10018719
3192 Ga0070681_10022794
3193 Ga0070681_10028845
3194 Ga0070681_10044695
3195 Ga0070681_10048166
3196 Ga0068867_100000624
3197 Ga0068867_100010519
3198 Ga0070706_100021386
3199 Ga0070706_100043544
3200 Ga0070707_100001529
3201 Ga0070707_100002641
3202 Ga0070707_100003141
3203 Ga0070707_100007839
3204 Ga0070707_100019849
3205 Ga0070707_100022687
3206 Ga0070707_100027125
3207 Ga0070698_100001624
3208 Ga0070698_100001984
3209 Ga0070698_100007258
3210 Ga0070698_100009066
3211 Ga0070698_100021234
3212 Ga0070698_100037793
3213 Ga0070699_100000998
3214 Ga0070699_100001841
3215 Ga0070699_100002193
3216 Ga0070699_100008369
3217 Ga0070699_100017920
3218 Ga0070699_100048558
3219 Ga0070679_100000096
3220 Ga0070679_100001044
3221 Ga0070679_100003574
3222 Ga0070679_100009019
3223 Ga0070679_100010444
3224 Ga0070679_100021714
3225 Ga0070679_100059968
3226 Ga0070679_100083236
3227 Ga0070684_100001070
3228 Ga0070697_100014630
3229 Ga0068853_100006484
3230 Ga0068853_100018883
3231 Ga0068853_100019285
3232 Ga0070672_100019459
3233 Ga0070672_100055086
3234 Ga0070695_100001100
3235 Ga0070695_100001787
3236 Ga0070695_100007052
3237 Ga0070695_100008369
3238 Ga0070696_100001400
3239 Ga0070696_100001483
3240 Ga0070696_100001728
3241 Ga0070696_100008171
3242 Ga0070696_100021087
3243 Ga0070693_100003495
3244 Ga0070693_100006109
3245 Ga0070665_100000008
3246 Ga0070665_100000212
3247 Ga0070665_100004001
3248 Ga0070665_100010246
3249 Ga0070665_100011564
3250 Ga0070665_100012139
3251 Ga0070665_100013761
3252 Ga0070665_100020182
3253 Ga0070665_100063075
3254 Ga0070704_100000433
3255 Ga0070704_100002024
3256 Ga0070704_100007785
3257 Ga0070704_100043869
3258 Ga0068855_100000010
3259 Ga0068855_100000109
3260 Ga0068855_100000329
3261 Ga0068855_100000406
3262 Ga0068855_100004552
3263 Ga0068855_100009640
3264 Ga0068855_100009709
3265 Ga0068855_100014582
3266 Ga0068855_100030380
3267 Ga0068855_100032225
3268 Ga0068855_100036925
3269 Ga0068855_100058200
3270 Ga0068855_100092907
3271 Ga0070664_100008260
3272 Ga0070664_100011221
3273 Ga0068857_100000666
3274 Ga0068857_100004345
3275 Ga0068857_100011157
3276 Ga0068857_100020120
3277 Ga0068857_100028795
3278 Ga0068856_100000036
3279 Ga0068856_100001113
3280 Ga0068856_100002129
3281 Ga0068856_100005235
3282 Ga0068856_100006102
3283 Ga0068856_100012641
3284 Ga0068856_100027191
3285 Ga0070702_100017369
3286 Ga0068852_100060330
3287 Ga0068859_100003480
3288 Ga0068859_100010680
3289 Ga0068859_100018383
3290 Ga0068859_100036337
3291 Ga0068864_100000472
3292 Ga0068864_100000705
3293 Ga0068861_100000975
3294 Ga0068861_100006015
3295 Ga0068863_100004848
3296 Ga0068863_100014948
3297 Ga0068858_100000098
3298 Ga0068858_100015424
3299 Ga0068860_100000059
3300 Ga0068860_100000583
3301 Ga0068860_100004744
3302 Ga0068860_100007317
3303 Ga0068860_100007646
3304 Ga0068860_100013563
3305 Ga0068860_100025603
3306 Ga0068860_100050353
3307 Ga0068862_100002044
3308 Ga0068862_100003140
3309 Ga0068862_100015567
3310 Ga0081455_10003041
3311 Ga0081455_10005147
3312 Ga0081455_10005435
3313 Ga0081455_10007330
3314 Ga0081455_10025694
3315 Ga0081538_10002367
3316 Ga0081540_1001919
3317 Ga0081539_10000030
3318 Ga0081539_10001207
3319 Ga0081539_10008581
3320 Ga0081539_10012887
3321 Ga0070717_10009533
3322 Ga0070717_10010135
3323 Ga0070717_10011987
3324 Ga0075365_10002781
3325 Ga0075365_10007994
3326 Ga0075365_10015412
3327 Ga0075368_10000570
3328 Ga0075368_10002583
3329 Ga0075364_10000043
3330 Ga0075364_10016211
3331 Ga0070716_100006801
3332 Ga0070712_100000031
3333 Ga0070712_100000248
3334 Ga0070712_100009197
3335 Ga0070712_100022976
3336 Ga0075367_10017275
3337 Ga0075369_10011000
3338 Ga0075366_10000026
3339 Ga0075366_10003487
3340 Ga0075366_10008377
3341 Ga0097621_100000004
3342 Ga0097621_100000205
3343 Ga0097621_100004540
3344 Ga0097621_100007006
3345 Ga0097621_100021472
3346 Ga0075370_10020141
3347 Ga0068871_100000159
3348 Ga0068871_100000162
3349 Ga0068871_100009633
3350 Ga0068871_100022142
3351 Ga0075428_100000633
3352 Ga0075428_100003545
3353 Ga0075428_100006657
3354 Ga0075428_100014015
3355 Ga0075430_100001414
3356 Ga0075430_100034830
3357 Ga0075430_100056105
3358 Ga0075431_100003737
3359 Ga0075431_100005571
3360 Ga0075431_100012801
3361 Ga0075431_100013457
3362 Ga0075431_100020742
3363 Ga0075431_100032278
3364 Ga0075434_100004162
3365 Ga0075434_100005907
3366 Ga0075434_100008538
3367 Ga0075434_100030731
3368 Ga0075434_100062219
3369 Ga0075429_100006546
3370 Ga0075429_100014989
3371 Ga0068865_100000075
3372 Ga0068865_100002203
3373 Ga0068865_100028501
3374 Ga0075436_100001425
3375 Ga0075436_100005029
3376 Ga0075436_100009569
3377 Ga0075436_100009612
3378 Ga0075436_100012404
3379 Ga0097620_100003480
3380 Ga0097620_100010683
3381 Ga0097620_100018383
3382 Ga0097620_100036337
3383 Ga0099824_1000378
3384 Ga0079104_1000022
3385 Ga0079104_1000108
3386 Ga0099826_10000091
3387 Ga0099826_10000322
3388 Ga0099826_10012587
3389 Ga0075435_100001974
3390 Ga0099794_10000080
3391 Ga0105244_10000099
3392 Ga0105240_10000005
3393 Ga0105240_10000176
3394 Ga0105240_10000189
3395 Ga0105240_10000231
3396 Ga0105240_10002181
3397 Ga0105240_10008492
3398 Ga0105240_10008796
3399 Ga0105240_10011563
3400 Ga0105240_10012030
3401 Ga0105240_10015516
3402 Ga0105240_10017464
3403 Ga0105240_10022519
3404 Ga0105240_10053787
3405 Ga0105240_10057880
3406 Ga0105240_10119455
3407 Ga0111539_10002036
3408 Ga0111539_10006433
3409 Ga0111539_10009980
3410 Ga0105245_10014119
3411 Ga0114129_10000088
3412 Ga0114129_10003252
3413 Ga0114129_10003306
3414 Ga0114129_10009496
3415 Ga0114129_10019621
3416 Ga0114129_10049982
3417 Ga0114129_10083838
3418 Ga0114129_10089597
3419 Ga0114129_10115113
3420 Ga0105243_10000003
3421 Ga0105243_10006875
3422 Ga0105243_10031070
3423 Ga0105241_10002920
3424 Ga0105241_10003766
3425 Ga0105241_10004614
3426 Ga0105241_10007817
3427 Ga0105242_10004738
3428 Ga0105242_10009599
3429 Ga0105248_10000001
3430 Ga0105248_10022963
3431 Ga0105248_10032351
3432 Ga0105248_10060257
3433 Ga0105248_10093710
3434 Ga0105237_10000082
3435 Ga0105237_10000221
3436 Ga0105237_10000402
3437 Ga0105237_10000620
3438 Ga0105237_10000773
3439 Ga0105237_10000808
3440 Ga0105237_10001293
3441 Ga0105237_10002622
3442 Ga0105237_10003033
3443 Ga0105237_10003784
3444 Ga0105237_10010022
3445 Ga0105237_10010500
3446 Ga0105237_10011710
3447 Ga0105237_10018206
3448 Ga0105237_10050424
3449 Ga0105237_10070821
3450 Ga0105238_10000588
3451 Ga0105238_10002426
3452 Ga0105238_10013213
3453 Ga0105249_10000580
3454 Ga0105249_10002037
3455 Ga0105249_10038522
3456 Ga0123341_1000049
3457 Ga0123342_1009349
3458 Ga0105239_10000014
3459 Ga0105239_10000045
3460 Ga0105239_10000068
3461 Ga0105239_10002348
3462 Ga0105239_10002485
3463 Ga0105239_10002598
3464 Ga0105239_10002839
3465 Ga0105239_10004008
3466 Ga0105239_10008015
3467 Ga0105239_10018891
3468 Ga0105239_10020539
3469 Ga0105239_10045948
3470 Ga0105239_10047140
3471 Ga0105239_10098691
3472 Ga0157373_10000001
3473 Ga0157373_10009355
3474 Ga0157373_10010934
3475 Ga0157373_10013765
3476 Ga0157373_10030288
3477 Ga0157373_10035318
3478 Ga0157371_10000015
3479 Ga0157371_10000297
3480 Ga0157371_10000503
3481 Ga0157371_10000874
3482 Ga0157371_10001360
3483 Ga0157371_10001871
3484 Ga0157371_10004356
3485 Ga0157371_10005700
3486 Ga0157371_10007371
3487 Ga0157371_10007854
3488 Ga0157371_10013290
3489 Ga0157370_10000084
3490 Ga0157370_10000402
3491 Ga0157370_10000434
3492 Ga0157370_10001291
3493 Ga0157370_10001737
3494 Ga0157370_10002291
3495 Ga0157370_10003013
3496 Ga0157370_10014904
3497 Ga0157370_10026995
3498 Ga0157370_10036100
3499 Ga0157370_10098178
3500 Ga0157369_10000285
3501 Ga0157369_10001051
3502 Ga0157369_10002378
3503 Ga0157369_10007950
3504 Ga0171463_1008
3505 Ga0171462_1028
3506 Ga0157374_10000009
3507 Ga0157374_10002136
3508 Ga0157378_10004145
3509 Ga0157378_10009182
3510 Ga0157378_10016280
3511 Ga0157378_10017250
3512 Ga0163162_10000041
3513 Ga0163162_10000073
3514 Ga0163162_10000164
3515 Ga0163162_10000413
3516 Ga0163162_10001761
3517 Ga0163162_10005322
3518 Ga0163162_10007653
3519 Ga0163162_10057127
3520 Ga0163162_10065516
3521 Ga0157372_10000009
3522 Ga0157372_10002480
3523 Ga0157372_10007125
3524 Ga0157372_10010575
3525 Ga0157372_10011190
3526 Ga0157372_10015796
3527 Ga0157372_10018426
3528 Ga0157375_10016954
3529 Ga0157375_10030589
3530 Ga0157375_10045700
3531 Ga0163163_10000111
3532 Ga0163163_10001622
3533 Ga0163163_10006611
3534 Ga0163163_10058285
3535 Ga0157380_10000807
3536 Ga0157380_10015149
3537 Ga0157380_10019985
3538 Ga0182008_10000002
3539 Ga0182008_10000112
3540 Ga0182008_10000749
3541 Ga0157379_10005202
3542 Ga0157379_10009194
3543 Ga0157379_10011124
3544 Ga0157379_10013482
3545 Ga0157379_10013695
3546 Ga0157379_10020579
3547 Ga0157379_10054674
3548 Ga0157376_10002437
3549 Ga0157376_10003625
3550 Ga0157376_10007147
3551 Ga0157376_10021134
3552 Ga0157376_10022247
3553 Ga0157376_10026262
3554 Ga0182006_1000209
3555 Ga0182006_1000236
3556 Ga0182006_1000291
3557 Ga0182006_1002055
3558 Ga0182007_10000016
3559 Ga0182007_10000618
3560 Ga0182005_1000124
3561 Ga0183373_1011
3562 Ga0183363_1112
3563 Ga0163161_10000023
3564 Ga0163161_10001065
3565 Ga0163161_10001282
3566 Ga0163161_10002775
3567 Ga0163161_10003492
3568 Ga0163161_10005043
3569 Ga0163161_10018108
3570 Ga0214544_1000051
3571 Ga0214544_1000129
3572 Ga0214542_1000828
3573 Ga0214543_1000010
3574 Ga0214543_1000134
3575 Ga0213872_10001151
3576 Ga0213876_10000554
3577 Ga0213876_10000954
3578 Ga0213876_10001191
3579 Ga0213876_10001849
3580 Ga0213875_10000023
3581 Ga0213875_10000673
3582 Ga0213875_10000901
3583 Ga0213875_10001289
3584 Ga0213875_10003793
3585 Ga0213875_10003886
3586 Ga0213875_10010207
3587 Ga0228710_1000006
3588 Ga0209435_100022
3589 Ga0209672_103566
3590 Ga0207427_100109
3591 Ga0209437_100030
3592 Ga0209437_100096
3593 Ga0209437_100122
3594 Ga0209437_100160
3595 Ga0209258_100029
3596 Ga0207425_1000003
3597 Ga0207425_1000024
3598 Ga0209646_1000005
3599 Ga0209646_1000078
3600 Ga0209026_1000002
3601 Ga0209026_1000065
3602 Ga0209026_1000169
3603 Ga0209026_1000225
3604 Ga0209677_101260
3605 Ga0209148_1000072
3606 Ga0209148_1000230
3607 Ga0209148_1000564
3608 Ga0209759_1000055
3609 Ga0209759_1000238
3610 Ga0209129_1000076
3611 Ga0209129_1000127
3612 Ga0209129_1000133
3613 Ga0209129_1001307
3614 Ga0209129_1002184
3615 Ga0209233_1000013
3616 Ga0209233_1000027
3617 Ga0209233_1000029
3618 Ga0209233_1000168
3619 Ga0209233_1000269
3620 Ga0209233_1000317
3621 Ga0209455_1000133
3622 Ga0209455_1002330
3623 Ga0209673_1000049
3624 Ga0209673_1000068
3625 Ga0209673_1000139
3626 Ga0209673_1002394
3627 Ga0209673_1006996
3628 Ga0209130_1000012
3629 Ga0209130_1000029
3630 Ga0209130_1000097
3631 Ga0209130_1000697
3632 Ga0209130_1001730
3633 Ga0209130_1005472
3634 Ga0209675_1002373
3635 Ga0209676_1000061
3636 Ga0209676_1000106
3637 Ga0209676_1000128
3638 Ga0209676_1000151
3639 Ga0209676_1000438
3640 Ga0209676_1001376
3641 Ga0209025_1000007
3642 Ga0209025_1000014
3643 Ga0209025_1000033
3644 Ga0209025_1000050
3645 Ga0209025_1000094
3646 Ga0209025_1000225
3647 Ga0209025_1000358
3648 Ga0209025_1000563
3649 Ga0209025_1001703
3650 Ga0209025_1003210
3651 Ga0209025_1005486
3652 Ga0209025_1007933
3653 Ga0209564_1000017
3654 Ga0209564_1000187
3655 Ga0209564_1000275
3656 Ga0209564_1000331
3657 Ga0209564_1000986
3658 Ga0209564_1002989
3659 Ga0209564_1006002
3660 Ga0209758_1000036
3661 Ga0209758_1000083
3662 Ga0209758_1000114
3663 Ga0209758_1000505
3664 Ga0209758_1000775
3665 Ga0209758_1000805
3666 Ga0209758_1000927
3667 Ga0209758_1001745
3668 Ga0209758_1002972
3669 Ga0209758_1004666
3670 Ga0209758_1010537
3671 Ga0209050_1000174
3672 Ga0209050_1000272
3673 Ga0209050_1000516
3674 Ga0209050_1000796
3675 Ga0209050_1001101
3676 Ga0209050_1003098
3677 Ga0209256_1000055
3678 Ga0209256_1000146
3679 Ga0209256_1000218
3680 Ga0209256_1000299
3681 Ga0209256_1003182
3682 Ga0209256_1004524
3683 Ga0207426_1000003
3684 Ga0207426_1000010
3685 Ga0207426_1000026
3686 Ga0207426_1000074
3687 Ga0207426_1000113
3688 Ga0207426_1000233
3689 Ga0207426_1000290
3690 Ga0207426_1000661
3691 Ga0207426_1001867
3692 Ga0207426_1003540
3693 Ga0209051_1000125
3694 Ga0209051_1001225
3695 Ga0209051_1001494
3696 Ga0209051_1003443
3697 Ga0209051_1011303
3698 Ga0209257_1000004
3699 Ga0209257_1000007
3700 Ga0209257_1000199
3701 Ga0209257_1000413
3702 Ga0209257_1000448
3703 Ga0209257_1000569
3704 Ga0209257_1002998
3705 Ga0207697_10001867
3706 Ga0207655_1000239
3707 Ga0207653_10000231
3708 Ga0207653_10001404
3709 Ga0207642_10005925
3710 Ga0207647_10000698
3711 Ga0207647_10012113
3712 Ga0207699_10000044
3713 Ga0207699_10000114
3714 Ga0207699_10008359
3715 Ga0207699_10009848
3716 Ga0207645_10000014
3717 Ga0207645_10000093
3718 Ga0207645_10000865
3719 Ga0207645_10000909
3720 Ga0207645_10002020
3721 Ga0207645_10014224
3722 Ga0207705_10000092
3723 Ga0207705_10000111
3724 Ga0207705_10002319
3725 Ga0207705_10003960
3726 Ga0207705_10008381
3727 Ga0207705_10041113
3728 Ga0207684_10053018
3729 Ga0207654_10014049
3730 Ga0207707_10000001
3731 Ga0207707_10002120
3732 Ga0207707_10004556
3733 Ga0207707_10005965
3734 Ga0207707_10007247
3735 Ga0207707_10008261
3736 Ga0207707_10035633
3737 Ga0207707_10061935
3738 Ga0207695_10000003
3739 Ga0207695_10000011
3740 Ga0207695_10000051
3741 Ga0207695_10000056
3742 Ga0207695_10000081
3743 Ga0207695_10000102
3744 Ga0207695_10000117
3745 Ga0207695_10000984
3746 Ga0207695_10002069
3747 Ga0207695_10004268
3748 Ga0207695_10006064
3749 Ga0207695_10007128
3750 Ga0207695_10011358
3751 Ga0207695_10016689
3752 Ga0207695_10020605
3753 Ga0207695_10052952
3754 Ga0207695_10070414
3755 Ga0207671_10000189
3756 Ga0207671_10000253
3757 Ga0207671_10000701
3758 Ga0207671_10000899
3759 Ga0207671_10002346
3760 Ga0207671_10002696
3761 Ga0207671_10005379
3762 Ga0207671_10030838
3763 Ga0207693_10000964
3764 Ga0207693_10002143
3765 Ga0207693_10003609
3766 Ga0207693_10004795
3767 Ga0207693_10016584
3768 Ga0207663_10000043
3769 Ga0207663_10004463
3770 Ga0207663_10005578
3771 Ga0207663_10018721
3772 Ga0207660_10000542
3773 Ga0207660_10004115
3774 Ga0207660_10007077
3775 Ga0207660_10007123
3776 Ga0207657_10000568
3777 Ga0207657_10001148
3778 Ga0207657_10001874
3779 Ga0207657_10007527
3780 Ga0207657_10011118
3781 Ga0207657_10016022
3782 Ga0207657_10017189
3783 Ga0207657_10062563
3784 Ga0207649_10000073
3785 Ga0207649_10002800
3786 Ga0207649_10007894
3787 Ga0207649_10010294
3788 Ga0207649_10022624
3789 Ga0207652_10000051
3790 Ga0207652_10000154
3791 Ga0207652_10000201
3792 Ga0207652_10000892
3793 Ga0207652_10004044
3794 Ga0207652_10012985
3795 Ga0207646_10002318
3796 Ga0207646_10003009
3797 Ga0207646_10005879
3798 Ga0207646_10022052
3799 Ga0207646_10022138
3800 Ga0207646_10032034
3801 Ga0207681_10000591
3802 Ga0207694_10000011
3803 Ga0207694_10001957
3804 Ga0207694_10028447
3805 Ga0207694_10028660
3806 Ga0207650_10001142
3807 Ga0207650_10006695
3808 Ga0207700_10000010
3809 Ga0207700_10001717
3810 Ga0207700_10002856
3811 Ga0207700_10018532
3812 Ga0207700_10025014
3813 Ga0207644_10004434
3814 Ga0207690_10000536
3815 Ga0207690_10000856
3816 Ga0207690_10031508
3817 Ga0207706_10000009
3818 Ga0207706_10000025
3819 Ga0207706_10002035
3820 Ga0207706_10002555
3821 Ga0207706_10002738
3822 Ga0207706_10036553
3823 Ga0207686_10004076
3824 Ga0207709_10000008
3825 Ga0207669_10004280
3826 Ga0207669_10006828
3827 Ga0207669_10015250
3828 Ga0207704_10011401
3829 Ga0207665_10000511
3830 Ga0207665_10001958
3831 Ga0207665_10008095
3832 Ga0207691_10003945
3833 Ga0207691_10027453
3834 Ga0207691_10032800
3835 Ga0207691_10078422
3836 Ga0207711_10000002
3837 Ga0207711_10013186
3838 Ga0207711_10030147
3839 Ga0207689_10002271
3840 Ga0207689_10005278
3841 Ga0207689_10008419
3842 Ga0207689_10009549
3843 Ga0207661_10009778
3844 Ga0207661_10018620
3845 Ga0207679_10015337
3846 Ga0207667_10000093
3847 Ga0207667_10000154
3848 Ga0207667_10000171
3849 Ga0207667_10000324
3850 Ga0207667_10003468
3851 Ga0207667_10003974
3852 Ga0207667_10007060
3853 Ga0207667_10028072
3854 Ga0207667_10031656
3855 Ga0207667_10046274
3856 Ga0207667_10047564
3857 Ga0207651_10002339
3858 Ga0207712_10000596
3859 Ga0207712_10003696
3860 Ga0207712_10004390
3861 Ga0207712_10006367
3862 Ga0207668_10012248
3863 Ga0207640_10005289
3864 Ga0207658_10025482
3865 Ga0207703_10000086
3866 Ga0207703_10002958
3867 Ga0207639_10000307
3868 Ga0207639_10007716
3869 Ga0207639_10016229
3870 Ga0207639_10018779
3871 Ga0207678_10005373
3872 Ga0207678_10010652
3873 Ga0207708_10000305
3874 Ga0207708_10002051
3875 Ga0207708_10003269
3876 Ga0207702_10000013
3877 Ga0207702_10000088
3878 Ga0207702_10005456
3879 Ga0207702_10035561
3880 Ga0207702_10043500
3881 Ga0207641_10000012
3882 Ga0207641_10003961
3883 Ga0207641_10011049
3884 Ga0207648_10000269
3885 Ga0207648_10000963
3886 Ga0207648_10002818
3887 Ga0207648_10003702
3888 Ga0207648_10004739
3889 Ga0207648_10009820
3890 Ga0207648_10026033
3891 Ga0207648_10047527
3892 Ga0207676_10000445
3893 Ga0207676_10017994
3894 Ga0207676_10022739
3895 Ga0207674_10000450
3896 Ga0207674_10005103
3897 Ga0207674_10008341
3898 Ga0207674_10011187
3899 Ga0207674_10031601
3900 Ga0207674_10050104
3901 Ga0207675_100000599
3902 Ga0207675_100002519
3903 Ga0207683_10000572
3904 Ga0207683_10016727
3905 Ga0207698_10000733
3906 Ga0207698_10014592
3907 Ga0207698_10025538
3908 Ga0207698_10031398
3909 Ga0207698_10037709
3910 Ga0209281_1000036
3911 Ga0209281_1000047
3912 Ga0209281_1000208
3913 Ga0209281_1000268
3914 Ga0209389_1000041
3915 Ga0209389_1000174
3916 Ga0209371_1000021
3917 Ga0209371_1000229
3918 Ga0209589_1000621
3919 Ga0209489_100178
3920 Ga0209489_101570
3921 Ga0209489_116584
3922 Ga0209700_100010
3923 Ga0209282_1000251
3924 Ga0209282_1000462
3925 Ga0209282_1010352
3926 Ga0209588_1000242
3927 Ga0209813_10000405
3928 Ga0207428_10000059
3929 Ga0268266_10000016
3930 Ga0268266_10000177
3931 Ga0268266_10000474
3932 Ga0268266_10001386
3933 Ga0268266_10002680
3934 Ga0268266_10005907
3935 Ga0268266_10014879
3936 Ga0268266_10016036
3937 Ga0268266_10043497
3938 Ga0268265_10001955
3939 Ga0268265_10008320
3940 Ga0268265_10009229
3941 Ga0268264_10000015
3942 Ga0268264_10002904
3943 Ga0268264_10004404
3944 Ga0268264_10008069
3945 Ga0268264_10012719
3946 Ga0265337_1000301
3947 Ga0265319_1003891
3948 Ga0265334_10001248
3949 Ga0265318_10000018
3950 Ga0265318_10007465
3951 Ga0265336_10000676
3952 Ga0307517_10000553
3953 Ga0307517_10000685
3954 Ga0307515_10000010
3955 Ga0307515_10000057
3956 Ga0307515_10000233
3957 Ga0307515_10000514
3958 Ga0307515_10000523
3959 Ga0307515_10000569
3960 Ga0307515_10001565
3961 Ga0307515_10015653
3962 Ga0307515_10017926
3963 Ga0307515_10082977
3964 Ga0265338_10000014
3965 Ga0265338_10003602
3966 Ga0265338_10004226
3967 Ga0265338_10014160
3968 Ga0265338_10016452
3969 Ga0265338_10018269
3970 Ga0265338_10018585
3971 Ga0265338_10023084
3972 Ga0265338_10030858
3973 Ga0265338_10049339
3974 Ga0265324_10008071
3975 Ga0268256_1000020
3976 Ga0268256_1006987
3977 Ga0307511_10024238
3978 Ga0265330_10000050
3979 Ga0265332_10000332
3980 Ga0265328_10000023
3981 Ga0265328_10000055
3982 Ga0265328_10000132
3983 Ga0265328_10002139
3984 Ga0265328_10011197
3985 Ga0265320_10000496
3986 Ga0265320_10010437
3987 Ga0265325_10000001
3988 Ga0265325_10002717
3989 Ga0265329_10007739
3990 Ga0265340_10000071
3991 Ga0265340_10008609
3992 Ga0265339_10000135
3993 Ga0265339_10002142
3994 Ga0265339_10011527
3995 Ga0265331_10000006
3996 Ga0265331_10000007
3997 Ga0265331_10000687
3998 Ga0265331_10000823
3999 Ga0265331_10001725
4000 Ga0265331_10002129
4001 Ga0265327_10000022
4002 Ga0265327_10000038
4003 Ga0265327_10000074
4004 Ga0265327_10000239
4005 Ga0265327_10000381
4006 Ga0265327_10001320
4007 Ga0265327_10001725
4008 Ga0265327_10009324
4009 Ga0265327_10011392
4010 Ga0265327_10014482
4011 Ga0265316_10000238
4012 Ga0265316_10001622
4013 Ga0265316_10002070
4014 Ga0265316_10009265
4015 Ga0265316_10012382
4016 Ga0265316_10025676
4017 Ga0265316_10030652
4018 Ga0307513_10057270
4019 Ga0307509_10010135
4020 Ga0307408_100000882
4021 Ga0307408_100001015
4022 Ga0307408_100002166
4023 Ga0307408_100003500
4024 Ga0307408_100004580
4025 Ga0307408_100015144
4026 Ga0307408_100022412
4027 Ga0265313_10000124
4028 Ga0265313_10000660
4029 Ga0265313_10001721
4030 Ga0265313_10002264
4031 Ga0265313_10003794
4032 Ga0265313_10005016
4033 Ga0265313_10010277
4034 Ga0307508_10000763
4035 Ga0316575_10012098
4036 Ga0316579_10006075
4037 Ga0316579_10015360
4038 Ga0265314_10000112
4039 Ga0265314_10002612
4040 Ga0265314_10002986
4041 Ga0265314_10008440
4042 Ga0265314_10016157
4043 Ga0265314_10018580
4044 Ga0265342_10000242
4045 Ga0265342_10012218
4046 Ga0265342_10015773
4047 Ga0265342_10023832
4048 Ga0307516_10000004
4049 Ga0307516_10001316
4050 Ga0307405_10000002
4051 Ga0307405_10000023
4052 Ga0307405_10000833
4053 Ga0307405_10001789
4054 Ga0316577_10021382
4055 Ga0307413_10000047
4056 Ga0307410_10001530
4057 Ga0307406_10000271
4058 Ga0307406_10002859
4059 Ga0307406_10004978
4060 Ga0307406_10006264
4061 Ga0307406_10020534
4062 Ga0307407_10000059
4063 Ga0307407_10000264
4064 Ga0307407_10000770
4065 Ga0307407_10015720
4066 Ga0307412_10000085
4067 Ga0307412_10001216
4068 Ga0307412_10015803
4069 Ga0315914_1000008
4070 Ga0307409_100000857
4071 Ga0307409_100002475
4072 Ga0307409_100018147
4073 Ga0307409_100035000
4074 Ga0307416_100000116
4075 Ga0307416_100002388
4076 Ga0307416_100002723
4077 Ga0307416_100004451
4078 Ga0307416_100008001
4079 Ga0307414_10000008
4080 Ga0307414_10000040
4081 Ga0307414_10000510
4082 Ga0307414_10001132
4083 Ga0307414_10002298
4084 Ga0307414_10005505
4085 Ga0307414_10006841
4086 Ga0307414_10008370
4087 Ga0307414_10016057
4088 Ga0307414_10021364
4089 Ga0307411_10000018
4090 Ga0307411_10001125
4091 Ga0307411_10001647
4092 Ga0307411_10001969
4093 Ga0307411_10005674
4094 Ga0307415_100003514
4095 Ga0307415_100009470
4096 Ga0307415_100015276
4097 Ga0307507_10000111
4098 Ga0307510_10000172
4099 Ga0315915_1000058
4100 Ga0373934_0001914
4101 Ga0373944_0002568
4102 Ga0373923_0002718
4103 Ga0373945_0002662
4104 Ga0373953_0000896
4105 Ga0373943_0002368
4106 Ga0373943_0011306
4107 Ga0373955_0000996
4108 Ga0373961_0002656
4109 Ga0373924_0003776
4110 Ga0373931_0007351
4111 Ga0373935_0001925
4112 Ga0373935_0014319
4113 Ga0373927_0001008
4114 Ga0373927_0014464
4115 Ga0373933_0000104
4116 Ga0373933_0002019
4117 Ga0373933_0005899
4118 Ga0373947_0000102
4119 Ga0373947_0001616
4120 Ga0373947_0009500
4121 Ga0373937_0000161
4122 Ga0373937_0002128
4123 Ga0373937_0003351
4124 Ga0373937_0005514
4125 Ga0373937_0008903
4126 Ga0373937_0021950
4127 Ga0373937_0022933
4128 Ga0373937_0024827
4129 Ga0373937_0048173
4130 Ga0316584_0011620
4131 Ga0373925_0000385
4132 Ga0373925_0001478
4133 Ga0373925_0038884
4134 Ga0395899_0000017
4135 Ga0395899_0000144
4136 Ga0395899_0000327
4137 Ga0395899_0001120
4138 Ga0395899_0005015
4139 Ga0395899_0006095
4140 Ga0395899_0007469
4141 Ga0395899_0009740
4142 Ga0395899_0014068
4143 Ga0395899_0020499
4144 Ga0395899_0031979
4145 Ga0395900_0000027
4146 Ga0395900_0000609
4147 Ga0395900_0000658
4148 Ga0395900_0001116
4149 Ga0395900_0017170
4150 Ga0395900_0020556
4151 Ga0395900_0029013
4152 Ga0395900_0032688
4153 Ga0395900_0051543
4154 Ga0395900_0078357
4155 Ga0395900_0082153
4156 Ga0395898_0000043
4157 Ga0395898_0001697
4158 Ga0395898_0004808
4159 Ga0395898_0005830
4160 Ga0395898_0014764
4161 Ga0395898_0016879
4162 Ga0395898_0019572
4163 Ga0395898_0021331
4164 Ga0395898_0031800
4165 Ga0395898_0036144
4166 Ga0395898_0039265
4167 Ga0395898_0059251
4168 Ga0395905_0000003
4169 Ga0395905_0000032
4170 Ga0395905_0000130
4171 Ga0395905_0003812
4172 Ga0395905_0006809
4173 Ga0395905_0007047
4174 Ga0395905_0010878
4175 Ga0395905_0015420
4176 Ga0395905_0027049
4177 Ga0395905_0043585
4178 Ga0395905_0067064
4179 Ga0436364_0173332
4180 Ga0436364_0397135
4181 Ga0436364_0630944
4182 Ga0436364_0661460
4183 Ga0436364_0730045
4184 Ga0436364_0936398
4185 Ga0436364_1080787
4186 Ga0436364_1149172
4187 Ga0436364_1371986
4188 Ga0395901_0000056
4189 Ga0395901_0000847
4190 Ga0395901_0001146
4191 Ga0395901_0001153
4192 Ga0395901_0001159
4193 Ga0395901_0001784
4194 Ga0395901_0002123
4195 Ga0395901_0003003
4196 Ga0395901_0004430
4197 Ga0395901_0005265
4198 Ga0395901_0014098
4199 Ga0395901_0014399
4200 Ga0395901_0016457
4201 Ga0395901_0019720
4202 Ga0395901_0020578
4203 Ga0395901_0021881
4204 Ga0395901_0027308
4205 Ga0395901_0030629
4206 Ga0395901_0038427
4207 Ga0395901_0059142
4208 Ga0400483_158932
4209 Ga0400483_237362
4210 Ga0400489_11051
4211 Ga0436365_0114166
4212 Ga0436365_0269340
4213 Ga0436365_0279987
4214 Ga0436365_0286964
4215 Ga0436365_0605653
4216 Ga0436365_1242987
4217 Ga0436365_1486271
4218 Ga0436365_1889064
4219 Ga0436360_0862127
4220 Ga0436361_0014949
4221 Ga0436361_0064193
4222 Ga0436361_1159520
4223 Ga0436363_0117045
4224 Ga0436363_0580065
4225 Ga0436362_0754150
4226 Ga0439447_001533
4227 Ga0439466_0001335
4228 Ga0439449_0009693
4229 Ga0439457_000505
4230 Ga0451577_0000329
4231 Ga0451577_0002681
4232 Ga0451577_0009219
4233 Ga0466969_0000637
4234 Ga0466972_0000050
4235 Ga0466972_0000095
4236 Ga0466972_0020555
4237 Ga0453683_0018146
4238 Ga0466966_0011169
4239 Ga0466961_0004101
4240 Ga0466963_0001045
4241 Ga0466963_0013100
4242 Ga0466963_0013338
4243 Ga0466963_0020358
4244 Ga0466964_0002702
4245 Ga0466964_0003993
4246 Ga0453684_0000006
4247 Ga0453684_0001753
4248 Ga0453684_0002341
4249 Ga0453684_0002621
4250 Ga0453684_0006249
4251 Ga0453684_0011091
4252 Ga0453684_0053245
4253 Ga0453684_0079514
4254 Ga0453684_0107090
4255 Ga0466971_0006207
4256 Ga0466971_0009054
4257 Ga0466968_0001213
4258 Ga0466957_0000044
4259 Ga0466957_0000078
4260 Ga0466959_0003250
4261 Ga0466959_0006351
4262 Ga0466959_0010280
4263 Ga0451576_0000015
4264 Ga0451576_0003258
4265 Ga0451576_0003475
4266 Ga0451576_0005560
4267 Ga0451576_0007229
4268 Ga0451576_0007700
4269 Ga0451576_0008205
4270 Ga0451576_0013390
4271 Ga0451576_0024297
4272 Ga0451576_0079635
4273 Ga0451576_0086952
4274 Ga0466958_0001517
4275 Ga0466958_0005472
4276 Ga0466958_0005937
4277 Ga0466967_0007564
4278 Ga0466967_0008675
4279 Ga0466967_0015169
4280 Ga0466967_0019623
4281 Ga0466967_0022134
4282 Ga0466967_0024185
4283 Ga0495592_0001615
4284 Ga0495592_0008572
4285 Ga0495592_0025320
4286 Ga0495603_0000774
4287 Ga0495603_0024815
4288 Ga0495629_0006901
4289 Ga0495629_0024664
4290 Ga0495629_0038417
4291 Ga0495638_0000004
4292 Ga0495638_0002602
4293 Ga0495641_0002094
4294 Ga0495641_0006293
4295 Ga0495641_0010223
4296 Ga0495651_0000001
4297 Ga0495651_0000077
4298 Ga0495651_0001379
4299 Ga0495651_0003563
4300 Ga0495651_0016939
4301 Ga0495653_0000153
4302 Ga0495653_0000668
4303 Ga0495653_0003014
4304 Ga0495653_0033114
4305 Ga0495650_0000050
4306 Ga0495580_0000048
4307 Ga0495580_0014257
4308 Ga0495580_0022217
4309 Ga0495580_0024529
4310 Ga0495582_0000293
4311 Ga0495582_0000805
4312 Ga0495582_0002103
4313 Ga0495639_0001257
4314 Ga0495639_0001937
4315 Ga0495662_0001462
4316 Ga0495662_0001675
4317 Ga0495664_0020843
4318 Ga0495585_0000560
4319 Ga0495585_0000785
4320 Ga0495594_0006467
4321 Ga0495607_0007348
4322 Ga0495583_0000001
4323 Ga0495606_0003576
4324 Ga0495606_0004238
4325 Ga0495606_0029963
4326 Ga0495608_0000166
4327 Ga0495608_0000448
4328 Ga0495608_0015811
4329 Ga0495608_0022609
4330 Ga0495608_0023427
4331 Ga0495610_0000098
4332 Ga0495610_0000119
4333 Ga0495610_0003768
4334 Ga0495616_0000296
4335 Ga0495618_0000834
4336 Ga0495628_0000243
4337 Ga0495628_0000500
4338 Ga0495628_0013327
4339 Ga0495628_0016087
4340 Ga0495628_0020409
4341 Ga0495630_0002510
4342 Ga0495630_0002942
4343 Ga0495630_0005371
4344 Ga0495630_0017680
4345 Ga0495630_0042326
4346 Ga0495631_0003853
4347 Ga0495643_0000288
4348 Ga0495643_0012095
4349 Ga0495648_0000834
4350 Ga0495648_0011726
4351 Ga0495666_0003840
4352 Ga0495652_0001211
4353 Ga0495652_0002951
4354 Ga0495665_0000002
4355 Ga0495665_0008043
4356 Ga0495640_0018032
4357 Ga0495586_0003187
4358 Ga0495586_0015716
4359 Ga0495586_0017974
4360 Ga0495587_0000036
4361 Ga0495587_0000452
4362 Ga0495587_0000999
4363 Ga0495609_0002045
4364 Ga0495609_0016736
4365 Ga0495645_0000039
4366 Ga0495645_0000471
4367 Ga0495645_0000661
4368 Ga0495645_0000982
4369 Ga0495645_0011164
4370 Ga0495622_0002923
4371 Ga0495622_0007362
4372 Ga0495633_0000083
4373 Ga0495633_0000869
4374 Ga0495633_0001189
4375 Ga0495633_0003455
4376 Ga0495667_0006482
4377 Ga0495667_0012323
4378 Ga0495668_0000037
4379 Ga0495668_0000055
4380 Ga0495668_0000057
4381 Ga0495625_0000077
4382 Ga0495625_0000284
4383 Ga0495625_0001180
4384 Ga0495625_0002142
4385 Ga0495625_0008307
4386 Ga0495625_0017000
4387 Ga0495625_0025252
4388 Ga0495635_0000048
4389 Ga0495635_0009983
4390 Ga0495659_0006037
4391 Ga0495661_0023189
4392 Ga0495588_0000368
4393 Ga0495657_0001010
4394 Ga0495657_0017938
4395 Ga0495657_0023561
4396 Ga0495599_0000055
4397 Ga0495599_0000215
4398 Ga0495599_0000314
4399 Ga0495599_0000409
4400 Ga0495599_0015440
4401 Ga0495623_0000110
4402 Ga0495646_0001458
4403 Ga0495647_0000084
4404 Ga0495647_0004709
4405 Ga0495658_0000017
4406 Ga0495658_0000537
4407 Ga0495669_0000001
4408 Ga0495624_0004436
4409 Ga0495649_0000011
4410 Ga0495600_0000158
4411 Ga0495600_0014319
4412 Ga0495600_0023016
4413 Ga0495600_0039098
4414 Ga0495660_0018968
4415 Ga0495581_0000623
4416 Ga0495581_0001805
4417 Ga0495581_0002026
4418 Ga0495581_0009590
4419 Ga0495604_0000004
4420 Ga0495604_0000017
4421 Ga0495604_0003568
4422 Ga0495604_0018292
4423 Ga0495604_0025278
4424 Ga0495604_0034107
4425 Ga0495636_0000031
4426 Ga0495674_0001283
4427 Ga0495674_0004367
4428 Ga0495674_0006945
4429 Ga0495672_0032067
4430 Ga0495676_0007953
4431 Ga0495676_0010472
4432 Ga0495680_0003419
4433 Ga0495680_0003455
4434 Ga0495680_0010071
4435 Ga0495680_0010203
4436 Ga0495680_0011609
4437 Ga0495687_000004
4438 Ga0495687_001849
4439 Ga0495687_008901
4440 Ga0495675_0000250
4441 Ga0495675_0002559
4442 Ga0495675_0015662
4443 Ga0495675_0017253
4444 Ga0495684_0000118
4445 Ga0495684_0008116
4446 Ga0495686_0000174
4447 Ga0495686_0000341
4448 Ga0495686_0000729
4449 Ga0495686_0001275
4450 Ga0495686_0002662
4451 Ga0495593_0000009
4452 Ga0495593_0004331
4453 Ga0495593_0007169
4454 Ga0495602_0000159
4455 Ga0495602_0000891
4456 Ga0495602_0004186
4457 Ga0495602_0011104
4458 Ga0495614_0000005
4459 Ga0495614_0000112
4460 Ga0495614_0007687
4461 Ga0496100_0007619
4462 Ga0496101_0001173
4463 Ga0496101_0008298
4464 Ga0496101_0010839
4465 Ga0496101_0014166
4466 Ga0496101_0025312
4467 Ga0496101_0027767
4468 Ga0496102_0009287
4469 Ga0496102_0019285
4470 Ga0496102_0020239
4471 Ga0496102_0024902
4472 Ga0496103_0009617
4473 Ga0496104_0000035
4474 Ga0496104_0000274
4475 Ga0496104_0001176
4476 Ga0496104_0001420
4477 Ga0496104_0001625
4478 Ga0496104_0008025
4479 Ga0496104_0012719
4480 Ga0496105_0000359
4481 Ga0496105_0000930
4482 Ga0496105_0000997
4483 Ga0496105_0004795
4484 Ga0496105_0026638
4485 Ga0496105_0033326
4486 Ga0496106_0002074
4487 Ga0496106_0007232
4488 Ga0496106_0011347
4489 Ga0496106_0024297
4490 Ga0496106_0024330
4491 Ga0496106_0036051
4492 Ga0496107_0008786
4493 Ga0496107_0013750
4494 Ga0496107_0020259
4495 Ga0496108_0002409
4496 Ga0496108_0005547
4497 Ga0496108_0005935
4498 Ga0496108_0031155
4499 Ga0496108_0039784
4500 Ga0496108_0041001
4501 Ga0496109_0001756
4502 Ga0496109_0002119
4503 Ga0496109_0004789
4504 Ga0496109_0007052
4505 Ga0496109_0008874
4506 Ga0496109_0010104
4507 Ga0496109_0015662
4508 Ga0496109_0016734
4509 Ga0496109_0026500
4510 Ga0496109_0041540
4511 Ga0496109_0043006
4512 Ga0496110_0000168
4513 Ga0496110_0004153
4514 Ga0496110_0007078
4515 Ga0496110_0013147
4516 Ga0496110_0016291
4517 Ga0496111_0001062
4518 Ga0496111_0001490
4519 Ga0496111_0002831
4520 Ga0496111_0004797
4521 Ga0496111_0006216
4522 Ga0496111_0010182
4523 Ga0496111_0035272
4524 Ga0496112_0000189
4525 Ga0496112_0001216
4526 Ga0496112_0002743
4527 Ga0496112_0025054
4528 Ga0496112_0085083
4529 Ga0496113_0001127
4530 Ga0496113_0001158
4531 Ga0496113_0006699
4532 Ga0496113_0042300
4533 Ga0496114_0000948
4534 Ga0496114_0012610
4535 Ga0496114_0018228
4536 Ga0496114_0027359
4537 Ga0496115_0001171
4538 Ga0496115_0002222
4539 Ga0496115_0045337
4540 Ga0496116_0000004
4541 Ga0496116_0000232
4542 Ga0496116_0002152
4543 Ga0496116_0010331
4544 Ga0496116_0010338
4545 Ga0496117_0000002
4546 Ga0496117_0002900
4547 Ga0496117_0015755
4548 Ga0496118_0003956
4549 Ga0496118_0012823
4550 Ga0496118_0014843
4551 Ga0496118_0041979
4552 Ga0496119_0008982
4553 Ga0496119_0016570
4554 Ga0496119_0043904
4555 Ga0496120_0000941
4556 Ga0496120_0020104
4557 Ga0496121_0000001
4558 Ga0496121_0000008
4559 Ga0496121_0000009
4560 Ga0496121_0002309
4561 Ga0496121_0005949
4562 Ga0496121_0013658
4563 Ga0496122_0000001
4564 Ga0496122_0000025
4565 Ga0496122_0000837
4566 Ga0496122_0000957
4567 Ga0496122_0006612
4568 Ga0496122_0009402
4569 Ga0496122_0009860
4570 Ga0496122_0015790
4571 Ga0496123_0000001
4572 Ga0496123_0000032
4573 Ga0496123_0000043
4574 Ga0496123_0001255
4575 Ga0496123_0011635
4576 Ga0496124_0001936
4577 Ga0496124_0004955
4578 Ga0496124_0008685
4579 Ga0496125_0000082
4580 Ga0496125_0000311
4581 Ga0496125_0000382
4582 Ga0496125_0000401
4583 Ga0496125_0001837
4584 Ga0496125_0018059
4585 Ga0496125_0018917
4586 Ga0496125_0022738
4587 Ga0496126_0000624
4588 Ga0496126_0000703
4589 Ga0496126_0001375
4590 Ga0496126_0005679
4591 Ga0496126_0006355
4592 Ga0496126_0019171
4593 Ga0495682_0002385
4594 Ga0501031_0000014
4595 Ga0501031_0001303
4596 Ga0501031_0002127
4597 Ga0501031_0003110
4598 Ga0501031_0021253
4599 Ga0501032_0000015
4600 Ga0501032_0000064
4601 Ga0501032_0000759
4602 Ga0501032_0000789
4603 Ga0501032_0007565
4604 Ga0501033_0000023
4605 Ga0501033_0000030
4606 Ga0501033_0000190
4607 Ga0501033_0000330
4608 Ga0501033_0001698
4609 Ga0501033_0026347
4610 Ga0501033_0034430
4611 Ga0501033_0053681
4612 Ga0501034_0000073
4613 Ga0501034_0000095
4614 Ga0501034_0000111
4615 Ga0501034_0000167
4616 Ga0501034_0000174
4617 Ga0501034_0000176
4618 Ga0501034_0000242
4619 Ga0501034_0000993
4620 Ga0501034_0004022
4621 Ga0501034_0005481
4622 Ga0501034_0006569
4623 Ga0501034_0029994
4624 Ga0501034_0034282
4625 Ga0501034_0041681
4626 Ga0501034_0069828
4627 Ga0501034_0093991
4628 Ga0501036_0000002
4629 Ga0501036_0000399
4630 Ga0501036_0001149
4631 Ga0501036_0004049
4632 Ga0501036_0005277
4633 Ga0501036_0007566
4634 Ga0501036_0009648
4635 Ga0501036_0010097
4636 Ga0501036_0020665
4637 Ga0501037_0000048
4638 Ga0501037_0000163
4639 Ga0501037_0002141
4640 Ga0501037_0004859
4641 Ga0501037_0009724
4642 Ga0501037_0016825
4643 Ga0501037_0019510
4644 Ga0501037_0027870
4645 Ga0501037_0037188
4646 Ga0501038_0000002
4647 Ga0501038_0000031
4648 Ga0501038_0003688
4649 Ga0501038_0008287
4650 Ga0501038_0009490
4651 Ga0501038_0010393
4652 Ga0501038_0012451
4653 Ga0501038_0013075
4654 Ga0501038_0016000
4655 Ga0501038_0019090
4656 Ga0501038_0032064
4657 Ga0501038_0036451
4658 Ga0501039_0000002
4659 Ga0501039_0000057
4660 Ga0501039_0001400
4661 Ga0501039_0008090
4662 Ga0501039_0010525
4663 Ga0501039_0011534
4664 Ga0501039_0017768
4665 Ga0501039_0030404
4666 Ga0501039_0031749
4667 Ga0501040_0001732
4668 Ga0501040_0004461
4669 Ga0501040_0010974
4670 Ga0501040_0012436
4671 Ga0501041_0003283
4672 Ga0501042_0002873
4673 Ga0501042_0014373
4674 Ga0501042_0030086
4675 Ga0501043_0000048
4676 Ga0501043_0000298
4677 Ga0501043_0000945
4678 Ga0501043_0005914
4679 Ga0501043_0007673
4680 Ga0501043_0009189
4681 Ga0501043_0031471
4682 Ga0501043_0046147
4683 Ga0501046_0000045
4684 Ga0501046_0000128
4685 Ga0501046_0002196
4686 Ga0501046_0002389
4687 Ga0501046_0002587
4688 Ga0501046_0004119
4689 Ga0501046_0005116
4690 Ga0501046_0010509
4691 Ga0501046_0012007
4692 Ga0501046_0048191
4693 Ga0501047_0000102
4694 Ga0501047_0000352
4695 Ga0501047_0000691
4696 Ga0501047_0001024
4697 Ga0501047_0003691
4698 Ga0501047_0009082
4699 Ga0501047_0015553
4700 Ga0501047_0016911
4701 Ga0501047_0028087
4702 Ga0501047_0051845
4703 Ga0501048_0001595
4704 Ga0501048_0001739
4705 Ga0501048_0001795
4706 Ga0501048_0002095
4707 Ga0501048_0003618
4708 Ga0501048_0006875
4709 Ga0501048_0011824
4710 Ga0501048_0031179
4711 Ga0501067_0000351
4712 Ga0501067_0000693
4713 Ga0501067_0000802
4714 Ga0501067_0000957
4715 Ga0501067_0002120
4716 Ga0501067_0003475
4717 Ga0501067_0005672
4718 Ga0501067_0006668
4719 Ga0501067_0006878
4720 Ga0501068_0000575
4721 Ga0501068_0001665
4722 Ga0501068_0002682
4723 Ga0501069_0000154
4724 Ga0501069_0000931
4725 Ga0501069_0001773
4726 Ga0501069_0011785
4727 Ga0501070_0000109
4728 Ga0501070_0000302
4729 Ga0501070_0002159
4730 Ga0501070_0003350
4731 Ga0501070_0006716
4732 Ga0501070_0007693
4733 Ga0501070_0012884
4734 Ga0501070_0016801
4735 Ga0501070_0017922
4736 Ga0501070_0039643
4737 Ga0501070_0068337
4738 Ga0501071_0000180
4739 Ga0501071_0009592
4740 Ga0501071_0009851
4741 Ga0501071_0014218
4742 Ga0501072_0000003
4743 Ga0501072_0000171
4744 Ga0501072_0001994
4745 Ga0501072_0003052
4746 Ga0501072_0008559
4747 Ga0501072_0017576
4748 Ga0501072_0021826
4749 Ga0501073_0000214
4750 Ga0501073_0000392
4751 Ga0501073_0001168
4752 Ga0501073_0002127
4753 Ga0501073_0003472
4754 Ga0501073_0006501
4755 Ga0501073_0006932
4756 Ga0501073_0010704
4757 Ga0501074_0000268
4758 Ga0501074_0000923
4759 Ga0501074_0001743
4760 Ga0501074_0014167
4761 Ga0501074_0037984
4762 Ga0501074_0045770
4763 Ga0501075_0001625
4764 Ga0501075_0008137
4765 Ga0501075_0024706
4766 Ga0501075_0042007
4767 Ga0501076_0003574
4768 Ga0501076_0012577
4769 Ga0501217_000521
4770 Ga0501223_000643
4771 Ga0501223_001780
4772 Ga0501249_000219
4773 Ga0501259_000187
4774 Ga0501259_001431
4775 Ga0501219_000009
4776 Ga0501221_000072
4777 Ga0501079_0001965
4778 Ga0501079_0004284
4779 Ga0501079_0005467
4780 Ga0501079_0011655
4781 Ga0501079_0014923
4782 Ga0501079_0020109
4783 Ga0501079_0025949
4784 Ga0501079_0028612
4785 Ga0501079_0054436
4786 Ga0501080_0000041
4787 Ga0501080_0002319
4788 Ga0501080_0004634
4789 Ga0501080_0006682
4790 Ga0501080_0007596
4791 Ga0501080_0009084
4792 Ga0501080_0009816
4793 Ga0501080_0016454
4794 Ga0501080_0035878
4795 Ga0501080_0037062
4796 Ga0501080_0041110
4797 Ga0501081_0003579
4798 Ga0501081_0003652
4799 Ga0501081_0010438
4800 Ga0501081_0016882
4801 Ga0501081_0029908
4802 Ga0501083_0000093
4803 Ga0501083_0000353
4804 Ga0501083_0000401
4805 Ga0501083_0001882
4806 Ga0501083_0002364
4807 Ga0501083_0005468
4808 Ga0501083_0014835
4809 Ga0501083_0019754
4810 Ga0501264_000187
4811 Ga0501266_000030
4812 Ga0501268_001534
4813 Ga0501035_0000020
4814 Ga0501035_0000022
4815 Ga0501035_0000036
4816 Ga0501035_0000198
4817 Ga0501035_0001475
4818 Ga0501035_0008202
4819 Ga0501035_0008394
4820 Ga0501035_0009199
4821 Ga0501035_0046568
4822 Ga0501035_0056363
4823 Ga0501044_0000002
4824 Ga0501044_0000007
4825 Ga0501044_0000011
4826 Ga0501044_0000503
4827 Ga0501044_0001090
4828 Ga0501044_0005359
4829 Ga0501044_0007248
4830 Ga0501044_0011217
4831 Ga0501044_0012477
4832 Ga0501044_0023653
4833 Ga0501044_0028128
4834 Ga0501044_0031826
4835 Ga0501044_0039914
4836 Ga0501044_0044965
4837 Ga0501044_0072844
4838 Ga0501045_0002779
4839 Ga0501045_0005477
4840 Ga0501045_0011364
4841 Ga0501212_000748
4842 Ga0501284_00008
4843 nmdc:mga03683_925_c1
4844 nmdc:mga00v17_12600_c1
4845 nmdc:mga00v17_203_c1
4846 nmdc:mga00v17_6_c1
4847 nmdc:mga0yw44_4652_c1
4848 nmdc:mga0k408_26_c4
4849 nmdc:mga0k408_31211_c1
4850 nmdc:mga0k408_4005_c1
4851 nmdc:mga0k408_696_c1
4852 nmdc:mga04h51_341_c1
4853 nmdc:mga07m45_1617_c1
4854 nmdc:mga07m45_25589_c1
4855 nmdc:mga05p37_10057_c1
4856 nmdc:mga05p37_2028_c1
4857 nmdc:mga05p37_20570_c1
4858 nmdc:mga05p37_21244_c1
4859 nmdc:mga05p37_2260_c1
4860 nmdc:mga05p37_23177_c1
4861 nmdc:mga05p37_32934_c1
4862 nmdc:mga05p37_77737_c1
4863 nmdc:mga09592_51896_c1
4864 nmdc:mga0qj67_26823_c1
4865 nmdc:mga0qj67_37512_c1
4866 nmdc:mga0qj67_382_c1
4867 nmdc:mga0qj67_4730_c1
4868 nmdc:mga06r32_10583_c1
4869 nmdc:mga06r32_12428_c1
4870 nmdc:mga06r32_14053_c1
4871 nmdc:mga06r32_6186_c1
4872 nmdc:mga06r32_7631_c1
4873 nmdc:mga08y16_11384_c1
4874 nmdc:mga08y16_16_c1
4875 nmdc:mga08y16_4059_c1
4876 nmdc:mga08y16_5732_c1
4877 nmdc:mga0n895_1505_c1
4878 nmdc:mga0n895_15139_c1
4879 nmdc:mga0n895_19306_c1
4880 nmdc:mga0n895_31745_c1
4881 nmdc:mga0n895_3482_c1
4882 nmdc:mga0n895_44889_c1
4883 nmdc:mga0n895_7603_c1
4884 nmdc:mga0rr50_26779_c1
4885 nmdc:mga0rr50_612_c1
4886 nmdc:mga0rr50_6599_c1
4887 nmdc:mga08x19_140_c1
4888 nmdc:mga08x19_5811_c1
4889 nmdc:mga08x19_7970_c1
4890 nmdc:mga08x19_819_c1
4891 nmdc:mga0a205_12737_c1
4892 nmdc:mga0a205_3328_c1
4893 nmdc:mga0sz30_215_c2
4894 Ga0495601_0000183
4895 Ga0495601_0025316
4896 Ga0500635_0001070
4897 Ga0495595_0010590
4898 Ga0495619_0001430
4899 Ga0495619_0017238
4900 Ga0500578_0000119
4901 Ga0500643_000014
4902 Ga0500643_001389
4903 Ga0500644_0000569
4904 Ga0500646_0001071
4905 Ga0500583_0000010
4906 Ga0500651_0000312
4907 Ga0500641_0000009
4908 Ga0500641_0000084
4909 Ga0500641_0000389
4910 Ga0500641_0001643
4911 Ga0500556_0000503
4912 Ga0500562_000030
4913 Ga0500569_000107
4914 Ga0500595_003261
4915 Ga0500608_000032
4916 Ga0500618_000021
4917 Ga0500618_000084
4918 Ga0500652_000401
4919 Ga0500652_001726
4920 Ga0500658_0000061
4921 Ga0500658_0005500
4922 Ga0500559_0005113
4923 Ga0500561_0000326
4924 Ga0500564_000051
4925 Ga0500568_0000641
4926 Ga0500568_0000776
4927 Ga0500568_0001723
4928 Ga0500573_0000003
4929 Ga0500590_019376
4930 Ga0500604_0000119
4931 Ga0500616_0000091
4932 Ga0500616_0000703
4933 Ga0500616_0002822
4934 Ga0500616_0002976
4935 Ga0500616_0007663
4936 Ga0500616_0011166
4937 Ga0500622_0000075
4938 Ga0500622_0000435
4939 Ga0500622_0000455
4940 Ga0500622_0001236
4941 Ga0500622_0007482
4942 Ga0500624_000603
4943 Ga0500634_0000169
4944 Ga0500636_0000153
4945 Ga0500636_0010431
4946 Ga0500637_0008126
4947 Ga0500584_010263
4948 Ga0500611_000020
4949 Ga0500645_000197
4950 Ga0501084_0000141
4951 Ga0501084_0000158
4952 Ga0501084_0000713
4953 Ga0501084_0001258
4954 Ga0501084_0001416
4955 Ga0501084_0003039
4956 Ga0501084_0004422
4957 Ga0501084_0006701
4958 Ga0501084_0020699
4959 Ga0501084_0032729
4960 Ga0501084_0042936
4961 Ga0590071_000552
4962 Ga0587072_000662
4963 Ga0501082_0000253
4964 Ga0501082_0002732
4965 Ga0501082_0006508
4966 Ga0501082_0007331
4967 Ga0501082_0019271
4968 Ga0501082_0030261
4969 Ga0501082_0032630
4970 Ga0501082_0035947
4971 Ga0501082_0036504
4972 Ga0501082_0036890
4973 Ga0530510_0001012
4974 Ga0530510_0011284
4975 2902408998
4976 2503202219
4977 2508728379
4978 2509078478
4979 2509107622
4980 2509117026
4981 2509140634
4982 2509370704
4983 2509375955
4984 2509386931
4985 2509396867
4986 2509442458
4987 2510133042
4988 2510306225
4989 2510317495
4990 2510840400
4991 2510894402
4992 2510899427
4993 2511134917
4994 2511172598
4995 2511183756
4996 2511193375
4997 2511389433
4998 2511501475
4999 2512033237
5000 2512532898
5001 2512930882
5002 2512958607
5003 2512971773
5004 2513235124
5005 2513569877
5006 2513575145
5007 2513583018
5008 2513591784
5009 2513594401
5010 2513605236
5011 2513609919
5012 2513617928
5013 2513626870
5014 2513635614
5015 2513646878
5016 2513713934
5017 2513722532
5018 2513866984
5019 2513884914
5020 2513905926
5021 2513909850
5022 2513926627
5023 2513986861
5024 2513997333
5025 2514005324
5026 2514021846
5027 2514034977
5028 2514418939
5029 2514589916
5030 2515111992
5031 2515611386
5032 2515633788
5033 2515645047
5034 2515660192
5035 2515738826
5036 2516892790
5037 2517035728
5038 2517076152
5039 2517094895
5040 2517101786
5041 2517406525
5042 2517569564
5043 2520881705
5044 2522552779
5045 2523102824
5046 2523466311
5047 2524436793
5048 2524453624
5049 2524460449
5050 2524611809
5051 2530645292
5052 2535484830
5053 2535516286
5054 2537877734
5055 2545677751
5056 2551674221
5057 2551680373
5058 2551687018
5059 2551695020
5060 2551697228
5061 2551709717
5062 2551719890
5063 2551726587
5064 2551735056
5065 2551745210
5066 2554247602
5067 2558868230
5068 2559294733
5069 2561466383
5070 2585149988
5071 2585168461
5072 2585199972
5073 2585225806
5074 2585229975
5075 2585254518
5076 2585270026
5077 2585270657
5078 2585276999
5079 2585323995
5080 2585333608
5081 2585389731
5082 2585393729
5083 2585403464
5084 2585528307
5085 2585537009
5086 2585540485
5087 2585546766
5088 2585551860
5089 2585558360
5090 2585819568
5091 2585838701
5092 2585846750
5093 2585897755
5094 2585904651
5095 2585995865
5096 2586000429
5097 2586210611
5098 2587919216
5099 2587980233
5100 2588516561
5101 2596376501
5102 2599106293
5103 2599331347
5104 2599417944
5105 2599480700
5106 2599604001
5107 2599721491
5108 2599938072
5109 2600197160
5110 2600375819
5111 2601608271
5112 2601745045
5113 2616292695
5114 2616308373
5115 2616556559
5116 2617385862
5117 2643772010
5118 2643775529
5119 2643793975
5120 2643808687
5121 2643811990
5122 2643840485
5123 2643857653
5124 2643883670
5125 2643919224
5126 2643989395
5127 2644003780
5128 2644008973
5129 2644049373
5130 2644066291
5131 2644107939
5132 2644132091
5133 2644148389
5134 2644152967
5135 2644166835
5136 2644192756
5137 2644204288
5138 2644210493
5139 2644225046
5140 2644232354
5141 2644239396
5142 2644300643
5143 2644309333
5144 2644333159
5145 2644349349
5146 2644352167
5147 2644372181
5148 2644377833
5149 2644415496
5150 2644450102
5151 2644482407
5152 2644494438
5153 2644502060
5154 2644522128
5155 2644545669
5156 2644551794
5157 2644615275
5158 2644640188
5159 2644654045
5160 2644658703
5161 2644673586
5162 2644683295
5163 2644687659
5164 2644729160
5165 2644735848
5166 2644746766
5167 2657683848
5168 2671115773
5169 2671692678
5170 2688599419
5171 2692316055
5172 2694632205
5173 2694634387
5174 2715499660
5175 2719180948
5176 2719385550
5177 2719665372
5178 2719731697
5179 2720491792
5180 2720613061
5181 2720619914
5182 2720631340
5183 2720775067
5184 2721147042
5185 2721158571
5186 2721163960
5187 2721399298
5188 2722730819
5189 2722840130
5190 2723026704
5191 2723560321
5192 2723566887
5193 2723576379
5194 2724038111
5195 2724044453
5196 2724089674
5197 2724104152
5198 2724109961
5199 2725949928
5200 2730107640
5201 2730164185
5202 2730298203
5203 2738729020
5204 2738734264
5205 2738743739
5206 2738758888
5207 2738762023
5208 2738767022
5209 2738802070
5210 2738856726
5211 2738945580
5212 2739037981
5213 2739215845
5214 2739302003
5215 2739307904
5216 2739350705
5217 2739352646
5218 2739587412
5219 2739614437
5220 2739646604
5221 2740002086
5222 2740006902
5223 2745080269
5224 2753359449
5225 2753458300
5226 2756675889
5227 2757572054
5228 2758641709
5229 2765465573
5230 2766062920
5231 2770195596
5232 2774873377
5233 2776259688
5234 2776271541
5235 2776279948
5236 2776615332
5237 2776913365
5238 2778176513
5239 2792459904
5240 2792580721
5241 2792619953
5242 2792626629
5243 2792639565
5244 2792748532
5245 2793279718
5246 2793298272
5247 2793313753
5248 2793324335
5249 2793326452
5250 2793337038
5251 2793341289
5252 2793347534
5253 2793352396
5254 2793361408
5255 2793369678
5256 2802652820
5257 2802718771
5258 2802726384
5259 2802732927
5260 2802738282
5261 2802744612
5262 2802751182
5263 2804752110
5264 2805927730
5265 2805935636
5266 2806045395
5267 2806055413
5268 2806061456
5269 2806068029
5270 2806072622
5271 2808985494
5272 2817416986
5273 2818242717
5274 2819241903
5275 2819550249
5276 2819559965
5277 2819576691
5278 2819587900
5279 2819610372
5280 2819638112
5281 2819677444
5282 2819684703
5283 2819718223
5284 2821127913
5285 2821143081
5286 2821446675
5287 2824681276
5288 2824750061
5289 2829748666
5290 2833643753
5291 2834579913
5292 2835314007
5293 2837653055
5294 2838021154
5295 2838025384
5296 2838034563
5297 2838041541
5298 2838043196
5299 2838054210
5300 2838067843
5301 2838071473
5302 2838078788
5303 2838666287
5304 2838670178
5305 2838676342
5306 2838682472
5307 2838689224
5308 2838697043
5309 2838702549
5310 2838709716
5311 2838715225
5312 2838720975
5313 2838725983
5314 2838730572
5315 2838738337
5316 2838743513
5317 2839995558
5318 2840678250
5319 2840768058
5320 2840879336
5321 2841740020
5322 2841762591
5323 2841841293
5324 2841847933
5325 2841854811
5326 2841859515
5327 2841864802
5328 2841913542
5329 2841919289
5330 2841958198
5331 2842077890
5332 2842110756
5333 2842119602
5334 2842126037
5335 2842131236
5336 2842141071
5337 2842146906
5338 2842153594
5339 2842157674
5340 2842164871
5341 2842171468
5342 2842177214
5343 2842180741
5344 2842188333
5345 2842196889
5346 2842200952
5347 2842206287
5348 2842212644
5349 2842222979
5350 2842225737
5351 2842231207
5352 2842239129
5353 2842244692
5354 2842251971
5355 2842258505
5356 2842268031
5357 2842273244
5358 2842279744
5359 2842287389
5360 2842291552
5361 2842301799
5362 2842310094
5363 2842313675
5364 2842318155
5365 2842333587
5366 2842347265
5367 2842357282
5368 2842366550
5369 2842373039
5370 2842377948
5371 2842386111
5372 2842397414
5373 2842405081
5374 2842411664
5375 2842417886
5376 2842424869
5377 2842431764
5378 2842438307
5379 2842444938
5380 2842452257
5381 2842466103
5382 2842472924
5383 2842481310
5384 2842487096
5385 2842492880
5386 2842496425
5387 2842508210
5388 2842510247
5389 2842516300
5390 2842522422
5391 2842700720
5392 2842726854
5393 2842776248
5394 2842872754
5395 2842911698
5396 2842923741
5397 2843744504
5398 2844006445
5399 2844014697
5400 2844110401
5401 2844167327
5402 2844459421
5403 2844536426
5404 2846956091
5405 2847418879
5406 2847676302
5407 2847692954
5408 2848861723
5409 2848993914
5410 2849285039
5411 2849565090
5412 2849575586
5413 2850081928
5414 2851155984
5415 2851187039
5416 2851252063
5417 2852389665
5418 2852625732
5419 2852628945
5420 2854681912
5421 2854899236
5422 2854911918
5423 2854918737
5424 2855825571
5425 2855840948
5426 2855876549
5427 2856316086
5428 2856325851
5429 2856328971
5430 2856340031
5431 2856343703
5432 2856351930
5433 2856363663
5434 2856368829
5435 2857350200
5436 2857368571
5437 2857507550
5438 2857513792
5439 2857518458
5440 2857534346
5441 2857618081
5442 2857623014
5443 2857631611
5444 2858801487
5445 2861694432
5446 2869165270
5447 2869174784
5448 2869247159
5449 2869253174
5450 2869262528
5451 2869274749
5452 2869278631
5453 2869291324
5454 2871433604
5455 2871438320
5456 2871458153
5457 2871466354
5458 2871475314
5459 2871495777
5460 2871500741
5461 2874111769
5462 2874117792
5463 2874125990
5464 2874132045
5465 2874145217
5466 2874153205
5467 2874160470
5468 2874167271
5469 2874176207
5470 2874616306
5471 2876365446
5472 2876386074
5473 2876394978
5474 2876405868
5475 2876407650
5476 2876419496
5477 2876426503
5478 2878040354
5479 2878743414
5480 2878751215
5481 2878753424
5482 2878764830
5483 2878771931
5484 2878774799
5485 2878786312
5486 2878795666
5487 2881152856
5488 2881156353
5489 2881168317
5490 2881248175
5491 2881362578
5492 2881851156
5493 2881857161
5494 2881867370
5495 2882458260
5496 2882633850
5497 2882915626
5498 2883070559
5499 2883294542
5500 2883356949
5501 2883580054
5502 2884300358
5503 2884635987
5504 2884797370
5505 2884935743
5506 2884960867
5507 2885310314
5508 2885317123
5509 2885347900
5510 2885355087
5511 2888340147
5512 2888347472
5513 2888356558
5514 2888383547
5515 2889011463
5516 2889016806
5517 2889312325
5518 2889793549
5519 2889918686
5520 2890737751
5521 2891051524
5522 2891093096
5523 2891374134
5524 2894235758
5525 2894654271
5526 2894772594
5527 2894818334
5528 2896086067
5529 2896115379
5530 2896255580
5531 2896321417
5532 2896346103
5533 2896390657
5534 2897809204
5535 2898331649
5536 2898713699
5537 2898796317
5538 2899796312
5539 2899808874
5540 2899849480
5541 2902049799
5542 2902333624
5543 2903455612
5544 2903495279
5545 2903501713
5546 2903517958
5547 2903522802
5548 2903532992
5549 2903545554
5550 2903899529
5551 2904423853
5552 2904448856
5553 2904470801
5554 2904560500
5555 2904583197
5556 2904661609
5557 2904783192
5558 2906313156
5559 2906325867
5560 2906335298
5561 2906365859
5562 2906373940
5563 2906385637
5564 2906402993
5565 2906412649
5566 2906416223
5567 2906433171
5568 2906644735
5569 2909045914
5570 2909401593
5571 2911139025
5572 2913301074
5573 2913310288
5574 2915651829
5575 2915985310
5576 2915992803
5577 2915994707
5578 2916012110
5579 2916016795
5580 2916025100
5581 2916029049
5582 2916041705
5583 2916044108
5584 2916054145
5585 2916061663
5586 2916062347
5587 2916077596
5588 2917699831
5589 2919107860
5590 2919115317
5591 2919123846
5592 2919167833
5593 2919175103
5594 2919180800
5595 2919188999
5596 2919191586
5597 2919409827
5598 2919439867
5599 2919682494
5600 2919687825
5601 2919696612
5602 2920765949
5603 2920824479
5604 2921213544
5605 2921239070
5606 2921250376
5607 2921253957
5608 2921257408
5609 2921264632
5610 2921283061
5611 2921293249
5612 2921299250
5613 2922157455
5614 2922177100
5615 2922187723
5616 2922395843
5617 2923560820
5618 2924149632
5619 2924156010
5620 2924159022
5621 2924167787
5622 2924175475
5623 2924182206
5624 2924187568
5625 2924198916
5626 2924205384
5627 2924213835
5628 2924217111
5629 2924225453
5630 2924234329
5631 2924723819
5632 2924729863
5633 2924736244
5634 2924746296
5635 2924768975
5636 2924781226
5637 2924789661
5638 2926756363
5639 2926760585
5640 2928081593
5641 2928125907
5642 2928150378
5643 2928523237
5644 2928972629
5645 2929140305
5646 2929154261
5647 2929183517
5648 2929203153
5649 2929239581
5650 2929921217
5651 2932085203
5652 2933008237
5653 2933013058
5654 2933018292
5655 2933576545
5656 2933586781
5657 2933597743
5658 2933602272
5659 2935899091
5660 2935904483
5661 2936372996
5662 2936381147
5663 2936386040
5664 2936997981
5665 2937007402
5666 2937012618
5667 2937019756
5668 2937029313
5669 2937032667
5670 2937038467
5671 2937049676
5672 2937055326
5673 2937057749
5674 2937069504
5675 2937076508
5676 2937082607
5677 2937098363
5678 2937100158
5679 2937107401
5680 2937118375
5681 2937122388
5682 2937130373
5683 2937820693
5684 2937827294
5685 2937837775
5686 2937845916
5687 2937849129
5688 2937866856
5689 2937874344
5690 2937878987
5691 2937892885
5692 2937975267
5693 2937999404
5694 2938020532
5695 2939666846
5696 2941488581
5697 2941505003
5698 2945979480
5699 2946002819
5700 2946014651
5701 2954015507
5702 2954019691
5703 2957378677
5704 2957386402
5705 2957389800
5706 2957399941
5707 2957406786
5708 2957410179
5709 2957420249
5710 2957424908
5711 2957433074
5712 2957441071
5713 2957445492
5714 2957453853
5715 2957459776
5716 2957465769
5717 2957474403
5718 2957478581
5719 2957490055
5720 2957494814
5721 2957502549
5722 2957511717
5723 2958034747
5724 2958043125
5725 2958066997
5726 2958077514
5727 2958086161
5728 2958106752
5729 2958112119
5730 2958122259
5731 2958135724
5732 2958160341
5733 2958169878
5734 2958173157
5735 2958185215
5736 2958461648
5737 2958512909
5738 2960588898
5739 2960596249
5740 2960600988
5741 2960605332
5742 2960616496
5743 2960618846
5744 2960629642
5745 2960632680
5746 2960645163
5747 2960648560
5748 2960655236
5749 2960664184
5750 2960669562
5751 2960679530
5752 2960686941
5753 2960688793
5754 2960700609
5755 2961083482
5756 2961116762
5757 2961132805
5758 2961137638
5759 2961168338
5760 2961177868
5761 2963648343
5762 2964614063
5763 2964616119
5764 2964627559
5765 2964632129
5766 2964639276
5767 2964648858
5768 2964652119
5769 2964665064
5770 2964677342
5771 2964682392
5772 2964686053
5773 2964694664
5774 2964704117
5775 2964708986
5776 2964716173
5777 2965023157
5778 2965029520
5779 2965037535
5780 2965065583
5781 2965095803
5782 2967667108
5783 2967672945
5784 2967683866
5785 2967687259
5786 2967693543
5787 2967706068
5788 2967711674
5789 2967715681
5790 2967726824
5791 2967734386
5792 2967736482
5793 2967746923
5794 2967749994
5795 2967761046
5796 2967763567
5797 2967770647
5798 2967780829
5799 2968003135
5800 2968003961
5801 2968017845
5802 2968084856
5803 2968091798
5804 2968103157
5805 2968112669
5806 2968123098
5807 2968129860
5808 2968176738
5809 2970022498
5810 2970029282
5811 2970039668
5812 2970041856
5813 2970061331
5814 2970062472
5815 2970074707
5816 2970077359
5817 2970085202
5818 2970092221
5819 2970102370
5820 2970104219
5821 2970113419
5822 2970120133
5823 2970124619
5824 2970130242
5825 2970138493
5826 2970148617
5827 2970153180
5828 2970170475
5829 2970172143
5830 2970181593
5831 2970185042
5832 2970193890
5833 2970471980
5834 2970495828
5835 2970510544
5836 2970512676
5837 2970531719
5838 2970544285
5839 2970550042
5840 2970559677
5841 2970593227
5842 2970621106
5843 2970631146
5844 2977235558
5845 2977242408
5846 2977271081
5847 2977521149
5848 2977526770
5849 2977535733
5850 2977541748
5851 2977550475
5852 2977554457
5853 2977562599
5854 2977571114
5855 2977577351
5856 2977583661
5857 2977822636
5858 2977833935
5859 2977848991
5860 2977858088
5861 2977872518
5862 2977875405
5863 2977923092
5864 2977941411
5865 2977948240
5866 2977952629
5867 2977958995
5868 2977974045
5869 2977989092
5870 2978974283
5871 2979094135
5872 2979098484
5873 2979106101
5874 2979713352
5875 2979743202
5876 2979773499
5877 2979780314
5878 2979815418
5879 2984512109
5880 2984521529
5881 2984540823
5882 2984589625
5883 2984603091
5884 2987637388
5885 2987648693
5886 2987653989
5887 2987664352
5888 2987670653
5889 2987675126
5890 2989353118
5891 2989776108
5892 2989778808
5893 2995393614
5894 2996310997
5895 2996337830
5896 2996344988
5897 2996350913
5898 2996392572
5899 2996889922
5900 2996898369
5901 3000018721
5902 3000138482
5903 3000408419
5904 3002143912
5905 3003234959
5906 3003668023
5907 3003933472
5908 3004169593
5909 3004193407
5910 3004197937
5911 3004206215
5912 3004211678
5913 3004218925
5914 3004238888
5915 3004242637
5916 3004275206
5917 3004277611
5918 3004340996
5919 3005409582
5920 3005420309
5921 3005447307
5922 3005454231
5923 3005489649
5924 3005590018
5925 3005721849
5926 637073928
5927 639648279
5928 641336273
5929 641642718
5930 643390070
5931 643599933
5932 643825760
5933 648738945
5934 649873923
5935 650739937
5936 8002062704
5937 8002286118
5938 8003152508
5939 8003570985
5940 8003993441
5941 8004000702
5942 8004303250
5943 8004314616
5944 8004363785
5945 8004374996
5946 8004394120
5947 8004445771
5948 8004634069
5949 8004646683
5950 8004713693
5951 8004719413
5952 8004731746
5953 8005248358
5954 8005261642
5955 8005280324
5956 8005288392
5957 8005294901
5958 8005306933
5959 8005314270
5960 8005317260
5961 8005324449
5962 8005378926
5963 8005388109
5964 8005396934
5965 8005434608
5966 8005462651
5967 8005486677
5968 8005500015
5969 8005544933
5970 8005557993
5971 8005569165
5972 8005575552
5973 8005621384
5974 8005631329
5975 8005646183
5976 8005659376
5977 8005671431
5978 8005686311
5979 8005694851
5980 8005696029
5981 8018129669
5982 8018155429
5983 8018168225
5984 8018178000
5985 8019601645
5986 8019627549
5987 8023681087
5988 8024485880
5989 8024492626
5990 8024505342
5991 8036738141
5992 8045865380
5993 8046772726
5994 8049294650
5995 8054002315
5996 8054311125
5997 8054462322
5998 8054561556
5999 8054568814
6000 8055422576
6001 8055435160
6002 8055595571
6003 8055621536
6004 8055633172
6005 8055915597
6006 8056377176
6007 8056388324
6008 8056443993
6009 8056877647
6010 8057535349
6011 8057578315
6012 8057875352

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17755

UvrA_DNA-bind

UvrA DNA-binding domain

389

498

0.99

PF17760

UvrA_inter

UvrA interaction domain

226

334

0.98

PF00005

ABC_tran

ABC transporter

863

960

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n9l-assembly1.cif.gz_A crystal structure of t. maritima uvra d117-399 with adp 0.9412 19 956
6n9l-assembly1.cif.gz_A crystal structure of t. maritima uvra d117-399 with adp 0.9382 19 956
3ux8-assembly1.cif.gz_A crystal structure of uvra 0.9277 19 956
3fpn-assembly2.cif.gz_A crystal structure of uvra-uvrb interaction domains 0.9264 144 262
3fpn-assembly2.cif.gz_A crystal structure of uvra-uvrb interaction domains 0.919 144 262
ID Description Score Start End Superfamily
2ygrD06 Mainly Alpha;Up-down Bundle;ABC transporter ATPase like fold;ABC transporter ATPase 0.9756 708 846 1.20.1580.10
2vf8B05 Mainly Alpha;Up-down Bundle;ABC transporter ATPase like fold;ABC transporter ATPase 0.972 707 860 1.20.1580.10
2r6fB06 Mainly Alpha;Up-down Bundle;ABC transporter ATPase like fold;ABC transporter ATPase 0.9702 710 846 1.20.1580.10
2ygrD06 Mainly Alpha;Up-down Bundle;ABC transporter ATPase like fold;ABC transporter ATPase 0.9688 708 846 1.20.1580.10
2r6fB06 Mainly Alpha;Up-down Bundle;ABC transporter ATPase like fold;ABC transporter ATPase 0.9562 710 846 1.20.1580.10
ID Description Score Start End GO Terms
AF-A0A855K883-F1-model_v4 UvrABC system protein A (Excinuclease ABC subunit A) 0.9989 735 822 GO:0003677
GO:0004518
GO:0005524
GO:0005737
GO:0006281
AF-A0A356X575-F1-model_v4 UvrABC system protein A (Excinuclease ABC subunit A) 0.9987 699 848 GO:0003677
GO:0004518
GO:0005524
GO:0005737
GO:0006281
AF-A0A3D2NGT8-F1-model_v4 UvrABC system protein A (Excinuclease ABC subunit A) 0.993 805 956 GO:0003677
GO:0004518
GO:0005524
GO:0005737
GO:0006281
GO:0016887
AF-A0A359KBL5-F1-model_v4 UvrABC system protein A (Excinuclease ABC subunit A) 0.9893 745 879 GO:0003677
GO:0004518
GO:0005524
GO:0005737
GO:0006281
GO:0016887
AF-X1K383-F1-model_v4 UvrA DNA-binding domain-containing protein 0.9875 646 843 GO:0003677
GO:0004518
GO:0005524
GO:0005737
GO:0006281

Map