F497097
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2846 | 1441 | 1885 | 381 |
Family's Representative Sequence
| Representative Sequence | 3300046520|Ga0495637_0046991|Ga0495637_0046991_355_1440 |
| Length | 361 |
| Sequence | MKITKLTTFIVPPRWCFLKVETDEGVTGWGEPVVEGRAHTVAAAVEELSDYLIGKDPRNIEDIWTVLYRGGFYRGGAIHMSALAGIDQALWDIKGKALGVSVSDLLGGQVRDKIRVYSWIGGDRPADTARAAKEAVSRGFTAVKMNGTEELQFLDTFDKVDLALANVAAVRDAVGPNVGIGVDFHGRVHKPMAKVLMKELDPYKLTSTPIALGERLFSRWDFKRVLSEGYVDIIQPDASHAGGITETRKIANMAEAYDVALALHCPLGPIALAACLQLDAVCYNAFIQEQSLGIHYNESNDLLDYVKDPRVFDYDKGFVKIPNGPGLGIEINEEYVIERAAVGHRWRNPIWRHADGSFAEW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 4 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 5 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 6 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 7 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 8 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 9 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 10 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 11 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 12 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 13 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 14 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 15 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 16 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 17 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 18 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 19 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 20 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 21 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 22 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 23 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 24 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 25 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 26 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 27 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 28 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 29 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 30 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 31 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 32 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 33 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 34 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 35 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 36 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 37 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 38 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 39 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 40 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 41 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 42 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 43 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 44 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 45 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 46 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 47 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 48 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 49 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 50 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 51 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 52 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 53 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 54 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 55 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 56 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 57 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 58 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 59 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 60 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 61 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 62 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 63 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 64 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 65 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 66 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 67 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 68 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 69 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 70 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 71 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 72 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 73 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 74 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 75 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 76 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 77 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 78 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 79 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 80 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 81 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 82 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 83 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 84 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 85 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 86 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 87 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 88 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 89 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 90 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 91 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 92 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 93 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 94 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 95 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 96 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 97 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 98 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 99 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 100 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 101 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 102 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 103 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 104 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 105 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 106 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 107 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 108 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 109 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 110 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 111 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 112 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 113 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 114 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 115 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 116 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 117 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 118 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 119 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 120 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 121 | 2593339198 | Paenibacillus sp. UNCCL117 | Isolate | Unclassified |
| 122 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 123 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 124 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 125 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 126 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 127 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 128 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 129 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 130 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 131 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 132 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 133 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 134 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 135 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 136 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 137 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 138 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 139 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 140 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 141 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 142 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 143 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 144 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 145 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 146 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 147 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 148 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 149 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 150 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 151 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 152 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 153 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 154 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 155 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 156 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 157 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 158 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 159 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 160 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 161 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 162 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 163 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 164 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 165 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 166 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 167 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 168 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 169 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 170 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 171 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 172 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 173 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 174 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 175 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 176 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 177 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 178 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 179 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 180 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 181 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 182 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 183 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 184 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 185 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 186 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 187 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 188 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 189 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 190 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 191 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 192 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 193 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 194 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 195 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 196 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 197 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 198 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 199 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 200 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 201 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 202 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 203 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 204 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 205 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 206 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 207 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 208 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 209 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 210 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 211 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 212 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 213 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 214 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 215 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 216 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 217 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 218 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 219 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 220 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 221 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 222 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 223 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 224 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 225 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 226 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 227 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 228 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 229 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 230 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 231 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 232 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 233 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 234 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 235 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 236 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 237 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 238 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 239 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 240 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 241 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 242 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 243 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 244 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 245 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 246 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 247 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 248 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 249 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 250 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 251 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 252 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 253 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 254 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 255 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 256 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 257 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 258 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 259 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 260 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 261 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 262 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 263 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 264 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 265 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 266 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 267 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 268 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 269 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 270 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 271 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 272 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 273 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 274 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 275 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 276 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 277 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 278 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 279 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 280 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 281 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 282 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 283 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 284 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 285 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 286 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 287 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 288 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 289 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 290 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 291 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 292 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 293 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 294 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 295 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 296 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 297 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 298 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 299 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 300 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 301 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 302 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 303 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 304 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 305 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 306 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 307 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 308 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 309 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 310 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 311 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 312 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 313 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 314 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 315 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 316 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 317 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 318 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 319 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 320 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 321 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 322 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 323 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 324 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 325 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 326 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 327 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 328 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 329 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 330 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 331 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 332 | 2808606364 | Bacillus sp. SLBN-3 | Isolate | Unclassified |
| 333 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 334 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 335 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 336 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 337 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 338 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 339 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 340 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 341 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 342 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 343 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 344 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 345 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 346 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 347 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 348 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 349 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 350 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 351 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 352 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 353 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 354 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 355 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 356 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 357 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 358 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 359 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 360 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 361 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 362 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 363 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 364 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 365 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 366 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 367 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 368 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 369 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 370 | 2831905167 | Ammoniphilus oxalaticus RAOx-1 | Isolate | Rhizosphere |
| 371 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 372 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 373 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 374 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 375 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 376 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 377 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 378 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 379 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 380 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 381 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 382 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 383 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 384 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 385 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 386 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 387 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 388 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 389 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 390 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 391 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 392 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 393 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 394 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 395 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 396 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 397 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 398 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 399 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 400 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 401 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 402 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 403 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 404 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 405 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 406 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 407 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 408 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 409 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 410 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 411 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 412 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 413 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 414 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 415 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 416 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 417 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 418 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 419 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 420 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 421 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 422 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 423 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 424 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 425 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 426 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 427 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 428 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 429 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 430 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 431 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 432 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 433 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 434 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 435 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 436 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 437 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 438 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 439 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 440 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 441 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 442 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 443 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 444 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 445 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 446 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 447 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 448 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 449 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 450 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 451 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 452 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 453 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 454 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 455 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 456 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 457 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 458 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 459 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 460 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 461 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 462 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 463 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 464 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 465 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 466 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 467 | 2852673933 | Sporosarcina sp. JAI121 | Isolate | Rhizosphere |
| 468 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 469 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 470 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 471 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 472 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 473 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 474 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 475 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 476 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 477 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 478 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 479 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 480 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 481 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 482 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 483 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 484 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 485 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 486 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 487 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 488 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 489 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 490 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 491 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 492 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 493 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 494 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 495 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 496 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 497 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 498 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 499 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 500 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 501 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 502 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 503 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 504 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 505 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 506 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 507 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 508 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 509 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 510 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 511 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 512 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 513 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 514 | 2881636855 | Paenibacillus sp. 7197 | Isolate | Rhizosphere |
| 515 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 516 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 517 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 518 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 519 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 520 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 521 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 522 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 523 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 524 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 525 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 526 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 527 | 2898907183 | Brevibacillus sp. SYP-B805 | Isolate | Rhizosphere |
| 528 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 529 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 530 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 531 | 2904113452 | Paenibacillus paridis py1325 | Isolate | Unclassified |
| 532 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 533 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 534 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 535 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 536 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 537 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 538 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 539 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 540 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 541 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 542 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 543 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 544 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 545 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 546 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 547 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 548 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 549 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 550 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 551 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 552 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 553 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 554 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 555 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 556 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 557 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 558 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 559 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 560 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 561 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 562 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 563 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 564 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 565 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 566 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 567 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 568 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 569 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 570 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 571 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 572 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 573 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 574 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 575 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 576 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 577 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 578 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 579 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 580 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 581 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 582 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 583 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 584 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 585 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 586 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 587 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 588 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 589 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 590 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 591 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 592 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 593 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 594 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 595 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 596 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 597 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 598 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 599 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 600 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 601 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 602 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 603 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 604 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 605 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 606 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 607 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 608 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 609 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 610 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 611 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 612 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 613 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 614 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 615 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 616 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 617 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 618 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 619 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 620 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 621 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 622 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 623 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 624 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 625 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 626 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 627 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 628 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 629 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 630 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 631 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 632 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 633 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 634 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 635 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 636 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 637 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 638 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 639 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 640 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 641 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 642 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 643 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 644 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 645 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 646 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 647 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 648 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 649 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 650 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 651 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 652 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 653 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 654 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 655 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 656 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 657 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 658 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 659 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 660 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 661 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 662 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 663 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 664 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 665 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 666 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 667 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 668 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 669 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 670 | 2941479691 | |||
| 671 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 672 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 673 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 674 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 675 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 676 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 677 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 678 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 679 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 680 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 681 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 682 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 683 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 684 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 685 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 686 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 687 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 688 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 689 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 690 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 691 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 692 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 693 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 694 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 695 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 696 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 697 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 698 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 699 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 700 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 701 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 702 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 703 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 704 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 705 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 706 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 707 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 708 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 709 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 710 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 711 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 712 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 713 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 714 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 715 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 716 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 717 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 718 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 719 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 720 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 721 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 722 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 723 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 724 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 725 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 726 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 727 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 728 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 729 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 730 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 731 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 732 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 733 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 734 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 735 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 736 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 737 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 738 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 739 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 740 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 741 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 742 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 743 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 744 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 745 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 746 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 747 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 748 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 749 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 750 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 751 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 752 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 753 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 754 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 755 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 756 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 757 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 758 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 759 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 760 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 761 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 762 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 763 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 764 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 765 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 766 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 767 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 768 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 769 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 770 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 771 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 772 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 773 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 774 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 775 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 776 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 777 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 778 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 779 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 780 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 781 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 782 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 783 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 784 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 785 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 786 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 787 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 788 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 789 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 790 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 791 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 792 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 793 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 794 | 2971403814 | Paenibacillus tritici LMG 29502 | Isolate | Unclassified |
| 795 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 796 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 797 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 798 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 799 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 800 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 801 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 802 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 803 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 804 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 805 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 806 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 807 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 808 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 809 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 810 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 811 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 812 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 813 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 814 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 815 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 816 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 817 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 818 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 819 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 820 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 821 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 822 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 823 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 824 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 825 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 826 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 827 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 828 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 829 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 830 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 831 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 832 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 833 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 834 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 835 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 836 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 837 | 3001267043 | Bacillus sp. FJAT-49870 | Isolate | Rhizosphere |
| 838 | 3001272096 | Lederbergia citrisecunda FJAT-49732 | Isolate | Rhizosphere |
| 839 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 840 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 841 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 842 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 843 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 844 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 845 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 846 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 847 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 848 | 3006826541 | Bacillus haikouensis CrR16 | Isolate | Unclassified |
| 849 | 3006984091 | Lederbergia citrea FJAT-49754 | Isolate | Rhizosphere |
| 850 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 851 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 852 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 853 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 854 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 855 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 856 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 857 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 858 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 859 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 860 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 861 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 862 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 863 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 864 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 865 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 866 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 867 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 868 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 869 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 870 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 871 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 872 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 873 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 874 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 875 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 876 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 877 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 878 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 879 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 880 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 881 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 882 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 883 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 884 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 885 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 886 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 887 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 888 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 889 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 890 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 891 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 892 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 893 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 894 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 895 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 896 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 897 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 898 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 899 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 900 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 901 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 902 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 903 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 904 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 905 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 906 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 907 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 908 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 909 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 910 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 911 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 912 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 913 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 914 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 915 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 916 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 917 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 918 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 919 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 920 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 921 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 922 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 923 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 924 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 925 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 926 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 927 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 928 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 929 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 930 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 931 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 932 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 933 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 934 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 935 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 936 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 937 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 938 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 939 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 940 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 941 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 942 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 943 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 944 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 945 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 946 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 947 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 948 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 949 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 950 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 951 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 952 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 953 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 954 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 955 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 956 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 957 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 958 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 959 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 960 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 961 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 962 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 963 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 964 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 965 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 966 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 967 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 968 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 969 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 970 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 971 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 972 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 973 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 974 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 975 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 976 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 977 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 978 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 979 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 980 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 981 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 982 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 983 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 984 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 985 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 986 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 987 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 988 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 989 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 990 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 991 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 992 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 993 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 994 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 995 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 996 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 997 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 998 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 999 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 1000 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 1001 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 1002 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 1003 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 1004 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 1005 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 1006 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 1007 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 1008 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 1009 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 1010 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 1011 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 1012 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 1013 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 1014 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 1015 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 1016 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 1017 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 1018 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 1019 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 1020 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1021 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1022 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1023 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1024 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1025 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1026 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 1027 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 1028 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1029 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 1030 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 1031 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 1032 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1033 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1034 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 1035 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 1036 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 1037 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 1038 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1039 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 1040 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 1041 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 1042 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1043 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 1044 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 1045 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 1046 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1047 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 1048 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 1049 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1050 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1051 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1052 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1053 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1054 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1055 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1056 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1057 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1058 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1059 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1060 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1061 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1062 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1063 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1064 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1065 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1066 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1067 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1068 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1069 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1070 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1071 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1072 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1073 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1074 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1075 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1076 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1077 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1078 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1079 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1080 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1081 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1082 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1083 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1084 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1085 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1086 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1087 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1088 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1089 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1090 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1091 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1092 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1093 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1094 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1095 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1096 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1097 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1098 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1099 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1100 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1101 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1102 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1103 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1104 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1105 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1106 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 1107 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1108 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 1109 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1110 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 1111 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1112 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1113 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 1114 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 1115 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 1116 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 1117 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 1118 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 1119 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 1120 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 1121 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 1122 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 1123 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 1124 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 1125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 1126 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 1127 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 1128 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 1129 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 1130 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 1131 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 1132 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 1133 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 1134 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 1135 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 1136 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 1137 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 1138 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 1139 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 1140 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 1141 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 1142 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 1143 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 1144 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 1145 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 1146 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 1147 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 1148 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 1149 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 1150 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 1151 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 1152 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 1153 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 1154 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 1155 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 1156 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 1157 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 1158 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 1159 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 1160 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 1161 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 1162 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 1163 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 1164 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 1165 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 1166 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 1167 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 1168 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 1169 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 1170 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 1171 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 1172 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 1173 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 1174 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 1175 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 1176 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 1177 | 3300044536 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E | Metagenome | Unclassified |
| 1178 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 1179 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 1180 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 1181 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 1182 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 1183 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 1184 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 1185 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 1186 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 1187 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 1188 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 1189 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 1190 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 1191 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 1192 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 1193 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 1194 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 1195 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 1196 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 1197 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 1198 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 1199 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 1200 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 1201 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 1202 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 1203 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 1204 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 1205 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 1206 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 1207 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 1208 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 1209 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 1210 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 1211 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 1212 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 1213 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 1214 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 1215 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 1216 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 1217 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 1218 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 1219 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 1220 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 1221 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 1222 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 1223 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 1224 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 1225 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 1226 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 1227 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 1228 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 1229 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 1230 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 1231 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 1232 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 1233 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 1234 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 1235 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 1236 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 1237 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 1238 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 1239 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 1240 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 1241 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 1242 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 1243 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 1244 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 1245 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 1246 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 1247 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 1248 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 1249 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 1250 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 1251 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 1252 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 1253 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 1254 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 1255 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 1256 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 1257 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 1258 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 1259 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 1260 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 1261 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 1262 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 1263 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 1264 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 1265 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 1266 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 1267 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 1268 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 1269 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 1270 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 1271 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 1272 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 1273 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 1274 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 1275 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 1276 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 1277 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 1278 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 1279 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 1280 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 1281 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 1282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 1283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 1284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 1285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 1286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 1287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 1288 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 1289 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 1290 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 1291 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 1292 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 1293 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 1294 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 1295 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 1296 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 1297 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 1298 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 1299 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 1300 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 1301 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 1302 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 1303 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 1304 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 1305 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 1306 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 1307 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 1308 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1309 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1310 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1311 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1312 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1313 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1314 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1315 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1316 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1317 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1318 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1319 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1320 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1321 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1322 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1323 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1324 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1325 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1326 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1327 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 1328 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 1329 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1330 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 1331 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1332 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1333 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1334 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 1335 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 1336 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 1337 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 1338 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 1339 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 1340 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 1341 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1342 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 1343 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 1344 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1345 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1346 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 1347 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1348 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1349 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 1350 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1351 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 1352 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 1353 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 1354 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 1355 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 1356 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 1357 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1358 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1359 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 1360 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 1361 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 1362 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1363 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1364 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1365 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1366 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1367 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1368 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 1369 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1370 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1371 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1372 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1373 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1374 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1375 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1376 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1377 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1378 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1379 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1380 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1381 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1382 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1383 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1384 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1385 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1386 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1387 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1388 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1389 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1390 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1391 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1392 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1393 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1394 | 8007371054 | Clostridium sp. YIM B02515 | Isolate | Unclassified |
| 1395 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 1396 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 1397 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1398 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1399 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1400 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1401 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 1402 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 1403 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 1404 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 1405 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 1406 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 1407 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 1408 | 8022948649 | Bacillus endophyticus FH5 | Isolate | Rhizosphere |
| 1409 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1410 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1411 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1412 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1413 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 1414 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 1415 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 1416 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 1417 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1418 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 1419 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 1420 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 1421 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 1422 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 1423 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 1424 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 1425 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 1426 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 1427 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 1428 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 1429 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 1430 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 1431 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 1432 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 1433 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 1434 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1435 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1436 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 1437 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 1438 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
| 1439 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
| 1440 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1441 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 66.02 |
| Metatranscriptomes | 0.25 |
| Isolates | 33.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.11 |
| Bulb | 0 |
| Endosphere | 14.13 |
| Nodule | 18.59 |
| Rhizoplane | 2.95 |
| Rhizosphere | 50.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_1574 | 2124908027 | Bacteria | 11607 |
| 2 | MRS2a_Contig_7117 | 2124908027 | Bacteria | 3106 |
| 3 | SwRhRL2b_contig_656453 | 2162886007 | Bacteria | 2013 |
| 4 | LJNas_1000019 | 3300000546 | Bacteria | 21615 |
| 5 | JGI24741J21665_1003171 | 3300001915 | Bacteria | 4018 |
| 6 | JGI24740J21852_10000251 | 3300001979 | Bacteria | 22787 |
| 7 | JGI24740J21852_10025962 | 3300001979 | Bacteria | 1967 |
| 8 | JGI24739J22299_10002246 | 3300001989 | Bacteria | 7425 |
| 9 | JGI24739J22299_10010413 | 3300001989 | Bacteria | 3453 |
| 10 | JGI24739J22299_10016407 | 3300001989 | Bacteria | 2681 |
| 11 | JGI24739J22299_10028970 | 3300001989 | Bacteria | 1929 |
| 12 | JGI24737J22298_10005314 | 3300001990 | Bacteria | 4454 |
| 13 | JGI24737J22298_10013296 | 3300001990 | Bacteria | 2680 |
| 14 | JGI24735J21928_10000746 | 3300002067 | Bacteria | 11582 |
| 15 | JGI24735J21928_10003472 | 3300002067 | Bacteria | 5369 |
| 16 | JGI24735J21928_10034200 | 3300002067 | Bacteria | 1499 |
| 17 | JGI24738J21930_10001078 | 3300002075 | Bacteria | 7735 |
| 18 | JGI25155J39150_1000012 | 3300002704 | Bacteria | 199435 |
| 19 | JGI25155J39150_1000255 | 3300002704 | Bacteria | 20336 |
| 20 | JGI25155J39150_1000546 | 3300002704 | Bacteria | 8569 |
| 21 | JGI25155J39150_1001072 | 3300002704 | Bacteria | 2796 |
| 22 | JGI25156J39149_1000049 | 3300002705 | Bacteria | 91988 |
| 23 | JGI25156J39149_1000527 | 3300002705 | Bacteria | 22068 |
| 24 | JGI25156J39149_1001036 | 3300002705 | Bacteria | 12935 |
| 25 | JGI25156J39149_1002069 | 3300002705 | Bacteria | 7619 |
| 26 | JGI25156J39149_1003564 | 3300002705 | Bacteria | 5047 |
| 27 | JGI25156J39149_1003955 | 3300002705 | Bacteria | 4682 |
| 28 | JGI25162J39368_1000063 | 3300002737 | Bacteria | 134747 |
| 29 | JGI25162J39368_1000287 | 3300002737 | Bacteria | 47192 |
| 30 | JGI25162J39368_1000421 | 3300002737 | Bacteria | 34311 |
| 31 | JGI25162J39368_1000753 | 3300002737 | Bacteria | 22009 |
| 32 | JGI25162J39368_1001046 | 3300002737 | Bacteria | 17014 |
| 33 | JGI25162J39368_1002965 | 3300002737 | Bacteria | 5663 |
| 34 | JGI25154J39366_1000033 | 3300002738 | Bacteria | 184379 |
| 35 | JGI25154J39366_1000732 | 3300002738 | Bacteria | 14765 |
| 36 | JGI25154J39366_1000768 | 3300002738 | Bacteria | 14234 |
| 37 | JGI25154J39366_1005939 | 3300002738 | Bacteria | 1861 |
| 38 | JGI25158J39367_1000032 | 3300002739 | Bacteria | 30976 |
| 39 | JGI25157J39369_1000055 | 3300002741 | Bacteria | 107875 |
| 40 | JGI25157J39369_1000217 | 3300002741 | Bacteria | 47210 |
| 41 | JGI25157J39369_1000549 | 3300002741 | Bacteria | 22462 |
| 42 | JGI25157J39369_1001301 | 3300002741 | Bacteria | 9988 |
| 43 | JGI25163J39215_1000201 | 3300002771 | Bacteria | 23245 |
| 44 | JGI25163J39215_1000677 | 3300002771 | Bacteria | 9056 |
| 45 | JGI25164J39214_1000064 | 3300002772 | Bacteria | 107073 |
| 46 | JGI25164J39214_1000296 | 3300002772 | Bacteria | 34311 |
| 47 | JGI25164J39214_1000412 | 3300002772 | Bacteria | 24378 |
| 48 | JGI25164J39214_1000586 | 3300002772 | Bacteria | 16340 |
| 49 | JGI25164J39214_1000672 | 3300002772 | Bacteria | 13810 |
| 50 | JGI25152J39213_1004254 | 3300002773 | Bacteria | 4575 |
| 51 | JGI25152J39213_1008986 | 3300002773 | Bacteria | 2419 |
| 52 | JGI25152J39213_1008994 | 3300002773 | Bacteria | 2416 |
| 53 | JGI25152J39213_1011389 | 3300002773 | Bacteria | 1970 |
| 54 | JGI25150J39212_1008933 | 3300002774 | Bacteria | 1935 |
| 55 | JGI25159J45721_1000052 | 3300002987 | Bacteria | 57175 |
| 56 | JGI25159J45721_1000123 | 3300002987 | Bacteria | 36902 |
| 57 | JGI25159J45721_1001948 | 3300002987 | Bacteria | 8221 |
| 58 | JGI25151J46595_10000611 | 3300003187 | Bacteria | 31284 |
| 59 | JGI25151J46595_10005785 | 3300003187 | Bacteria | 6329 |
| 60 | JGI25151J46595_10016124 | 3300003187 | Bacteria | 3274 |
| 61 | JGI25151J46595_10036121 | 3300003187 | Bacteria | 1868 |
| 62 | JGI25165J46597_1000035 | 3300003214 | Bacteria | 290723 |
| 63 | JGI25165J46597_1000069 | 3300003214 | Bacteria | 195460 |
| 64 | JGI25165J46597_1000388 | 3300003214 | Bacteria | 47192 |
| 65 | JGI25165J46597_1000528 | 3300003214 | Bacteria | 35737 |
| 66 | JGI25165J46597_1001054 | 3300003214 | Bacteria | 17773 |
| 67 | JGI25165J46597_1001292 | 3300003214 | Bacteria | 14518 |
| 68 | JGI25165J46597_1005308 | 3300003214 | Bacteria | 2516 |
| 69 | JGI25153J46596_10000670 | 3300003215 | Bacteria | 20957 |
| 70 | JGI25153J46596_10001189 | 3300003215 | Bacteria | 15728 |
| 71 | JGI25153J46596_10003140 | 3300003215 | Bacteria | 9317 |
| 72 | JGI25153J46596_10021317 | 3300003215 | Bacteria | 2419 |
| 73 | JGI25153J46596_10021348 | 3300003215 | Bacteria | 2416 |
| 74 | JGI25153J46596_10029685 | 3300003215 | Bacteria | 1873 |
| 75 | JGI25160J50197_1000006 | 3300003354 | Bacteria | 316247 |
| 76 | JGI25160J50197_1000007 | 3300003354 | Bacteria | 316012 |
| 77 | JGI25160J50197_1000112 | 3300003354 | Bacteria | 76612 |
| 78 | JGI25161J50226_1000004 | 3300003374 | Bacteria | 316212 |
| 79 | JGI25161J50226_1000129 | 3300003374 | Bacteria | 53598 |
| 80 | JGI25161J50226_1000648 | 3300003374 | Bacteria | 13978 |
| 81 | JGI25161J50226_1005966 | 3300003374 | Bacteria | 2270 |
| 82 | Ga0006562J51391_1183124 | 3300003578 | Bacteria | 5180 |
| 83 | Ga0006562J51391_1183125 | 3300003578 | Bacteria | 4980 |
| 84 | Ga0055538_1000008 | 3300003751 | Bacteria | 398547 |
| 85 | Ga0055538_1000012 | 3300003751 | Bacteria | 353826 |
| 86 | Ga0055538_1000034 | 3300003751 | Bacteria | 195460 |
| 87 | Ga0055539_1000012 | 3300003752 | Bacteria | 398547 |
| 88 | Ga0055539_1000017 | 3300003752 | Bacteria | 353873 |
| 89 | Ga0055539_1000044 | 3300003752 | Bacteria | 195460 |
| 90 | Ga0055539_1001291 | 3300003752 | Bacteria | 4933 |
| 91 | Ga0055539_1006155 | 3300003752 | Bacteria | 1539 |
| 92 | Ga0055533_1000015 | 3300003756 | Bacteria | 398547 |
| 93 | Ga0055533_1000021 | 3300003756 | Bacteria | 353826 |
| 94 | Ga0055533_1000055 | 3300003756 | Bacteria | 195460 |
| 95 | Ga0055533_1001195 | 3300003756 | Bacteria | 7277 |
| 96 | Ga0055533_1001332 | 3300003756 | Bacteria | 6686 |
| 97 | Ga0055533_1001997 | 3300003756 | Bacteria | 4973 |
| 98 | Ga0055532_1000005 | 3300003758 | Bacteria | 458107 |
| 99 | Ga0055532_1000012 | 3300003758 | Bacteria | 382698 |
| 100 | Ga0055532_1000020 | 3300003758 | Bacteria | 270853 |
| 101 | Ga0055525_1000017 | 3300003759 | Bacteria | 398547 |
| 102 | Ga0055525_1000043 | 3300003759 | Bacteria | 268656 |
| 103 | Ga0055525_1000066 | 3300003759 | Bacteria | 195460 |
| 104 | Ga0055525_1000117 | 3300003759 | Bacteria | 120690 |
| 105 | Ga0055527_1000011 | 3300003760 | Bacteria | 354560 |
| 106 | Ga0055527_1000226 | 3300003760 | Bacteria | 36179 |
| 107 | Ga0055527_1000243 | 3300003760 | Bacteria | 33717 |
| 108 | Ga0055527_1005570 | 3300003760 | Bacteria | 1629 |
| 109 | Ga0055535_1000009 | 3300003761 | Bacteria | 382698 |
| 110 | Ga0055535_1000335 | 3300003761 | Bacteria | 47184 |
| 111 | Ga0055535_1000515 | 3300003761 | Bacteria | 33711 |
| 112 | Ga0055535_1000518 | 3300003761 | Bacteria | 33624 |
| 113 | Ga0055535_1000629 | 3300003761 | Bacteria | 28178 |
| 114 | Ga0055535_1001383 | 3300003761 | Bacteria | 12604 |
| 115 | Ga0055542_1000015 | 3300003762 | Bacteria | 382698 |
| 116 | Ga0055542_1000363 | 3300003762 | Bacteria | 47192 |
| 117 | Ga0055542_1000393 | 3300003762 | Bacteria | 43699 |
| 118 | Ga0055542_1000434 | 3300003762 | Bacteria | 40153 |
| 119 | Ga0055542_1000537 | 3300003762 | Bacteria | 33711 |
| 120 | Ga0055542_1000661 | 3300003762 | Bacteria | 28178 |
| 121 | Ga0055529_1000011 | 3300003763 | Bacteria | 382698 |
| 122 | Ga0055529_1000391 | 3300003763 | Bacteria | 47192 |
| 123 | Ga0055529_1000409 | 3300003763 | Bacteria | 45120 |
| 124 | Ga0055529_1000519 | 3300003763 | Bacteria | 33717 |
| 125 | Ga0055529_1000601 | 3300003763 | Bacteria | 27817 |
| 126 | Ga0055526_1001100 | 3300003771 | Bacteria | 19639 |
| 127 | Ga0055526_1002853 | 3300003771 | Bacteria | 11397 |
| 128 | Ga0055526_1003392 | 3300003771 | Bacteria | 10146 |
| 129 | Ga0055526_1004773 | 3300003771 | Bacteria | 8026 |
| 130 | Ga0055526_1010390 | 3300003771 | Bacteria | 4336 |
| 131 | Ga0055526_1017002 | 3300003771 | Bacteria | 2807 |
| 132 | Ga0055537_1000426 | 3300003773 | Bacteria | 27485 |
| 133 | Ga0055524_1000262 | 3300003775 | Bacteria | 53062 |
| 134 | Ga0055524_1000376 | 3300003775 | Bacteria | 38929 |
| 135 | Ga0055524_1000429 | 3300003775 | Bacteria | 35268 |
| 136 | Ga0055524_1011159 | 3300003775 | Bacteria | 3531 |
| 137 | Ga0055536_1000126 | 3300003781 | Bacteria | 65482 |
| 138 | Ga0055536_1000519 | 3300003781 | Bacteria | 26575 |
| 139 | Ga0055536_1000581 | 3300003781 | Bacteria | 24895 |
| 140 | Ga0055536_1002169 | 3300003781 | Bacteria | 11186 |
| 141 | Ga0055536_1004583 | 3300003781 | Bacteria | 7009 |
| 142 | Ga0055536_1014189 | 3300003781 | Bacteria | 2817 |
| 143 | Ga0055534_1000518 | 3300003784 | Bacteria | 20801 |
| 144 | Ga0055528_1000040 | 3300003790 | Bacteria | 112553 |
| 145 | Ga0055528_1000186 | 3300003790 | Bacteria | 52663 |
| 146 | Ga0055528_1000718 | 3300003790 | Bacteria | 23387 |
| 147 | Ga0055528_1002246 | 3300003790 | Bacteria | 10517 |
| 148 | Ga0055528_1002418 | 3300003790 | Bacteria | 10030 |
| 149 | Ga0055528_1003731 | 3300003790 | Bacteria | 7516 |
| 150 | Ga0055528_1005253 | 3300003790 | Bacteria | 6075 |
| 151 | Ga0055528_1006219 | 3300003790 | Bacteria | 5438 |
| 152 | Ga0055530_10000132 | 3300003791 | Bacteria | 65482 |
| 153 | Ga0055530_10000240 | 3300003791 | Bacteria | 49322 |
| 154 | Ga0055530_10000671 | 3300003791 | Bacteria | 29135 |
| 155 | Ga0055530_10000778 | 3300003791 | Bacteria | 26608 |
| 156 | Ga0055530_10001374 | 3300003791 | Bacteria | 18030 |
| 157 | Ga0055530_10007126 | 3300003791 | Bacteria | 4791 |
| 158 | Ga0055540_1000248 | 3300003792 | Bacteria | 49322 |
| 159 | Ga0055540_1000400 | 3300003792 | Bacteria | 35238 |
| 160 | Ga0055540_1000780 | 3300003792 | Bacteria | 21598 |
| 161 | Ga0055540_1000954 | 3300003792 | Bacteria | 18781 |
| 162 | Ga0055540_1004383 | 3300003792 | Bacteria | 6397 |
| 163 | Ga0055540_1004497 | 3300003792 | Bacteria | 6256 |
| 164 | Ga0055540_1006733 | 3300003792 | Bacteria | 4497 |
| 165 | Ga0055531_10004609 | 3300003794 | Bacteria | 8294 |
| 166 | Ga0055531_10005677 | 3300003794 | Bacteria | 7242 |
| 167 | Ga0055531_10006687 | 3300003794 | Bacteria | 6463 |
| 168 | Ga0055531_10029714 | 3300003794 | Bacteria | 1854 |
| 169 | Ga0055541_1000009 | 3300003841 | Bacteria | 398547 |
| 170 | Ga0055541_1000012 | 3300003841 | Bacteria | 353826 |
| 171 | Ga0055541_1000032 | 3300003841 | Bacteria | 195460 |
| 172 | Ga0058692_1000009 | 3300003856 | Bacteria | 349545 |
| 173 | Ga0058692_1001699 | 3300003856 | Bacteria | 7887 |
| 174 | Ga0058692_1011584 | 3300003856 | Bacteria | 2124 |
| 175 | Ga0055543_1000002 | 3300004625 | Bacteria | 390020 |
| 176 | Ga0055543_1000029 | 3300004625 | Bacteria | 131452 |
| 177 | Ga0055543_1000120 | 3300004625 | Bacteria | 66419 |
| 178 | Ga0065165_1000011 | 3300005262 | Bacteria | 316465 |
| 179 | Ga0065165_1000340 | 3300005262 | Bacteria | 76653 |
| 180 | Ga0065165_1001337 | 3300005262 | Bacteria | 27348 |
| 181 | Ga0065165_1005342 | 3300005262 | Bacteria | 7296 |
| 182 | Ga0065165_1005358 | 3300005262 | Bacteria | 7274 |
| 183 | Ga0065165_1005608 | 3300005262 | Bacteria | 6953 |
| 184 | Ga0065165_1013531 | 3300005262 | Bacteria | 3236 |
| 185 | Ga0065714_10000104 | 3300005288 | Bacteria | 10640 |
| 186 | Ga0065714_10003301 | 3300005288 | Bacteria | 14194 |
| 187 | Ga0065704_10009257 | 3300005289 | Bacteria | 4670 |
| 188 | Ga0065704_10070222 | 3300005289 | Bacteria | 63342 |
| 189 | Ga0065712_10000132 | 3300005290 | Bacteria | 73390 |
| 190 | Ga0065712_10007303 | 3300005290 | Bacteria | 3605 |
| 191 | Ga0065712_10090203 | 3300005290 | Bacteria | 2403 |
| 192 | Ga0070658_10028890 | 3300005327 | Bacteria | 4452 |
| 193 | Ga0070658_10063809 | 3300005327 | Bacteria | 3004 |
| 194 | Ga0070683_100021797 | 3300005329 | Bacteria | 5720 |
| 195 | Ga0070690_100035152 | 3300005330 | Bacteria | 3144 |
| 196 | Ga0070670_100000258 | 3300005331 | Bacteria | 47306 |
| 197 | Ga0070670_100001188 | 3300005331 | Bacteria | 20637 |
| 198 | Ga0070670_100001386 | 3300005331 | Bacteria | 19431 |
| 199 | Ga0068869_100001960 | 3300005334 | Bacteria | 12331 |
| 200 | Ga0068869_100200683 | 3300005334 | Bacteria | 1573 |
| 201 | Ga0070666_10000016 | 3300005335 | Bacteria | 198246 |
| 202 | Ga0070666_10016846 | 3300005335 | Bacteria | 4679 |
| 203 | Ga0070680_100010046 | 3300005336 | Bacteria | 7291 |
| 204 | Ga0070682_100003944 | 3300005337 | Bacteria | 8239 |
| 205 | Ga0070682_100091778 | 3300005337 | Bacteria | 1988 |
| 206 | Ga0070660_100000056 | 3300005339 | Bacteria | 66748 |
| 207 | Ga0070660_100001525 | 3300005339 | Bacteria | 15894 |
| 208 | Ga0070660_100030905 | 3300005339 | Bacteria | 4019 |
| 209 | Ga0070660_100097668 | 3300005339 | Bacteria | 2324 |
| 210 | Ga0070660_100105084 | 3300005339 | Bacteria | 2240 |
| 211 | Ga0070660_100114547 | 3300005339 | Bacteria | 2148 |
| 212 | Ga0070689_100020485 | 3300005340 | Bacteria | 4908 |
| 213 | Ga0070661_100000146 | 3300005344 | Bacteria | 58043 |
| 214 | Ga0070661_100023158 | 3300005344 | Bacteria | 4450 |
| 215 | Ga0070661_100028844 | 3300005344 | Bacteria | 4004 |
| 216 | Ga0070661_100190829 | 3300005344 | Bacteria | 1563 |
| 217 | Ga0070668_100004033 | 3300005347 | Bacteria | 10859 |
| 218 | Ga0070668_100024332 | 3300005347 | Bacteria | 4587 |
| 219 | Ga0070669_100000153 | 3300005353 | Bacteria | 62355 |
| 220 | Ga0070669_100029899 | 3300005353 | Bacteria | 3929 |
| 221 | Ga0070675_100039079 | 3300005354 | Bacteria | 3870 |
| 222 | Ga0070675_100345761 | 3300005354 | Bacteria | 1318 |
| 223 | Ga0070671_100003307 | 3300005355 | Bacteria | 12581 |
| 224 | Ga0070671_100046175 | 3300005355 | Bacteria | 3622 |
| 225 | Ga0070671_100151417 | 3300005355 | Bacteria | 1959 |
| 226 | Ga0070673_100020736 | 3300005364 | Bacteria | 4745 |
| 227 | Ga0070673_100021478 | 3300005364 | Bacteria | 4681 |
| 228 | Ga0070688_100047145 | 3300005365 | Bacteria | 2672 |
| 229 | Ga0070688_100117600 | 3300005365 | Bacteria | 1776 |
| 230 | Ga0070659_100000079 | 3300005366 | Bacteria | 74255 |
| 231 | Ga0070659_100018894 | 3300005366 | Bacteria | 5207 |
| 232 | Ga0070659_100022360 | 3300005366 | Bacteria | 4827 |
| 233 | Ga0070659_100217375 | 3300005366 | Bacteria | 1576 |
| 234 | Ga0070659_100350853 | 3300005366 | Bacteria | 1238 |
| 235 | Ga0070667_100061137 | 3300005367 | Bacteria | 3189 |
| 236 | Ga0070667_100101645 | 3300005367 | Bacteria | 2484 |
| 237 | Ga0070667_100112641 | 3300005367 | Bacteria | 2360 |
| 238 | Ga0070667_100117535 | 3300005367 | Bacteria | 2310 |
| 239 | Ga0070667_100235784 | 3300005367 | Bacteria | 1632 |
| 240 | Ga0070714_100033331 | 3300005435 | Bacteria | 4305 |
| 241 | Ga0070714_100054626 | 3300005435 | Bacteria | 3412 |
| 242 | Ga0070713_100166217 | 3300005436 | Bacteria | 1973 |
| 243 | Ga0070663_100027442 | 3300005455 | Bacteria | 3867 |
| 244 | Ga0070663_100142519 | 3300005455 | Bacteria | 1831 |
| 245 | Ga0070678_100009479 | 3300005456 | Bacteria | 5903 |
| 246 | Ga0070678_100016310 | 3300005456 | Bacteria | 4750 |
| 247 | Ga0070678_100034861 | 3300005456 | Bacteria | 3508 |
| 248 | Ga0070678_100221508 | 3300005456 | Bacteria | 1573 |
| 249 | Ga0070662_100000562 | 3300005457 | Bacteria | 22575 |
| 250 | Ga0070662_100009714 | 3300005457 | Bacteria | 6296 |
| 251 | Ga0070681_10058975 | 3300005458 | Bacteria | 3818 |
| 252 | Ga0070681_10117591 | 3300005458 | Bacteria | 2595 |
| 253 | Ga0070681_10424763 | 3300005458 | Bacteria | 1241 |
| 254 | Ga0068867_100002132 | 3300005459 | Bacteria | 13898 |
| 255 | Ga0068867_100039853 | 3300005459 | Bacteria | 3426 |
| 256 | Ga0070679_100012938 | 3300005530 | Bacteria | 7992 |
| 257 | Ga0070679_100013191 | 3300005530 | Bacteria | 7910 |
| 258 | Ga0070679_100326600 | 3300005530 | Bacteria | 1483 |
| 259 | Ga0070684_100001235 | 3300005535 | Bacteria | 18342 |
| 260 | Ga0068853_100000184 | 3300005539 | Bacteria | 43882 |
| 261 | Ga0068853_100003976 | 3300005539 | Bacteria | 11360 |
| 262 | Ga0068853_100117246 | 3300005539 | Bacteria | 2371 |
| 263 | Ga0070672_100107480 | 3300005543 | Bacteria | 2270 |
| 264 | Ga0070665_100000322 | 3300005548 | Bacteria | 73995 |
| 265 | Ga0070665_100012164 | 3300005548 | Bacteria | 8676 |
| 266 | Ga0070665_100012285 | 3300005548 | Bacteria | 8632 |
| 267 | Ga0070665_100019293 | 3300005548 | Bacteria | 6841 |
| 268 | Ga0070665_100022869 | 3300005548 | Bacteria | 6293 |
| 269 | Ga0070665_100034909 | 3300005548 | Bacteria | 5059 |
| 270 | Ga0070665_100165839 | 3300005548 | Bacteria | 2211 |
| 271 | Ga0068855_100000423 | 3300005563 | Bacteria | 52174 |
| 272 | Ga0068855_100000557 | 3300005563 | Bacteria | 45786 |
| 273 | Ga0068855_100003248 | 3300005563 | Bacteria | 19878 |
| 274 | Ga0068855_100008781 | 3300005563 | Bacteria | 12214 |
| 275 | Ga0068855_100015021 | 3300005563 | Bacteria | 9326 |
| 276 | Ga0068855_100070479 | 3300005563 | Bacteria | 4067 |
| 277 | Ga0068855_100098068 | 3300005563 | Bacteria | 3376 |
| 278 | Ga0068855_100106722 | 3300005563 | Bacteria | 3218 |
| 279 | Ga0068855_100183432 | 3300005563 | Bacteria | 2365 |
| 280 | Ga0068855_100193924 | 3300005563 | Bacteria | 2289 |
| 281 | Ga0068855_100247353 | 3300005563 | Bacteria | 1990 |
| 282 | Ga0068855_100408244 | 3300005563 | Bacteria | 1487 |
| 283 | Ga0070664_100000049 | 3300005564 | Bacteria | 71805 |
| 284 | Ga0070664_100055289 | 3300005564 | Bacteria | 3369 |
| 285 | Ga0068857_100008513 | 3300005577 | Bacteria | 8870 |
| 286 | Ga0068857_100122495 | 3300005577 | Bacteria | 2342 |
| 287 | Ga0068857_100143152 | 3300005577 | Bacteria | 2162 |
| 288 | Ga0068854_100000054 | 3300005578 | Bacteria | 84435 |
| 289 | Ga0068854_100000699 | 3300005578 | Bacteria | 19878 |
| 290 | Ga0068854_100002224 | 3300005578 | Bacteria | 11931 |
| 291 | Ga0068854_100065113 | 3300005578 | Bacteria | 2649 |
| 292 | Ga0068854_100072572 | 3300005578 | Bacteria | 2520 |
| 293 | Ga0068856_100000157 | 3300005614 | Bacteria | 70380 |
| 294 | Ga0068856_100010013 | 3300005614 | Bacteria | 9207 |
| 295 | Ga0068856_100023950 | 3300005614 | Bacteria | 5938 |
| 296 | Ga0068856_100071585 | 3300005614 | Bacteria | 3432 |
| 297 | Ga0068856_100191047 | 3300005614 | Bacteria | 2061 |
| 298 | Ga0068856_100206281 | 3300005614 | Bacteria | 1980 |
| 299 | Ga0068852_100001139 | 3300005616 | Bacteria | 17577 |
| 300 | Ga0068852_100004003 | 3300005616 | Bacteria | 10362 |
| 301 | Ga0068852_100012051 | 3300005616 | Bacteria | 6544 |
| 302 | Ga0068852_100030384 | 3300005616 | Bacteria | 4446 |
| 303 | Ga0068852_100114517 | 3300005616 | Bacteria | 2457 |
| 304 | Ga0068852_100245786 | 3300005616 | Bacteria | 1712 |
| 305 | Ga0068859_100011168 | 3300005617 | Bacteria | 9029 |
| 306 | Ga0068864_100005889 | 3300005618 | Bacteria | 10046 |
| 307 | Ga0068866_10024422 | 3300005718 | Bacteria | 2826 |
| 308 | Ga0068861_100013381 | 3300005719 | Bacteria | 5742 |
| 309 | Ga0068851_10000018 | 3300005834 | Bacteria | 137425 |
| 310 | Ga0068851_10140346 | 3300005834 | Bacteria | 1314 |
| 311 | Ga0068870_10027147 | 3300005840 | Bacteria | 2861 |
| 312 | Ga0068863_100007163 | 3300005841 | Bacteria | 10940 |
| 313 | Ga0068858_100024178 | 3300005842 | Bacteria | 5661 |
| 314 | Ga0068858_100069161 | 3300005842 | Bacteria | 3273 |
| 315 | Ga0068860_100012152 | 3300005843 | Bacteria | 8482 |
| 316 | Ga0068860_100018457 | 3300005843 | Bacteria | 6785 |
| 317 | Ga0068860_100070809 | 3300005843 | Bacteria | 3315 |
| 318 | Ga0068860_100250939 | 3300005843 | Bacteria | 1723 |
| 319 | Ga0075368_10017657 | 3300006042 | Bacteria | 2673 |
| 320 | Ga0075364_10005396 | 3300006051 | Bacteria | 7424 |
| 321 | Ga0075432_10000316 | 3300006058 | Bacteria | 13593 |
| 322 | Ga0075432_10008546 | 3300006058 | Bacteria | 3493 |
| 323 | Ga0075362_10054628 | 3300006177 | Bacteria | 1795 |
| 324 | Ga0075367_10171404 | 3300006178 | Bacteria | 1352 |
| 325 | Ga0075367_10203499 | 3300006178 | Bacteria | 1237 |
| 326 | Ga0075369_10018610 | 3300006186 | Bacteria | 2830 |
| 327 | Ga0075369_10065045 | 3300006186 | Bacteria | 1598 |
| 328 | Ga0075366_10001966 | 3300006195 | Bacteria | 10401 |
| 329 | Ga0097621_100002735 | 3300006237 | Bacteria | 12065 |
| 330 | Ga0097621_100012639 | 3300006237 | Bacteria | 6266 |
| 331 | Ga0097621_100025700 | 3300006237 | Bacteria | 4609 |
| 332 | Ga0097621_100028731 | 3300006237 | Bacteria | 4386 |
| 333 | Ga0097621_100062541 | 3300006237 | Bacteria | 3056 |
| 334 | Ga0097621_100101894 | 3300006237 | Bacteria | 2416 |
| 335 | Ga0075370_10000591 | 3300006353 | Bacteria | 14005 |
| 336 | Ga0075370_10021524 | 3300006353 | Bacteria | 3533 |
| 337 | Ga0068871_100000329 | 3300006358 | Bacteria | 33127 |
| 338 | Ga0068871_100011348 | 3300006358 | Bacteria | 6532 |
| 339 | Ga0068871_100035210 | 3300006358 | Bacteria | 3976 |
| 340 | Ga0068871_100057184 | 3300006358 | Bacteria | 3173 |
| 341 | Ga0068871_100128774 | 3300006358 | Bacteria | 2144 |
| 342 | Ga0075436_100109924 | 3300006914 | Bacteria | 1923 |
| 343 | Ga0097620_100011168 | 3300006931 | Bacteria | 9029 |
| 344 | Ga0079104_1000029 | 3300006946 | Bacteria | 207648 |
| 345 | Ga0079104_1000094 | 3300006946 | Bacteria | 130202 |
| 346 | Ga0079104_1000668 | 3300006946 | Bacteria | 32257 |
| 347 | Ga0079104_1004551 | 3300006946 | Bacteria | 5876 |
| 348 | Ga0099826_10038409 | 3300006948 | Bacteria | 3363 |
| 349 | Ga0105251_10000018 | 3300009011 | Bacteria | 142493 |
| 350 | Ga0105251_10000047 | 3300009011 | Bacteria | 110996 |
| 351 | Ga0105251_10000830 | 3300009011 | Bacteria | 27671 |
| 352 | Ga0105251_10001501 | 3300009011 | Bacteria | 20033 |
| 353 | Ga0105251_10001601 | 3300009011 | Bacteria | 19275 |
| 354 | Ga0105251_10001924 | 3300009011 | Bacteria | 17001 |
| 355 | Ga0105251_10002823 | 3300009011 | Bacteria | 13136 |
| 356 | Ga0105251_10004604 | 3300009011 | Bacteria | 9313 |
| 357 | Ga0105251_10011096 | 3300009011 | Bacteria | 5168 |
| 358 | Ga0105251_10014064 | 3300009011 | Bacteria | 4444 |
| 359 | Ga0105251_10016548 | 3300009011 | Bacteria | 3981 |
| 360 | Ga0105244_10001003 | 3300009036 | Bacteria | 23674 |
| 361 | Ga0105244_10002401 | 3300009036 | Bacteria | 14159 |
| 362 | Ga0105244_10013196 | 3300009036 | Bacteria | 4839 |
| 363 | Ga0105244_10014374 | 3300009036 | Bacteria | 4580 |
| 364 | Ga0105244_10014929 | 3300009036 | Bacteria | 4470 |
| 365 | Ga0105244_10023477 | 3300009036 | Bacteria | 3380 |
| 366 | Ga0105244_10031272 | 3300009036 | Bacteria | 2825 |
| 367 | Ga0105244_10045022 | 3300009036 | Bacteria | 2271 |
| 368 | Ga0105244_10045134 | 3300009036 | Bacteria | 2268 |
| 369 | Ga0105244_10045584 | 3300009036 | Bacteria | 2255 |
| 370 | Ga0105244_10052161 | 3300009036 | Bacteria | 2083 |
| 371 | Ga0105244_10055493 | 3300009036 | Bacteria | 2007 |
| 372 | Ga0105244_10067421 | 3300009036 | Bacteria | 1790 |
| 373 | Ga0105244_10099880 | 3300009036 | Bacteria | 1420 |
| 374 | Ga0105250_10000068 | 3300009092 | Bacteria | 98087 |
| 375 | Ga0105250_10000550 | 3300009092 | Bacteria | 25618 |
| 376 | Ga0105250_10002212 | 3300009092 | Bacteria | 9912 |
| 377 | Ga0105250_10002526 | 3300009092 | Bacteria | 9168 |
| 378 | Ga0105250_10004938 | 3300009092 | Bacteria | 6048 |
| 379 | Ga0105240_10000019 | 3300009093 | Bacteria | 406211 |
| 380 | Ga0105240_10001844 | 3300009093 | Bacteria | 35489 |
| 381 | Ga0105240_10005342 | 3300009093 | Bacteria | 19161 |
| 382 | Ga0105240_10014642 | 3300009093 | Bacteria | 10701 |
| 383 | Ga0105240_10017316 | 3300009093 | Bacteria | 9714 |
| 384 | Ga0105240_10020280 | 3300009093 | Bacteria | 8873 |
| 385 | Ga0105240_10038888 | 3300009093 | Bacteria | 6099 |
| 386 | Ga0105240_10041264 | 3300009093 | Bacteria | 5892 |
| 387 | Ga0105240_10092593 | 3300009093 | Bacteria | 3690 |
| 388 | Ga0105240_10171679 | 3300009093 | Bacteria | 2568 |
| 389 | Ga0105240_10179199 | 3300009093 | Bacteria | 2502 |
| 390 | Ga0105240_10194506 | 3300009093 | Bacteria | 2382 |
| 391 | Ga0105240_10243222 | 3300009093 | Bacteria | 2085 |
| 392 | Ga0105240_10305407 | 3300009093 | Bacteria | 1819 |
| 393 | Ga0105245_10009081 | 3300009098 | Bacteria | 8662 |
| 394 | Ga0105243_10001011 | 3300009148 | Bacteria | 25990 |
| 395 | Ga0105243_10005184 | 3300009148 | Bacteria | 10204 |
| 396 | Ga0105243_10005610 | 3300009148 | Bacteria | 9776 |
| 397 | Ga0105243_10124727 | 3300009148 | Bacteria | 2177 |
| 398 | Ga0105241_10031368 | 3300009174 | Bacteria | 3979 |
| 399 | Ga0105241_10152069 | 3300009174 | Bacteria | 1894 |
| 400 | Ga0105242_10001632 | 3300009176 | Bacteria | 17700 |
| 401 | Ga0105242_10006325 | 3300009176 | Bacteria | 9124 |
| 402 | Ga0105242_10007441 | 3300009176 | Bacteria | 8430 |
| 403 | Ga0105242_10228868 | 3300009176 | Bacteria | 1665 |
| 404 | Ga0105248_10001466 | 3300009177 | Bacteria | 26259 |
| 405 | Ga0105248_10002239 | 3300009177 | Bacteria | 21390 |
| 406 | Ga0105248_10002548 | 3300009177 | Bacteria | 20287 |
| 407 | Ga0105248_10020178 | 3300009177 | Bacteria | 7383 |
| 408 | Ga0105248_10063147 | 3300009177 | Bacteria | 4157 |
| 409 | Ga0105248_10211088 | 3300009177 | Bacteria | 2187 |
| 410 | Ga0105237_10000036 | 3300009545 | Bacteria | 191142 |
| 411 | Ga0105237_10000136 | 3300009545 | Bacteria | 103269 |
| 412 | Ga0105237_10002463 | 3300009545 | Bacteria | 22970 |
| 413 | Ga0105237_10037085 | 3300009545 | Bacteria | 4929 |
| 414 | Ga0105237_10163901 | 3300009545 | Bacteria | 2222 |
| 415 | Ga0105237_10167368 | 3300009545 | Bacteria | 2197 |
| 416 | Ga0105237_10175660 | 3300009545 | Bacteria | 2142 |
| 417 | Ga0105238_10000062 | 3300009551 | Bacteria | 126356 |
| 418 | Ga0105238_10000315 | 3300009551 | Bacteria | 52804 |
| 419 | Ga0105238_10013811 | 3300009551 | Bacteria | 8163 |
| 420 | Ga0105238_10018759 | 3300009551 | Bacteria | 7044 |
| 421 | Ga0105238_10025026 | 3300009551 | Bacteria | 6085 |
| 422 | Ga0105238_10025120 | 3300009551 | Bacteria | 6072 |
| 423 | Ga0105238_10033604 | 3300009551 | Bacteria | 5220 |
| 424 | Ga0105238_10136732 | 3300009551 | Bacteria | 2428 |
| 425 | Ga0105238_10262947 | 3300009551 | Bacteria | 1705 |
| 426 | Ga0105238_10320567 | 3300009551 | Bacteria | 1536 |
| 427 | Ga0105238_10333921 | 3300009551 | Bacteria | 1503 |
| 428 | Ga0105249_10001344 | 3300009553 | Bacteria | 21505 |
| 429 | Ga0123341_1000015 | 3300009765 | Bacteria | 86184 |
| 430 | Ga0123342_1014946 | 3300009766 | Bacteria | 7243 |
| 431 | Ga0123342_1024353 | 3300009766 | Bacteria | 3799 |
| 432 | Ga0105239_10008574 | 3300010375 | Bacteria | 11600 |
| 433 | Ga0105239_10009998 | 3300010375 | Bacteria | 10643 |
| 434 | Ga0105239_10052225 | 3300010375 | Bacteria | 4482 |
| 435 | Ga0105239_10061307 | 3300010375 | Bacteria | 4128 |
| 436 | Ga0105239_10089130 | 3300010375 | Bacteria | 3402 |
| 437 | Ga0105239_10274540 | 3300010375 | Bacteria | 1896 |
| 438 | Ga0105239_10499777 | 3300010375 | Bacteria | 1382 |
| 439 | Ga0105246_10000322 | 3300011119 | Bacteria | 25369 |
| 440 | Ga0105246_10002126 | 3300011119 | Bacteria | 11943 |
| 441 | Ga0105246_10014150 | 3300011119 | Bacteria | 5013 |
| 442 | Ga0105246_10027154 | 3300011119 | Bacteria | 3747 |
| 443 | Ga0157322_1000407 | 3300012490 | Bacteria | 1554 |
| 444 | Ga0157345_1000091 | 3300012498 | Bacteria | 19224 |
| 445 | Ga0157347_1005371 | 3300012502 | Bacteria | 1222 |
| 446 | Ga0157373_10000139 | 3300013100 | Bacteria | 57722 |
| 447 | Ga0157373_10000568 | 3300013100 | Bacteria | 28815 |
| 448 | Ga0157373_10004735 | 3300013100 | Bacteria | 10233 |
| 449 | Ga0157373_10024574 | 3300013100 | Bacteria | 4364 |
| 450 | Ga0157373_10061803 | 3300013100 | Bacteria | 2653 |
| 451 | Ga0157373_10062418 | 3300013100 | Bacteria | 2639 |
| 452 | Ga0157373_10148867 | 3300013100 | Bacteria | 1647 |
| 453 | Ga0157371_10000592 | 3300013102 | Bacteria | 43090 |
| 454 | Ga0157371_10003098 | 3300013102 | Bacteria | 15412 |
| 455 | Ga0157371_10006317 | 3300013102 | Bacteria | 9812 |
| 456 | Ga0157371_10006521 | 3300013102 | Bacteria | 9603 |
| 457 | Ga0157371_10008173 | 3300013102 | Bacteria | 8367 |
| 458 | Ga0157371_10009793 | 3300013102 | Bacteria | 7516 |
| 459 | Ga0157371_10010625 | 3300013102 | Bacteria | 7152 |
| 460 | Ga0157371_10033820 | 3300013102 | Bacteria | 3671 |
| 461 | Ga0157371_10097255 | 3300013102 | Bacteria | 2087 |
| 462 | Ga0157371_10114821 | 3300013102 | Bacteria | 1912 |
| 463 | Ga0157370_10003077 | 3300013104 | Bacteria | 19768 |
| 464 | Ga0157370_10010853 | 3300013104 | Bacteria | 9567 |
| 465 | Ga0157370_10014219 | 3300013104 | Bacteria | 8155 |
| 466 | Ga0157370_10020670 | 3300013104 | Bacteria | 6570 |
| 467 | Ga0157370_10024308 | 3300013104 | Bacteria | 6001 |
| 468 | Ga0157370_10049765 | 3300013104 | Bacteria | 4009 |
| 469 | Ga0157370_10056432 | 3300013104 | Bacteria | 3738 |
| 470 | Ga0157370_10065537 | 3300013104 | Bacteria | 3437 |
| 471 | Ga0157370_10077206 | 3300013104 | Bacteria | 3138 |
| 472 | Ga0157370_10136690 | 3300013104 | Bacteria | 2284 |
| 473 | Ga0157370_10137004 | 3300013104 | Bacteria | 2281 |
| 474 | Ga0157370_10166021 | 3300013104 | Bacteria | 2053 |
| 475 | Ga0157369_10000280 | 3300013105 | Bacteria | 68583 |
| 476 | Ga0157369_10000525 | 3300013105 | Bacteria | 50581 |
| 477 | Ga0157369_10001737 | 3300013105 | Bacteria | 26487 |
| 478 | Ga0157369_10001978 | 3300013105 | Bacteria | 24687 |
| 479 | Ga0157369_10003683 | 3300013105 | Bacteria | 18212 |
| 480 | Ga0157369_10005341 | 3300013105 | Bacteria | 14968 |
| 481 | Ga0157369_10005760 | 3300013105 | Bacteria | 14401 |
| 482 | Ga0157369_10020129 | 3300013105 | Bacteria | 7462 |
| 483 | Ga0157369_10083106 | 3300013105 | Bacteria | 3425 |
| 484 | Ga0157369_10159836 | 3300013105 | Bacteria | 2378 |
| 485 | Ga0157369_10170224 | 3300013105 | Bacteria | 2295 |
| 486 | Ga0157369_10359731 | 3300013105 | Unclassified | 1511 |
| 487 | Ga0171463_1002 | 3300013249 | Bacteria | 1274851 |
| 488 | Ga0157374_10000138 | 3300013296 | Bacteria | 65783 |
| 489 | Ga0157374_10011805 | 3300013296 | Bacteria | 7578 |
| 490 | Ga0157374_10041310 | 3300013296 | Bacteria | 4250 |
| 491 | Ga0157378_10004718 | 3300013297 | Bacteria | 11951 |
| 492 | Ga0163162_10000239 | 3300013306 | Bacteria | 50190 |
| 493 | Ga0163162_10000495 | 3300013306 | Bacteria | 36598 |
| 494 | Ga0163162_10001215 | 3300013306 | Bacteria | 24072 |
| 495 | Ga0163162_10135717 | 3300013306 | Bacteria | 2571 |
| 496 | Ga0163162_10142660 | 3300013306 | Bacteria | 2509 |
| 497 | Ga0163162_10182204 | 3300013306 | Bacteria | 2227 |
| 498 | Ga0163162_10258243 | 3300013306 | Bacteria | 1874 |
| 499 | Ga0157372_10008403 | 3300013307 | Bacteria | 10966 |
| 500 | Ga0157372_10026402 | 3300013307 | Bacteria | 6320 |
| 501 | Ga0157372_10043798 | 3300013307 | Bacteria | 4958 |
| 502 | Ga0157375_10002515 | 3300013308 | Bacteria | 15908 |
| 503 | Ga0157375_10006746 | 3300013308 | Bacteria | 9997 |
| 504 | Ga0157375_10106507 | 3300013308 | Bacteria | 2895 |
| 505 | Ga0157375_10275268 | 3300013308 | Bacteria | 1845 |
| 506 | Ga0163163_10214452 | 3300014325 | Bacteria | 1974 |
| 507 | Ga0163163_10375587 | 3300014325 | Bacteria | 1479 |
| 508 | Ga0163163_10431371 | 3300014325 | Bacteria | 1377 |
| 509 | Ga0157380_10012577 | 3300014326 | Bacteria | 6141 |
| 510 | Ga0157380_10111126 | 3300014326 | Bacteria | 2303 |
| 511 | Ga0182008_10000023 | 3300014497 | Bacteria | 201526 |
| 512 | Ga0182008_10001995 | 3300014497 | Bacteria | 13100 |
| 513 | Ga0182008_10002602 | 3300014497 | Bacteria | 11209 |
| 514 | Ga0182008_10009442 | 3300014497 | Bacteria | 5263 |
| 515 | Ga0182008_10014834 | 3300014497 | Bacteria | 4075 |
| 516 | Ga0182008_10022340 | 3300014497 | Bacteria | 3240 |
| 517 | Ga0182008_10027070 | 3300014497 | Bacteria | 2906 |
| 518 | Ga0182008_10033767 | 3300014497 | Bacteria | 2567 |
| 519 | Ga0157379_10044263 | 3300014968 | Bacteria | 3973 |
| 520 | Ga0157379_10275823 | 3300014968 | Bacteria | 1530 |
| 521 | Ga0157376_10011819 | 3300014969 | Bacteria | 6455 |
| 522 | Ga0157376_10025582 | 3300014969 | Bacteria | 4651 |
| 523 | Ga0157376_10025908 | 3300014969 | Bacteria | 4625 |
| 524 | Ga0157376_10109183 | 3300014969 | Bacteria | 2432 |
| 525 | Ga0182006_1000404 | 3300015261 | Bacteria | 35006 |
| 526 | Ga0182006_1000808 | 3300015261 | Bacteria | 20962 |
| 527 | Ga0182006_1000967 | 3300015261 | Bacteria | 19035 |
| 528 | Ga0182006_1006793 | 3300015261 | Bacteria | 5279 |
| 529 | Ga0182006_1053038 | 3300015261 | Bacteria | 1556 |
| 530 | Ga0182007_10000965 | 3300015262 | Bacteria | 15786 |
| 531 | Ga0182007_10003252 | 3300015262 | Bacteria | 7728 |
| 532 | Ga0182007_10003543 | 3300015262 | Bacteria | 7352 |
| 533 | Ga0182007_10030438 | 3300015262 | Bacteria | 1845 |
| 534 | Ga0182005_1000758 | 3300015265 | Bacteria | 14754 |
| 535 | Ga0182005_1003308 | 3300015265 | Bacteria | 5505 |
| 536 | Ga0182005_1013990 | 3300015265 | Bacteria | 2251 |
| 537 | Ga0182005_1016131 | 3300015265 | Bacteria | 2079 |
| 538 | Ga0182005_1021282 | 3300015265 | Bacteria | 1780 |
| 539 | Ga0183369_1011 | 3300015685 | Bacteria | 252490 |
| 540 | Ga0183368_1007 | 3300015687 | Bacteria | 405609 |
| 541 | Ga0183363_1106 | 3300015690 | Bacteria | 23641 |
| 542 | Ga0183361_10001 | 3300016635 | Bacteria | 908583 |
| 543 | Ga0163161_10001737 | 3300017792 | Bacteria | 15947 |
| 544 | Ga0163161_10025774 | 3300017792 | Bacteria | 4164 |
| 545 | Ga0163161_10071262 | 3300017792 | Bacteria | 2543 |
| 546 | Ga0163161_10117200 | 3300017792 | Bacteria | 1997 |
| 547 | Ga0163161_10138268 | 3300017792 | Bacteria | 1843 |
| 548 | Ga0206356_10061609 | 3300020070 | Bacteria | 3827 |
| 549 | Ga0206356_11616746 | 3300020070 | Bacteria | 3414 |
| 550 | Ga0206353_11840038 | 3300020082 | Bacteria | 4348 |
| 551 | Ga0213876_10101399 | 3300021384 | Bacteria | 1526 |
| 552 | Ga0224712_10000090 | 3300022467 | Bacteria | 14205 |
| 553 | Ga0228711_1005754 | 3300022739 | Bacteria | 18767 |
| 554 | Ga0228711_1032337 | 3300022739 | Bacteria | 2464 |
| 555 | Ga0228710_1006542 | 3300022740 | Bacteria | 17603 |
| 556 | Ga0228710_1031661 | 3300022740 | Bacteria | 2464 |
| 557 | Ga0209435_100004 | 3300025206 | Bacteria | 633417 |
| 558 | Ga0209435_100005 | 3300025206 | Bacteria | 573745 |
| 559 | Ga0209435_100866 | 3300025206 | Bacteria | 4653 |
| 560 | Ga0209760_100114 | 3300025207 | Bacteria | 57573 |
| 561 | Ga0209760_100340 | 3300025207 | Bacteria | 13643 |
| 562 | Ga0209436_100026 | 3300025208 | Bacteria | 90859 |
| 563 | Ga0209784_100005 | 3300025224 | Bacteria | 1040422 |
| 564 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 565 | Ga0209784_100049 | 3300025224 | Bacteria | 195512 |
| 566 | Ga0209784_100164 | 3300025224 | Bacteria | 57421 |
| 567 | Ga0209566_100005 | 3300025225 | Bacteria | 1040422 |
| 568 | Ga0209566_100009 | 3300025225 | Bacteria | 554018 |
| 569 | Ga0209566_100061 | 3300025225 | Bacteria | 195512 |
| 570 | Ga0209566_100212 | 3300025225 | Bacteria | 59180 |
| 571 | Ga0209566_102109 | 3300025225 | Bacteria | 4082 |
| 572 | Ga0209674_100009 | 3300025226 | Bacteria | 1040422 |
| 573 | Ga0209674_100013 | 3300025226 | Bacteria | 813140 |
| 574 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 575 | Ga0209674_100037 | 3300025226 | Bacteria | 404339 |
| 576 | Ga0209674_100059 | 3300025226 | Bacteria | 282517 |
| 577 | Ga0209674_100069 | 3300025226 | Bacteria | 243948 |
| 578 | Ga0209674_100163 | 3300025226 | Bacteria | 86638 |
| 579 | Ga0209674_100437 | 3300025226 | Bacteria | 19539 |
| 580 | Ga0209674_100560 | 3300025226 | Bacteria | 14677 |
| 581 | Ga0209674_101415 | 3300025226 | Bacteria | 6410 |
| 582 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 583 | Ga0209672_100008 | 3300025228 | Bacteria | 946876 |
| 584 | Ga0209672_100010 | 3300025228 | Bacteria | 873151 |
| 585 | Ga0209672_100046 | 3300025228 | Bacteria | 264244 |
| 586 | Ga0209672_100047 | 3300025228 | Bacteria | 250925 |
| 587 | Ga0209672_100121 | 3300025228 | Bacteria | 83609 |
| 588 | Ga0209672_100272 | 3300025228 | Bacteria | 37908 |
| 589 | Ga0209672_101050 | 3300025228 | Bacteria | 11845 |
| 590 | Ga0209672_101871 | 3300025228 | Bacteria | 6222 |
| 591 | Ga0209147_100006 | 3300025229 | Bacteria | 873276 |
| 592 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 593 | Ga0209147_100011 | 3300025229 | Bacteria | 702140 |
| 594 | Ga0209147_100043 | 3300025229 | Bacteria | 300460 |
| 595 | Ga0209147_100059 | 3300025229 | Bacteria | 250891 |
| 596 | Ga0209147_100172 | 3300025229 | Bacteria | 84617 |
| 597 | Ga0209563_100012 | 3300025230 | Bacteria | 1040422 |
| 598 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 599 | Ga0209563_100036 | 3300025230 | Bacteria | 448275 |
| 600 | Ga0209563_100083 | 3300025230 | Bacteria | 195512 |
| 601 | Ga0209563_100379 | 3300025230 | Bacteria | 16079 |
| 602 | Ga0209563_101790 | 3300025230 | Bacteria | 5348 |
| 603 | Ga0209563_102726 | 3300025230 | Bacteria | 3878 |
| 604 | Ga0207427_100008 | 3300025231 | Bacteria | 740731 |
| 605 | Ga0207427_100037 | 3300025231 | Bacteria | 303108 |
| 606 | Ga0207427_100084 | 3300025231 | Bacteria | 142663 |
| 607 | Ga0207427_100134 | 3300025231 | Bacteria | 91077 |
| 608 | Ga0207427_101852 | 3300025231 | Bacteria | 6686 |
| 609 | Ga0207427_101954 | 3300025231 | Bacteria | 6328 |
| 610 | Ga0207427_103135 | 3300025231 | Bacteria | 3710 |
| 611 | Ga0209437_100005 | 3300025233 | Bacteria | 1071596 |
| 612 | Ga0209437_100014 | 3300025233 | Bacteria | 740714 |
| 613 | Ga0209437_100037 | 3300025233 | Bacteria | 459730 |
| 614 | Ga0209437_100078 | 3300025233 | Bacteria | 278088 |
| 615 | Ga0209437_100084 | 3300025233 | Bacteria | 255423 |
| 616 | Ga0209437_100091 | 3300025233 | Bacteria | 243344 |
| 617 | Ga0209437_100197 | 3300025233 | Bacteria | 120813 |
| 618 | Ga0209437_100213 | 3300025233 | Bacteria | 107087 |
| 619 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 620 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 621 | Ga0209258_100008 | 3300025242 | Bacteria | 1009355 |
| 622 | Ga0209258_100010 | 3300025242 | Bacteria | 873276 |
| 623 | Ga0209258_100023 | 3300025242 | Bacteria | 547286 |
| 624 | Ga0209258_100034 | 3300025242 | Bacteria | 437372 |
| 625 | Ga0209258_100057 | 3300025242 | Bacteria | 334259 |
| 626 | Ga0209258_100106 | 3300025242 | Bacteria | 206622 |
| 627 | Ga0209258_100172 | 3300025242 | Bacteria | 144895 |
| 628 | Ga0209258_100237 | 3300025242 | Bacteria | 102220 |
| 629 | Ga0209258_100441 | 3300025242 | Bacteria | 46899 |
| 630 | Ga0209258_100792 | 3300025242 | Bacteria | 18794 |
| 631 | Ga0209258_101200 | 3300025242 | Bacteria | 10284 |
| 632 | Ga0207425_1003167 | 3300025245 | Bacteria | 5382 |
| 633 | Ga0207425_1003464 | 3300025245 | Bacteria | 5042 |
| 634 | Ga0207425_1005523 | 3300025245 | Bacteria | 3591 |
| 635 | Ga0209646_1000011 | 3300025246 | Bacteria | 573745 |
| 636 | Ga0209646_1000032 | 3300025246 | Bacteria | 375315 |
| 637 | Ga0209646_1000052 | 3300025246 | Bacteria | 286370 |
| 638 | Ga0209646_1000442 | 3300025246 | Bacteria | 22332 |
| 639 | Ga0209646_1000895 | 3300025246 | Bacteria | 9727 |
| 640 | Ga0209646_1001329 | 3300025246 | Bacteria | 6884 |
| 641 | Ga0209646_1001788 | 3300025246 | Bacteria | 5375 |
| 642 | Ga0209646_1002158 | 3300025246 | Bacteria | 4565 |
| 643 | Ga0209026_1000008 | 3300025250 | Bacteria | 573745 |
| 644 | Ga0209026_1000045 | 3300025250 | Bacteria | 263431 |
| 645 | Ga0209026_1000062 | 3300025250 | Bacteria | 213298 |
| 646 | Ga0209026_1000187 | 3300025250 | Bacteria | 90872 |
| 647 | Ga0209026_1000223 | 3300025250 | Bacteria | 77328 |
| 648 | Ga0209026_1000761 | 3300025250 | Bacteria | 18064 |
| 649 | Ga0209026_1003142 | 3300025250 | Bacteria | 5616 |
| 650 | Ga0209677_100006 | 3300025253 | Bacteria | 1040422 |
| 651 | Ga0209677_100012 | 3300025253 | Bacteria | 554018 |
| 652 | Ga0209677_100039 | 3300025253 | Bacteria | 243974 |
| 653 | Ga0209677_100916 | 3300025253 | Bacteria | 14407 |
| 654 | Ga0209677_102832 | 3300025253 | Bacteria | 6133 |
| 655 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 656 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 657 | Ga0209148_1000018 | 3300025254 | Bacteria | 756247 |
| 658 | Ga0209148_1000025 | 3300025254 | Bacteria | 663262 |
| 659 | Ga0209148_1000029 | 3300025254 | Bacteria | 579199 |
| 660 | Ga0209148_1000042 | 3300025254 | Bacteria | 464111 |
| 661 | Ga0209148_1000053 | 3300025254 | Bacteria | 373506 |
| 662 | Ga0209148_1000068 | 3300025254 | Bacteria | 335510 |
| 663 | Ga0209148_1000925 | 3300025254 | Bacteria | 19445 |
| 664 | Ga0209148_1005322 | 3300025254 | Bacteria | 2974 |
| 665 | Ga0209759_1000004 | 3300025256 | Bacteria | 573745 |
| 666 | Ga0209759_1000054 | 3300025256 | Bacteria | 211422 |
| 667 | Ga0209759_1000132 | 3300025256 | Bacteria | 127521 |
| 668 | Ga0209759_1000181 | 3300025256 | Bacteria | 103230 |
| 669 | Ga0209759_1000185 | 3300025256 | Bacteria | 100505 |
| 670 | Ga0209759_1000212 | 3300025256 | Bacteria | 89756 |
| 671 | Ga0209759_1000303 | 3300025256 | Bacteria | 67661 |
| 672 | Ga0209759_1001491 | 3300025256 | Bacteria | 12985 |
| 673 | Ga0209759_1001499 | 3300025256 | Bacteria | 12890 |
| 674 | Ga0209759_1001939 | 3300025256 | Bacteria | 10058 |
| 675 | Ga0209759_1002853 | 3300025256 | Bacteria | 7286 |
| 676 | Ga0209759_1003544 | 3300025256 | Bacteria | 6178 |
| 677 | Ga0209759_1010084 | 3300025256 | Bacteria | 2796 |
| 678 | Ga0209759_1019960 | 3300025256 | Bacteria | 1572 |
| 679 | Ga0209129_1000203 | 3300025258 | Bacteria | 70739 |
| 680 | Ga0209129_1000755 | 3300025258 | Bacteria | 20560 |
| 681 | Ga0209129_1001047 | 3300025258 | Bacteria | 16324 |
| 682 | Ga0209129_1001557 | 3300025258 | Bacteria | 12606 |
| 683 | Ga0209129_1001808 | 3300025258 | Bacteria | 11359 |
| 684 | Ga0209129_1001861 | 3300025258 | Bacteria | 11151 |
| 685 | Ga0209129_1001919 | 3300025258 | Bacteria | 10930 |
| 686 | Ga0209129_1002692 | 3300025258 | Bacteria | 8353 |
| 687 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 688 | Ga0209233_1000006 | 3300025261 | Bacteria | 1473685 |
| 689 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 690 | Ga0209233_1000011 | 3300025261 | Bacteria | 1071611 |
| 691 | Ga0209233_1000093 | 3300025261 | Bacteria | 306016 |
| 692 | Ga0209233_1000096 | 3300025261 | Bacteria | 303482 |
| 693 | Ga0209233_1000115 | 3300025261 | Bacteria | 243344 |
| 694 | Ga0209233_1000163 | 3300025261 | Bacteria | 152912 |
| 695 | Ga0209233_1000199 | 3300025261 | Bacteria | 123684 |
| 696 | Ga0209233_1000397 | 3300025261 | Bacteria | 36444 |
| 697 | Ga0209565_1000024 | 3300025263 | Bacteria | 379907 |
| 698 | Ga0209565_1014397 | 3300025263 | Bacteria | 1819 |
| 699 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 700 | Ga0209455_1000007 | 3300025272 | Bacteria | 1157983 |
| 701 | Ga0209455_1000015 | 3300025272 | Bacteria | 756128 |
| 702 | Ga0209455_1000016 | 3300025272 | Bacteria | 753097 |
| 703 | Ga0209455_1000054 | 3300025272 | Bacteria | 358936 |
| 704 | Ga0209455_1000064 | 3300025272 | Bacteria | 332404 |
| 705 | Ga0209455_1006243 | 3300025272 | Bacteria | 3549 |
| 706 | Ga0209673_1000037 | 3300025273 | Bacteria | 313804 |
| 707 | Ga0209673_1000115 | 3300025273 | Bacteria | 176939 |
| 708 | Ga0209673_1000222 | 3300025273 | Bacteria | 112605 |
| 709 | Ga0209673_1000237 | 3300025273 | Bacteria | 106342 |
| 710 | Ga0209673_1000670 | 3300025273 | Bacteria | 49698 |
| 711 | Ga0209673_1001021 | 3300025273 | Bacteria | 33411 |
| 712 | Ga0209673_1007680 | 3300025273 | Bacteria | 4916 |
| 713 | Ga0209673_1009725 | 3300025273 | Bacteria | 4130 |
| 714 | Ga0209673_1032481 | 3300025273 | Bacteria | 1607 |
| 715 | Ga0209130_1000030 | 3300025284 | Bacteria | 323323 |
| 716 | Ga0209130_1000032 | 3300025284 | Bacteria | 316240 |
| 717 | Ga0209130_1000033 | 3300025284 | Bacteria | 316064 |
| 718 | Ga0209130_1002498 | 3300025284 | Bacteria | 9091 |
| 719 | Ga0209130_1011655 | 3300025284 | Bacteria | 2343 |
| 720 | Ga0209675_1000011 | 3300025291 | Bacteria | 520597 |
| 721 | Ga0209675_1019504 | 3300025291 | Bacteria | 1864 |
| 722 | Ga0209675_1021539 | 3300025291 | Bacteria | 1717 |
| 723 | Ga0209675_1023592 | 3300025291 | Bacteria | 1590 |
| 724 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 725 | Ga0209676_1000011 | 3300025292 | Bacteria | 860463 |
| 726 | Ga0209676_1000021 | 3300025292 | Bacteria | 609534 |
| 727 | Ga0209676_1000345 | 3300025292 | Bacteria | 88051 |
| 728 | Ga0209676_1000440 | 3300025292 | Bacteria | 71013 |
| 729 | Ga0209676_1000605 | 3300025292 | Bacteria | 52680 |
| 730 | Ga0209676_1001461 | 3300025292 | Bacteria | 22119 |
| 731 | Ga0209676_1004038 | 3300025292 | Bacteria | 8449 |
| 732 | Ga0209676_1008671 | 3300025292 | Bacteria | 4496 |
| 733 | Ga0209676_1015940 | 3300025292 | Bacteria | 2741 |
| 734 | Ga0209025_1000032 | 3300025294 | Bacteria | 416141 |
| 735 | Ga0209025_1000044 | 3300025294 | Bacteria | 349480 |
| 736 | Ga0209025_1000354 | 3300025294 | Bacteria | 98665 |
| 737 | Ga0209025_1000864 | 3300025294 | Bacteria | 47865 |
| 738 | Ga0209025_1001447 | 3300025294 | Bacteria | 31156 |
| 739 | Ga0209025_1003821 | 3300025294 | Bacteria | 13747 |
| 740 | Ga0209025_1005184 | 3300025294 | Bacteria | 10770 |
| 741 | Ga0209025_1029298 | 3300025294 | Bacteria | 2668 |
| 742 | Ga0209025_1032266 | 3300025294 | Bacteria | 2453 |
| 743 | Ga0209025_1036238 | 3300025294 | Bacteria | 2213 |
| 744 | Ga0209564_1000079 | 3300025295 | Bacteria | 266525 |
| 745 | Ga0209564_1000207 | 3300025295 | Bacteria | 135313 |
| 746 | Ga0209564_1000258 | 3300025295 | Bacteria | 112586 |
| 747 | Ga0209564_1000379 | 3300025295 | Bacteria | 81420 |
| 748 | Ga0209564_1000490 | 3300025295 | Bacteria | 65811 |
| 749 | Ga0209564_1002591 | 3300025295 | Bacteria | 13871 |
| 750 | Ga0209564_1005577 | 3300025295 | Bacteria | 7103 |
| 751 | Ga0209564_1021889 | 3300025295 | Bacteria | 2280 |
| 752 | Ga0209564_1022583 | 3300025295 | Bacteria | 2217 |
| 753 | Ga0209758_1000008 | 3300025297 | Bacteria | 1215263 |
| 754 | Ga0209758_1000586 | 3300025297 | Bacteria | 56819 |
| 755 | Ga0209758_1000674 | 3300025297 | Bacteria | 50969 |
| 756 | Ga0209758_1000983 | 3300025297 | Bacteria | 38351 |
| 757 | Ga0209758_1001007 | 3300025297 | Bacteria | 37395 |
| 758 | Ga0209758_1001098 | 3300025297 | Bacteria | 35006 |
| 759 | Ga0209758_1001230 | 3300025297 | Bacteria | 32053 |
| 760 | Ga0209758_1001815 | 3300025297 | Bacteria | 23598 |
| 761 | Ga0209758_1004625 | 3300025297 | Bacteria | 11285 |
| 762 | Ga0209758_1015519 | 3300025297 | Bacteria | 3935 |
| 763 | Ga0209758_1022030 | 3300025297 | Bacteria | 2942 |
| 764 | Ga0209050_1000032 | 3300025298 | Bacteria | 456335 |
| 765 | Ga0209050_1000081 | 3300025298 | Bacteria | 267533 |
| 766 | Ga0209050_1000162 | 3300025298 | Bacteria | 155309 |
| 767 | Ga0209050_1000227 | 3300025298 | Bacteria | 123743 |
| 768 | Ga0209050_1001253 | 3300025298 | Bacteria | 29284 |
| 769 | Ga0209050_1001540 | 3300025298 | Bacteria | 24193 |
| 770 | Ga0209050_1001731 | 3300025298 | Bacteria | 21722 |
| 771 | Ga0209050_1002704 | 3300025298 | Bacteria | 14408 |
| 772 | Ga0209050_1003537 | 3300025298 | Bacteria | 11399 |
| 773 | Ga0209050_1009731 | 3300025298 | Bacteria | 4865 |
| 774 | Ga0209256_1000202 | 3300025299 | Bacteria | 112605 |
| 775 | Ga0209256_1000709 | 3300025299 | Bacteria | 44332 |
| 776 | Ga0209256_1000893 | 3300025299 | Bacteria | 36710 |
| 777 | Ga0209256_1000950 | 3300025299 | Bacteria | 35138 |
| 778 | Ga0209256_1001345 | 3300025299 | Bacteria | 26077 |
| 779 | Ga0209256_1001793 | 3300025299 | Bacteria | 20278 |
| 780 | Ga0209256_1001832 | 3300025299 | Bacteria | 19843 |
| 781 | Ga0209256_1008649 | 3300025299 | Bacteria | 4663 |
| 782 | Ga0209256_1010324 | 3300025299 | Bacteria | 3931 |
| 783 | Ga0209256_1013528 | 3300025299 | Bacteria | 3019 |
| 784 | Ga0207426_1000007 | 3300025302 | Bacteria | 971011 |
| 785 | Ga0207426_1000047 | 3300025302 | Bacteria | 417011 |
| 786 | Ga0207426_1000077 | 3300025302 | Bacteria | 316246 |
| 787 | Ga0207426_1000078 | 3300025302 | Bacteria | 316064 |
| 788 | Ga0207426_1000296 | 3300025302 | Bacteria | 98032 |
| 789 | Ga0207426_1001188 | 3300025302 | Bacteria | 23185 |
| 790 | Ga0209051_1000104 | 3300025303 | Bacteria | 161001 |
| 791 | Ga0209051_1000121 | 3300025303 | Bacteria | 146477 |
| 792 | Ga0209051_1000164 | 3300025303 | Bacteria | 124186 |
| 793 | Ga0209051_1000202 | 3300025303 | Bacteria | 106010 |
| 794 | Ga0209051_1000710 | 3300025303 | Bacteria | 36523 |
| 795 | Ga0209051_1000908 | 3300025303 | Bacteria | 29447 |
| 796 | Ga0209051_1000909 | 3300025303 | Bacteria | 29436 |
| 797 | Ga0209051_1001365 | 3300025303 | Bacteria | 21092 |
| 798 | Ga0209051_1003501 | 3300025303 | Bacteria | 10266 |
| 799 | Ga0209051_1005522 | 3300025303 | Bacteria | 7372 |
| 800 | Ga0209051_1013475 | 3300025303 | Bacteria | 3890 |
| 801 | Ga0209051_1021653 | 3300025303 | Bacteria | 2727 |
| 802 | Ga0209051_1030693 | 3300025303 | Bacteria | 2081 |
| 803 | Ga0209051_1030965 | 3300025303 | Bacteria | 2067 |
| 804 | Ga0209257_1000014 | 3300025304 | Bacteria | 946850 |
| 805 | Ga0209257_1000040 | 3300025304 | Bacteria | 538759 |
| 806 | Ga0209257_1000065 | 3300025304 | Bacteria | 353604 |
| 807 | Ga0209257_1000121 | 3300025304 | Bacteria | 222588 |
| 808 | Ga0209257_1000356 | 3300025304 | Bacteria | 93656 |
| 809 | Ga0209257_1000452 | 3300025304 | Bacteria | 77144 |
| 810 | Ga0209257_1001064 | 3300025304 | Bacteria | 36288 |
| 811 | Ga0209257_1004058 | 3300025304 | Bacteria | 11755 |
| 812 | Ga0209257_1004137 | 3300025304 | Bacteria | 11561 |
| 813 | Ga0209257_1007238 | 3300025304 | Bacteria | 6788 |
| 814 | Ga0209257_1012983 | 3300025304 | Bacteria | 3765 |
| 815 | Ga0209257_1013555 | 3300025304 | Bacteria | 3609 |
| 816 | Ga0209257_1028082 | 3300025304 | Bacteria | 1858 |
| 817 | Ga0207656_10000009 | 3300025321 | Bacteria | 245637 |
| 818 | Ga0207696_1000097 | 3300025711 | Bacteria | 175696 |
| 819 | Ga0207696_1000152 | 3300025711 | Bacteria | 119512 |
| 820 | Ga0207696_1000165 | 3300025711 | Bacteria | 104683 |
| 821 | Ga0207696_1001780 | 3300025711 | Bacteria | 11122 |
| 822 | Ga0207696_1001993 | 3300025711 | Bacteria | 10346 |
| 823 | Ga0207655_1000021 | 3300025728 | Bacteria | 518596 |
| 824 | Ga0207655_1000603 | 3300025728 | Bacteria | 43527 |
| 825 | Ga0207655_1000652 | 3300025728 | Bacteria | 41403 |
| 826 | Ga0207655_1000772 | 3300025728 | Bacteria | 35772 |
| 827 | Ga0207655_1000931 | 3300025728 | Bacteria | 30378 |
| 828 | Ga0207655_1003483 | 3300025728 | Bacteria | 11691 |
| 829 | Ga0207655_1012890 | 3300025728 | Bacteria | 4840 |
| 830 | Ga0207655_1017528 | 3300025728 | Bacteria | 3858 |
| 831 | Ga0207655_1018487 | 3300025728 | Bacteria | 3692 |
| 832 | Ga0207655_1022739 | 3300025728 | Bacteria | 3130 |
| 833 | Ga0207655_1029630 | 3300025728 | Bacteria | 2559 |
| 834 | Ga0207713_1000009 | 3300025735 | Bacteria | 551314 |
| 835 | Ga0207713_1000041 | 3300025735 | Bacteria | 244768 |
| 836 | Ga0207713_1000692 | 3300025735 | Bacteria | 31614 |
| 837 | Ga0207713_1001034 | 3300025735 | Bacteria | 24156 |
| 838 | Ga0207713_1001400 | 3300025735 | Bacteria | 19498 |
| 839 | Ga0207713_1002103 | 3300025735 | Bacteria | 14852 |
| 840 | Ga0207713_1002787 | 3300025735 | Bacteria | 12350 |
| 841 | Ga0207713_1003713 | 3300025735 | Bacteria | 10262 |
| 842 | Ga0207713_1003965 | 3300025735 | Bacteria | 9815 |
| 843 | Ga0207713_1006559 | 3300025735 | Bacteria | 7063 |
| 844 | Ga0207713_1007252 | 3300025735 | Bacteria | 6582 |
| 845 | Ga0207713_1008559 | 3300025735 | Bacteria | 5873 |
| 846 | Ga0207713_1010947 | 3300025735 | Bacteria | 4979 |
| 847 | Ga0207713_1017746 | 3300025735 | Bacteria | 3551 |
| 848 | Ga0207642_10017216 | 3300025899 | Bacteria | 2743 |
| 849 | Ga0207680_10000003 | 3300025903 | Bacteria | 925264 |
| 850 | Ga0207680_10010848 | 3300025903 | Bacteria | 4576 |
| 851 | Ga0207647_10000406 | 3300025904 | Bacteria | 35299 |
| 852 | Ga0207647_10005179 | 3300025904 | Bacteria | 9593 |
| 853 | Ga0207647_10006150 | 3300025904 | Bacteria | 8742 |
| 854 | Ga0207647_10020784 | 3300025904 | Bacteria | 4396 |
| 855 | Ga0207647_10047493 | 3300025904 | Bacteria | 2670 |
| 856 | Ga0207645_10020432 | 3300025907 | Bacteria | 4335 |
| 857 | Ga0207645_10025328 | 3300025907 | Bacteria | 3839 |
| 858 | Ga0207643_10021300 | 3300025908 | Bacteria | 3560 |
| 859 | Ga0207643_10028023 | 3300025908 | Bacteria | 3125 |
| 860 | Ga0207643_10074720 | 3300025908 | Bacteria | 1955 |
| 861 | Ga0207705_10002609 | 3300025909 | Bacteria | 13838 |
| 862 | Ga0207705_10013348 | 3300025909 | Bacteria | 5925 |
| 863 | Ga0207705_10013783 | 3300025909 | Bacteria | 5829 |
| 864 | Ga0207705_10035760 | 3300025909 | Bacteria | 3554 |
| 865 | Ga0207705_10040318 | 3300025909 | Bacteria | 3348 |
| 866 | Ga0207705_10055162 | 3300025909 | Bacteria | 2865 |
| 867 | Ga0207705_10109084 | 3300025909 | Bacteria | 2043 |
| 868 | Ga0207654_10019928 | 3300025911 | Bacteria | 3547 |
| 869 | Ga0207654_10024194 | 3300025911 | Bacteria | 3262 |
| 870 | Ga0207707_10052033 | 3300025912 | Bacteria | 3566 |
| 871 | Ga0207695_10000049 | 3300025913 | Bacteria | 406233 |
| 872 | Ga0207695_10000429 | 3300025913 | Bacteria | 92640 |
| 873 | Ga0207695_10001702 | 3300025913 | Bacteria | 35225 |
| 874 | Ga0207695_10003515 | 3300025913 | Bacteria | 21943 |
| 875 | Ga0207695_10005252 | 3300025913 | Bacteria | 17289 |
| 876 | Ga0207695_10011740 | 3300025913 | Bacteria | 10579 |
| 877 | Ga0207695_10012415 | 3300025913 | Bacteria | 10229 |
| 878 | Ga0207695_10021072 | 3300025913 | Bacteria | 7444 |
| 879 | Ga0207695_10026274 | 3300025913 | Bacteria | 6499 |
| 880 | Ga0207695_10133729 | 3300025913 | Bacteria | 2435 |
| 881 | Ga0207695_10141210 | 3300025913 | Bacteria | 2357 |
| 882 | Ga0207695_10249740 | 3300025913 | Bacteria | 1674 |
| 883 | Ga0207695_10316730 | 3300025913 | Bacteria | 1450 |
| 884 | Ga0207671_10000059 | 3300025914 | Bacteria | 179761 |
| 885 | Ga0207671_10000135 | 3300025914 | Bacteria | 112401 |
| 886 | Ga0207671_10000556 | 3300025914 | Bacteria | 50250 |
| 887 | Ga0207671_10000713 | 3300025914 | Bacteria | 42635 |
| 888 | Ga0207671_10004705 | 3300025914 | Bacteria | 12902 |
| 889 | Ga0207671_10034008 | 3300025914 | Bacteria | 3790 |
| 890 | Ga0207671_10060219 | 3300025914 | Bacteria | 2816 |
| 891 | Ga0207663_10142381 | 3300025916 | Bacteria | 1672 |
| 892 | Ga0207662_10001567 | 3300025918 | Bacteria | 11184 |
| 893 | Ga0207657_10000008 | 3300025919 | Bacteria | 189885 |
| 894 | Ga0207657_10001585 | 3300025919 | Bacteria | 24460 |
| 895 | Ga0207657_10017790 | 3300025919 | Bacteria | 6804 |
| 896 | Ga0207657_10067795 | 3300025919 | Bacteria | 3033 |
| 897 | Ga0207649_10000007 | 3300025920 | Bacteria | 334217 |
| 898 | Ga0207649_10014289 | 3300025920 | Bacteria | 4442 |
| 899 | Ga0207649_10237503 | 3300025920 | Bacteria | 1307 |
| 900 | Ga0207652_10015302 | 3300025921 | Bacteria | 6229 |
| 901 | Ga0207652_10041632 | 3300025921 | Bacteria | 3906 |
| 902 | Ga0207652_10125743 | 3300025921 | Bacteria | 2284 |
| 903 | Ga0207652_10129091 | 3300025921 | Bacteria | 2253 |
| 904 | Ga0207652_10132655 | 3300025921 | Bacteria | 2222 |
| 905 | Ga0207681_10000163 | 3300025923 | Bacteria | 55005 |
| 906 | Ga0207681_10007357 | 3300025923 | Bacteria | 6745 |
| 907 | Ga0207681_10173549 | 3300025923 | Bacteria | 1636 |
| 908 | Ga0207694_10000128 | 3300025924 | Bacteria | 78863 |
| 909 | Ga0207694_10000359 | 3300025924 | Bacteria | 42962 |
| 910 | Ga0207694_10019147 | 3300025924 | Bacteria | 5175 |
| 911 | Ga0207694_10032251 | 3300025924 | Bacteria | 4008 |
| 912 | Ga0207694_10042761 | 3300025924 | Bacteria | 3496 |
| 913 | Ga0207694_10064274 | 3300025924 | Bacteria | 2860 |
| 914 | Ga0207694_10186621 | 3300025924 | Bacteria | 1683 |
| 915 | Ga0207650_10000178 | 3300025925 | Bacteria | 74821 |
| 916 | Ga0207650_10000210 | 3300025925 | Bacteria | 66574 |
| 917 | Ga0207650_10008117 | 3300025925 | Bacteria | 7156 |
| 918 | Ga0207650_10336585 | 3300025925 | Bacteria | 1239 |
| 919 | Ga0207659_10036901 | 3300025926 | Bacteria | 3390 |
| 920 | Ga0207659_10249400 | 3300025926 | Bacteria | 1440 |
| 921 | Ga0207687_10015209 | 3300025927 | Bacteria | 5043 |
| 922 | Ga0207664_10010237 | 3300025929 | Bacteria | 6622 |
| 923 | Ga0207664_10095916 | 3300025929 | Bacteria | 2441 |
| 924 | Ga0207644_10003369 | 3300025931 | Bacteria | 10318 |
| 925 | Ga0207690_10000013 | 3300025932 | Bacteria | 266156 |
| 926 | Ga0207690_10014282 | 3300025932 | Bacteria | 4795 |
| 927 | Ga0207706_10000050 | 3300025933 | Bacteria | 116811 |
| 928 | Ga0207706_10132688 | 3300025933 | Bacteria | 2191 |
| 929 | Ga0207706_10133108 | 3300025933 | Bacteria | 2187 |
| 930 | Ga0207686_10001532 | 3300025934 | Bacteria | 13024 |
| 931 | Ga0207709_10000035 | 3300025935 | Bacteria | 300968 |
| 932 | Ga0207709_10005638 | 3300025935 | Bacteria | 7077 |
| 933 | Ga0207709_10071412 | 3300025935 | Bacteria | 2204 |
| 934 | Ga0207709_10100678 | 3300025935 | Bacteria | 1909 |
| 935 | Ga0207670_10011958 | 3300025936 | Bacteria | 5057 |
| 936 | Ga0207670_10096398 | 3300025936 | Bacteria | 2103 |
| 937 | Ga0207669_10060191 | 3300025937 | Bacteria | 2327 |
| 938 | Ga0207704_10010676 | 3300025938 | Bacteria | 4489 |
| 939 | Ga0207704_10078039 | 3300025938 | Bacteria | 2128 |
| 940 | Ga0207691_10004858 | 3300025940 | Bacteria | 12997 |
| 941 | Ga0207691_10071976 | 3300025940 | Bacteria | 3118 |
| 942 | Ga0207691_10160767 | 3300025940 | Bacteria | 1971 |
| 943 | Ga0207711_10033204 | 3300025941 | Bacteria | 4365 |
| 944 | Ga0207711_10045097 | 3300025941 | Bacteria | 3767 |
| 945 | Ga0207711_10133059 | 3300025941 | Bacteria | 2231 |
| 946 | Ga0207711_10378763 | 3300025941 | Bacteria | 1313 |
| 947 | Ga0207689_10002599 | 3300025942 | Bacteria | 16704 |
| 948 | Ga0207689_10015989 | 3300025942 | Bacteria | 6350 |
| 949 | Ga0207689_10092746 | 3300025942 | Bacteria | 2481 |
| 950 | Ga0207661_10013152 | 3300025944 | Bacteria | 6041 |
| 951 | Ga0207661_10041845 | 3300025944 | Bacteria | 3609 |
| 952 | Ga0207661_10102213 | 3300025944 | Bacteria | 2409 |
| 953 | Ga0207661_10208914 | 3300025944 | Bacteria | 1720 |
| 954 | Ga0207679_10000013 | 3300025945 | Bacteria | 334197 |
| 955 | Ga0207679_10007435 | 3300025945 | Bacteria | 6949 |
| 956 | Ga0207679_10024109 | 3300025945 | Bacteria | 4168 |
| 957 | Ga0207679_10051926 | 3300025945 | Bacteria | 3004 |
| 958 | Ga0207667_10000028 | 3300025949 | Bacteria | 334510 |
| 959 | Ga0207667_10000062 | 3300025949 | Bacteria | 190422 |
| 960 | Ga0207667_10000292 | 3300025949 | Bacteria | 69279 |
| 961 | Ga0207667_10000486 | 3300025949 | Bacteria | 52631 |
| 962 | Ga0207667_10002564 | 3300025949 | Bacteria | 22605 |
| 963 | Ga0207667_10013346 | 3300025949 | Bacteria | 9406 |
| 964 | Ga0207667_10013807 | 3300025949 | Bacteria | 9228 |
| 965 | Ga0207667_10015048 | 3300025949 | Bacteria | 8801 |
| 966 | Ga0207667_10070719 | 3300025949 | Bacteria | 3631 |
| 967 | Ga0207667_10081051 | 3300025949 | Bacteria | 3362 |
| 968 | Ga0207667_10106559 | 3300025949 | Bacteria | 2891 |
| 969 | Ga0207667_10121940 | 3300025949 | Bacteria | 2686 |
| 970 | Ga0207667_10132596 | 3300025949 | Bacteria | 2566 |
| 971 | Ga0207667_10208048 | 3300025949 | Bacteria | 2006 |
| 972 | Ga0207651_10012970 | 3300025960 | Bacteria | 4745 |
| 973 | Ga0207651_10119814 | 3300025960 | Bacteria | 1993 |
| 974 | Ga0207712_10033098 | 3300025961 | Bacteria | 3493 |
| 975 | Ga0207668_10008682 | 3300025972 | Bacteria | 6070 |
| 976 | Ga0207668_10082433 | 3300025972 | Bacteria | 2337 |
| 977 | Ga0207640_10000022 | 3300025981 | Bacteria | 167526 |
| 978 | Ga0207640_10000471 | 3300025981 | Bacteria | 24571 |
| 979 | Ga0207640_10000670 | 3300025981 | Bacteria | 19993 |
| 980 | Ga0207640_10145962 | 3300025981 | Bacteria | 1731 |
| 981 | Ga0207658_10070348 | 3300025986 | Bacteria | 2647 |
| 982 | Ga0207703_10120948 | 3300026035 | Bacteria | 2248 |
| 983 | Ga0207639_10027540 | 3300026041 | Bacteria | 4142 |
| 984 | Ga0207678_10000969 | 3300026067 | Bacteria | 26231 |
| 985 | Ga0207678_10001675 | 3300026067 | Bacteria | 20327 |
| 986 | Ga0207678_10095511 | 3300026067 | Bacteria | 2540 |
| 987 | Ga0207702_10000624 | 3300026078 | Bacteria | 38966 |
| 988 | Ga0207702_10009106 | 3300026078 | Bacteria | 8358 |
| 989 | Ga0207702_10028519 | 3300026078 | Bacteria | 4640 |
| 990 | Ga0207702_10051439 | 3300026078 | Bacteria | 3481 |
| 991 | Ga0207702_10070045 | 3300026078 | Bacteria | 3016 |
| 992 | Ga0207702_10077002 | 3300026078 | Bacteria | 2884 |
| 993 | Ga0207702_10153332 | 3300026078 | Bacteria | 2098 |
| 994 | Ga0207702_10252153 | 3300026078 | Bacteria | 1658 |
| 995 | Ga0207641_10006248 | 3300026088 | Bacteria | 10080 |
| 996 | Ga0207641_10014471 | 3300026088 | Bacteria | 6463 |
| 997 | Ga0207648_10034441 | 3300026089 | Bacteria | 4464 |
| 998 | Ga0207648_10051585 | 3300026089 | Bacteria | 3595 |
| 999 | Ga0207676_10073470 | 3300026095 | Bacteria | 2752 |
| 1000 | Ga0207676_10105343 | 3300026095 | Bacteria | 2348 |
| 1001 | Ga0207676_10170681 | 3300026095 | Bacteria | 1895 |
| 1002 | Ga0207676_10332450 | 3300026095 | Bacteria | 1399 |
| 1003 | Ga0207674_10000298 | 3300026116 | Bacteria | 62902 |
| 1004 | Ga0207674_10010196 | 3300026116 | Bacteria | 10673 |
| 1005 | Ga0207674_10044449 | 3300026116 | Bacteria | 4574 |
| 1006 | Ga0207674_10056308 | 3300026116 | Bacteria | 3994 |
| 1007 | Ga0207674_10091822 | 3300026116 | Bacteria | 3026 |
| 1008 | Ga0207674_10162508 | 3300026116 | Bacteria | 2187 |
| 1009 | Ga0207674_10379914 | 3300026116 | Bacteria | 1366 |
| 1010 | Ga0207675_100053155 | 3300026118 | Bacteria | 3780 |
| 1011 | Ga0207675_100110860 | 3300026118 | Unclassified | 2589 |
| 1012 | Ga0207683_10014610 | 3300026121 | Bacteria | 6686 |
| 1013 | Ga0207683_10016309 | 3300026121 | Bacteria | 6323 |
| 1014 | Ga0207683_10307360 | 3300026121 | Bacteria | 1451 |
| 1015 | Ga0207698_10014129 | 3300026142 | Bacteria | 5294 |
| 1016 | Ga0207698_10015955 | 3300026142 | Bacteria | 5050 |
| 1017 | Ga0207698_10019529 | 3300026142 | Bacteria | 4642 |
| 1018 | Ga0207698_10232031 | 3300026142 | Bacteria | 1676 |
| 1019 | Ga0209281_1000077 | 3300027111 | Bacteria | 262887 |
| 1020 | Ga0209281_1000118 | 3300027111 | Bacteria | 208448 |
| 1021 | Ga0209281_1000212 | 3300027111 | Bacteria | 130216 |
| 1022 | Ga0209281_1000346 | 3300027111 | Bacteria | 77504 |
| 1023 | Ga0209281_1000469 | 3300027111 | Bacteria | 56711 |
| 1024 | Ga0209281_1013795 | 3300027111 | Bacteria | 1731 |
| 1025 | Ga0209371_1000023 | 3300027312 | Bacteria | 519553 |
| 1026 | Ga0209371_1000065 | 3300027312 | Bacteria | 214464 |
| 1027 | Ga0209371_1002067 | 3300027312 | Bacteria | 11970 |
| 1028 | Ga0209371_1010681 | 3300027312 | Bacteria | 2796 |
| 1029 | Ga0209282_1000038 | 3300027666 | Bacteria | 128955 |
| 1030 | Ga0209282_1029815 | 3300027666 | Bacteria | 3363 |
| 1031 | Ga0209813_10006468 | 3300027866 | Bacteria | 2896 |
| 1032 | Ga0207428_10015977 | 3300027907 | Bacteria | 6471 |
| 1033 | Ga0207428_10044995 | 3300027907 | Bacteria | 3559 |
| 1034 | Ga0268266_10000011 | 3300028379 | Bacteria | 757403 |
| 1035 | Ga0268266_10000364 | 3300028379 | Bacteria | 70331 |
| 1036 | Ga0268266_10000895 | 3300028379 | Bacteria | 38492 |
| 1037 | Ga0268266_10005005 | 3300028379 | Bacteria | 12518 |
| 1038 | Ga0268266_10020541 | 3300028379 | Bacteria | 5628 |
| 1039 | Ga0268266_10023157 | 3300028379 | Bacteria | 5287 |
| 1040 | Ga0268266_10055690 | 3300028379 | Bacteria | 3400 |
| 1041 | Ga0268266_10263051 | 3300028379 | Bacteria | 1599 |
| 1042 | Ga0268264_10003867 | 3300028381 | Bacteria | 12847 |
| 1043 | Ga0268264_10384530 | 3300028381 | Bacteria | 1345 |
| 1044 | Ga0268264_10469945 | 3300028381 | Bacteria | 1221 |
| 1045 | Ga0307515_10085133 | 3300028794 | Bacteria | 4050 |
| 1046 | Ga0307515_10223914 | 3300028794 | Bacteria | 1691 |
| 1047 | Ga0265338_10000476 | 3300028800 | Bacteria | 71490 |
| 1048 | Ga0265338_10143969 | 3300028800 | Bacteria | 1862 |
| 1049 | Ga0268256_1000023 | 3300030500 | Bacteria | 519631 |
| 1050 | Ga0268256_1000118 | 3300030500 | Bacteria | 115175 |
| 1051 | Ga0268256_1002195 | 3300030500 | Bacteria | 10299 |
| 1052 | Ga0268256_1011475 | 3300030500 | Bacteria | 2799 |
| 1053 | Ga0316177_1155876 | 3300030731 | Bacteria | 3033 |
| 1054 | Ga0316176_1003471 | 3300030732 | Bacteria | 14957 |
| 1055 | Ga0316176_1180376 | 3300030732 | Bacteria | 1469 |
| 1056 | Ga0314311_1113156 | 3300030733 | Bacteria | 2052 |
| 1057 | Ga0316178_1043989 | 3300030735 | Bacteria | 34199 |
| 1058 | Ga0316183_1207931 | 3300030742 | Bacteria | 24415 |
| 1059 | Ga0316181_1063746 | 3300030744 | Bacteria | 1853 |
| 1060 | Ga0316181_1140375 | 3300030744 | Bacteria | 21291 |
| 1061 | Ga0265330_10023164 | 3300031235 | Bacteria | 2822 |
| 1062 | Ga0265340_10016453 | 3300031247 | Bacteria | 3829 |
| 1063 | Ga0307513_10009248 | 3300031456 | Bacteria | 12473 |
| 1064 | Ga0307513_10035883 | 3300031456 | Bacteria | 5541 |
| 1065 | Ga0307408_100011609 | 3300031548 | Bacteria | 5822 |
| 1066 | Ga0307408_100112000 | 3300031548 | Bacteria | 2097 |
| 1067 | Ga0307516_10019066 | 3300031730 | Bacteria | 7116 |
| 1068 | Ga0307516_10097128 | 3300031730 | Bacteria | 2766 |
| 1069 | Ga0307405_10000266 | 3300031731 | Bacteria | 19217 |
| 1070 | Ga0307405_10046393 | 3300031731 | Bacteria | 2670 |
| 1071 | Ga0307405_10086501 | 3300031731 | Bacteria | 2063 |
| 1072 | Ga0307518_10000232 | 3300031838 | Bacteria | 42086 |
| 1073 | Ga0307406_10008205 | 3300031901 | Bacteria | 5821 |
| 1074 | Ga0307406_10132790 | 3300031901 | Bacteria | 1750 |
| 1075 | Ga0307412_10000044 | 3300031911 | Bacteria | 165237 |
| 1076 | Ga0307412_10000086 | 3300031911 | Bacteria | 85829 |
| 1077 | Ga0307412_10000696 | 3300031911 | Bacteria | 19413 |
| 1078 | Ga0307412_10007745 | 3300031911 | Bacteria | 6107 |
| 1079 | Ga0307412_10016846 | 3300031911 | Bacteria | 4365 |
| 1080 | Ga0307412_10128074 | 3300031911 | Bacteria | 1839 |
| 1081 | Ga0315914_1001085 | 3300031967 | Bacteria | 39130 |
| 1082 | Ga0307409_100060590 | 3300031995 | Bacteria | 2952 |
| 1083 | Ga0307414_10002474 | 3300032004 | Bacteria | 9682 |
| 1084 | Ga0307414_10135333 | 3300032004 | Bacteria | 1920 |
| 1085 | Ga0307510_10013166 | 3300033180 | Bacteria | 9811 |
| 1086 | Ga0307510_10022649 | 3300033180 | Bacteria | 7290 |
| 1087 | Ga0315913_1000342 | 3300033430 | Bacteria | 39072 |
| 1088 | Ga0315915_1000018 | 3300033464 | Bacteria | 129799 |
| 1089 | Ga0373936_0014950 | 3300035113 | Bacteria | 2972 |
| 1090 | Ga0373931_0035536 | 3300035691 | Bacteria | 2592 |
| 1091 | Ga0373935_0060242 | 3300035692 | Bacteria | 2428 |
| 1092 | Ga0373937_0035137 | 3300036401 | Bacteria | 4560 |
| 1093 | Ga0373937_0064861 | 3300036401 | Bacteria | 3361 |
| 1094 | Ga0373937_0236117 | 3300036401 | Bacteria | 1722 |
| 1095 | Ga0395899_0000031 | 3300037312 | Bacteria | 322356 |
| 1096 | Ga0395899_0000226 | 3300037312 | Bacteria | 76657 |
| 1097 | Ga0395899_0001543 | 3300037312 | Bacteria | 19449 |
| 1098 | Ga0395899_0018763 | 3300037312 | Bacteria | 5256 |
| 1099 | Ga0395899_0023189 | 3300037312 | Bacteria | 4704 |
| 1100 | Ga0395899_0060569 | 3300037312 | Bacteria | 2789 |
| 1101 | Ga0395899_0074384 | 3300037312 | Bacteria | 2482 |
| 1102 | Ga0395899_0105892 | 3300037312 | Bacteria | 2025 |
| 1103 | Ga0395899_0115276 | 3300037312 | Bacteria | 1928 |
| 1104 | Ga0395900_0000011 | 3300037418 | Bacteria | 421926 |
| 1105 | Ga0395900_0000776 | 3300037418 | Bacteria | 42484 |
| 1106 | Ga0395900_0000980 | 3300037418 | Bacteria | 37119 |
| 1107 | Ga0395900_0010941 | 3300037418 | Bacteria | 9279 |
| 1108 | Ga0395900_0038598 | 3300037418 | Bacteria | 4923 |
| 1109 | Ga0395900_0124178 | 3300037418 | Bacteria | 2647 |
| 1110 | Ga0395898_0000029 | 3300037466 | Bacteria | 370667 |
| 1111 | Ga0395898_0000040 | 3300037466 | Bacteria | 317329 |
| 1112 | Ga0395898_0000202 | 3300037466 | Bacteria | 153541 |
| 1113 | Ga0395898_0001962 | 3300037466 | Bacteria | 25903 |
| 1114 | Ga0395898_0010632 | 3300037466 | Bacteria | 9614 |
| 1115 | Ga0395898_0015160 | 3300037466 | Bacteria | 7910 |
| 1116 | Ga0395898_0016122 | 3300037466 | Bacteria | 7653 |
| 1117 | Ga0395898_0020527 | 3300037466 | Bacteria | 6709 |
| 1118 | Ga0395898_0048473 | 3300037466 | Bacteria | 4166 |
| 1119 | Ga0395905_0000014 | 3300037471 | Bacteria | 394209 |
| 1120 | Ga0395905_0004763 | 3300037471 | Bacteria | 14022 |
| 1121 | Ga0395905_0036820 | 3300037471 | Bacteria | 4595 |
| 1122 | Ga0395901_0000002 | 3300038443 | Bacteria | 761045 |
| 1123 | Ga0395901_0000059 | 3300038443 | Bacteria | 152667 |
| 1124 | Ga0395901_0000196 | 3300038443 | Bacteria | 77048 |
| 1125 | Ga0395901_0001136 | 3300038443 | Bacteria | 28215 |
| 1126 | Ga0395901_0051148 | 3300038443 | Bacteria | 4294 |
| 1127 | Ga0395901_0080501 | 3300038443 | Bacteria | 3401 |
| 1128 | Ga0395901_0100401 | 3300038443 | Bacteria | 3035 |
| 1129 | Ga0395901_0144106 | 3300038443 | Bacteria | 2504 |
| 1130 | Ga0395901_0231549 | 3300038443 | Bacteria | 1928 |
| 1131 | Ga0395901_0312047 | 3300038443 | Bacteria | 1628 |
| 1132 | Ga0395901_0329189 | 3300038443 | Bacteria | 1579 |
| 1133 | Ga0237819_00624 | 3300038705 | Bacteria | 11567 |
| 1134 | Ga0400490_12115 | 3300038726 | Bacteria | 7150 |
| 1135 | Ga0400488_44097 | 3300038741 | Bacteria | 6429 |
| 1136 | Ga0400486_01123 | 3300038742 | Bacteria | 1740 |
| 1137 | Ga0400483_095196 | 3300039062 | Bacteria | 15889 |
| 1138 | Ga0400489_45052 | 3300039093 | Bacteria | 1434 |
| 1139 | Ga0436365_0182246 | 3300039437 | Bacteria | 13762 |
| 1140 | Ga0436361_0167540 | 3300039447 | Bacteria | 6110 |
| 1141 | Ga0436361_0607146 | 3300039447 | Bacteria | 4347 |
| 1142 | Ga0439436_0025860 | 3300041404 | Bacteria | 1723 |
| 1143 | Ga0439438_001542 | 3300041405 | Bacteria | 10156 |
| 1144 | Ga0439438_001831 | 3300041405 | Bacteria | 9313 |
| 1145 | Ga0439438_004000 | 3300041405 | Bacteria | 5792 |
| 1146 | Ga0439438_004655 | 3300041405 | Bacteria | 5215 |
| 1147 | Ga0439438_008994 | 3300041405 | Bacteria | 3263 |
| 1148 | Ga0439447_000377 | 3300041407 | Bacteria | 16242 |
| 1149 | Ga0439447_001015 | 3300041407 | Bacteria | 10230 |
| 1150 | Ga0439447_003199 | 3300041407 | Bacteria | 5832 |
| 1151 | Ga0439466_0000387 | 3300041411 | Bacteria | 16853 |
| 1152 | Ga0439466_0003126 | 3300041411 | Bacteria | 6442 |
| 1153 | Ga0439466_0007551 | 3300041411 | Bacteria | 4112 |
| 1154 | Ga0451793_1027815 | 3300041452 | Bacteria | 7799 |
| 1155 | Ga0451798_0992722 | 3300041458 | Bacteria | 2997 |
| 1156 | Ga0451851_0205038 | 3300041507 | Bacteria | 2012 |
| 1157 | Ga0439448_0000023 | 3300042005 | Bacteria | 24812 |
| 1158 | Ga0439432_000066 | 3300042006 | Bacteria | 32758 |
| 1159 | Ga0439432_003340 | 3300042006 | Bacteria | 5959 |
| 1160 | Ga0439432_010182 | 3300042006 | Bacteria | 3263 |
| 1161 | Ga0439451_004420 | 3300042009 | Bacteria | 2855 |
| 1162 | Ga0439452_000281 | 3300042010 | Bacteria | 33473 |
| 1163 | Ga0439452_000485 | 3300042010 | Bacteria | 22057 |
| 1164 | Ga0439452_000562 | 3300042010 | Bacteria | 19552 |
| 1165 | Ga0439452_007303 | 3300042010 | Bacteria | 3391 |
| 1166 | Ga0439452_014090 | 3300042010 | Bacteria | 2228 |
| 1167 | Ga0439456_003411 | 3300042013 | Bacteria | 3220 |
| 1168 | Ga0439456_004142 | 3300042013 | Bacteria | 2939 |
| 1169 | Ga0439456_009259 | 3300042013 | Bacteria | 2035 |
| 1170 | Ga0439463_000226 | 3300042016 | Bacteria | 15540 |
| 1171 | Ga0450911_000382 | 3300042115 | Bacteria | 14760 |
| 1172 | Ga0450890_000729 | 3300042127 | Bacteria | 4769 |
| 1173 | Ga0450902_004202 | 3300042137 | Bacteria | 2135 |
| 1174 | Ga0450906_000246 | 3300042145 | Bacteria | 10404 |
| 1175 | Ga0450906_007766 | 3300042145 | Bacteria | 2105 |
| 1176 | Ga0450907_000139 | 3300042146 | Bacteria | 27686 |
| 1177 | Ga0450907_000683 | 3300042146 | Bacteria | 8791 |
| 1178 | Ga0450910_001033 | 3300042147 | Bacteria | 3405 |
| 1179 | Ga0439446_0009091 | 3300042156 | Bacteria | 2652 |
| 1180 | Ga0450908_010027 | 3300042184 | Bacteria | 1752 |
| 1181 | Ga0439434_0000870 | 3300042435 | Bacteria | 8699 |
| 1182 | Ga0439459_0001008 | 3300042438 | Bacteria | 4003 |
| 1183 | Ga0466988_0054010 | 3300044536 | Bacteria | 2362 |
| 1184 | Ga0466969_0001020 | 3300044656 | Bacteria | 15135 |
| 1185 | Ga0466969_0006226 | 3300044656 | Bacteria | 6353 |
| 1186 | Ga0466969_0009536 | 3300044656 | Bacteria | 5144 |
| 1187 | Ga0466969_0011611 | 3300044656 | Bacteria | 4662 |
| 1188 | Ga0466972_0004632 | 3300044658 | Bacteria | 6886 |
| 1189 | Ga0466965_0004789 | 3300044683 | Bacteria | 6035 |
| 1190 | Ga0466965_0045424 | 3300044683 | Bacteria | 2172 |
| 1191 | Ga0466965_0059186 | 3300044683 | Bacteria | 1911 |
| 1192 | Ga0466966_0000296 | 3300044684 | Bacteria | 32722 |
| 1193 | Ga0466966_0010340 | 3300044684 | Bacteria | 6195 |
| 1194 | Ga0466966_0027307 | 3300044684 | Bacteria | 3723 |
| 1195 | Ga0466966_0028286 | 3300044684 | Bacteria | 3652 |
| 1196 | Ga0466966_0053662 | 3300044684 | Bacteria | 2556 |
| 1197 | Ga0466961_0000272 | 3300044693 | Bacteria | 34599 |
| 1198 | Ga0466961_0000689 | 3300044693 | Bacteria | 21338 |
| 1199 | Ga0466961_0000696 | 3300044693 | Bacteria | 21225 |
| 1200 | Ga0466961_0023239 | 3300044693 | Bacteria | 3988 |
| 1201 | Ga0466961_0035401 | 3300044693 | Bacteria | 3206 |
| 1202 | Ga0466961_0093036 | 3300044693 | Bacteria | 1903 |
| 1203 | Ga0466961_0126356 | 3300044693 | Bacteria | 1604 |
| 1204 | Ga0466961_0177226 | 3300044693 | Bacteria | 1324 |
| 1205 | Ga0466963_0000764 | 3300044694 | Bacteria | 15926 |
| 1206 | Ga0466963_0003166 | 3300044694 | Bacteria | 9346 |
| 1207 | Ga0466963_0005273 | 3300044694 | Bacteria | 7548 |
| 1208 | Ga0466971_0002420 | 3300044719 | Bacteria | 7871 |
| 1209 | Ga0466971_0025461 | 3300044719 | Bacteria | 2642 |
| 1210 | Ga0466971_0040501 | 3300044719 | Bacteria | 2092 |
| 1211 | Ga0466970_0000201 | 3300044765 | Bacteria | 28963 |
| 1212 | Ga0466970_0003084 | 3300044765 | Bacteria | 8089 |
| 1213 | Ga0466970_0035691 | 3300044765 | Bacteria | 2634 |
| 1214 | Ga0466957_0004013 | 3300044842 | Bacteria | 8140 |
| 1215 | Ga0466957_0008763 | 3300044842 | Bacteria | 5758 |
| 1216 | Ga0466960_0000049 | 3300044901 | Bacteria | 39790 |
| 1217 | Ga0466959_0000006 | 3300045049 | Bacteria | 192678 |
| 1218 | Ga0466959_0000958 | 3300045049 | Bacteria | 17161 |
| 1219 | Ga0466959_0008194 | 3300045049 | Bacteria | 7374 |
| 1220 | Ga0466959_0012533 | 3300045049 | Bacteria | 6129 |
| 1221 | Ga0466959_0015829 | 3300045049 | Bacteria | 5502 |
| 1222 | Ga0466959_0096473 | 3300045049 | Bacteria | 2119 |
| 1223 | Ga0466959_0106109 | 3300045049 | Bacteria | 2008 |
| 1224 | Ga0466959_0110959 | 3300045049 | Bacteria | 1957 |
| 1225 | Ga0466958_0001554 | 3300045836 | Bacteria | 10999 |
| 1226 | Ga0466958_0026070 | 3300045836 | Bacteria | 3452 |
| 1227 | Ga0466958_0035630 | 3300045836 | Bacteria | 2973 |
| 1228 | Ga0466958_0038094 | 3300045836 | Bacteria | 2883 |
| 1229 | Ga0495617_000225 | 3300046452 | Bacteria | 34294 |
| 1230 | Ga0495617_006032 | 3300046452 | Bacteria | 4270 |
| 1231 | Ga0495617_011018 | 3300046452 | Bacteria | 3090 |
| 1232 | Ga0495627_000083 | 3300046453 | Bacteria | 113227 |
| 1233 | Ga0495627_000451 | 3300046453 | Bacteria | 35736 |
| 1234 | Ga0495627_003061 | 3300046453 | Bacteria | 7616 |
| 1235 | Ga0495627_003650 | 3300046453 | Bacteria | 6678 |
| 1236 | Ga0495627_010833 | 3300046453 | Bacteria | 3296 |
| 1237 | Ga0495592_0016556 | 3300046454 | Bacteria | 5595 |
| 1238 | Ga0495592_0044971 | 3300046454 | Bacteria | 3296 |
| 1239 | Ga0495603_0000802 | 3300046455 | Bacteria | 18008 |
| 1240 | Ga0495603_0016077 | 3300046455 | Bacteria | 4523 |
| 1241 | Ga0495603_0016648 | 3300046455 | Bacteria | 4448 |
| 1242 | Ga0495590_0001173 | 3300046457 | Bacteria | 11470 |
| 1243 | Ga0495590_0001387 | 3300046457 | Bacteria | 10506 |
| 1244 | Ga0495590_0002501 | 3300046457 | Bacteria | 7606 |
| 1245 | Ga0495590_0005783 | 3300046457 | Bacteria | 4859 |
| 1246 | Ga0495591_000037 | 3300046458 | Bacteria | 158323 |
| 1247 | Ga0495591_000648 | 3300046458 | Bacteria | 25749 |
| 1248 | Ga0495591_000960 | 3300046458 | Bacteria | 19699 |
| 1249 | Ga0495591_001346 | 3300046458 | Bacteria | 15427 |
| 1250 | Ga0495591_001506 | 3300046458 | Bacteria | 14373 |
| 1251 | Ga0495591_001756 | 3300046458 | Bacteria | 12889 |
| 1252 | Ga0495591_002170 | 3300046458 | Bacteria | 11235 |
| 1253 | Ga0495591_016885 | 3300046458 | Bacteria | 2524 |
| 1254 | Ga0495629_0000105 | 3300046459 | Bacteria | 74421 |
| 1255 | Ga0495629_0000175 | 3300046459 | Bacteria | 57283 |
| 1256 | Ga0495629_0002935 | 3300046459 | Bacteria | 13003 |
| 1257 | Ga0495629_0017828 | 3300046459 | Bacteria | 5089 |
| 1258 | Ga0495629_0021123 | 3300046459 | Bacteria | 4646 |
| 1259 | Ga0495638_0000060 | 3300046460 | Bacteria | 190580 |
| 1260 | Ga0495638_0000116 | 3300046460 | Bacteria | 128087 |
| 1261 | Ga0495638_0000609 | 3300046460 | Bacteria | 40051 |
| 1262 | Ga0495638_0004826 | 3300046460 | Bacteria | 10156 |
| 1263 | Ga0495638_0005276 | 3300046460 | Bacteria | 9656 |
| 1264 | Ga0495638_0006182 | 3300046460 | Bacteria | 8746 |
| 1265 | Ga0495638_0006926 | 3300046460 | Bacteria | 8178 |
| 1266 | Ga0495638_0053292 | 3300046460 | Bacteria | 2518 |
| 1267 | Ga0495651_0001526 | 3300046462 | Bacteria | 17899 |
| 1268 | Ga0495651_0020487 | 3300046462 | Bacteria | 5134 |
| 1269 | Ga0495651_0034950 | 3300046462 | Bacteria | 3916 |
| 1270 | Ga0495653_0010928 | 3300046463 | Bacteria | 7434 |
| 1271 | Ga0495653_0020160 | 3300046463 | Bacteria | 5405 |
| 1272 | Ga0495653_0023003 | 3300046463 | Bacteria | 5039 |
| 1273 | Ga0495653_0040343 | 3300046463 | Bacteria | 3648 |
| 1274 | Ga0495653_0054893 | 3300046463 | Bacteria | 3042 |
| 1275 | Ga0495653_0106040 | 3300046463 | Bacteria | 2027 |
| 1276 | Ga0495653_0209202 | 3300046463 | Bacteria | 1318 |
| 1277 | Ga0495650_0000064 | 3300046471 | Bacteria | 275412 |
| 1278 | Ga0495650_0000075 | 3300046471 | Bacteria | 250589 |
| 1279 | Ga0495650_0001163 | 3300046471 | Bacteria | 28128 |
| 1280 | Ga0495650_0005547 | 3300046471 | Bacteria | 8151 |
| 1281 | Ga0495650_0005976 | 3300046471 | Bacteria | 7710 |
| 1282 | Ga0495650_0006437 | 3300046471 | Bacteria | 7315 |
| 1283 | Ga0495650_0010142 | 3300046471 | Bacteria | 5282 |
| 1284 | Ga0495650_0010597 | 3300046471 | Bacteria | 5130 |
| 1285 | Ga0495580_0000125 | 3300046472 | Bacteria | 52763 |
| 1286 | Ga0495580_0014113 | 3300046472 | Bacteria | 6073 |
| 1287 | Ga0495580_0058472 | 3300046472 | Bacteria | 2711 |
| 1288 | Ga0495580_0195520 | 3300046472 | Bacteria | 1394 |
| 1289 | Ga0495582_0003710 | 3300046473 | Bacteria | 8597 |
| 1290 | Ga0495582_0007857 | 3300046473 | Bacteria | 5894 |
| 1291 | Ga0495582_0051955 | 3300046473 | Bacteria | 2260 |
| 1292 | Ga0495605_0000036 | 3300046474 | Bacteria | 203902 |
| 1293 | Ga0495605_0000745 | 3300046474 | Bacteria | 23872 |
| 1294 | Ga0495605_0000849 | 3300046474 | Bacteria | 21311 |
| 1295 | Ga0495605_0001253 | 3300046474 | Bacteria | 16834 |
| 1296 | Ga0495605_0001795 | 3300046474 | Bacteria | 13765 |
| 1297 | Ga0495605_0002427 | 3300046474 | Bacteria | 11521 |
| 1298 | Ga0495605_0009484 | 3300046474 | Bacteria | 5466 |
| 1299 | Ga0495605_0013476 | 3300046474 | Bacteria | 4501 |
| 1300 | Ga0495605_0013595 | 3300046474 | Bacteria | 4479 |
| 1301 | Ga0495605_0019669 | 3300046474 | Bacteria | 3603 |
| 1302 | Ga0495605_0020667 | 3300046474 | Bacteria | 3496 |
| 1303 | Ga0495639_0000158 | 3300046475 | Bacteria | 34960 |
| 1304 | Ga0495662_0003246 | 3300046476 | Bacteria | 8218 |
| 1305 | Ga0495664_0006406 | 3300046477 | Bacteria | 6500 |
| 1306 | Ga0495664_0081859 | 3300046477 | Bacteria | 1935 |
| 1307 | Ga0495664_0107807 | 3300046477 | Bacteria | 1680 |
| 1308 | Ga0495584_0019260 | 3300046491 | Bacteria | 3466 |
| 1309 | Ga0495584_0108722 | 3300046491 | Bacteria | 1402 |
| 1310 | Ga0495584_0141953 | 3300046491 | Bacteria | 1219 |
| 1311 | Ga0495585_0002523 | 3300046492 | Bacteria | 13009 |
| 1312 | Ga0495585_0013417 | 3300046492 | Bacteria | 4795 |
| 1313 | Ga0495585_0035355 | 3300046492 | Bacteria | 2824 |
| 1314 | Ga0495585_0037360 | 3300046492 | Bacteria | 2735 |
| 1315 | Ga0495594_0001462 | 3300046499 | Bacteria | 12271 |
| 1316 | Ga0495594_0001898 | 3300046499 | Bacteria | 10887 |
| 1317 | Ga0495594_0002321 | 3300046499 | Bacteria | 9905 |
| 1318 | Ga0495594_0005955 | 3300046499 | Bacteria | 6266 |
| 1319 | Ga0495596_0000488 | 3300046500 | Bacteria | 25168 |
| 1320 | Ga0495596_0003157 | 3300046500 | Bacteria | 8489 |
| 1321 | Ga0495596_0022504 | 3300046500 | Bacteria | 2565 |
| 1322 | Ga0495607_0000860 | 3300046501 | Bacteria | 28560 |
| 1323 | Ga0495607_0001076 | 3300046501 | Bacteria | 24950 |
| 1324 | Ga0495607_0001283 | 3300046501 | Bacteria | 22484 |
| 1325 | Ga0495607_0001388 | 3300046501 | Bacteria | 21548 |
| 1326 | Ga0495607_0001475 | 3300046501 | Bacteria | 20928 |
| 1327 | Ga0495607_0004512 | 3300046501 | Bacteria | 10216 |
| 1328 | Ga0495607_0009221 | 3300046501 | Bacteria | 6704 |
| 1329 | Ga0495607_0021322 | 3300046501 | Bacteria | 4078 |
| 1330 | Ga0495607_0027774 | 3300046501 | Bacteria | 3495 |
| 1331 | Ga0495607_0038072 | 3300046501 | Bacteria | 2883 |
| 1332 | Ga0495607_0059014 | 3300046501 | Bacteria | 2190 |
| 1333 | Ga0495583_0000028 | 3300046506 | Bacteria | 255787 |
| 1334 | Ga0495583_0001522 | 3300046506 | Bacteria | 23003 |
| 1335 | Ga0495583_0001875 | 3300046506 | Bacteria | 19558 |
| 1336 | Ga0495583_0003346 | 3300046506 | Bacteria | 12366 |
| 1337 | Ga0495583_0003399 | 3300046506 | Bacteria | 12174 |
| 1338 | Ga0495583_0005967 | 3300046506 | Bacteria | 8081 |
| 1339 | Ga0495583_0007570 | 3300046506 | Bacteria | 6792 |
| 1340 | Ga0495583_0014990 | 3300046506 | Bacteria | 4241 |
| 1341 | Ga0495583_0021529 | 3300046506 | Bacteria | 3314 |
| 1342 | Ga0495606_0000042 | 3300046507 | Bacteria | 215099 |
| 1343 | Ga0495606_0000094 | 3300046507 | Bacteria | 151840 |
| 1344 | Ga0495606_0000415 | 3300046507 | Bacteria | 71371 |
| 1345 | Ga0495606_0004342 | 3300046507 | Bacteria | 14233 |
| 1346 | Ga0495606_0010458 | 3300046507 | Bacteria | 7697 |
| 1347 | Ga0495606_0017134 | 3300046507 | Bacteria | 5492 |
| 1348 | Ga0495606_0024275 | 3300046507 | Bacteria | 4373 |
| 1349 | Ga0495606_0031645 | 3300046507 | Bacteria | 3674 |
| 1350 | Ga0495606_0047270 | 3300046507 | Bacteria | 2837 |
| 1351 | Ga0495606_0052374 | 3300046507 | Bacteria | 2654 |
| 1352 | Ga0495606_0092027 | 3300046507 | Bacteria | 1863 |
| 1353 | Ga0495606_0101378 | 3300046507 | Unclassified | 1752 |
| 1354 | Ga0495606_0121684 | 3300046507 | Bacteria | 1562 |
| 1355 | Ga0495608_0002301 | 3300046511 | Bacteria | 13788 |
| 1356 | Ga0495608_0049734 | 3300046511 | Bacteria | 2783 |
| 1357 | Ga0495608_0128929 | 3300046511 | Bacteria | 1619 |
| 1358 | Ga0495610_0001773 | 3300046512 | Bacteria | 18869 |
| 1359 | Ga0495610_0002926 | 3300046512 | Bacteria | 13804 |
| 1360 | Ga0495610_0006406 | 3300046512 | Bacteria | 8104 |
| 1361 | Ga0495610_0007142 | 3300046512 | Bacteria | 7527 |
| 1362 | Ga0495610_0009768 | 3300046512 | Bacteria | 6028 |
| 1363 | Ga0495610_0011761 | 3300046512 | Bacteria | 5316 |
| 1364 | Ga0495610_0021121 | 3300046512 | Bacteria | 3587 |
| 1365 | Ga0495610_0026266 | 3300046512 | Bacteria | 3111 |
| 1366 | Ga0495616_0001328 | 3300046513 | Bacteria | 17284 |
| 1367 | Ga0495616_0003641 | 3300046513 | Bacteria | 9840 |
| 1368 | Ga0495616_0024526 | 3300046513 | Bacteria | 3234 |
| 1369 | Ga0495618_0005830 | 3300046514 | Bacteria | 7490 |
| 1370 | Ga0495618_0006411 | 3300046514 | Bacteria | 7141 |
| 1371 | Ga0495620_0000322 | 3300046515 | Bacteria | 33867 |
| 1372 | Ga0495620_0000370 | 3300046515 | Bacteria | 30870 |
| 1373 | Ga0495620_0000712 | 3300046515 | Bacteria | 20529 |
| 1374 | Ga0495620_0004434 | 3300046515 | Bacteria | 7912 |
| 1375 | Ga0495620_0006667 | 3300046515 | Bacteria | 6326 |
| 1376 | Ga0495620_0012891 | 3300046515 | Bacteria | 4297 |
| 1377 | Ga0495620_0028687 | 3300046515 | Bacteria | 2584 |
| 1378 | Ga0495620_0039355 | 3300046515 | Bacteria | 2090 |
| 1379 | Ga0495620_0039358 | 3300046515 | Bacteria | 2090 |
| 1380 | Ga0495628_0010471 | 3300046516 | Bacteria | 7874 |
| 1381 | Ga0495628_0019455 | 3300046516 | Bacteria | 5612 |
| 1382 | Ga0495628_0023111 | 3300046516 | Bacteria | 5105 |
| 1383 | Ga0495628_0053416 | 3300046516 | Bacteria | 3188 |
| 1384 | Ga0495630_0007696 | 3300046517 | Bacteria | 7704 |
| 1385 | Ga0495630_0120160 | 3300046517 | Bacteria | 1993 |
| 1386 | Ga0495630_0218900 | 3300046517 | Bacteria | 1453 |
| 1387 | Ga0495631_0001689 | 3300046518 | Bacteria | 13122 |
| 1388 | Ga0495631_0005206 | 3300046518 | Bacteria | 6849 |
| 1389 | Ga0495632_0000360 | 3300046519 | Bacteria | 43203 |
| 1390 | Ga0495632_0000839 | 3300046519 | Bacteria | 27070 |
| 1391 | Ga0495632_0007029 | 3300046519 | Bacteria | 7136 |
| 1392 | Ga0495632_0017470 | 3300046519 | Bacteria | 3957 |
| 1393 | Ga0495632_0021778 | 3300046519 | Bacteria | 3447 |
| 1394 | Ga0495632_0027352 | 3300046519 | Bacteria | 2988 |
| 1395 | Ga0495632_0081507 | 3300046519 | Bacteria | 1542 |
| 1396 | Ga0495632_0089107 | 3300046519 | Bacteria | 1465 |
| 1397 | Ga0495637_0000491 | 3300046520 | Bacteria | 28683 |
| 1398 | Ga0495637_0000518 | 3300046520 | Bacteria | 27995 |
| 1399 | Ga0495637_0001199 | 3300046520 | Bacteria | 15781 |
| 1400 | Ga0495637_0002120 | 3300046520 | Bacteria | 11144 |
| 1401 | Ga0495637_0002498 | 3300046520 | Bacteria | 10150 |
| 1402 | Ga0495637_0006632 | 3300046520 | Bacteria | 5795 |
| 1403 | Ga0495637_0020789 | 3300046520 | Bacteria | 3013 |
| 1404 | Ga0495637_0038833 | 3300046520 | Bacteria | 2059 |
| 1405 | Ga0495637_0046991 | 3300046520 | Bacteria | 1824 |
| 1406 | Ga0495643_0000086 | 3300046522 | Bacteria | 156793 |
| 1407 | Ga0495643_0001985 | 3300046522 | Bacteria | 17133 |
| 1408 | Ga0495643_0004073 | 3300046522 | Bacteria | 10408 |
| 1409 | Ga0495643_0035642 | 3300046522 | Bacteria | 2738 |
| 1410 | Ga0495643_0070422 | 3300046522 | Bacteria | 1836 |
| 1411 | Ga0495644_0000023 | 3300046523 | Bacteria | 79095 |
| 1412 | Ga0495644_0003319 | 3300046523 | Bacteria | 6361 |
| 1413 | Ga0495644_0022555 | 3300046523 | Bacteria | 2399 |
| 1414 | Ga0495648_0009523 | 3300046524 | Bacteria | 7506 |
| 1415 | Ga0495648_0017985 | 3300046524 | Bacteria | 5028 |
| 1416 | Ga0495648_0024067 | 3300046524 | Bacteria | 4156 |
| 1417 | Ga0495648_0131871 | 3300046524 | Bacteria | 1327 |
| 1418 | Ga0495666_0001050 | 3300046526 | Bacteria | 13112 |
| 1419 | Ga0495666_0004226 | 3300046526 | Bacteria | 7244 |
| 1420 | Ga0495666_0012026 | 3300046526 | Bacteria | 4320 |
| 1421 | Ga0495666_0015904 | 3300046526 | Bacteria | 3747 |
| 1422 | Ga0495666_0016571 | 3300046526 | Bacteria | 3671 |
| 1423 | Ga0495666_0104325 | 3300046526 | Bacteria | 1334 |
| 1424 | Ga0495642_0001013 | 3300046528 | Bacteria | 13045 |
| 1425 | Ga0495642_0001683 | 3300046528 | Bacteria | 9580 |
| 1426 | Ga0495652_0001674 | 3300046529 | Bacteria | 24027 |
| 1427 | Ga0495652_0003383 | 3300046529 | Bacteria | 15774 |
| 1428 | Ga0495652_0017996 | 3300046529 | Bacteria | 6304 |
| 1429 | Ga0495652_0042949 | 3300046529 | Bacteria | 3896 |
| 1430 | Ga0495652_0104061 | 3300046529 | Bacteria | 2296 |
| 1431 | Ga0495654_0001499 | 3300046530 | Bacteria | 15959 |
| 1432 | Ga0495654_0004083 | 3300046530 | Bacteria | 8760 |
| 1433 | Ga0495654_0007063 | 3300046530 | Bacteria | 6318 |
| 1434 | Ga0495654_0009795 | 3300046530 | Bacteria | 5236 |
| 1435 | Ga0495654_0010614 | 3300046530 | Bacteria | 5005 |
| 1436 | Ga0495654_0018508 | 3300046530 | Bacteria | 3649 |
| 1437 | Ga0495654_0023907 | 3300046530 | Bacteria | 3161 |
| 1438 | Ga0495654_0057801 | 3300046530 | Bacteria | 1873 |
| 1439 | Ga0495665_0000875 | 3300046531 | Bacteria | 15751 |
| 1440 | Ga0495665_0007079 | 3300046531 | Bacteria | 6053 |
| 1441 | Ga0495665_0015355 | 3300046531 | Bacteria | 4124 |
| 1442 | Ga0495640_0034402 | 3300046533 | Bacteria | 3593 |
| 1443 | Ga0495640_0123908 | 3300046533 | Bacteria | 1677 |
| 1444 | Ga0495586_0000896 | 3300046535 | Bacteria | 16999 |
| 1445 | Ga0495587_0004691 | 3300046536 | Bacteria | 8972 |
| 1446 | Ga0495587_0014198 | 3300046536 | Bacteria | 4999 |
| 1447 | Ga0495587_0072568 | 3300046536 | Bacteria | 2001 |
| 1448 | Ga0495609_0000115 | 3300046538 | Bacteria | 93419 |
| 1449 | Ga0495609_0000248 | 3300046538 | Bacteria | 51092 |
| 1450 | Ga0495609_0000395 | 3300046538 | Bacteria | 36677 |
| 1451 | Ga0495609_0088505 | 3300046538 | Bacteria | 1348 |
| 1452 | Ga0495621_0026915 | 3300046539 | Bacteria | 1944 |
| 1453 | Ga0495597_0001034 | 3300046542 | Bacteria | 21263 |
| 1454 | Ga0495597_0002749 | 3300046542 | Bacteria | 10826 |
| 1455 | Ga0495597_0003571 | 3300046542 | Bacteria | 8969 |
| 1456 | Ga0495645_0002052 | 3300046543 | Bacteria | 13703 |
| 1457 | Ga0495645_0002469 | 3300046543 | Bacteria | 12554 |
| 1458 | Ga0495645_0015033 | 3300046543 | Bacteria | 5499 |
| 1459 | Ga0495645_0041759 | 3300046543 | Bacteria | 3344 |
| 1460 | Ga0495645_0096052 | 3300046543 | Bacteria | 2112 |
| 1461 | Ga0495622_0000575 | 3300046557 | Bacteria | 22020 |
| 1462 | Ga0495622_0001521 | 3300046557 | Bacteria | 11587 |
| 1463 | Ga0495622_0003706 | 3300046557 | Bacteria | 7156 |
| 1464 | Ga0495622_0015667 | 3300046557 | Bacteria | 3524 |
| 1465 | Ga0495633_0001190 | 3300046558 | Bacteria | 20892 |
| 1466 | Ga0495633_0001693 | 3300046558 | Bacteria | 16578 |
| 1467 | Ga0495633_0008768 | 3300046558 | Bacteria | 5658 |
| 1468 | Ga0495667_0203396 | 3300046559 | Bacteria | 1267 |
| 1469 | Ga0495668_0018071 | 3300046616 | Bacteria | 4080 |
| 1470 | Ga0495668_0063825 | 3300046616 | Bacteria | 2028 |
| 1471 | Ga0495634_0005493 | 3300046642 | Bacteria | 9746 |
| 1472 | Ga0495634_0019337 | 3300046642 | Bacteria | 4841 |
| 1473 | Ga0495634_0042765 | 3300046642 | Bacteria | 3072 |
| 1474 | Ga0495611_0000736 | 3300046648 | Bacteria | 18466 |
| 1475 | Ga0495611_0000932 | 3300046648 | Bacteria | 15712 |
| 1476 | Ga0495611_0004344 | 3300046648 | Bacteria | 6144 |
| 1477 | Ga0495611_0047326 | 3300046648 | Bacteria | 1930 |
| 1478 | Ga0495625_0000672 | 3300046660 | Bacteria | 48741 |
| 1479 | Ga0495625_0001298 | 3300046660 | Bacteria | 31365 |
| 1480 | Ga0495625_0003330 | 3300046660 | Bacteria | 16184 |
| 1481 | Ga0495625_0007862 | 3300046660 | Bacteria | 9187 |
| 1482 | Ga0495625_0010613 | 3300046660 | Bacteria | 7601 |
| 1483 | Ga0495625_0013918 | 3300046660 | Bacteria | 6441 |
| 1484 | Ga0495625_0018819 | 3300046660 | Bacteria | 5378 |
| 1485 | Ga0495625_0020283 | 3300046660 | Bacteria | 5134 |
| 1486 | Ga0495625_0024901 | 3300046660 | Bacteria | 4545 |
| 1487 | Ga0495625_0036436 | 3300046660 | Bacteria | 3616 |
| 1488 | Ga0495625_0051875 | 3300046660 | Bacteria | 2938 |
| 1489 | Ga0495625_0065430 | 3300046660 | Bacteria | 2562 |
| 1490 | Ga0495635_0027587 | 3300046663 | Bacteria | 3949 |
| 1491 | Ga0495635_0093110 | 3300046663 | Bacteria | 2060 |
| 1492 | Ga0495635_0224942 | 3300046663 | Bacteria | 1268 |
| 1493 | Ga0495659_0000652 | 3300046664 | Bacteria | 12561 |
| 1494 | Ga0495661_0000116 | 3300046665 | Bacteria | 95285 |
| 1495 | Ga0495661_0000205 | 3300046665 | Bacteria | 68743 |
| 1496 | Ga0495661_0000437 | 3300046665 | Bacteria | 44095 |
| 1497 | Ga0495661_0000685 | 3300046665 | Bacteria | 33805 |
| 1498 | Ga0495661_0001817 | 3300046665 | Bacteria | 17115 |
| 1499 | Ga0495661_0017755 | 3300046665 | Bacteria | 4690 |
| 1500 | Ga0495661_0017872 | 3300046665 | Bacteria | 4674 |
| 1501 | Ga0495661_0020307 | 3300046665 | Bacteria | 4338 |
| 1502 | Ga0495661_0024154 | 3300046665 | Bacteria | 3935 |
| 1503 | Ga0495588_0077383 | 3300046674 | Bacteria | 1735 |
| 1504 | Ga0495599_0018977 | 3300046678 | Bacteria | 4286 |
| 1505 | Ga0495599_0065919 | 3300046678 | Bacteria | 2262 |
| 1506 | Ga0495599_0198232 | 3300046678 | Bacteria | 1234 |
| 1507 | Ga0495623_0006272 | 3300046679 | Bacteria | 7731 |
| 1508 | Ga0495623_0011011 | 3300046679 | Bacteria | 5853 |
| 1509 | Ga0495623_0025627 | 3300046679 | Bacteria | 3798 |
| 1510 | Ga0495623_0156254 | 3300046679 | Bacteria | 1344 |
| 1511 | Ga0495623_0206809 | 3300046679 | Bacteria | 1125 |
| 1512 | Ga0495646_0011260 | 3300046680 | Bacteria | 5681 |
| 1513 | Ga0495646_0012311 | 3300046680 | Bacteria | 5439 |
| 1514 | Ga0495646_0023815 | 3300046680 | Bacteria | 3855 |
| 1515 | Ga0495646_0031113 | 3300046680 | Bacteria | 3329 |
| 1516 | Ga0495646_0044896 | 3300046680 | Bacteria | 2700 |
| 1517 | Ga0495669_0001481 | 3300046684 | Bacteria | 9682 |
| 1518 | Ga0495669_0024735 | 3300046684 | Bacteria | 2616 |
| 1519 | Ga0495613_0008243 | 3300046689 | Bacteria | 7734 |
| 1520 | Ga0495613_0015970 | 3300046689 | Bacteria | 5589 |
| 1521 | Ga0495624_0005166 | 3300046690 | Bacteria | 9431 |
| 1522 | Ga0495624_0006441 | 3300046690 | Bacteria | 8330 |
| 1523 | Ga0495624_0008292 | 3300046690 | Bacteria | 7263 |
| 1524 | Ga0495624_0008471 | 3300046690 | Bacteria | 7167 |
| 1525 | Ga0495624_0010611 | 3300046690 | Bacteria | 6345 |
| 1526 | Ga0495624_0021149 | 3300046690 | Bacteria | 4318 |
| 1527 | Ga0495670_0001795 | 3300046691 | Bacteria | 10537 |
| 1528 | Ga0495670_0003146 | 3300046691 | Bacteria | 8130 |
| 1529 | Ga0495670_0007244 | 3300046691 | Bacteria | 5455 |
| 1530 | Ga0495670_0020115 | 3300046691 | Bacteria | 3290 |
| 1531 | Ga0495670_0082037 | 3300046691 | Bacteria | 1643 |
| 1532 | Ga0495671_0001279 | 3300046692 | Bacteria | 17169 |
| 1533 | Ga0495671_0003674 | 3300046692 | Bacteria | 9339 |
| 1534 | Ga0495671_0004465 | 3300046692 | Bacteria | 8360 |
| 1535 | Ga0495671_0004798 | 3300046692 | Bacteria | 7989 |
| 1536 | Ga0495671_0004983 | 3300046692 | Bacteria | 7824 |
| 1537 | Ga0495671_0007822 | 3300046692 | Bacteria | 6049 |
| 1538 | Ga0495671_0010802 | 3300046692 | Bacteria | 5047 |
| 1539 | Ga0495671_0011402 | 3300046692 | Bacteria | 4892 |
| 1540 | Ga0495671_0021625 | 3300046692 | Bacteria | 3376 |
| 1541 | Ga0495671_0048111 | 3300046692 | Bacteria | 2128 |
| 1542 | Ga0495649_0000813 | 3300046694 | Bacteria | 25176 |
| 1543 | Ga0495649_0000958 | 3300046694 | Bacteria | 22785 |
| 1544 | Ga0495649_0001962 | 3300046694 | Bacteria | 14916 |
| 1545 | Ga0495649_0002855 | 3300046694 | Bacteria | 11989 |
| 1546 | Ga0495649_0022427 | 3300046694 | Bacteria | 3533 |
| 1547 | Ga0495649_0023047 | 3300046694 | Bacteria | 3478 |
| 1548 | Ga0495649_0030996 | 3300046694 | Bacteria | 2950 |
| 1549 | Ga0495649_0060976 | 3300046694 | Bacteria | 2028 |
| 1550 | Ga0495589_0000603 | 3300046794 | Bacteria | 24337 |
| 1551 | Ga0495589_0001311 | 3300046794 | Bacteria | 14606 |
| 1552 | Ga0495589_0002748 | 3300046794 | Bacteria | 9733 |
| 1553 | Ga0495589_0003822 | 3300046794 | Bacteria | 8093 |
| 1554 | Ga0495589_0006874 | 3300046794 | Bacteria | 5981 |
| 1555 | Ga0495589_0028661 | 3300046794 | Bacteria | 2809 |
| 1556 | Ga0495589_0050533 | 3300046794 | Bacteria | 2056 |
| 1557 | Ga0495600_0002250 | 3300046809 | Bacteria | 10996 |
| 1558 | Ga0495600_0005056 | 3300046809 | Bacteria | 7922 |
| 1559 | Ga0495600_0012956 | 3300046809 | Bacteria | 5226 |
| 1560 | Ga0495600_0027878 | 3300046809 | Bacteria | 3652 |
| 1561 | Ga0495660_0001767 | 3300046810 | Bacteria | 14330 |
| 1562 | Ga0495660_0002709 | 3300046810 | Bacteria | 11186 |
| 1563 | Ga0495660_0003160 | 3300046810 | Bacteria | 10257 |
| 1564 | Ga0495660_0011688 | 3300046810 | Bacteria | 5092 |
| 1565 | Ga0495660_0016648 | 3300046810 | Bacteria | 4237 |
| 1566 | Ga0495660_0046471 | 3300046810 | Bacteria | 2380 |
| 1567 | Ga0495660_0051902 | 3300046810 | Bacteria | 2229 |
| 1568 | Ga0495660_0092925 | 3300046810 | Bacteria | 1565 |
| 1569 | Ga0495581_0001650 | 3300047315 | Bacteria | 12438 |
| 1570 | Ga0495581_0021920 | 3300047315 | Bacteria | 3702 |
| 1571 | Ga0495581_0023133 | 3300047315 | Bacteria | 3601 |
| 1572 | Ga0495581_0023908 | 3300047315 | Bacteria | 3541 |
| 1573 | Ga0495581_0055110 | 3300047315 | Bacteria | 2295 |
| 1574 | Ga0495604_0002992 | 3300047317 | Bacteria | 13531 |
| 1575 | Ga0495604_0008904 | 3300047317 | Bacteria | 7932 |
| 1576 | Ga0495604_0012390 | 3300047317 | Bacteria | 6779 |
| 1577 | Ga0495604_0015148 | 3300047317 | Bacteria | 6153 |
| 1578 | Ga0495604_0096008 | 3300047317 | Bacteria | 2188 |
| 1579 | Ga0495604_0119378 | 3300047317 | Bacteria | 1910 |
| 1580 | Ga0495636_0006842 | 3300047318 | Bacteria | 4484 |
| 1581 | Ga0495674_0009541 | 3300047319 | Bacteria | 9219 |
| 1582 | Ga0495674_0020257 | 3300047319 | Bacteria | 6158 |
| 1583 | Ga0495674_0023860 | 3300047319 | Bacteria | 5629 |
| 1584 | Ga0495674_0038522 | 3300047319 | Bacteria | 4289 |
| 1585 | Ga0495672_0000006 | 3300047320 | Bacteria | 589807 |
| 1586 | Ga0495672_0001599 | 3300047320 | Bacteria | 22097 |
| 1587 | Ga0495672_0002422 | 3300047320 | Bacteria | 17192 |
| 1588 | Ga0495672_0003165 | 3300047320 | Bacteria | 14310 |
| 1589 | Ga0495672_0003648 | 3300047320 | Bacteria | 13034 |
| 1590 | Ga0495672_0005788 | 3300047320 | Bacteria | 9712 |
| 1591 | Ga0495672_0007469 | 3300047320 | Bacteria | 8217 |
| 1592 | Ga0495672_0007769 | 3300047320 | Bacteria | 8024 |
| 1593 | Ga0495672_0008206 | 3300047320 | Bacteria | 7744 |
| 1594 | Ga0495672_0012356 | 3300047320 | Bacteria | 5962 |
| 1595 | Ga0495672_0027158 | 3300047320 | Bacteria | 3642 |
| 1596 | Ga0495672_0029446 | 3300047320 | Bacteria | 3458 |
| 1597 | Ga0495672_0029976 | 3300047320 | Bacteria | 3419 |
| 1598 | Ga0495672_0047493 | 3300047320 | Bacteria | 2552 |
| 1599 | Ga0495676_0000171 | 3300047321 | Bacteria | 50588 |
| 1600 | Ga0495676_0001994 | 3300047321 | Bacteria | 17966 |
| 1601 | Ga0495676_0014357 | 3300047321 | Bacteria | 7089 |
| 1602 | Ga0495676_0021499 | 3300047321 | Bacteria | 5631 |
| 1603 | Ga0495676_0139918 | 3300047321 | Bacteria | 1735 |
| 1604 | Ga0495676_0207857 | 3300047321 | Bacteria | 1356 |
| 1605 | Ga0495680_0021825 | 3300047322 | Bacteria | 5350 |
| 1606 | Ga0495680_0046863 | 3300047322 | Bacteria | 3405 |
| 1607 | Ga0495680_0241858 | 3300047322 | Bacteria | 1281 |
| 1608 | Ga0495683_0000122 | 3300047323 | Bacteria | 77369 |
| 1609 | Ga0495683_0000507 | 3300047323 | Bacteria | 30072 |
| 1610 | Ga0495683_0002187 | 3300047323 | Bacteria | 11984 |
| 1611 | Ga0495683_0004452 | 3300047323 | Bacteria | 7955 |
| 1612 | Ga0495683_0009029 | 3300047323 | Bacteria | 5313 |
| 1613 | Ga0495683_0009650 | 3300047323 | Bacteria | 5138 |
| 1614 | Ga0495683_0019910 | 3300047323 | Bacteria | 3462 |
| 1615 | Ga0495683_0033374 | 3300047323 | Bacteria | 2619 |
| 1616 | Ga0495683_0063995 | 3300047323 | Bacteria | 1816 |
| 1617 | Ga0495683_0088161 | 3300047323 | Bacteria | 1506 |
| 1618 | Ga0495687_000011 | 3300047443 | Bacteria | 397225 |
| 1619 | Ga0495687_006192 | 3300047443 | Bacteria | 7397 |
| 1620 | Ga0495687_014652 | 3300047443 | Bacteria | 4022 |
| 1621 | Ga0495687_025890 | 3300047443 | Bacteria | 2766 |
| 1622 | Ga0495675_0004539 | 3300047444 | Bacteria | 8416 |
| 1623 | Ga0495675_0010416 | 3300047444 | Bacteria | 5812 |
| 1624 | Ga0495675_0028822 | 3300047444 | Bacteria | 3538 |
| 1625 | Ga0495675_0039223 | 3300047444 | Bacteria | 3016 |
| 1626 | Ga0495679_000119 | 3300047446 | Bacteria | 69255 |
| 1627 | Ga0495679_000471 | 3300047446 | Bacteria | 29142 |
| 1628 | Ga0495679_001597 | 3300047446 | Bacteria | 12731 |
| 1629 | Ga0495679_010672 | 3300047446 | Bacteria | 3593 |
| 1630 | Ga0495673_0000995 | 3300047469 | Bacteria | 25228 |
| 1631 | Ga0495673_0002146 | 3300047469 | Bacteria | 14327 |
| 1632 | Ga0495673_0003396 | 3300047469 | Bacteria | 10517 |
| 1633 | Ga0495673_0004684 | 3300047469 | Bacteria | 8491 |
| 1634 | Ga0495673_0009152 | 3300047469 | Bacteria | 5498 |
| 1635 | Ga0495673_0021426 | 3300047469 | Bacteria | 3190 |
| 1636 | Ga0495673_0022515 | 3300047469 | Bacteria | 3085 |
| 1637 | Ga0495673_0032777 | 3300047469 | Bacteria | 2417 |
| 1638 | Ga0495673_0033536 | 3300047469 | Bacteria | 2381 |
| 1639 | Ga0495673_0053657 | 3300047469 | Bacteria | 1756 |
| 1640 | Ga0495673_0078241 | 3300047469 | Bacteria | 1375 |
| 1641 | Ga0495681_0000588 | 3300047470 | Bacteria | 27772 |
| 1642 | Ga0495681_0001141 | 3300047470 | Bacteria | 20191 |
| 1643 | Ga0495681_0004351 | 3300047470 | Bacteria | 9685 |
| 1644 | Ga0495681_0005242 | 3300047470 | Bacteria | 8707 |
| 1645 | Ga0495681_0007039 | 3300047470 | Bacteria | 7263 |
| 1646 | Ga0495681_0008829 | 3300047470 | Bacteria | 6268 |
| 1647 | Ga0495684_0027409 | 3300047471 | Bacteria | 4374 |
| 1648 | Ga0495686_0000014 | 3300047472 | Bacteria | 474014 |
| 1649 | Ga0495686_0000106 | 3300047472 | Bacteria | 175852 |
| 1650 | Ga0495686_0002286 | 3300047472 | Bacteria | 18387 |
| 1651 | Ga0495686_0005326 | 3300047472 | Bacteria | 10190 |
| 1652 | Ga0495686_0013497 | 3300047472 | Bacteria | 5665 |
| 1653 | Ga0495686_0027334 | 3300047472 | Bacteria | 3727 |
| 1654 | Ga0495686_0052895 | 3300047472 | Bacteria | 2545 |
| 1655 | Ga0495593_0002465 | 3300047673 | Bacteria | 11124 |
| 1656 | Ga0495593_0005528 | 3300047673 | Bacteria | 7462 |
| 1657 | Ga0495593_0005604 | 3300047673 | Bacteria | 7412 |
| 1658 | Ga0495593_0010719 | 3300047673 | Bacteria | 5284 |
| 1659 | Ga0495593_0022884 | 3300047673 | Bacteria | 3477 |
| 1660 | Ga0495602_0026550 | 3300048088 | Bacteria | 5582 |
| 1661 | Ga0495602_0035542 | 3300048088 | Bacteria | 4646 |
| 1662 | Ga0495602_0106812 | 3300048088 | Bacteria | 2284 |
| 1663 | Ga0495614_0004980 | 3300048089 | Bacteria | 5996 |
| 1664 | Ga0495614_0006551 | 3300048089 | Bacteria | 5220 |
| 1665 | Ga0495626_0000123 | 3300048091 | Bacteria | 100704 |
| 1666 | Ga0495626_0000721 | 3300048091 | Bacteria | 30932 |
| 1667 | Ga0495626_0001593 | 3300048091 | Bacteria | 17705 |
| 1668 | Ga0495626_0002867 | 3300048091 | Bacteria | 11494 |
| 1669 | Ga0495626_0003467 | 3300048091 | Bacteria | 10110 |
| 1670 | Ga0495626_0009762 | 3300048091 | Bacteria | 5168 |
| 1671 | Ga0495626_0012178 | 3300048091 | Bacteria | 4521 |
| 1672 | Ga0495626_0015529 | 3300048091 | Bacteria | 3893 |
| 1673 | Ga0496100_0024102 | 3300048903 | Bacteria | 3706 |
| 1674 | Ga0496102_0004120 | 3300048905 | Bacteria | 12324 |
| 1675 | Ga0496102_0240363 | 3300048905 | Bacteria | 1707 |
| 1676 | Ga0496103_0023783 | 3300048906 | Bacteria | 3695 |
| 1677 | Ga0496103_0208661 | 3300048906 | Bacteria | 1256 |
| 1678 | Ga0496104_0074107 | 3300048907 | Bacteria | 3240 |
| 1679 | Ga0496105_0012365 | 3300048908 | Bacteria | 6758 |
| 1680 | Ga0496105_0013547 | 3300048908 | Bacteria | 6477 |
| 1681 | Ga0496105_0175230 | 3300048908 | Bacteria | 1757 |
| 1682 | Ga0496106_0000026 | 3300048909 | Bacteria | 150927 |
| 1683 | Ga0496106_0123578 | 3300048909 | Bacteria | 2025 |
| 1684 | Ga0496107_0179955 | 3300048910 | Bacteria | 1570 |
| 1685 | Ga0496109_0051688 | 3300048912 | Bacteria | 3743 |
| 1686 | Ga0496110_0000191 | 3300048913 | Bacteria | 38480 |
| 1687 | Ga0496111_0172494 | 3300048914 | Bacteria | 1607 |
| 1688 | Ga0496112_0284761 | 3300048915 | Bacteria | 1599 |
| 1689 | Ga0496113_0009261 | 3300048916 | Bacteria | 6461 |
| 1690 | Ga0496113_0021787 | 3300048916 | Bacteria | 4525 |
| 1691 | Ga0496113_0065923 | 3300048916 | Bacteria | 2741 |
| 1692 | Ga0496113_0088449 | 3300048916 | Bacteria | 2383 |
| 1693 | Ga0496113_0114603 | 3300048916 | Bacteria | 2102 |
| 1694 | Ga0496114_0095111 | 3300048917 | Bacteria | 2535 |
| 1695 | Ga0496115_0000272 | 3300048918 | Bacteria | 45410 |
| 1696 | Ga0496115_0000603 | 3300048918 | Bacteria | 27521 |
| 1697 | Ga0496115_0060115 | 3300048918 | Bacteria | 3061 |
| 1698 | Ga0496116_0000194 | 3300048919 | Bacteria | 121290 |
| 1699 | Ga0496116_0001102 | 3300048919 | Bacteria | 32408 |
| 1700 | Ga0496116_0001261 | 3300048919 | Bacteria | 29306 |
| 1701 | Ga0496116_0008312 | 3300048919 | Bacteria | 9020 |
| 1702 | Ga0496116_0045898 | 3300048919 | Bacteria | 2953 |
| 1703 | Ga0496116_0047289 | 3300048919 | Bacteria | 2896 |
| 1704 | Ga0496117_0001360 | 3300048920 | Bacteria | 35658 |
| 1705 | Ga0496117_0002501 | 3300048920 | Bacteria | 23069 |
| 1706 | Ga0496117_0004110 | 3300048920 | Bacteria | 16309 |
| 1707 | Ga0496117_0004748 | 3300048920 | Bacteria | 14752 |
| 1708 | Ga0496117_0013894 | 3300048920 | Bacteria | 6981 |
| 1709 | Ga0496117_0013964 | 3300048920 | Bacteria | 6959 |
| 1710 | Ga0496117_0028254 | 3300048920 | Bacteria | 4347 |
| 1711 | Ga0496117_0030977 | 3300048920 | Bacteria | 4092 |
| 1712 | Ga0496117_0051200 | 3300048920 | Bacteria | 2921 |
| 1713 | Ga0496118_0000110 | 3300048921 | Bacteria | 152891 |
| 1714 | Ga0496118_0001537 | 3300048921 | Bacteria | 34298 |
| 1715 | Ga0496118_0009650 | 3300048921 | Bacteria | 9704 |
| 1716 | Ga0496118_0024278 | 3300048921 | Bacteria | 5240 |
| 1717 | Ga0496118_0027773 | 3300048921 | Bacteria | 4780 |
| 1718 | Ga0496118_0037297 | 3300048921 | Bacteria | 3914 |
| 1719 | Ga0496118_0063680 | 3300048921 | Bacteria | 2711 |
| 1720 | Ga0496118_0124363 | 3300048921 | Bacteria | 1673 |
| 1721 | Ga0496119_0006317 | 3300048922 | Bacteria | 11032 |
| 1722 | Ga0496119_0015727 | 3300048922 | Bacteria | 5802 |
| 1723 | Ga0496119_0040362 | 3300048922 | Bacteria | 2986 |
| 1724 | Ga0496119_0041312 | 3300048922 | Bacteria | 2938 |
| 1725 | Ga0496119_0044682 | 3300048922 | Bacteria | 2786 |
| 1726 | Ga0496120_0003794 | 3300048923 | Bacteria | 13325 |
| 1727 | Ga0496120_0016041 | 3300048923 | Bacteria | 4910 |
| 1728 | Ga0496120_0050582 | 3300048923 | Bacteria | 2378 |
| 1729 | Ga0496121_0000005 | 3300048924 | Bacteria | 1034486 |
| 1730 | Ga0496121_0000396 | 3300048924 | Bacteria | 87716 |
| 1731 | Ga0496121_0000742 | 3300048924 | Bacteria | 60012 |
| 1732 | Ga0496121_0000791 | 3300048924 | Bacteria | 57823 |
| 1733 | Ga0496121_0001329 | 3300048924 | Bacteria | 42366 |
| 1734 | Ga0496121_0003265 | 3300048924 | Bacteria | 23309 |
| 1735 | Ga0496121_0003863 | 3300048924 | Bacteria | 20833 |
| 1736 | Ga0496121_0004801 | 3300048924 | Bacteria | 17819 |
| 1737 | Ga0496121_0007177 | 3300048924 | Bacteria | 13499 |
| 1738 | Ga0496121_0010549 | 3300048924 | Bacteria | 10393 |
| 1739 | Ga0496121_0013553 | 3300048924 | Bacteria | 8743 |
| 1740 | Ga0496121_0022594 | 3300048924 | Bacteria | 6093 |
| 1741 | Ga0496121_0073761 | 3300048924 | Bacteria | 2733 |
| 1742 | Ga0496122_0000156 | 3300048925 | Bacteria | 160178 |
| 1743 | Ga0496122_0000203 | 3300048925 | Bacteria | 132679 |
| 1744 | Ga0496122_0000249 | 3300048925 | Bacteria | 121066 |
| 1745 | Ga0496122_0000266 | 3300048925 | Bacteria | 117021 |
| 1746 | Ga0496122_0000451 | 3300048925 | Bacteria | 85677 |
| 1747 | Ga0496122_0001854 | 3300048925 | Bacteria | 32234 |
| 1748 | Ga0496122_0005055 | 3300048925 | Bacteria | 15939 |
| 1749 | Ga0496122_0008009 | 3300048925 | Bacteria | 11541 |
| 1750 | Ga0496122_0024208 | 3300048925 | Bacteria | 5319 |
| 1751 | Ga0496122_0035401 | 3300048925 | Bacteria | 4062 |
| 1752 | Ga0496122_0123320 | 3300048925 | Bacteria | 1665 |
| 1753 | Ga0496123_0000018 | 3300048926 | Bacteria | 404553 |
| 1754 | Ga0496123_0000087 | 3300048926 | Bacteria | 182994 |
| 1755 | Ga0496123_0000164 | 3300048926 | Bacteria | 132565 |
| 1756 | Ga0496123_0000347 | 3300048926 | Bacteria | 86788 |
| 1757 | Ga0496123_0001482 | 3300048926 | Bacteria | 32593 |
| 1758 | Ga0496123_0003910 | 3300048926 | Bacteria | 16191 |
| 1759 | Ga0496123_0007317 | 3300048926 | Bacteria | 10466 |
| 1760 | Ga0496123_0008731 | 3300048926 | Bacteria | 9251 |
| 1761 | Ga0496123_0009255 | 3300048926 | Bacteria | 8900 |
| 1762 | Ga0496123_0022466 | 3300048926 | Bacteria | 4859 |
| 1763 | Ga0496124_0000006 | 3300048927 | Bacteria | 904259 |
| 1764 | Ga0496124_0000023 | 3300048927 | Bacteria | 415226 |
| 1765 | Ga0496124_0000506 | 3300048927 | Bacteria | 67023 |
| 1766 | Ga0496124_0000625 | 3300048927 | Bacteria | 58974 |
| 1767 | Ga0496124_0004020 | 3300048927 | Bacteria | 17509 |
| 1768 | Ga0496124_0014633 | 3300048927 | Bacteria | 7575 |
| 1769 | Ga0496124_0033021 | 3300048927 | Bacteria | 4559 |
| 1770 | Ga0496124_0050176 | 3300048927 | Bacteria | 3557 |
| 1771 | Ga0496124_0073391 | 3300048927 | Bacteria | 2831 |
| 1772 | Ga0496124_0097320 | 3300048927 | Bacteria | 2389 |
| 1773 | Ga0496124_0108001 | 3300048927 | Bacteria | 2245 |
| 1774 | Ga0496124_0161963 | 3300048927 | Bacteria | 1742 |
| 1775 | Ga0496125_0000023 | 3300048928 | Bacteria | 449042 |
| 1776 | Ga0496125_0000144 | 3300048928 | Bacteria | 156270 |
| 1777 | Ga0496125_0000159 | 3300048928 | Bacteria | 151205 |
| 1778 | Ga0496125_0000215 | 3300048928 | Bacteria | 118487 |
| 1779 | Ga0496125_0000453 | 3300048928 | Bacteria | 74032 |
| 1780 | Ga0496125_0003794 | 3300048928 | Bacteria | 17970 |
| 1781 | Ga0496125_0028662 | 3300048928 | Bacteria | 5022 |
| 1782 | Ga0496125_0039995 | 3300048928 | Bacteria | 4029 |
| 1783 | Ga0496125_0051405 | 3300048928 | Bacteria | 3399 |
| 1784 | Ga0496125_0052078 | 3300048928 | Bacteria | 3369 |
| 1785 | Ga0496125_0059632 | 3300048928 | Bacteria | 3073 |
| 1786 | Ga0496125_0194922 | 3300048928 | Bacteria | 1333 |
| 1787 | Ga0496126_0000061 | 3300048929 | Bacteria | 261515 |
| 1788 | Ga0496126_0012736 | 3300048929 | Bacteria | 8596 |
| 1789 | Ga0496126_0033969 | 3300048929 | Bacteria | 4796 |
| 1790 | Ga0496126_0057325 | 3300048929 | Bacteria | 3517 |
| 1791 | Ga0496126_0073626 | 3300048929 | Bacteria | 3036 |
| 1792 | Ga0496126_0078778 | 3300048929 | Bacteria | 2919 |
| 1793 | Ga0496126_0097693 | 3300048929 | Bacteria | 2573 |
| 1794 | Ga0496126_0190670 | 3300048929 | Bacteria | 1736 |
| 1795 | Ga0496126_0237270 | 3300048929 | Bacteria | 1525 |
| 1796 | Ga0495678_000020 | 3300049459 | Bacteria | 253654 |
| 1797 | Ga0495678_001763 | 3300049459 | Bacteria | 16027 |
| 1798 | Ga0495678_003152 | 3300049459 | Bacteria | 10408 |
| 1799 | Ga0495678_003293 | 3300049459 | Bacteria | 10086 |
| 1800 | Ga0495678_003507 | 3300049459 | Bacteria | 9650 |
| 1801 | Ga0495678_007368 | 3300049459 | Bacteria | 5714 |
| 1802 | Ga0495678_011773 | 3300049459 | Bacteria | 4173 |
| 1803 | Ga0495678_020128 | 3300049459 | Bacteria | 2961 |
| 1804 | Ga0495678_035839 | 3300049459 | Bacteria | 2030 |
| 1805 | Ga0495682_0000018 | 3300049460 | Bacteria | 229211 |
| 1806 | Ga0501312_003177 | 3300049528 | Bacteria | 1843 |
| 1807 | Ga0501031_0010845 | 3300049568 | Bacteria | 5934 |
| 1808 | Ga0501032_0005636 | 3300049569 | Bacteria | 9277 |
| 1809 | Ga0501033_0005599 | 3300049570 | Bacteria | 9920 |
| 1810 | Ga0501033_0006555 | 3300049570 | Bacteria | 9105 |
| 1811 | Ga0501033_0054385 | 3300049570 | Bacteria | 2961 |
| 1812 | Ga0501034_0000160 | 3300049571 | Bacteria | 126787 |
| 1813 | Ga0501034_0013846 | 3300049571 | Bacteria | 8302 |
| 1814 | Ga0501034_0040386 | 3300049571 | Bacteria | 4723 |
| 1815 | Ga0501034_0085625 | 3300049571 | Bacteria | 3153 |
| 1816 | Ga0501034_0094429 | 3300049571 | Unclassified | 2987 |
| 1817 | Ga0501034_0110024 | 3300049571 | Bacteria | 2746 |
| 1818 | Ga0501034_0259127 | 3300049571 | Bacteria | 1682 |
| 1819 | Ga0501034_0281965 | 3300049571 | Bacteria | 1601 |
| 1820 | Ga0501034_0344651 | 3300049571 | Bacteria | 1419 |
| 1821 | Ga0501034_0442255 | 3300049571 | Bacteria | 1219 |
| 1822 | Ga0501036_0016078 | 3300049572 | Bacteria | 6252 |
| 1823 | Ga0501036_0105473 | 3300049572 | Unclassified | 2384 |
| 1824 | Ga0501037_0005493 | 3300049573 | Bacteria | 9241 |
| 1825 | Ga0501037_0014455 | 3300049573 | Bacteria | 5809 |
| 1826 | Ga0501037_0046604 | 3300049573 | Bacteria | 3179 |
| 1827 | Ga0501038_0099312 | 3300049574 | Unclassified | 2427 |
| 1828 | Ga0501038_0099393 | 3300049574 | Bacteria | 2425 |
| 1829 | Ga0501039_0007179 | 3300049575 | Bacteria | 8487 |
| 1830 | Ga0501040_0000155 | 3300049576 | Bacteria | 37853 |
| 1831 | Ga0501042_0012756 | 3300049578 | Bacteria | 5702 |
| 1832 | Ga0501042_0031461 | 3300049578 | Bacteria | 3753 |
| 1833 | Ga0501043_0003327 | 3300049579 | Bacteria | 13249 |
| 1834 | Ga0501043_0023026 | 3300049579 | Bacteria | 4886 |
| 1835 | Ga0501043_0038713 | 3300049579 | Bacteria | 3749 |
| 1836 | Ga0501043_0074265 | 3300049579 | Bacteria | 2671 |
| 1837 | Ga0501046_0007074 | 3300049580 | Bacteria | 9879 |
| 1838 | Ga0501046_0024284 | 3300049580 | Bacteria | 4974 |
| 1839 | Ga0501047_0085911 | 3300049581 | Bacteria | 3022 |
| 1840 | Ga0501047_0090321 | 3300049581 | Bacteria | 2940 |
| 1841 | Ga0501047_0140690 | 3300049581 | Bacteria | 2292 |
| 1842 | Ga0501047_0147189 | 3300049581 | Bacteria | 2231 |
| 1843 | Ga0501047_0270674 | 3300049581 | Bacteria | 1545 |
| 1844 | Ga0501048_0001062 | 3300049582 | Bacteria | 20570 |
| 1845 | Ga0501048_0021957 | 3300049582 | Bacteria | 4672 |
| 1846 | Ga0501048_0043025 | 3300049582 | Bacteria | 3233 |
| 1847 | Ga0501067_0000141 | 3300049583 | Bacteria | 39689 |
| 1848 | Ga0501068_0097096 | 3300049584 | Bacteria | 1823 |
| 1849 | Ga0501069_0019353 | 3300049585 | Bacteria | 3680 |
| 1850 | Ga0501070_0023144 | 3300049586 | Bacteria | 5204 |
| 1851 | Ga0501217_015787 | 3300049661 | Bacteria | 1724 |
| 1852 | Ga0501238_012959 | 3300049671 | Bacteria | 1132 |
| 1853 | Ga0501079_0007620 | 3300049741 | Bacteria | 8197 |
| 1854 | Ga0501280_005389 | 3300049776 | Bacteria | 1829 |
| 1855 | Ga0501035_0004258 | 3300049822 | Bacteria | 13582 |
| 1856 | Ga0501035_0063758 | 3300049822 | Bacteria | 3276 |
| 1857 | Ga0501035_0137431 | 3300049822 | Unclassified | 2127 |
| 1858 | Ga0501044_0002363 | 3300049823 | Bacteria | 21502 |
| 1859 | Ga0501044_0064616 | 3300049823 | Bacteria | 3735 |
| 1860 | Ga0501044_0069742 | 3300049823 | Bacteria | 3578 |
| 1861 | Ga0501044_0095026 | 3300049823 | Bacteria | 3004 |
| 1862 | Ga0501045_0026003 | 3300049824 | Bacteria | 4208 |
| 1863 | nmdc:mga03683_19772_c1 | 3300050489 | Bacteria | 2574 |
| 1864 | nmdc:mga00v17_374_c1 | 3300050491 | Bacteria | 25329 |
| 1865 | nmdc:mga00v17_57355_c1 | 3300050491 | Bacteria | 2383 |
| 1866 | Ga0500643_000017 | 3300053087 | Bacteria | 305781 |
| 1867 | Ga0500651_0001291 | 3300053093 | Bacteria | 12489 |
| 1868 | Ga0500641_0013826 | 3300053096 | Bacteria | 2970 |
| 1869 | Ga0500595_000927 | 3300053119 | Bacteria | 16616 |
| 1870 | Ga0500595_001126 | 3300053119 | Bacteria | 14807 |
| 1871 | Ga0500595_018414 | 3300053119 | Bacteria | 2554 |
| 1872 | Ga0500618_000126 | 3300053125 | Bacteria | 63007 |
| 1873 | Ga0500618_002046 | 3300053125 | Bacteria | 8147 |
| 1874 | Ga0500658_0004601 | 3300053134 | Bacteria | 5145 |
| 1875 | Ga0500568_0006096 | 3300053139 | Bacteria | 6112 |
| 1876 | Ga0500573_0000055 | 3300053140 | Bacteria | 82259 |
| 1877 | Ga0500616_0013230 | 3300053153 | Bacteria | 4800 |
| 1878 | Ga0500622_0005062 | 3300053156 | Bacteria | 8024 |
| 1879 | Ga0500634_0003859 | 3300053161 | Bacteria | 6788 |
| 1880 | Ga0500634_0018233 | 3300053161 | Bacteria | 3767 |
| 1881 | Ga0501084_0013919 | 3300054114 | Bacteria | 6660 |
| 1882 | Ga0501082_0007757 | 3300060353 | Bacteria | 9265 |
| 1883 | Ga0501082_0063322 | 3300060353 | Bacteria | 3184 |
| 1884 | Ga0466962_0005308 | 3300061719 | Bacteria | 6191 |
| 1885 | Ga0466962_0021384 | 3300061719 | Bacteria | 3107 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026121 | Ga0207683_10307360 | Ga0207683_103073601 | 326 |
| 2 | 3300046679 | Ga0495623_0206809 | Ga0495623_0206809_107_1114 | 335 |
| 3 | 3300049671 | Ga0501238_012959 | Ga0501238_012959_108_1115 | 335 |
| 4 | 3300048927 | Ga0496124_0161963 | Ga0496124_0161963_700_1728 | 342 |
| 5 | 3300053161 | Ga0500634_0018233 | Ga0500634_0018233_21_1049 | 342 |
| 6 | 3300013102 | Ga0157371_10114821 | Ga0157371_101148212 | 349 |
| 7 | 3300045049 | Ga0466959_0096473 | Ga0466959_0096473_1046_2095 | 349 |
| 8 | 3300046472 | Ga0495580_0195520 | Ga0495580_0195520_25_1077 | 350 |
| 9 | 3300046559 | Ga0495667_0203396 | Ga0495667_0203396_204_1256 | 350 |
| 10 | 3300046520 | Ga0495637_0046991 | Ga0495637_0046991_355_1440 | 361 |
| 11 | 3300009766 | Ga0123342_1014946 | Ga0123342_10149467 | 367 |
| 12 | 3300038742 | Ga0400486_01123 | Ga0400486_01123_625_1728 | 367 |
| 13 | 3300048921 | Ga0496118_0024278 | Ga0496118_0024278_4118_5221 | 367 |
| 14 | 3300048921 | Ga0496118_0063680 | Ga0496118_0063680_33_1136 | 367 |
| 15 | 3300048922 | Ga0496119_0044682 | Ga0496119_0044682_30_1133 | 367 |
| 16 | 3300049776 | Ga0501280_005389 | Ga0501280_005389_640_1764 | 371 |
| 17 | 3300048906 | Ga0496103_0023783 | Ga0496103_0023783_575_1696 | 373 |
| 18 | 3300048908 | Ga0496105_0013547 | Ga0496105_0013547_4833_5954 | 373 |
| 19 | 3300048914 | Ga0496111_0172494 | Ga0496111_0172494_22_1143 | 373 |
| 20 | 3300048922 | Ga0496119_0006317 | Ga0496119_0006317_7345_8466 | 373 |
| 21 | 3300048927 | Ga0496124_0033021 | Ga0496124_0033021_725_1846 | 373 |
| 22 | iso_pu_bacteria | 2738541272 | 2738693709 | 373 |
| 23 | iso_pu_bacteria | 2738543027 | 2739322876 | 373 |
| 24 | iso_pu_bacteria | 2758568621 | 2760621549 | 373 |
| 25 | iso_pu_bacteria | 641228493 | 641336122 | 373 |
| 26 | 3300026116 | Ga0207674_10056308 | Ga0207674_100563082 | 376 |
| 27 | 2124908027 | MRS2a_Contig_7117 | MRS2a_00018670 | 377 |
| 28 | 3300030732 | Ga0316176_1180376 | Ga0316176_11803761 | 377 |
| 29 | 3300030733 | Ga0314311_1113156 | Ga0314311_11131561 | 377 |
| 30 | iso_pu_bacteria | 8007371054 | 8007371595 | 377 |
| 31 | iso_pu_bacteria | 2501025501 | 2501074232 | 378 |
| 32 | iso_pu_bacteria | 2501025502 | 2501081676 | 378 |
| 33 | iso_pu_bacteria | 2501025504 | 2501408000 | 378 |
| 34 | iso_pu_bacteria | 2503198000 | 2503198287 | 378 |
| 35 | iso_pu_bacteria | 2508501125 | 2509130290 | 378 |
| 36 | iso_pu_bacteria | 2509276018 | 2509368360 | 378 |
| 37 | iso_pu_bacteria | 2509276033 | 2509445857 | 378 |
| 38 | iso_pu_bacteria | 2510065019 | 2510134953 | 378 |
| 39 | iso_pu_bacteria | 2510065045 | 2510252264 | 378 |
| 40 | iso_pu_bacteria | 2510065053 | 2510282949 | 378 |
| 41 | iso_pu_bacteria | 2510065055 | 2510293623 | 378 |
| 42 | iso_pu_bacteria | 2510065057 | 2510308907 | 378 |
| 43 | iso_pu_bacteria | 2510065058 | 2510310771 | 378 |
| 44 | iso_pu_bacteria | 2510065059 | 2510314641 | 378 |
| 45 | iso_pu_bacteria | 2510461076 | 2510896375 | 378 |
| 46 | iso_pu_bacteria | 2510917013 | 2511085617 | 378 |
| 47 | iso_pu_bacteria | 2510917014 | 2511095744 | 378 |
| 48 | iso_pu_bacteria | 2510917015 | 2511103503 | 378 |
| 49 | iso_pu_bacteria | 2510917022 | 2511136004 | 378 |
| 50 | iso_pu_bacteria | 2510917026 | 2511169450 | 378 |
| 51 | iso_pu_bacteria | 2510917030 | 2511197329 | 378 |
| 52 | iso_pu_bacteria | 2511231003 | 2511248248 | 378 |
| 53 | iso_pu_bacteria | 2511231004 | 2511256745 | 378 |
| 54 | iso_pu_bacteria | 2511231007 | 2511274754 | 378 |
| 55 | iso_pu_bacteria | 2511231008 | 2511277723 | 378 |
| 56 | iso_pu_bacteria | 2511231010 | 2511287654 | 378 |
| 57 | iso_pu_bacteria | 2511231011 | 2511294082 | 378 |
| 58 | iso_pu_bacteria | 2511231012 | 2511303120 | 378 |
| 59 | iso_pu_bacteria | 2511231014 | 2511314169 | 378 |
| 60 | iso_pu_bacteria | 2511231015 | 2511319886 | 378 |
| 61 | iso_pu_bacteria | 2511231016 | 2511327729 | 378 |
| 62 | iso_pu_bacteria | 2511231017 | 2511331594 | 378 |
| 63 | iso_pu_bacteria | 2511231018 | 2511340315 | 378 |
| 64 | iso_pu_bacteria | 2511231019 | 2511344955 | 378 |
| 65 | iso_pu_bacteria | 2511231020 | 2511348645 | 378 |
| 66 | iso_pu_bacteria | 2511231021 | 2511359772 | 378 |
| 67 | iso_pu_bacteria | 2511231022 | 2511360795 | 378 |
| 68 | iso_pu_bacteria | 2511231023 | 2511371091 | 378 |
| 69 | iso_pu_bacteria | 2511231026 | 2511384811 | 378 |
| 70 | iso_pu_bacteria | 2511231031 | 2511410728 | 378 |
| 71 | iso_pu_bacteria | 2511231052 | 2511496876 | 378 |
| 72 | iso_pu_bacteria | 2511231156 | 2511826112 | 378 |
| 73 | iso_pu_bacteria | 2512047030 | 2512344814 | 378 |
| 74 | iso_pu_bacteria | 2512047086 | 2512528925 | 378 |
| 75 | iso_pu_bacteria | 2512875026 | 2512969135 | 378 |
| 76 | iso_pu_bacteria | 2513237082 | 2513554279 | 378 |
| 77 | iso_pu_bacteria | 2513237083 | 2513562557 | 378 |
| 78 | iso_pu_bacteria | 2513237084 | 2513573740 | 378 |
| 79 | iso_pu_bacteria | 2513237085 | 2513581541 | 378 |
| 80 | iso_pu_bacteria | 2513237086 | 2513583318 | 378 |
| 81 | iso_pu_bacteria | 2513237089 | 2513605653 | 378 |
| 82 | iso_pu_bacteria | 2513237090 | 2513609745 | 378 |
| 83 | iso_pu_bacteria | 2513237091 | 2513615008 | 378 |
| 84 | iso_pu_bacteria | 2513237093 | 2513631199 | 378 |
| 85 | iso_pu_bacteria | 2513237103 | 2513710904 | 378 |
| 86 | iso_pu_bacteria | 2513237140 | 2513884102 | 378 |
| 87 | iso_pu_bacteria | 2513237143 | 2513901538 | 378 |
| 88 | iso_pu_bacteria | 2513237144 | 2513908079 | 378 |
| 89 | iso_pu_bacteria | 2513237151 | 2513963429 | 378 |
| 90 | iso_pu_bacteria | 2513237160 | 2514007795 | 378 |
| 91 | iso_pu_bacteria | 2513237162 | 2514023264 | 378 |
| 92 | iso_pu_bacteria | 2513237166 | 2514047408 | 378 |
| 93 | iso_pu_bacteria | 2515075009 | 2515114040 | 378 |
| 94 | iso_pu_bacteria | 2515154107 | 2515612261 | 378 |
| 95 | iso_pu_bacteria | 2515154113 | 2515637124 | 378 |
| 96 | iso_pu_bacteria | 2515154114 | 2515642904 | 378 |
| 97 | iso_pu_bacteria | 2515154116 | 2515656652 | 378 |
| 98 | iso_pu_bacteria | 2515154122 | 2515682598 | 378 |
| 99 | iso_pu_bacteria | 2515154123 | 2515689494 | 378 |
| 100 | iso_pu_bacteria | 2515154134 | 2515744512 | 378 |
| 101 | iso_pu_bacteria | 2515154189 | 2516021577 | 378 |
| 102 | iso_pu_bacteria | 2516653046 | 2516895901 | 378 |
| 103 | iso_pu_bacteria | 2516653077 | 2517037676 | 378 |
| 104 | iso_pu_bacteria | 2516653085 | 2517077964 | 378 |
| 105 | iso_pu_bacteria | 2517093000 | 2517096758 | 378 |
| 106 | iso_pu_bacteria | 2517287029 | 2517410471 | 378 |
| 107 | iso_pu_bacteria | 2517487022 | 2517566125 | 378 |
| 108 | iso_pu_bacteria | 2519103095 | 2519459709 | 378 |
| 109 | iso_pu_bacteria | 2521172590 | 2521556902 | 378 |
| 110 | iso_pu_bacteria | 2522125168 | 2522552843 | 378 |
| 111 | iso_pu_bacteria | 2522572158 | 2523103361 | 378 |
| 112 | iso_pu_bacteria | 2524023207 | 2524449101 | 378 |
| 113 | iso_pu_bacteria | 2524023209 | 2524461017 | 378 |
| 114 | iso_pu_bacteria | 2526164713 | 2527078662 | 378 |
| 115 | iso_pu_bacteria | 2529292951 | 2530647072 | 378 |
| 116 | iso_pu_bacteria | 2534681796 | 2535520491 | 378 |
| 117 | iso_pu_bacteria | 2537561587 | 2537872842 | 378 |
| 118 | iso_pu_bacteria | 2547132374 | 2548498719 | 378 |
| 119 | iso_pu_bacteria | 2548876994 | 2550697495 | 378 |
| 120 | iso_pu_bacteria | 2551306084 | 2551678637 | 378 |
| 121 | iso_pu_bacteria | 2551306084 | 2551681875 | 378 |
| 122 | iso_pu_bacteria | 2551306085 | 2551683196 | 378 |
| 123 | iso_pu_bacteria | 2551306086 | 2551695849 | 378 |
| 124 | iso_pu_bacteria | 2551306089 | 2551709188 | 378 |
| 125 | iso_pu_bacteria | 2551306089 | 2551714043 | 378 |
| 126 | iso_pu_bacteria | 2551306093 | 2551744175 | 378 |
| 127 | iso_pu_bacteria | 2551306416 | 2553004692 | 378 |
| 128 | iso_pu_bacteria | 2554235227 | 2555230505 | 378 |
| 129 | iso_pu_bacteria | 2562617112 | 2563059655 | 378 |
| 130 | iso_pu_bacteria | 2582581298 | 2585224665 | 378 |
| 131 | iso_pu_bacteria | 2582581299 | 2585227951 | 378 |
| 132 | iso_pu_bacteria | 2582581304 | 2585257915 | 378 |
| 133 | iso_pu_bacteria | 2582581307 | 2585274424 | 378 |
| 134 | iso_pu_bacteria | 2582581308 | 2585282904 | 378 |
| 135 | iso_pu_bacteria | 2582581311 | 2585291286 | 378 |
| 136 | iso_pu_bacteria | 2582581315 | 2585322365 | 378 |
| 137 | iso_pu_bacteria | 2582581316 | 2585331884 | 378 |
| 138 | iso_pu_bacteria | 2582581316 | 2585335055 | 378 |
| 139 | iso_pu_bacteria | 2582581865 | 2585389116 | 378 |
| 140 | iso_pu_bacteria | 2585427526 | 2585530283 | 378 |
| 141 | iso_pu_bacteria | 2585427527 | 2585532311 | 378 |
| 142 | iso_pu_bacteria | 2585427528 | 2585540903 | 378 |
| 143 | iso_pu_bacteria | 2585427529 | 2585547221 | 378 |
| 144 | iso_pu_bacteria | 2585427530 | 2585557574 | 378 |
| 145 | iso_pu_bacteria | 2585427531 | 2585560876 | 378 |
| 146 | iso_pu_bacteria | 2585427593 | 2585839665 | 378 |
| 147 | iso_pu_bacteria | 2585427594 | 2585846179 | 378 |
| 148 | iso_pu_bacteria | 2585427608 | 2585899075 | 378 |
| 149 | iso_pu_bacteria | 2585427609 | 2585903331 | 378 |
| 150 | iso_pu_bacteria | 2585427649 | 2586059877 | 378 |
| 151 | iso_pu_bacteria | 2585428125 | 2587981550 | 378 |
| 152 | iso_pu_bacteria | 2593339198 | 2595320013 | 378 |
| 153 | iso_pu_bacteria | 2597489888 | 2597861226 | 378 |
| 154 | iso_pu_bacteria | 2597489889 | 2597866973 | 378 |
| 155 | iso_pu_bacteria | 2599185155 | 2599326629 | 378 |
| 156 | iso_pu_bacteria | 2599185156 | 2599334063 | 378 |
| 157 | iso_pu_bacteria | 2599185167 | 2599401113 | 378 |
| 158 | iso_pu_bacteria | 2599185179 | 2599449554 | 378 |
| 159 | iso_pu_bacteria | 2599185188 | 2599504339 | 378 |
| 160 | iso_pu_bacteria | 2599185189 | 2599506053 | 378 |
| 161 | iso_pu_bacteria | 2599185190 | 2599511626 | 378 |
| 162 | iso_pu_bacteria | 2599185191 | 2599516600 | 378 |
| 163 | iso_pu_bacteria | 2599185212 | 2599613629 | 378 |
| 164 | iso_pu_bacteria | 2599185236 | 2599723754 | 378 |
| 165 | iso_pu_bacteria | 2599185239 | 2599739939 | 378 |
| 166 | iso_pu_bacteria | 2599185240 | 2599748137 | 378 |
| 167 | iso_pu_bacteria | 2599185248 | 2599773003 | 378 |
| 168 | iso_pu_bacteria | 2599185288 | 2599879346 | 378 |
| 169 | iso_pu_bacteria | 2599185289 | 2599889370 | 378 |
| 170 | iso_pu_bacteria | 2599185290 | 2599893129 | 378 |
| 171 | iso_pu_bacteria | 2599185291 | 2599900768 | 378 |
| 172 | iso_pu_bacteria | 2599185292 | 2599906010 | 378 |
| 173 | iso_pu_bacteria | 2599185300 | 2599933400 | 378 |
| 174 | iso_pu_bacteria | 2599185301 | 2599935518 | 378 |
| 175 | iso_pu_bacteria | 2599185302 | 2599944147 | 378 |
| 176 | iso_pu_bacteria | 2599185303 | 2599948708 | 378 |
| 177 | iso_pu_bacteria | 2599185304 | 2599956365 | 378 |
| 178 | iso_pu_bacteria | 2599185305 | 2599963411 | 378 |
| 179 | iso_pu_bacteria | 2599185306 | 2599966541 | 378 |
| 180 | iso_pu_bacteria | 2599185307 | 2599970516 | 378 |
| 181 | iso_pu_bacteria | 2599185308 | 2599977678 | 378 |
| 182 | iso_pu_bacteria | 2599185309 | 2599985059 | 378 |
| 183 | iso_pu_bacteria | 2599185310 | 2599989315 | 378 |
| 184 | iso_pu_bacteria | 2599185311 | 2599994228 | 378 |
| 185 | iso_pu_bacteria | 2599185312 | 2600000289 | 378 |
| 186 | iso_pu_bacteria | 2599185313 | 2600008169 | 378 |
| 187 | iso_pu_bacteria | 2599185314 | 2600011847 | 378 |
| 188 | iso_pu_bacteria | 2599185315 | 2600019338 | 378 |
| 189 | iso_pu_bacteria | 2599185316 | 2600023523 | 378 |
| 190 | iso_pu_bacteria | 2599185317 | 2600030675 | 378 |
| 191 | iso_pu_bacteria | 2599185318 | 2600037032 | 378 |
| 192 | iso_pu_bacteria | 2599185319 | 2600042455 | 378 |
| 193 | iso_pu_bacteria | 2599185320 | 2600049549 | 378 |
| 194 | iso_pu_bacteria | 2599185321 | 2600053848 | 378 |
| 195 | iso_pu_bacteria | 2599185322 | 2600060518 | 378 |
| 196 | iso_pu_bacteria | 2599185323 | 2600065617 | 378 |
| 197 | iso_pu_bacteria | 2599185324 | 2600070776 | 378 |
| 198 | iso_pu_bacteria | 2599185325 | 2600078302 | 378 |
| 199 | iso_pu_bacteria | 2599185352 | 2600192557 | 378 |
| 200 | iso_pu_bacteria | 2599185355 | 2600209993 | 378 |
| 201 | iso_pu_bacteria | 2600254930 | 2600360482 | 378 |
| 202 | iso_pu_bacteria | 2600255067 | 2600810445 | 378 |
| 203 | iso_pu_bacteria | 2600255283 | 2601624907 | 378 |
| 204 | iso_pu_bacteria | 2600255296 | 2601693300 | 378 |
| 205 | iso_pu_bacteria | 2600255318 | 2601796377 | 378 |
| 206 | iso_pu_bacteria | 2603880185 | 2606073527 | 378 |
| 207 | iso_pu_bacteria | 2603880199 | 2606126829 | 378 |
| 208 | iso_pu_bacteria | 2615840624 | 2616295671 | 378 |
| 209 | iso_pu_bacteria | 2615840626 | 2616307534 | 378 |
| 210 | iso_pu_bacteria | 2615840698 | 2616555083 | 378 |
| 211 | iso_pu_bacteria | 2617270742 | 2617384290 | 378 |
| 212 | iso_pu_bacteria | 2619619299 | 2621296520 | 378 |
| 213 | iso_pu_bacteria | 2623620443 | 2624482028 | 378 |
| 214 | iso_pu_bacteria | 2623620446 | 2624490891 | 378 |
| 215 | iso_pu_bacteria | 2643221550 | 2643772716 | 378 |
| 216 | iso_pu_bacteria | 2643221557 | 2643808917 | 378 |
| 217 | iso_pu_bacteria | 2643221565 | 2643845071 | 378 |
| 218 | iso_pu_bacteria | 2643221569 | 2643858973 | 378 |
| 219 | iso_pu_bacteria | 2643221570 | 2643865504 | 378 |
| 220 | iso_pu_bacteria | 2643221571 | 2643873516 | 378 |
| 221 | iso_pu_bacteria | 2643221577 | 2643895808 | 378 |
| 222 | iso_pu_bacteria | 2643221589 | 2643956601 | 378 |
| 223 | iso_pu_bacteria | 2643221594 | 2643981843 | 378 |
| 224 | iso_pu_bacteria | 2643221596 | 2643992043 | 378 |
| 225 | iso_pu_bacteria | 2643221599 | 2644005286 | 378 |
| 226 | iso_pu_bacteria | 2643221602 | 2644025356 | 378 |
| 227 | iso_pu_bacteria | 2643221607 | 2644048633 | 378 |
| 228 | iso_pu_bacteria | 2643221609 | 2644063253 | 378 |
| 229 | iso_pu_bacteria | 2643221610 | 2644068002 | 378 |
| 230 | iso_pu_bacteria | 2643221611 | 2644071736 | 378 |
| 231 | iso_pu_bacteria | 2643221621 | 2644122845 | 378 |
| 232 | iso_pu_bacteria | 2643221626 | 2644149354 | 378 |
| 233 | iso_pu_bacteria | 2643221634 | 2644196024 | 378 |
| 234 | iso_pu_bacteria | 2643221636 | 2644202046 | 378 |
| 235 | iso_pu_bacteria | 2643221643 | 2644240801 | 378 |
| 236 | iso_pu_bacteria | 2643221650 | 2644286254 | 378 |
| 237 | iso_pu_bacteria | 2643221652 | 2644296214 | 378 |
| 238 | iso_pu_bacteria | 2643221659 | 2644337198 | 378 |
| 239 | iso_pu_bacteria | 2643221668 | 2644378441 | 378 |
| 240 | iso_pu_bacteria | 2643221675 | 2644418957 | 378 |
| 241 | iso_pu_bacteria | 2643221680 | 2644453412 | 378 |
| 242 | iso_pu_bacteria | 2643221685 | 2644478000 | 378 |
| 243 | iso_pu_bacteria | 2643221686 | 2644481435 | 378 |
| 244 | iso_pu_bacteria | 2643221689 | 2644498077 | 378 |
| 245 | iso_pu_bacteria | 2643221698 | 2644540489 | 378 |
| 246 | iso_pu_bacteria | 2643221713 | 2644624467 | 378 |
| 247 | iso_pu_bacteria | 2643221717 | 2644649450 | 378 |
| 248 | iso_pu_bacteria | 2643221723 | 2644677414 | 378 |
| 249 | iso_pu_bacteria | 2643221726 | 2644688295 | 378 |
| 250 | iso_pu_bacteria | 2651869719 | 2652548001 | 378 |
| 251 | iso_pu_bacteria | 2654587600 | 2655034077 | 378 |
| 252 | iso_pu_bacteria | 2667528170 | 2671093676 | 378 |
| 253 | iso_pu_bacteria | 2667528174 | 2671112316 | 378 |
| 254 | iso_pu_bacteria | 2667528176 | 2671129094 | 378 |
| 255 | iso_pu_bacteria | 2671180139 | 2671694754 | 378 |
| 256 | iso_pu_bacteria | 2675903129 | 2676746409 | 378 |
| 257 | iso_pu_bacteria | 2675903420 | 2677900443 | 378 |
| 258 | iso_pu_bacteria | 2675903515 | 2678264448 | 378 |
| 259 | iso_pu_bacteria | 2687453129 | 2687580970 | 378 |
| 260 | iso_pu_bacteria | 2687453130 | 2687584866 | 378 |
| 261 | iso_pu_bacteria | 2693429784 | 2694640885 | 378 |
| 262 | iso_pu_bacteria | 2711768613 | 2713479396 | 378 |
| 263 | iso_pu_bacteria | 2713897148 | 2715751334 | 378 |
| 264 | iso_pu_bacteria | 2713897149 | 2715758330 | 378 |
| 265 | iso_pu_bacteria | 2718217725 | 2718635271 | 378 |
| 266 | iso_pu_bacteria | 2718217882 | 2719182708 | 378 |
| 267 | iso_pu_bacteria | 2718217927 | 2719387376 | 378 |
| 268 | iso_pu_bacteria | 2718217991 | 2719641357 | 378 |
| 269 | iso_pu_bacteria | 2718217997 | 2719667035 | 378 |
| 270 | iso_pu_bacteria | 2718218009 | 2719733425 | 378 |
| 271 | iso_pu_bacteria | 2718218199 | 2720493455 | 378 |
| 272 | iso_pu_bacteria | 2718218232 | 2720614912 | 378 |
| 273 | iso_pu_bacteria | 2718218233 | 2720621683 | 378 |
| 274 | iso_pu_bacteria | 2718218235 | 2720633011 | 378 |
| 275 | iso_pu_bacteria | 2718218269 | 2720776735 | 378 |
| 276 | iso_pu_bacteria | 2718218363 | 2721148820 | 378 |
| 277 | iso_pu_bacteria | 2718218365 | 2721160204 | 378 |
| 278 | iso_pu_bacteria | 2718218366 | 2721165633 | 378 |
| 279 | iso_pu_bacteria | 2718218423 | 2721401011 | 378 |
| 280 | iso_pu_bacteria | 2721755514 | 2722841803 | 378 |
| 281 | iso_pu_bacteria | 2721755556 | 2723028326 | 378 |
| 282 | iso_pu_bacteria | 2721755607 | 2723246130 | 378 |
| 283 | iso_pu_bacteria | 2721755684 | 2723561953 | 378 |
| 284 | iso_pu_bacteria | 2721755685 | 2723568583 | 378 |
| 285 | iso_pu_bacteria | 2721755809 | 2724039824 | 378 |
| 286 | iso_pu_bacteria | 2721755810 | 2724046181 | 378 |
| 287 | iso_pu_bacteria | 2721755819 | 2724091342 | 378 |
| 288 | iso_pu_bacteria | 2721755822 | 2724105848 | 378 |
| 289 | iso_pu_bacteria | 2721755823 | 2724111676 | 378 |
| 290 | iso_pu_bacteria | 2724679232 | 2725950798 | 378 |
| 291 | iso_pu_bacteria | 2728369352 | 2730109262 | 378 |
| 292 | iso_pu_bacteria | 2728369365 | 2730165943 | 378 |
| 293 | iso_pu_bacteria | 2728369397 | 2730299836 | 378 |
| 294 | iso_pu_bacteria | 2738541265 | 2738673466 | 378 |
| 295 | iso_pu_bacteria | 2738541271 | 2738688497 | 378 |
| 296 | iso_pu_bacteria | 2738541282 | 2738751859 | 378 |
| 297 | iso_pu_bacteria | 2738541293 | 2738803130 | 378 |
| 298 | iso_pu_bacteria | 2738541294 | 2738807570 | 378 |
| 299 | iso_pu_bacteria | 2738541296 | 2738821758 | 378 |
| 300 | iso_pu_bacteria | 2738541298 | 2738834240 | 378 |
| 301 | iso_pu_bacteria | 2738541303 | 2738860900 | 378 |
| 302 | iso_pu_bacteria | 2738541306 | 2738875444 | 378 |
| 303 | iso_pu_bacteria | 2738541309 | 2738894930 | 378 |
| 304 | iso_pu_bacteria | 2738541333 | 2739035459 | 378 |
| 305 | iso_pu_bacteria | 2738543002 | 2739187397 | 378 |
| 306 | iso_pu_bacteria | 2738543004 | 2739197062 | 378 |
| 307 | iso_pu_bacteria | 2738543008 | 2739222042 | 378 |
| 308 | iso_pu_bacteria | 2738543012 | 2739246367 | 378 |
| 309 | iso_pu_bacteria | 2738543015 | 2739259130 | 378 |
| 310 | iso_pu_bacteria | 2738543016 | 2739264229 | 378 |
| 311 | iso_pu_bacteria | 2738543020 | 2739284893 | 378 |
| 312 | iso_pu_bacteria | 2738543021 | 2739290207 | 378 |
| 313 | iso_pu_bacteria | 2738543024 | 2739305544 | 378 |
| 314 | iso_pu_bacteria | 2738543025 | 2739315060 | 378 |
| 315 | iso_pu_bacteria | 2739367654 | 2739607462 | 378 |
| 316 | iso_pu_bacteria | 2739367700 | 2739733514 | 378 |
| 317 | iso_pu_bacteria | 2744054620 | 2745004902 | 378 |
| 318 | iso_pu_bacteria | 2744054900 | 2746088544 | 378 |
| 319 | iso_pu_bacteria | 2744054901 | 2746092583 | 378 |
| 320 | iso_pu_bacteria | 2751185846 | 2753569491 | 378 |
| 321 | iso_pu_bacteria | 2756170246 | 2756674304 | 378 |
| 322 | iso_pu_bacteria | 2758568522 | 2760304641 | 378 |
| 323 | iso_pu_bacteria | 2765235838 | 2765568097 | 378 |
| 324 | iso_pu_bacteria | 2765235840 | 2765578236 | 378 |
| 325 | iso_pu_bacteria | 2765235942 | 2766065204 | 378 |
| 326 | iso_pu_bacteria | 2773857670 | 2774122727 | 378 |
| 327 | iso_pu_bacteria | 2773857672 | 2774129006 | 378 |
| 328 | iso_pu_bacteria | 2773857673 | 2774132929 | 378 |
| 329 | iso_pu_bacteria | 2775506987 | 2776614626 | 378 |
| 330 | iso_pu_bacteria | 2775507266 | 2778176146 | 378 |
| 331 | iso_pu_bacteria | 2784132063 | 2784263207 | 378 |
| 332 | iso_pu_bacteria | 2784132072 | 2784317614 | 378 |
| 333 | iso_pu_bacteria | 2791355137 | 2792834553 | 378 |
| 334 | iso_pu_bacteria | 2791355253 | 2793283600 | 378 |
| 335 | iso_pu_bacteria | 2791355256 | 2793293514 | 378 |
| 336 | iso_pu_bacteria | 2791355259 | 2793312967 | 378 |
| 337 | iso_pu_bacteria | 2791355260 | 2793319613 | 378 |
| 338 | iso_pu_bacteria | 2791355261 | 2793327889 | 378 |
| 339 | iso_pu_bacteria | 2791355262 | 2793333502 | 378 |
| 340 | iso_pu_bacteria | 2791355263 | 2793341975 | 378 |
| 341 | iso_pu_bacteria | 2791355264 | 2793347481 | 378 |
| 342 | iso_pu_bacteria | 2791355265 | 2793353811 | 378 |
| 343 | iso_pu_bacteria | 2791355266 | 2793359584 | 378 |
| 344 | iso_pu_bacteria | 2791355267 | 2793371113 | 378 |
| 345 | iso_pu_bacteria | 2791355520 | 2794595963 | 378 |
| 346 | iso_pu_bacteria | 2802428858 | 2802720765 | 378 |
| 347 | iso_pu_bacteria | 2802428859 | 2802727954 | 378 |
| 348 | iso_pu_bacteria | 2802428860 | 2802733107 | 378 |
| 349 | iso_pu_bacteria | 2802428861 | 2802740321 | 378 |
| 350 | iso_pu_bacteria | 2802428863 | 2802753446 | 378 |
| 351 | iso_pu_bacteria | 2802429605 | 2805929515 | 378 |
| 352 | iso_pu_bacteria | 2802429606 | 2805935304 | 378 |
| 353 | iso_pu_bacteria | 2802429633 | 2806044446 | 378 |
| 354 | iso_pu_bacteria | 2802429634 | 2806052647 | 378 |
| 355 | iso_pu_bacteria | 2802429635 | 2806058947 | 378 |
| 356 | iso_pu_bacteria | 2802429636 | 2806068390 | 378 |
| 357 | iso_pu_bacteria | 2802429637 | 2806074510 | 378 |
| 358 | iso_pu_bacteria | 2808606361 | 2808856904 | 378 |
| 359 | iso_pu_bacteria | 2808606364 | 2808868768 | 378 |
| 360 | iso_pu_bacteria | 2808606376 | 2808924262 | 378 |
| 361 | iso_pu_bacteria | 2808606377 | 2808930710 | 378 |
| 362 | iso_pu_bacteria | 2808606378 | 2808936975 | 378 |
| 363 | iso_pu_bacteria | 2808606380 | 2808946353 | 378 |
| 364 | iso_pu_bacteria | 2808606381 | 2808952832 | 378 |
| 365 | iso_pu_bacteria | 2808606382 | 2808957227 | 378 |
| 366 | iso_pu_bacteria | 2808606383 | 2808965329 | 378 |
| 367 | iso_pu_bacteria | 2808606384 | 2808968196 | 378 |
| 368 | iso_pu_bacteria | 2808606385 | 2808980118 | 378 |
| 369 | iso_pu_bacteria | 2808606386 | 2808983656 | 378 |
| 370 | iso_pu_bacteria | 2808606388 | 2808995838 | 378 |
| 371 | iso_pu_bacteria | 2808606389 | 2809000183 | 378 |
| 372 | iso_pu_bacteria | 2808606390 | 2809003027 | 378 |
| 373 | iso_pu_bacteria | 2808606391 | 2809010304 | 378 |
| 374 | iso_pu_bacteria | 2808606394 | 2809026342 | 378 |
| 375 | iso_pu_bacteria | 2808606395 | 2809033910 | 378 |
| 376 | iso_pu_bacteria | 2808606415 | 2809129320 | 378 |
| 377 | iso_pu_bacteria | 2808606419 | 2809149625 | 378 |
| 378 | iso_pu_bacteria | 2808606445 | 2809218872 | 378 |
| 379 | iso_pu_bacteria | 2816332133 | 2816475417 | 378 |
| 380 | iso_pu_bacteria | 2816332186 | 2816864505 | 378 |
| 381 | iso_pu_bacteria | 2816332253 | 2817261982 | 378 |
| 382 | iso_pu_bacteria | 2816332256 | 2817279700 | 378 |
| 383 | iso_pu_bacteria | 2816332286 | 2817453931 | 378 |
| 384 | iso_pu_bacteria | 2816332298 | 2817488001 | 378 |
| 385 | iso_pu_bacteria | 2818991436 | 2819543540 | 378 |
| 386 | iso_pu_bacteria | 2818991445 | 2819595577 | 378 |
| 387 | iso_pu_bacteria | 2818991448 | 2819613546 | 378 |
| 388 | iso_pu_bacteria | 2818991449 | 2819616916 | 378 |
| 389 | iso_pu_bacteria | 2818991450 | 2819623348 | 378 |
| 390 | iso_pu_bacteria | 2818991452 | 2819633844 | 378 |
| 391 | iso_pu_bacteria | 2818991453 | 2819644056 | 378 |
| 392 | iso_pu_bacteria | 2818991456 | 2819655766 | 378 |
| 393 | iso_pu_bacteria | 2818991461 | 2819683188 | 378 |
| 394 | iso_pu_bacteria | 2821123053 | 2821126739 | 378 |
| 395 | iso_pu_bacteria | 2825651385 | 2825656610 | 378 |
| 396 | iso_pu_bacteria | 2826581358 | 2826583067 | 378 |
| 397 | iso_pu_bacteria | 2831905167 | 2831908032 | 378 |
| 398 | iso_pu_bacteria | 2834028612 | 2834031259 | 378 |
| 399 | iso_pu_bacteria | 2838016132 | 2838019218 | 378 |
| 400 | iso_pu_bacteria | 2838022645 | 2838024192 | 378 |
| 401 | iso_pu_bacteria | 2838029111 | 2838034667 | 378 |
| 402 | iso_pu_bacteria | 2838042994 | 2838047477 | 378 |
| 403 | iso_pu_bacteria | 2838048938 | 2838051064 | 378 |
| 404 | iso_pu_bacteria | 2838061910 | 2838063958 | 378 |
| 405 | iso_pu_bacteria | 2838068647 | 2838073441 | 378 |
| 406 | iso_pu_bacteria | 2838074704 | 2838075779 | 378 |
| 407 | iso_pu_bacteria | 2838661181 | 2838664737 | 378 |
| 408 | iso_pu_bacteria | 2838668709 | 2838674661 | 378 |
| 409 | iso_pu_bacteria | 2838680041 | 2838684848 | 378 |
| 410 | iso_pu_bacteria | 2838686498 | 2838691200 | 378 |
| 411 | iso_pu_bacteria | 2838694306 | 2838699315 | 378 |
| 412 | iso_pu_bacteria | 2838701080 | 2838706982 | 378 |
| 413 | iso_pu_bacteria | 2838707686 | 2838712796 | 378 |
| 414 | iso_pu_bacteria | 2838729681 | 2838735683 | 378 |
| 415 | iso_pu_bacteria | 2838736955 | 2838740346 | 378 |
| 416 | iso_pu_bacteria | 2838742623 | 2838748585 | 378 |
| 417 | iso_pu_bacteria | 2839094727 | 2839097610 | 378 |
| 418 | iso_pu_bacteria | 2841840854 | 2841843530 | 378 |
| 419 | iso_pu_bacteria | 2841851746 | 2841853980 | 378 |
| 420 | iso_pu_bacteria | 2841864319 | 2841868039 | 378 |
| 421 | iso_pu_bacteria | 2842077413 | 2842082273 | 378 |
| 422 | iso_pu_bacteria | 2842110456 | 2842113315 | 378 |
| 423 | iso_pu_bacteria | 2842118031 | 2842123198 | 378 |
| 424 | iso_pu_bacteria | 2842140634 | 2842143250 | 378 |
| 425 | iso_pu_bacteria | 2842146304 | 2842151672 | 378 |
| 426 | iso_pu_bacteria | 2842156927 | 2842162501 | 378 |
| 427 | iso_pu_bacteria | 2842163707 | 2842170397 | 378 |
| 428 | iso_pu_bacteria | 2842180545 | 2842184939 | 378 |
| 429 | iso_pu_bacteria | 2842192696 | 2842198605 | 378 |
| 430 | iso_pu_bacteria | 2842198810 | 2842199733 | 378 |
| 431 | iso_pu_bacteria | 2842205361 | 2842208428 | 378 |
| 432 | iso_pu_bacteria | 2842217011 | 2842219959 | 378 |
| 433 | iso_pu_bacteria | 2842229732 | 2842235688 | 378 |
| 434 | iso_pu_bacteria | 2842237096 | 2842241902 | 378 |
| 435 | iso_pu_bacteria | 2842243621 | 2842249278 | 378 |
| 436 | iso_pu_bacteria | 2842250916 | 2842256810 | 378 |
| 437 | iso_pu_bacteria | 2842257432 | 2842263585 | 378 |
| 438 | iso_pu_bacteria | 2842264693 | 2842269937 | 378 |
| 439 | iso_pu_bacteria | 2842271015 | 2842275675 | 378 |
| 440 | iso_pu_bacteria | 2842278818 | 2842281563 | 378 |
| 441 | iso_pu_bacteria | 2842285085 | 2842288688 | 378 |
| 442 | iso_pu_bacteria | 2842291075 | 2842296274 | 378 |
| 443 | iso_pu_bacteria | 2842298080 | 2842298848 | 378 |
| 444 | iso_pu_bacteria | 2842304105 | 2842308341 | 378 |
| 445 | iso_pu_bacteria | 2842311132 | 2842316386 | 378 |
| 446 | iso_pu_bacteria | 2842317721 | 2842321274 | 378 |
| 447 | iso_pu_bacteria | 2842324504 | 2842324688 | 378 |
| 448 | iso_pu_bacteria | 2842341865 | 2842345143 | 378 |
| 449 | iso_pu_bacteria | 2842341865 | 2842347842 | 378 |
| 450 | iso_pu_bacteria | 2842348783 | 2842348966 | 378 |
| 451 | iso_pu_bacteria | 2842357229 | 2842359284 | 378 |
| 452 | iso_pu_bacteria | 2842363717 | 2842369948 | 378 |
| 453 | iso_pu_bacteria | 2842370503 | 2842375524 | 378 |
| 454 | iso_pu_bacteria | 2842377471 | 2842382674 | 378 |
| 455 | iso_pu_bacteria | 2842384541 | 2842390075 | 378 |
| 456 | iso_pu_bacteria | 2842395702 | 2842398384 | 378 |
| 457 | iso_pu_bacteria | 2842402390 | 2842406645 | 378 |
| 458 | iso_pu_bacteria | 2842409023 | 2842412927 | 378 |
| 459 | iso_pu_bacteria | 2842415677 | 2842419571 | 378 |
| 460 | iso_pu_bacteria | 2842422224 | 2842427076 | 378 |
| 461 | iso_pu_bacteria | 2842428310 | 2842433818 | 378 |
| 462 | iso_pu_bacteria | 2842434925 | 2842440150 | 378 |
| 463 | iso_pu_bacteria | 2842441272 | 2842446839 | 378 |
| 464 | iso_pu_bacteria | 2842447887 | 2842453613 | 378 |
| 465 | iso_pu_bacteria | 2842454564 | 2842457328 | 378 |
| 466 | iso_pu_bacteria | 2842462802 | 2842468233 | 378 |
| 467 | iso_pu_bacteria | 2842469257 | 2842474759 | 378 |
| 468 | iso_pu_bacteria | 2842475841 | 2842481440 | 378 |
| 469 | iso_pu_bacteria | 2842482326 | 2842489090 | 378 |
| 470 | iso_pu_bacteria | 2842489311 | 2842495571 | 378 |
| 471 | iso_pu_bacteria | 2842495871 | 2842499040 | 378 |
| 472 | iso_pu_bacteria | 2842502639 | 2842508314 | 378 |
| 473 | iso_pu_bacteria | 2842509118 | 2842510876 | 378 |
| 474 | iso_pu_bacteria | 2842682962 | 2842683335 | 378 |
| 475 | iso_pu_bacteria | 2842780639 | 2842782427 | 378 |
| 476 | iso_pu_bacteria | 2842815866 | 2842817527 | 378 |
| 477 | iso_pu_bacteria | 2842826826 | 2842828446 | 378 |
| 478 | iso_pu_bacteria | 2842832357 | 2842836627 | 378 |
| 479 | iso_pu_bacteria | 2842837860 | 2842838233 | 378 |
| 480 | iso_pu_bacteria | 2842843487 | 2842844740 | 378 |
| 481 | iso_pu_bacteria | 2842849001 | 2842850678 | 378 |
| 482 | iso_pu_bacteria | 2842854478 | 2842859301 | 378 |
| 483 | iso_pu_bacteria | 2842903701 | 2842904382 | 378 |
| 484 | iso_pu_bacteria | 2842922631 | 2842925656 | 378 |
| 485 | iso_pu_bacteria | 2844002411 | 2844003861 | 378 |
| 486 | iso_pu_bacteria | 2844009547 | 2844010412 | 378 |
| 487 | iso_pu_bacteria | 2844163670 | 2844170986 | 378 |
| 488 | iso_pu_bacteria | 2844454524 | 2844457374 | 378 |
| 489 | iso_pu_bacteria | 2849139964 | 2849144181 | 378 |
| 490 | iso_pu_bacteria | 2852387548 | 2852391375 | 378 |
| 491 | iso_pu_bacteria | 2852612431 | 2852616658 | 378 |
| 492 | iso_pu_bacteria | 2852618963 | 2852619777 | 378 |
| 493 | iso_pu_bacteria | 2852657418 | 2852663018 | 378 |
| 494 | iso_pu_bacteria | 2852667396 | 2852671626 | 378 |
| 495 | iso_pu_bacteria | 2852673933 | 2852674553 | 378 |
| 496 | iso_pu_bacteria | 2854681122 | 2854683263 | 378 |
| 497 | iso_pu_bacteria | 2854896431 | 2854896843 | 378 |
| 498 | iso_pu_bacteria | 2855825444 | 2855829289 | 378 |
| 499 | iso_pu_bacteria | 2855839649 | 2855844389 | 378 |
| 500 | iso_pu_bacteria | 2856287931 | 2856291907 | 378 |
| 501 | iso_pu_bacteria | 2856320880 | 2856321924 | 378 |
| 502 | iso_pu_bacteria | 2856328259 | 2856331782 | 378 |
| 503 | iso_pu_bacteria | 2856334872 | 2856340816 | 378 |
| 504 | iso_pu_bacteria | 2857349434 | 2857352567 | 378 |
| 505 | iso_pu_bacteria | 2857357740 | 2857360458 | 378 |
| 506 | iso_pu_bacteria | 2857367948 | 2857373599 | 378 |
| 507 | iso_pu_bacteria | 2857442823 | 2857443923 | 378 |
| 508 | iso_pu_bacteria | 2857516855 | 2857518785 | 378 |
| 509 | iso_pu_bacteria | 2857531043 | 2857535477 | 378 |
| 510 | iso_pu_bacteria | 2857537821 | 2857539823 | 378 |
| 511 | iso_pu_bacteria | 2858800743 | 2858806151 | 378 |
| 512 | iso_pu_bacteria | 2858950400 | 2858955237 | 378 |
| 513 | iso_pu_bacteria | 2860339153 | 2860340931 | 378 |
| 514 | iso_pu_bacteria | 2860867994 | 2860868026 | 378 |
| 515 | iso_pu_bacteria | 2863421361 | 2863427016 | 378 |
| 516 | iso_pu_bacteria | 2869169390 | 2869170778 | 378 |
| 517 | iso_pu_bacteria | 2869234852 | 2869236920 | 378 |
| 518 | iso_pu_bacteria | 2869242130 | 2869243363 | 378 |
| 519 | iso_pu_bacteria | 2869249662 | 2869251905 | 378 |
| 520 | iso_pu_bacteria | 2869256925 | 2869261818 | 378 |
| 521 | iso_pu_bacteria | 2869264136 | 2869264871 | 378 |
| 522 | iso_pu_bacteria | 2869271264 | 2869278128 | 378 |
| 523 | iso_pu_bacteria | 2870068957 | 2870070265 | 378 |
| 524 | iso_pu_bacteria | 2871435913 | 2871440273 | 378 |
| 525 | iso_pu_bacteria | 2871451962 | 2871458856 | 378 |
| 526 | iso_pu_bacteria | 2871459585 | 2871459637 | 378 |
| 527 | iso_pu_bacteria | 2871466892 | 2871468251 | 378 |
| 528 | iso_pu_bacteria | 2871481445 | 2871488623 | 378 |
| 529 | iso_pu_bacteria | 2874109183 | 2874109954 | 378 |
| 530 | iso_pu_bacteria | 2874116593 | 2874123260 | 378 |
| 531 | iso_pu_bacteria | 2874131515 | 2874132118 | 378 |
| 532 | iso_pu_bacteria | 2874162495 | 2874162917 | 378 |
| 533 | iso_pu_bacteria | 2876377896 | 2876385585 | 378 |
| 534 | iso_pu_bacteria | 2876386047 | 2876391387 | 378 |
| 535 | iso_pu_bacteria | 2876399893 | 2876404228 | 378 |
| 536 | iso_pu_bacteria | 2876406927 | 2876412406 | 378 |
| 537 | iso_pu_bacteria | 2876420981 | 2876423802 | 378 |
| 538 | iso_pu_bacteria | 2878029506 | 2878034010 | 378 |
| 539 | iso_pu_bacteria | 2878730984 | 2878736385 | 378 |
| 540 | iso_pu_bacteria | 2878774303 | 2878779763 | 378 |
| 541 | iso_pu_bacteria | 2880230671 | 2880234630 | 378 |
| 542 | iso_pu_bacteria | 2881636855 | 2881638728 | 378 |
| 543 | iso_pu_bacteria | 2883087390 | 2883095258 | 378 |
| 544 | iso_pu_bacteria | 2884411467 | 2884412792 | 378 |
| 545 | iso_pu_bacteria | 2884411467 | 2884414547 | 378 |
| 546 | iso_pu_bacteria | 2884411467 | 2884414775 | 378 |
| 547 | iso_pu_bacteria | 2884811622 | 2884814583 | 378 |
| 548 | iso_pu_bacteria | 2884836552 | 2884839090 | 378 |
| 549 | iso_pu_bacteria | 2884852848 | 2884855381 | 378 |
| 550 | iso_pu_bacteria | 2885270888 | 2885279860 | 378 |
| 551 | iso_pu_bacteria | 2889010040 | 2889014518 | 378 |
| 552 | iso_pu_bacteria | 2891373044 | 2891376742 | 378 |
| 553 | iso_pu_bacteria | 2894817345 | 2894819204 | 378 |
| 554 | iso_pu_bacteria | 2896085136 | 2896086226 | 378 |
| 555 | iso_pu_bacteria | 2896154374 | 2896159112 | 378 |
| 556 | iso_pu_bacteria | 2896384573 | 2896388228 | 378 |
| 557 | iso_pu_bacteria | 2898907183 | 2898911311 | 378 |
| 558 | iso_pu_bacteria | 2900634093 | 2900637404 | 378 |
| 559 | iso_pu_bacteria | 2902682994 | 2902691133 | 378 |
| 560 | iso_pu_bacteria | 2903513507 | 2903517120 | 378 |
| 561 | iso_pu_bacteria | 2904113452 | 2904119144 | 378 |
| 562 | iso_pu_bacteria | 2904434214 | 2904434670 | 378 |
| 563 | iso_pu_bacteria | 2904439833 | 2904440396 | 378 |
| 564 | iso_pu_bacteria | 2904479285 | 2904481515 | 378 |
| 565 | iso_pu_bacteria | 2904483920 | 2904487776 | 378 |
| 566 | iso_pu_bacteria | 2904518522 | 2904521231 | 378 |
| 567 | iso_pu_bacteria | 2904530477 | 2904530689 | 378 |
| 568 | iso_pu_bacteria | 2904550169 | 2904555285 | 378 |
| 569 | iso_pu_bacteria | 2904564687 | 2904570425 | 378 |
| 570 | iso_pu_bacteria | 2904571731 | 2904577602 | 378 |
| 571 | iso_pu_bacteria | 2904584206 | 2904585898 | 378 |
| 572 | iso_pu_bacteria | 2904589729 | 2904592289 | 378 |
| 573 | iso_pu_bacteria | 2904601388 | 2904601575 | 378 |
| 574 | iso_pu_bacteria | 2904615490 | 2904620516 | 378 |
| 575 | iso_pu_bacteria | 2906363423 | 2906370383 | 378 |
| 576 | iso_pu_bacteria | 2906386501 | 2906389355 | 378 |
| 577 | iso_pu_bacteria | 2906393657 | 2906394367 | 378 |
| 578 | iso_pu_bacteria | 2906401398 | 2906404376 | 378 |
| 579 | iso_pu_bacteria | 2906408224 | 2906413352 | 378 |
| 580 | iso_pu_bacteria | 2906427513 | 2906430011 | 378 |
| 581 | iso_pu_bacteria | 2908446538 | 2908446604 | 378 |
| 582 | iso_pu_bacteria | 2909042592 | 2909048450 | 378 |
| 583 | iso_pu_bacteria | 2909399089 | 2909402904 | 378 |
| 584 | iso_pu_bacteria | 2910809715 | 2910811758 | 378 |
| 585 | iso_pu_bacteria | 2913036834 | 2913040925 | 378 |
| 586 | iso_pu_bacteria | 2915980308 | 2915982829 | 378 |
| 587 | iso_pu_bacteria | 2915986958 | 2915990152 | 378 |
| 588 | iso_pu_bacteria | 2915993759 | 2915995010 | 378 |
| 589 | iso_pu_bacteria | 2916000859 | 2916005536 | 378 |
| 590 | iso_pu_bacteria | 2916007675 | 2916013807 | 378 |
| 591 | iso_pu_bacteria | 2916014648 | 2916014891 | 378 |
| 592 | iso_pu_bacteria | 2916021584 | 2916021587 | 378 |
| 593 | iso_pu_bacteria | 2916028427 | 2916028602 | 378 |
| 594 | iso_pu_bacteria | 2916035215 | 2916035829 | 378 |
| 595 | iso_pu_bacteria | 2916041962 | 2916046559 | 378 |
| 596 | iso_pu_bacteria | 2916048683 | 2916048713 | 378 |
| 597 | iso_pu_bacteria | 2916055098 | 2916059939 | 378 |
| 598 | iso_pu_bacteria | 2916061851 | 2916064625 | 378 |
| 599 | iso_pu_bacteria | 2916068649 | 2916074288 | 378 |
| 600 | iso_pu_bacteria | 2916076590 | 2916079194 | 378 |
| 601 | iso_pu_bacteria | 2917832318 | 2917836878 | 378 |
| 602 | iso_pu_bacteria | 2919046199 | 2919049702 | 378 |
| 603 | iso_pu_bacteria | 2919063839 | 2919069373 | 378 |
| 604 | iso_pu_bacteria | 2919079590 | 2919082773 | 378 |
| 605 | iso_pu_bacteria | 2919100787 | 2919104683 | 378 |
| 606 | iso_pu_bacteria | 2919125081 | 2919125913 | 378 |
| 607 | iso_pu_bacteria | 2919385768 | 2919388106 | 378 |
| 608 | iso_pu_bacteria | 2919408235 | 2919410802 | 378 |
| 609 | iso_pu_bacteria | 2919456309 | 2919460968 | 378 |
| 610 | iso_pu_bacteria | 2919481497 | 2919487276 | 378 |
| 611 | iso_pu_bacteria | 2919487758 | 2919489708 | 378 |
| 612 | iso_pu_bacteria | 2919527303 | 2919529081 | 378 |
| 613 | iso_pu_bacteria | 2919697872 | 2919701883 | 378 |
| 614 | iso_pu_bacteria | 2919704043 | 2919707672 | 378 |
| 615 | iso_pu_bacteria | 2920760137 | 2920764337 | 378 |
| 616 | iso_pu_bacteria | 2920822456 | 2920827080 | 378 |
| 617 | iso_pu_bacteria | 2921201388 | 2921206676 | 378 |
| 618 | iso_pu_bacteria | 2921208531 | 2921214134 | 378 |
| 619 | iso_pu_bacteria | 2921237296 | 2921243572 | 378 |
| 620 | iso_pu_bacteria | 2921244191 | 2921249152 | 378 |
| 621 | iso_pu_bacteria | 2921250672 | 2921253203 | 378 |
| 622 | iso_pu_bacteria | 2921257292 | 2921263698 | 378 |
| 623 | iso_pu_bacteria | 2921263974 | 2921268018 | 378 |
| 624 | iso_pu_bacteria | 2921282425 | 2921288571 | 378 |
| 625 | iso_pu_bacteria | 2921289301 | 2921294295 | 378 |
| 626 | iso_pu_bacteria | 2921296804 | 2921302846 | 378 |
| 627 | iso_pu_bacteria | 2921643360 | 2921646338 | 378 |
| 628 | iso_pu_bacteria | 2922172374 | 2922177241 | 378 |
| 629 | iso_pu_bacteria | 2922178524 | 2922183725 | 378 |
| 630 | iso_pu_bacteria | 2923510766 | 2923515520 | 378 |
| 631 | iso_pu_bacteria | 2923586266 | 2923589962 | 378 |
| 632 | iso_pu_bacteria | 2924144063 | 2924150361 | 378 |
| 633 | iso_pu_bacteria | 2924150972 | 2924156908 | 378 |
| 634 | iso_pu_bacteria | 2924158325 | 2924163870 | 378 |
| 635 | iso_pu_bacteria | 2924165586 | 2924171273 | 378 |
| 636 | iso_pu_bacteria | 2924172951 | 2924175115 | 378 |
| 637 | iso_pu_bacteria | 2924179722 | 2924181303 | 378 |
| 638 | iso_pu_bacteria | 2924186466 | 2924192159 | 378 |
| 639 | iso_pu_bacteria | 2924193448 | 2924196743 | 378 |
| 640 | iso_pu_bacteria | 2924200457 | 2924200475 | 378 |
| 641 | iso_pu_bacteria | 2924207177 | 2924212015 | 378 |
| 642 | iso_pu_bacteria | 2924214083 | 2924220566 | 378 |
| 643 | iso_pu_bacteria | 2924221636 | 2924227708 | 378 |
| 644 | iso_pu_bacteria | 2924228884 | 2924233465 | 378 |
| 645 | iso_pu_bacteria | 2924710171 | 2924715473 | 378 |
| 646 | iso_pu_bacteria | 2924733363 | 2924736703 | 378 |
| 647 | iso_pu_bacteria | 2924741084 | 2924743945 | 378 |
| 648 | iso_pu_bacteria | 2924748358 | 2924753884 | 378 |
| 649 | iso_pu_bacteria | 2928108538 | 2928113492 | 378 |
| 650 | iso_pu_bacteria | 2928130867 | 2928134440 | 378 |
| 651 | iso_pu_bacteria | 2928135762 | 2928140795 | 378 |
| 652 | iso_pu_bacteria | 2928157003 | 2928161198 | 378 |
| 653 | iso_pu_bacteria | 2928163908 | 2928168041 | 378 |
| 654 | iso_pu_bacteria | 2928170801 | 2928175606 | 378 |
| 655 | iso_pu_bacteria | 2928503688 | 2928506087 | 378 |
| 656 | iso_pu_bacteria | 2928536128 | 2928542700 | 378 |
| 657 | iso_pu_bacteria | 2928963466 | 2928966798 | 378 |
| 658 | iso_pu_bacteria | 2928963466 | 2928966809 | 378 |
| 659 | iso_pu_bacteria | 2929138655 | 2929142922 | 378 |
| 660 | iso_pu_bacteria | 2929144301 | 2929148424 | 378 |
| 661 | iso_pu_bacteria | 2929189879 | 2929189909 | 378 |
| 662 | iso_pu_bacteria | 2931369376 | 2931374160 | 378 |
| 663 | iso_pu_bacteria | 2931390751 | 2931390970 | 378 |
| 664 | iso_pu_bacteria | 2931396565 | 2931396673 | 378 |
| 665 | iso_pu_bacteria | 2933016740 | 2933019870 | 378 |
| 666 | iso_pu_bacteria | 2933016740 | 2933020680 | 378 |
| 667 | iso_pu_bacteria | 2933570622 | 2933574790 | 378 |
| 668 | iso_pu_bacteria | 2933586486 | 2933589394 | 378 |
| 669 | iso_pu_bacteria | 2933599457 | 2933603429 | 378 |
| 670 | iso_pu_bacteria | 2935894831 | 2935901173 | 378 |
| 671 | iso_pu_bacteria | 2935901341 | 2935908259 | 378 |
| 672 | iso_pu_bacteria | 2936367885 | 2936374758 | 378 |
| 673 | iso_pu_bacteria | 2936375103 | 2936380450 | 378 |
| 674 | iso_pu_bacteria | 2936381700 | 2936382387 | 378 |
| 675 | iso_pu_bacteria | 2936996657 | 2936998336 | 378 |
| 676 | iso_pu_bacteria | 2937002841 | 2937002930 | 378 |
| 677 | iso_pu_bacteria | 2937009748 | 2937009779 | 378 |
| 678 | iso_pu_bacteria | 2937016420 | 2937021605 | 378 |
| 679 | iso_pu_bacteria | 2937023124 | 2937025089 | 378 |
| 680 | iso_pu_bacteria | 2937029754 | 2937034053 | 378 |
| 681 | iso_pu_bacteria | 2937036028 | 2937038142 | 378 |
| 682 | iso_pu_bacteria | 2937042894 | 2937049162 | 378 |
| 683 | iso_pu_bacteria | 2937049772 | 2937054217 | 378 |
| 684 | iso_pu_bacteria | 2937056579 | 2937063847 | 378 |
| 685 | iso_pu_bacteria | 2937063883 | 2937070833 | 378 |
| 686 | iso_pu_bacteria | 2937071275 | 2937077669 | 378 |
| 687 | iso_pu_bacteria | 2937078374 | 2937081214 | 378 |
| 688 | iso_pu_bacteria | 2937084907 | 2937087175 | 378 |
| 689 | iso_pu_bacteria | 2937091812 | 2937097765 | 378 |
| 690 | iso_pu_bacteria | 2937098957 | 2937105098 | 378 |
| 691 | iso_pu_bacteria | 2937106411 | 2937107973 | 378 |
| 692 | iso_pu_bacteria | 2937113482 | 2937115353 | 378 |
| 693 | iso_pu_bacteria | 2937119839 | 2937121081 | 378 |
| 694 | iso_pu_bacteria | 2937126314 | 2937128287 | 378 |
| 695 | iso_pu_bacteria | 2937861824 | 2937868897 | 378 |
| 696 | iso_pu_bacteria | 2937868953 | 2937874718 | 378 |
| 697 | iso_pu_bacteria | 2937980651 | 2937986207 | 378 |
| 698 | iso_pu_bacteria | 2938014810 | 2938016665 | 378 |
| 699 | iso_pu_bacteria | 2939589442 | 2939591610 | 378 |
| 700 | iso_pu_bacteria | 2939622612 | 2939623925 | 378 |
| 701 | iso_pu_bacteria | 2939636861 | 2939637520 | 378 |
| 702 | iso_pu_bacteria | 2941479691 | 2941479789 | 378 |
| 703 | iso_pu_bacteria | 2941499720 | 2941503273 | 378 |
| 704 | iso_pu_bacteria | 2945928738 | 2945930575 | 378 |
| 705 | iso_pu_bacteria | 2945934425 | 2945938050 | 378 |
| 706 | iso_pu_bacteria | 2945961074 | 2945967179 | 378 |
| 707 | iso_pu_bacteria | 2946006987 | 2946012922 | 378 |
| 708 | iso_pu_bacteria | 2946027586 | 2946028214 | 378 |
| 709 | iso_pu_bacteria | 2947233263 | 2947234735 | 378 |
| 710 | iso_pu_bacteria | 2952252522 | 2952254407 | 378 |
| 711 | iso_pu_bacteria | 2957375807 | 2957377280 | 378 |
| 712 | iso_pu_bacteria | 2957382221 | 2957386189 | 378 |
| 713 | iso_pu_bacteria | 2957388812 | 2957393495 | 378 |
| 714 | iso_pu_bacteria | 2957395598 | 2957397909 | 378 |
| 715 | iso_pu_bacteria | 2957402308 | 2957406594 | 378 |
| 716 | iso_pu_bacteria | 2957408893 | 2957412381 | 378 |
| 717 | iso_pu_bacteria | 2957415311 | 2957419713 | 378 |
| 718 | iso_pu_bacteria | 2957422303 | 2957429844 | 378 |
| 719 | iso_pu_bacteria | 2957430029 | 2957432949 | 378 |
| 720 | iso_pu_bacteria | 2957437181 | 2957439012 | 378 |
| 721 | iso_pu_bacteria | 2957443900 | 2957446083 | 378 |
| 722 | iso_pu_bacteria | 2957450854 | 2957451621 | 378 |
| 723 | iso_pu_bacteria | 2957457609 | 2957463667 | 378 |
| 724 | iso_pu_bacteria | 2957464669 | 2957465901 | 378 |
| 725 | iso_pu_bacteria | 2957471148 | 2957477063 | 378 |
| 726 | iso_pu_bacteria | 2957478035 | 2957483220 | 378 |
| 727 | iso_pu_bacteria | 2957484790 | 2957491202 | 378 |
| 728 | iso_pu_bacteria | 2957491536 | 2957494732 | 378 |
| 729 | iso_pu_bacteria | 2957498199 | 2957504431 | 378 |
| 730 | iso_pu_bacteria | 2957505466 | 2957505471 | 378 |
| 731 | iso_pu_bacteria | 2958064165 | 2958068059 | 378 |
| 732 | iso_pu_bacteria | 2958108152 | 2958114697 | 378 |
| 733 | iso_pu_bacteria | 2958122699 | 2958129387 | 378 |
| 734 | iso_pu_bacteria | 2958137437 | 2958138514 | 378 |
| 735 | iso_pu_bacteria | 2958158011 | 2958164034 | 378 |
| 736 | iso_pu_bacteria | 2960584000 | 2960587782 | 378 |
| 737 | iso_pu_bacteria | 2960591022 | 2960593821 | 378 |
| 738 | iso_pu_bacteria | 2960597568 | 2960600298 | 378 |
| 739 | iso_pu_bacteria | 2960603979 | 2960604220 | 378 |
| 740 | iso_pu_bacteria | 2960610863 | 2960610870 | 378 |
| 741 | iso_pu_bacteria | 2960617483 | 2960624013 | 378 |
| 742 | iso_pu_bacteria | 2960624210 | 2960624305 | 378 |
| 743 | iso_pu_bacteria | 2960631154 | 2960636447 | 378 |
| 744 | iso_pu_bacteria | 2960637947 | 2960638045 | 378 |
| 745 | iso_pu_bacteria | 2960645483 | 2960649521 | 378 |
| 746 | iso_pu_bacteria | 2960652885 | 2960659731 | 378 |
| 747 | iso_pu_bacteria | 2960660292 | 2960663617 | 378 |
| 748 | iso_pu_bacteria | 2960667422 | 2960667446 | 378 |
| 749 | iso_pu_bacteria | 2960674078 | 2960678987 | 378 |
| 750 | iso_pu_bacteria | 2960680706 | 2960683320 | 378 |
| 751 | iso_pu_bacteria | 2960693952 | 2960700303 | 378 |
| 752 | iso_pu_bacteria | 2961136820 | 2961142041 | 378 |
| 753 | iso_pu_bacteria | 2961183825 | 2961184117 | 378 |
| 754 | iso_pu_bacteria | 2964607997 | 2964608308 | 378 |
| 755 | iso_pu_bacteria | 2964615318 | 2964615392 | 378 |
| 756 | iso_pu_bacteria | 2964621998 | 2964628235 | 378 |
| 757 | iso_pu_bacteria | 2964628898 | 2964628902 | 378 |
| 758 | iso_pu_bacteria | 2964636051 | 2964640758 | 378 |
| 759 | iso_pu_bacteria | 2964643177 | 2964643496 | 378 |
| 760 | iso_pu_bacteria | 2964649959 | 2964653192 | 378 |
| 761 | iso_pu_bacteria | 2964656573 | 2964656595 | 378 |
| 762 | iso_pu_bacteria | 2964663802 | 2964664125 | 378 |
| 763 | iso_pu_bacteria | 2964670856 | 2964674387 | 378 |
| 764 | iso_pu_bacteria | 2964678106 | 2964683687 | 378 |
| 765 | iso_pu_bacteria | 2964685014 | 2964690803 | 378 |
| 766 | iso_pu_bacteria | 2964691889 | 2964698360 | 378 |
| 767 | iso_pu_bacteria | 2964698721 | 2964698790 | 378 |
| 768 | iso_pu_bacteria | 2964705432 | 2964707657 | 378 |
| 769 | iso_pu_bacteria | 2964712639 | 2964715806 | 378 |
| 770 | iso_pu_bacteria | 2964719344 | 2964726103 | 378 |
| 771 | iso_pu_bacteria | 2965025482 | 2965028591 | 378 |
| 772 | iso_pu_bacteria | 2965032056 | 2965038518 | 378 |
| 773 | iso_pu_bacteria | 2965047637 | 2965050226 | 378 |
| 774 | iso_pu_bacteria | 2965089291 | 2965094523 | 378 |
| 775 | iso_pu_bacteria | 2965102966 | 2965105084 | 378 |
| 776 | iso_pu_bacteria | 2967664464 | 2967670206 | 378 |
| 777 | iso_pu_bacteria | 2967671571 | 2967673370 | 378 |
| 778 | iso_pu_bacteria | 2967678726 | 2967679410 | 378 |
| 779 | iso_pu_bacteria | 2967686174 | 2967689669 | 378 |
| 780 | iso_pu_bacteria | 2967693043 | 2967696011 | 378 |
| 781 | iso_pu_bacteria | 2967699805 | 2967704741 | 378 |
| 782 | iso_pu_bacteria | 2967706974 | 2967711226 | 378 |
| 783 | iso_pu_bacteria | 2967714385 | 2967718336 | 378 |
| 784 | iso_pu_bacteria | 2967721400 | 2967722306 | 378 |
| 785 | iso_pu_bacteria | 2967728569 | 2967729927 | 378 |
| 786 | iso_pu_bacteria | 2967735183 | 2967738726 | 378 |
| 787 | iso_pu_bacteria | 2967742019 | 2967747604 | 378 |
| 788 | iso_pu_bacteria | 2967748971 | 2967749300 | 378 |
| 789 | iso_pu_bacteria | 2967755722 | 2967757355 | 378 |
| 790 | iso_pu_bacteria | 2967762386 | 2967762597 | 378 |
| 791 | iso_pu_bacteria | 2967769361 | 2967774087 | 378 |
| 792 | iso_pu_bacteria | 2967775926 | 2967780877 | 378 |
| 793 | iso_pu_bacteria | 2968117919 | 2968121909 | 378 |
| 794 | iso_pu_bacteria | 2969304461 | 2969308784 | 378 |
| 795 | iso_pu_bacteria | 2970019648 | 2970025819 | 378 |
| 796 | iso_pu_bacteria | 2970026789 | 2970027110 | 378 |
| 797 | iso_pu_bacteria | 2970033650 | 2970037728 | 378 |
| 798 | iso_pu_bacteria | 2970040964 | 2970045777 | 378 |
| 799 | iso_pu_bacteria | 2970047711 | 2970053946 | 378 |
| 800 | iso_pu_bacteria | 2970054988 | 2970058977 | 378 |
| 801 | iso_pu_bacteria | 2970061556 | 2970064789 | 378 |
| 802 | iso_pu_bacteria | 2970068827 | 2970075782 | 378 |
| 803 | iso_pu_bacteria | 2970076120 | 2970079677 | 378 |
| 804 | iso_pu_bacteria | 2970082768 | 2970084142 | 378 |
| 805 | iso_pu_bacteria | 2970088815 | 2970093398 | 378 |
| 806 | iso_pu_bacteria | 2970095765 | 2970099225 | 378 |
| 807 | iso_pu_bacteria | 2970102677 | 2970103007 | 378 |
| 808 | iso_pu_bacteria | 2970109326 | 2970115353 | 378 |
| 809 | iso_pu_bacteria | 2970116247 | 2970118939 | 378 |
| 810 | iso_pu_bacteria | 2970122695 | 2970124002 | 378 |
| 811 | iso_pu_bacteria | 2970129317 | 2970133319 | 378 |
| 812 | iso_pu_bacteria | 2970136068 | 2970140050 | 378 |
| 813 | iso_pu_bacteria | 2970143518 | 2970149168 | 378 |
| 814 | iso_pu_bacteria | 2970149975 | 2970152245 | 378 |
| 815 | iso_pu_bacteria | 2970156795 | 2970163005 | 378 |
| 816 | iso_pu_bacteria | 2970164137 | 2970164892 | 378 |
| 817 | iso_pu_bacteria | 2970170962 | 2970171309 | 378 |
| 818 | iso_pu_bacteria | 2970177841 | 2970179894 | 378 |
| 819 | iso_pu_bacteria | 2970191845 | 2970197726 | 378 |
| 820 | iso_pu_bacteria | 2970489779 | 2970493896 | 378 |
| 821 | iso_pu_bacteria | 2970510686 | 2970510791 | 378 |
| 822 | iso_pu_bacteria | 2970532167 | 2970533099 | 378 |
| 823 | iso_pu_bacteria | 2970547951 | 2970548449 | 378 |
| 824 | iso_pu_bacteria | 2970619444 | 2970622143 | 378 |
| 825 | iso_pu_bacteria | 2970627176 | 2970632800 | 378 |
| 826 | iso_pu_bacteria | 2971403814 | 2971404269 | 378 |
| 827 | iso_pu_bacteria | 2971410472 | 2971416463 | 378 |
| 828 | iso_pu_bacteria | 2974289157 | 2974289833 | 378 |
| 829 | iso_pu_bacteria | 2974298342 | 2974302579 | 378 |
| 830 | iso_pu_bacteria | 2974307012 | 2974308854 | 378 |
| 831 | iso_pu_bacteria | 2977247770 | 2977249570 | 378 |
| 832 | iso_pu_bacteria | 2977516862 | 2977521655 | 378 |
| 833 | iso_pu_bacteria | 2977523885 | 2977525746 | 378 |
| 834 | iso_pu_bacteria | 2977530762 | 2977534911 | 378 |
| 835 | iso_pu_bacteria | 2977537788 | 2977539953 | 378 |
| 836 | iso_pu_bacteria | 2977544691 | 2977545580 | 378 |
| 837 | iso_pu_bacteria | 2977551784 | 2977557648 | 378 |
| 838 | iso_pu_bacteria | 2977558990 | 2977559178 | 378 |
| 839 | iso_pu_bacteria | 2977565890 | 2977565956 | 378 |
| 840 | iso_pu_bacteria | 2977572785 | 2977574475 | 378 |
| 841 | iso_pu_bacteria | 2977579622 | 2977584658 | 378 |
| 842 | iso_pu_bacteria | 2977851361 | 2977856414 | 378 |
| 843 | iso_pu_bacteria | 2977872689 | 2977875348 | 378 |
| 844 | iso_pu_bacteria | 2977898635 | 2977901987 | 378 |
| 845 | iso_pu_bacteria | 2977907340 | 2977910899 | 378 |
| 846 | iso_pu_bacteria | 2977915119 | 2977919778 | 378 |
| 847 | iso_pu_bacteria | 2977935797 | 2977938538 | 378 |
| 848 | iso_pu_bacteria | 2977942078 | 2977950644 | 378 |
| 849 | iso_pu_bacteria | 2977950692 | 2977951693 | 378 |
| 850 | iso_pu_bacteria | 2977957713 | 2977964801 | 378 |
| 851 | iso_pu_bacteria | 2979764755 | 2979770471 | 378 |
| 852 | iso_pu_bacteria | 2979772303 | 2979773482 | 378 |
| 853 | iso_pu_bacteria | 2981990288 | 2981997189 | 378 |
| 854 | iso_pu_bacteria | 2984499530 | 2984499835 | 378 |
| 855 | iso_pu_bacteria | 2984504281 | 2984506266 | 378 |
| 856 | iso_pu_bacteria | 2984514374 | 2984515938 | 378 |
| 857 | iso_pu_bacteria | 2987636660 | 2987641159 | 378 |
| 858 | iso_pu_bacteria | 2987645492 | 2987650592 | 378 |
| 859 | iso_pu_bacteria | 2987652177 | 2987659177 | 378 |
| 860 | iso_pu_bacteria | 2988728565 | 2988730025 | 378 |
| 861 | iso_pu_bacteria | 2989349275 | 2989354662 | 378 |
| 862 | iso_pu_bacteria | 2989771324 | 2989776632 | 378 |
| 863 | iso_pu_bacteria | 2990703756 | 2990705234 | 378 |
| 864 | iso_pu_bacteria | 2990710928 | 2990712093 | 378 |
| 865 | iso_pu_bacteria | 2995392953 | 2995394847 | 378 |
| 866 | iso_pu_bacteria | 2996386984 | 2996388046 | 378 |
| 867 | iso_pu_bacteria | 2998139840 | 2998144087 | 378 |
| 868 | iso_pu_bacteria | 3000135777 | 3000142619 | 378 |
| 869 | iso_pu_bacteria | 3001267043 | 3001268606 | 378 |
| 870 | iso_pu_bacteria | 3001272096 | 3001274083 | 378 |
| 871 | iso_pu_bacteria | 3001892409 | 3001898537 | 378 |
| 872 | iso_pu_bacteria | 3004167301 | 3004172818 | 378 |
| 873 | iso_pu_bacteria | 3004195979 | 3004203247 | 378 |
| 874 | iso_pu_bacteria | 3004232784 | 3004235419 | 378 |
| 875 | iso_pu_bacteria | 3004239961 | 3004245565 | 378 |
| 876 | iso_pu_bacteria | 3004248173 | 3004254617 | 378 |
| 877 | iso_pu_bacteria | 3005416602 | 3005418348 | 378 |
| 878 | iso_pu_bacteria | 3005445848 | 3005449389 | 378 |
| 879 | iso_pu_bacteria | 3005445848 | 3005450712 | 378 |
| 880 | iso_pu_bacteria | 3005452660 | 3005457503 | 378 |
| 881 | iso_pu_bacteria | 3006826541 | 3006831294 | 378 |
| 882 | iso_pu_bacteria | 3006984091 | 3006984336 | 378 |
| 883 | iso_pu_bacteria | 3006988479 | 3006988752 | 378 |
| 884 | iso_pu_bacteria | 3006988479 | 3006991066 | 378 |
| 885 | iso_pu_bacteria | 3007395558 | 3007400968 | 378 |
| 886 | iso_pu_bacteria | 3007419365 | 3007425133 | 378 |
| 887 | iso_pu_bacteria | 3007511990 | 3007515728 | 378 |
| 888 | iso_pu_bacteria | 3007614139 | 3007617864 | 378 |
| 889 | iso_pu_bacteria | 3007619802 | 3007619928 | 378 |
| 890 | iso_pu_bacteria | 3007718800 | 3007719018 | 378 |
| 891 | iso_pu_bacteria | 3007855910 | 3007858926 | 378 |
| 892 | iso_pu_bacteria | 3007861166 | 3007865518 | 378 |
| 893 | iso_pu_bacteria | 3007866637 | 3007868138 | 378 |
| 894 | iso_pu_bacteria | 639633055 | 639650112 | 378 |
| 895 | iso_pu_bacteria | 641736151 | 642424252 | 378 |
| 896 | iso_pu_bacteria | 641736154 | 642416009 | 378 |
| 897 | iso_pu_bacteria | 642555112 | 642592197 | 378 |
| 898 | iso_pu_bacteria | 642555113 | 642622877 | 378 |
| 899 | iso_pu_bacteria | 643348555 | 643389922 | 378 |
| 900 | iso_pu_bacteria | 648276728 | 648735401 | 378 |
| 901 | iso_pu_bacteria | 649633066 | 649870181 | 378 |
| 902 | iso_pu_bacteria | 8002285264 | 8002289603 | 378 |
| 903 | iso_pu_bacteria | 8003014200 | 8003015637 | 378 |
| 904 | iso_pu_bacteria | 8003955200 | 8003959765 | 378 |
| 905 | iso_pu_bacteria | 8003992118 | 8003996913 | 378 |
| 906 | iso_pu_bacteria | 8003999396 | 8004004582 | 378 |
| 907 | iso_pu_bacteria | 8004300914 | 8004303693 | 378 |
| 908 | iso_pu_bacteria | 8004312739 | 8004317385 | 378 |
| 909 | iso_pu_bacteria | 8004361976 | 8004364251 | 378 |
| 910 | iso_pu_bacteria | 8004640170 | 8004644302 | 378 |
| 911 | iso_pu_bacteria | 8004695233 | 8004703460 | 378 |
| 912 | iso_pu_bacteria | 8004727605 | 8004732836 | 378 |
| 913 | iso_pu_bacteria | 8005275841 | 8005282123 | 378 |
| 914 | iso_pu_bacteria | 8005282627 | 8005285062 | 378 |
| 915 | iso_pu_bacteria | 8005289223 | 8005294155 | 378 |
| 916 | iso_pu_bacteria | 8005301065 | 8005306569 | 378 |
| 917 | iso_pu_bacteria | 8005307578 | 8005312151 | 378 |
| 918 | iso_pu_bacteria | 8005314921 | 8005318760 | 378 |
| 919 | iso_pu_bacteria | 8005376324 | 8005378441 | 378 |
| 920 | iso_pu_bacteria | 8005382845 | 8005383732 | 378 |
| 921 | iso_pu_bacteria | 8005395548 | 8005401059 | 378 |
| 922 | iso_pu_bacteria | 8005430974 | 8005434013 | 378 |
| 923 | iso_pu_bacteria | 8005460587 | 8005464728 | 378 |
| 924 | iso_pu_bacteria | 8005484373 | 8005486841 | 378 |
| 925 | iso_pu_bacteria | 8005497431 | 8005501774 | 378 |
| 926 | iso_pu_bacteria | 8005542996 | 8005548246 | 378 |
| 927 | iso_pu_bacteria | 8005556819 | 8005559049 | 378 |
| 928 | iso_pu_bacteria | 8005563573 | 8005566893 | 378 |
| 929 | iso_pu_bacteria | 8005570704 | 8005574832 | 378 |
| 930 | iso_pu_bacteria | 8005619151 | 8005623128 | 378 |
| 931 | iso_pu_bacteria | 8005626139 | 8005631564 | 378 |
| 932 | iso_pu_bacteria | 8005645114 | 8005647278 | 378 |
| 933 | iso_pu_bacteria | 8005668836 | 8005673196 | 378 |
| 934 | iso_pu_bacteria | 8005682033 | 8005682061 | 378 |
| 935 | iso_pu_bacteria | 8005688590 | 8005693735 | 378 |
| 936 | iso_pu_bacteria | 8005695170 | 8005700992 | 378 |
| 937 | iso_pu_bacteria | 8015687852 | 8015689650 | 378 |
| 938 | iso_pu_bacteria | 8016728285 | 8016731743 | 378 |
| 939 | iso_pu_bacteria | 8018127388 | 8018133508 | 378 |
| 940 | iso_pu_bacteria | 8018150411 | 8018155567 | 378 |
| 941 | iso_pu_bacteria | 8018163183 | 8018170335 | 378 |
| 942 | iso_pu_bacteria | 8018176218 | 8018178343 | 378 |
| 943 | iso_pu_bacteria | 8018845410 | 8018851639 | 378 |
| 944 | iso_pu_bacteria | 8019775933 | 8019779382 | 378 |
| 945 | iso_pu_bacteria | 8020807995 | 8020808332 | 378 |
| 946 | iso_pu_bacteria | 8020938398 | 8020945226 | 378 |
| 947 | iso_pu_bacteria | 8020945358 | 8020950661 | 378 |
| 948 | iso_pu_bacteria | 8020953355 | 8020955689 | 378 |
| 949 | iso_pu_bacteria | 8021120328 | 8021125700 | 378 |
| 950 | iso_pu_bacteria | 8022948649 | 8022953559 | 378 |
| 951 | iso_pu_bacteria | 8023680758 | 8023687428 | 378 |
| 952 | iso_pu_bacteria | 8024479707 | 8024482060 | 378 |
| 953 | iso_pu_bacteria | 8024486573 | 8024489071 | 378 |
| 954 | iso_pu_bacteria | 8024501048 | 8024505829 | 378 |
| 955 | iso_pu_bacteria | 8029995093 | 8029996791 | 378 |
| 956 | iso_pu_bacteria | 8039098773 | 8039100980 | 378 |
| 957 | iso_pu_bacteria | 8040167225 | 8040169792 | 378 |
| 958 | iso_pu_bacteria | 8040173305 | 8040178034 | 378 |
| 959 | iso_pu_bacteria | 8046767195 | 8046769213 | 378 |
| 960 | iso_pu_bacteria | 8054285046 | 8054290015 | 378 |
| 961 | iso_pu_bacteria | 8054347763 | 8054349281 | 378 |
| 962 | iso_pu_bacteria | 8054503363 | 8054503577 | 378 |
| 963 | iso_pu_bacteria | 8054929484 | 8054929881 | 378 |
| 964 | iso_pu_bacteria | 8055266321 | 8055267354 | 378 |
| 965 | iso_pu_bacteria | 8055301274 | 8055301346 | 378 |
| 966 | iso_pu_bacteria | 8055817908 | 8055817939 | 378 |
| 967 | iso_pu_bacteria | 8056125926 | 8056127470 | 378 |
| 968 | iso_pu_bacteria | 8056131705 | 8056131910 | 378 |
| 969 | iso_pu_bacteria | 8056143049 | 8056144947 | 378 |
| 970 | iso_pu_bacteria | 8056148874 | 8056151192 | 378 |
| 971 | iso_pu_bacteria | 8056155041 | 8056155139 | 378 |
| 972 | iso_pu_bacteria | 8056161164 | 8056163935 | 378 |
| 973 | iso_pu_bacteria | 8056166840 | 8056167195 | 378 |
| 974 | iso_pu_bacteria | 8056172158 | 8056173163 | 378 |
| 975 | iso_pu_bacteria | 8056177738 | 8056180093 | 378 |
| 976 | iso_pu_bacteria | 8056375014 | 8056379681 | 378 |
| 977 | iso_pu_bacteria | 8056382006 | 8056387133 | 378 |
| 978 | iso_pu_bacteria | 8056533031 | 8056534486 | 378 |
| 979 | iso_pu_bacteria | 8056569372 | 8056572827 | 378 |
| 980 | iso_pu_bacteria | 8056579771 | 8056583268 | 378 |
| 981 | iso_pu_bacteria | 8057160832 | 8057163130 | 378 |
| 982 | iso_pu_bacteria | 8057575449 | 8057581244 | 378 |
| 983 | iso_pu_bacteria | 8057874678 | 8057877111 | 378 |
| 984 | iso_pu_bacteria | 2643221688 | 2644491941 | 381 |
| 985 | 2124908027 | MRS2a_Contig_1574 | MRS2a_00446730 | 382 |
| 986 | 2162886007 | SwRhRL2b_contig_656453 | SwRhRL2b_0247.00007830 | 382 |
| 987 | 3300000546 | LJNas_1000019 | LJNas_10000198 | 382 |
| 988 | 3300001915 | JGI24741J21665_1003171 | JGI24741J21665_10031713 | 382 |
| 989 | 3300001979 | JGI24740J21852_10000251 | JGI24740J21852_1000025114 | 382 |
| 990 | 3300001979 | JGI24740J21852_10025962 | JGI24740J21852_100259622 | 382 |
| 991 | 3300001989 | JGI24739J22299_10002246 | JGI24739J22299_100022465 | 382 |
| 992 | 3300001989 | JGI24739J22299_10010413 | JGI24739J22299_100104134 | 382 |
| 993 | 3300001989 | JGI24739J22299_10016407 | JGI24739J22299_100164071 | 382 |
| 994 | 3300001989 | JGI24739J22299_10028970 | JGI24739J22299_100289702 | 382 |
| 995 | 3300001990 | JGI24737J22298_10005314 | JGI24737J22298_100053142 | 382 |
| 996 | 3300001990 | JGI24737J22298_10013296 | JGI24737J22298_100132963 | 382 |
| 997 | 3300002067 | JGI24735J21928_10000746 | JGI24735J21928_100007469 | 382 |
| 998 | 3300002067 | JGI24735J21928_10003472 | JGI24735J21928_100034724 | 382 |
| 999 | 3300002067 | JGI24735J21928_10034200 | JGI24735J21928_100342001 | 382 |
| 1000 | 3300002075 | JGI24738J21930_10001078 | JGI24738J21930_100010784 | 382 |
| 1001 | 3300002704 | JGI25155J39150_1000012 | JGI25155J39150_100001223 | 382 |
| 1002 | 3300002704 | JGI25155J39150_1000255 | JGI25155J39150_100025510 | 382 |
| 1003 | 3300002704 | JGI25155J39150_1000546 | JGI25155J39150_10005461 | 382 |
| 1004 | 3300002704 | JGI25155J39150_1001072 | JGI25155J39150_10010722 | 382 |
| 1005 | 3300002705 | JGI25156J39149_1000049 | JGI25156J39149_100004970 | 382 |
| 1006 | 3300002705 | JGI25156J39149_1000527 | JGI25156J39149_100052711 | 382 |
| 1007 | 3300002705 | JGI25156J39149_1001036 | JGI25156J39149_100103610 | 382 |
| 1008 | 3300002705 | JGI25156J39149_1002069 | JGI25156J39149_10020696 | 382 |
| 1009 | 3300002705 | JGI25156J39149_1003564 | JGI25156J39149_10035643 | 382 |
| 1010 | 3300002705 | JGI25156J39149_1003955 | JGI25156J39149_10039554 | 382 |
| 1011 | 3300002737 | JGI25162J39368_1000063 | JGI25162J39368_100006314 | 382 |
| 1012 | 3300002737 | JGI25162J39368_1000287 | JGI25162J39368_10002875 | 382 |
| 1013 | 3300002737 | JGI25162J39368_1000421 | JGI25162J39368_100042116 | 382 |
| 1014 | 3300002737 | JGI25162J39368_1000753 | JGI25162J39368_10007537 | 382 |
| 1015 | 3300002737 | JGI25162J39368_1001046 | JGI25162J39368_10010463 | 382 |
| 1016 | 3300002737 | JGI25162J39368_1002965 | JGI25162J39368_10029651 | 382 |
| 1017 | 3300002738 | JGI25154J39366_1000033 | JGI25154J39366_1000033150 | 382 |
| 1018 | 3300002738 | JGI25154J39366_1000732 | JGI25154J39366_10007328 | 382 |
| 1019 | 3300002738 | JGI25154J39366_1000768 | JGI25154J39366_10007686 | 382 |
| 1020 | 3300002738 | JGI25154J39366_1005939 | JGI25154J39366_10059392 | 382 |
| 1021 | 3300002739 | JGI25158J39367_1000032 | JGI25158J39367_10000327 | 382 |
| 1022 | 3300002741 | JGI25157J39369_1000055 | JGI25157J39369_100005523 | 382 |
| 1023 | 3300002741 | JGI25157J39369_1000217 | JGI25157J39369_100021732 | 382 |
| 1024 | 3300002741 | JGI25157J39369_1000549 | JGI25157J39369_10005499 | 382 |
| 1025 | 3300002741 | JGI25157J39369_1001301 | JGI25157J39369_10013016 | 382 |
| 1026 | 3300002771 | JGI25163J39215_1000201 | JGI25163J39215_100020113 | 382 |
| 1027 | 3300002771 | JGI25163J39215_1000677 | JGI25163J39215_10006773 | 382 |
| 1028 | 3300002772 | JGI25164J39214_1000064 | JGI25164J39214_100006470 | 382 |
| 1029 | 3300002772 | JGI25164J39214_1000296 | JGI25164J39214_100029619 | 382 |
| 1030 | 3300002772 | JGI25164J39214_1000412 | JGI25164J39214_100041211 | 382 |
| 1031 | 3300002772 | JGI25164J39214_1000586 | JGI25164J39214_10005865 | 382 |
| 1032 | 3300002772 | JGI25164J39214_1000672 | JGI25164J39214_10006727 | 382 |
| 1033 | 3300002773 | JGI25152J39213_1004254 | JGI25152J39213_10042544 | 382 |
| 1034 | 3300002773 | JGI25152J39213_1008986 | JGI25152J39213_10089862 | 382 |
| 1035 | 3300002773 | JGI25152J39213_1008994 | JGI25152J39213_10089942 | 382 |
| 1036 | 3300002773 | JGI25152J39213_1011389 | JGI25152J39213_10113892 | 382 |
| 1037 | 3300002774 | JGI25150J39212_1008933 | JGI25150J39212_10089332 | 382 |
| 1038 | 3300002987 | JGI25159J45721_1000052 | JGI25159J45721_100005229 | 382 |
| 1039 | 3300002987 | JGI25159J45721_1000123 | JGI25159J45721_100012324 | 382 |
| 1040 | 3300002987 | JGI25159J45721_1001948 | JGI25159J45721_10019487 | 382 |
| 1041 | 3300003187 | JGI25151J46595_10000611 | JGI25151J46595_1000061118 | 382 |
| 1042 | 3300003187 | JGI25151J46595_10005785 | JGI25151J46595_100057852 | 382 |
| 1043 | 3300003187 | JGI25151J46595_10016124 | JGI25151J46595_100161243 | 382 |
| 1044 | 3300003187 | JGI25151J46595_10036121 | JGI25151J46595_100361212 | 382 |
| 1045 | 3300003214 | JGI25165J46597_1000035 | JGI25165J46597_100003539 | 382 |
| 1046 | 3300003214 | JGI25165J46597_1000069 | JGI25165J46597_100006914 | 382 |
| 1047 | 3300003214 | JGI25165J46597_1000388 | JGI25165J46597_100038832 | 382 |
| 1048 | 3300003214 | JGI25165J46597_1000528 | JGI25165J46597_100052819 | 382 |
| 1049 | 3300003214 | JGI25165J46597_1001054 | JGI25165J46597_10010549 | 382 |
| 1050 | 3300003214 | JGI25165J46597_1001292 | JGI25165J46597_100129213 | 382 |
| 1051 | 3300003214 | JGI25165J46597_1005308 | JGI25165J46597_10053082 | 382 |
| 1052 | 3300003215 | JGI25153J46596_10000670 | JGI25153J46596_100006704 | 382 |
| 1053 | 3300003215 | JGI25153J46596_10001189 | JGI25153J46596_100011897 | 382 |
| 1054 | 3300003215 | JGI25153J46596_10003140 | JGI25153J46596_100031405 | 382 |
| 1055 | 3300003215 | JGI25153J46596_10021317 | JGI25153J46596_100213172 | 382 |
| 1056 | 3300003215 | JGI25153J46596_10021348 | JGI25153J46596_100213482 | 382 |
| 1057 | 3300003215 | JGI25153J46596_10029685 | JGI25153J46596_100296851 | 382 |
| 1058 | 3300003354 | JGI25160J50197_1000006 | JGI25160J50197_1000006261 | 382 |
| 1059 | 3300003354 | JGI25160J50197_1000007 | JGI25160J50197_1000007266 | 382 |
| 1060 | 3300003354 | JGI25160J50197_1000112 | JGI25160J50197_100011216 | 382 |
| 1061 | 3300003374 | JGI25161J50226_1000004 | JGI25161J50226_1000004261 | 382 |
| 1062 | 3300003374 | JGI25161J50226_1000129 | JGI25161J50226_100012911 | 382 |
| 1063 | 3300003374 | JGI25161J50226_1000648 | JGI25161J50226_10006484 | 382 |
| 1064 | 3300003374 | JGI25161J50226_1005966 | JGI25161J50226_10059662 | 382 |
| 1065 | 3300003578 | Ga0006562J51391_1183124 | Ga0006562J51391_11831241 | 382 |
| 1066 | 3300003578 | Ga0006562J51391_1183125 | Ga0006562J51391_11831255 | 382 |
| 1067 | 3300003751 | Ga0055538_1000008 | Ga0055538_1000008190 | 382 |
| 1068 | 3300003751 | Ga0055538_1000012 | Ga0055538_100001283 | 382 |
| 1069 | 3300003751 | Ga0055538_1000034 | Ga0055538_100003413 | 382 |
| 1070 | 3300003752 | Ga0055539_1000012 | Ga0055539_1000012190 | 382 |
| 1071 | 3300003752 | Ga0055539_1000017 | Ga0055539_100001783 | 382 |
| 1072 | 3300003752 | Ga0055539_1000044 | Ga0055539_100004413 | 382 |
| 1073 | 3300003752 | Ga0055539_1001291 | Ga0055539_10012912 | 382 |
| 1074 | 3300003752 | Ga0055539_1006155 | Ga0055539_10061552 | 382 |
| 1075 | 3300003756 | Ga0055533_1000015 | Ga0055533_1000015190 | 382 |
| 1076 | 3300003756 | Ga0055533_1000021 | Ga0055533_100002183 | 382 |
| 1077 | 3300003756 | Ga0055533_1000055 | Ga0055533_100005513 | 382 |
| 1078 | 3300003756 | Ga0055533_1001195 | Ga0055533_10011954 | 382 |
| 1079 | 3300003756 | Ga0055533_1001332 | Ga0055533_10013325 | 382 |
| 1080 | 3300003756 | Ga0055533_1001997 | Ga0055533_10019974 | 382 |
| 1081 | 3300003758 | Ga0055532_1000005 | Ga0055532_1000005251 | 382 |
| 1082 | 3300003758 | Ga0055532_1000012 | Ga0055532_100001249 | 382 |
| 1083 | 3300003758 | Ga0055532_1000020 | Ga0055532_1000020159 | 382 |
| 1084 | 3300003759 | Ga0055525_1000017 | Ga0055525_1000017153 | 382 |
| 1085 | 3300003759 | Ga0055525_1000043 | Ga0055525_100004337 | 382 |
| 1086 | 3300003759 | Ga0055525_1000066 | Ga0055525_1000066169 | 382 |
| 1087 | 3300003759 | Ga0055525_1000117 | Ga0055525_100011733 | 382 |
| 1088 | 3300003760 | Ga0055527_1000011 | Ga0055527_1000011292 | 382 |
| 1089 | 3300003760 | Ga0055527_1000226 | Ga0055527_100022610 | 382 |
| 1090 | 3300003760 | Ga0055527_1000243 | Ga0055527_100024316 | 382 |
| 1091 | 3300003760 | Ga0055527_1005570 | Ga0055527_10055702 | 382 |
| 1092 | 3300003761 | Ga0055535_1000009 | Ga0055535_100000949 | 382 |
| 1093 | 3300003761 | Ga0055535_1000335 | Ga0055535_10003355 | 382 |
| 1094 | 3300003761 | Ga0055535_1000515 | Ga0055535_100051513 | 382 |
| 1095 | 3300003761 | Ga0055535_1000518 | Ga0055535_100051813 | 382 |
| 1096 | 3300003761 | Ga0055535_1000629 | Ga0055535_100062910 | 382 |
| 1097 | 3300003761 | Ga0055535_1001383 | Ga0055535_10013834 | 382 |
| 1098 | 3300003762 | Ga0055542_1000015 | Ga0055542_100001549 | 382 |
| 1099 | 3300003762 | Ga0055542_1000363 | Ga0055542_100036332 | 382 |
| 1100 | 3300003762 | Ga0055542_1000393 | Ga0055542_100039317 | 382 |
| 1101 | 3300003762 | Ga0055542_1000434 | Ga0055542_100043418 | 382 |
| 1102 | 3300003762 | Ga0055542_1000537 | Ga0055542_100053713 | 382 |
| 1103 | 3300003762 | Ga0055542_1000661 | Ga0055542_100066110 | 382 |
| 1104 | 3300003763 | Ga0055529_1000011 | Ga0055529_100001149 | 382 |
| 1105 | 3300003763 | Ga0055529_1000391 | Ga0055529_100039132 | 382 |
| 1106 | 3300003763 | Ga0055529_1000409 | Ga0055529_100040917 | 382 |
| 1107 | 3300003763 | Ga0055529_1000519 | Ga0055529_100051916 | 382 |
| 1108 | 3300003763 | Ga0055529_1000601 | Ga0055529_100060110 | 382 |
| 1109 | 3300003771 | Ga0055526_1001100 | Ga0055526_10011008 | 382 |
| 1110 | 3300003771 | Ga0055526_1002853 | Ga0055526_10028533 | 382 |
| 1111 | 3300003771 | Ga0055526_1003392 | Ga0055526_10033923 | 382 |
| 1112 | 3300003771 | Ga0055526_1004773 | Ga0055526_10047736 | 382 |
| 1113 | 3300003771 | Ga0055526_1010390 | Ga0055526_10103902 | 382 |
| 1114 | 3300003771 | Ga0055526_1017002 | Ga0055526_10170022 | 382 |
| 1115 | 3300003773 | Ga0055537_1000426 | Ga0055537_10004265 | 382 |
| 1116 | 3300003775 | Ga0055524_1000262 | Ga0055524_10002622 | 382 |
| 1117 | 3300003775 | Ga0055524_1000376 | Ga0055524_100037617 | 382 |
| 1118 | 3300003775 | Ga0055524_1000429 | Ga0055524_100042926 | 382 |
| 1119 | 3300003775 | Ga0055524_1011159 | Ga0055524_10111593 | 382 |
| 1120 | 3300003781 | Ga0055536_1000126 | Ga0055536_100012610 | 382 |
| 1121 | 3300003781 | Ga0055536_1000519 | Ga0055536_10005197 | 382 |
| 1122 | 3300003781 | Ga0055536_1000581 | Ga0055536_10005817 | 382 |
| 1123 | 3300003781 | Ga0055536_1002169 | Ga0055536_10021694 | 382 |
| 1124 | 3300003781 | Ga0055536_1004583 | Ga0055536_10045832 | 382 |
| 1125 | 3300003781 | Ga0055536_1014189 | Ga0055536_10141892 | 382 |
| 1126 | 3300003784 | Ga0055534_1000518 | Ga0055534_10005187 | 382 |
| 1127 | 3300003790 | Ga0055528_1000040 | Ga0055528_100004058 | 382 |
| 1128 | 3300003790 | Ga0055528_1000186 | Ga0055528_100018623 | 382 |
| 1129 | 3300003790 | Ga0055528_1000718 | Ga0055528_100071816 | 382 |
| 1130 | 3300003790 | Ga0055528_1002246 | Ga0055528_10022464 | 382 |
| 1131 | 3300003790 | Ga0055528_1002418 | Ga0055528_10024186 | 382 |
| 1132 | 3300003790 | Ga0055528_1003731 | Ga0055528_10037316 | 382 |
| 1133 | 3300003790 | Ga0055528_1005253 | Ga0055528_10052535 | 382 |
| 1134 | 3300003790 | Ga0055528_1006219 | Ga0055528_10062194 | 382 |
| 1135 | 3300003791 | Ga0055530_10000132 | Ga0055530_1000013210 | 382 |
| 1136 | 3300003791 | Ga0055530_10000240 | Ga0055530_1000024028 | 382 |
| 1137 | 3300003791 | Ga0055530_10000671 | Ga0055530_100006717 | 382 |
| 1138 | 3300003791 | Ga0055530_10000778 | Ga0055530_100007786 | 382 |
| 1139 | 3300003791 | Ga0055530_10001374 | Ga0055530_100013745 | 382 |
| 1140 | 3300003791 | Ga0055530_10007126 | Ga0055530_100071264 | 382 |
| 1141 | 3300003792 | Ga0055540_1000248 | Ga0055540_100024828 | 382 |
| 1142 | 3300003792 | Ga0055540_1000400 | Ga0055540_10004007 | 382 |
| 1143 | 3300003792 | Ga0055540_1000780 | Ga0055540_100078019 | 382 |
| 1144 | 3300003792 | Ga0055540_1000954 | Ga0055540_100095417 | 382 |
| 1145 | 3300003792 | Ga0055540_1004383 | Ga0055540_10043833 | 382 |
| 1146 | 3300003792 | Ga0055540_1004497 | Ga0055540_10044972 | 382 |
| 1147 | 3300003792 | Ga0055540_1006733 | Ga0055540_10067332 | 382 |
| 1148 | 3300003794 | Ga0055531_10004609 | Ga0055531_100046097 | 382 |
| 1149 | 3300003794 | Ga0055531_10005677 | Ga0055531_100056776 | 382 |
| 1150 | 3300003794 | Ga0055531_10006687 | Ga0055531_100066875 | 382 |
| 1151 | 3300003794 | Ga0055531_10029714 | Ga0055531_100297141 | 382 |
| 1152 | 3300003841 | Ga0055541_1000009 | Ga0055541_1000009190 | 382 |
| 1153 | 3300003841 | Ga0055541_1000012 | Ga0055541_100001283 | 382 |
| 1154 | 3300003841 | Ga0055541_1000032 | Ga0055541_1000032170 | 382 |
| 1155 | 3300003856 | Ga0058692_1000009 | Ga0058692_1000009260 | 382 |
| 1156 | 3300003856 | Ga0058692_1001699 | Ga0058692_10016993 | 382 |
| 1157 | 3300003856 | Ga0058692_1011584 | Ga0058692_10115842 | 382 |
| 1158 | 3300004625 | Ga0055543_1000002 | Ga0055543_100000274 | 382 |
| 1159 | 3300004625 | Ga0055543_1000029 | Ga0055543_100002980 | 382 |
| 1160 | 3300004625 | Ga0055543_1000120 | Ga0055543_100012028 | 382 |
| 1161 | 3300005262 | Ga0065165_1000011 | Ga0065165_100001128 | 382 |
| 1162 | 3300005262 | Ga0065165_1000340 | Ga0065165_100034016 | 382 |
| 1163 | 3300005262 | Ga0065165_1001337 | Ga0065165_100133720 | 382 |
| 1164 | 3300005262 | Ga0065165_1005342 | Ga0065165_10053425 | 382 |
| 1165 | 3300005262 | Ga0065165_1005358 | Ga0065165_10053584 | 382 |
| 1166 | 3300005262 | Ga0065165_1005608 | Ga0065165_10056086 | 382 |
| 1167 | 3300005262 | Ga0065165_1013531 | Ga0065165_10135314 | 382 |
| 1168 | 3300005288 | Ga0065714_10000104 | Ga0065714_100001049 | 382 |
| 1169 | 3300005288 | Ga0065714_10003301 | Ga0065714_100033012 | 382 |
| 1170 | 3300005289 | Ga0065704_10009257 | Ga0065704_100092575 | 382 |
| 1171 | 3300005289 | Ga0065704_10070222 | Ga0065704_1007022259 | 382 |
| 1172 | 3300005290 | Ga0065712_10000132 | Ga0065712_100001326 | 382 |
| 1173 | 3300005290 | Ga0065712_10007303 | Ga0065712_100073034 | 382 |
| 1174 | 3300005290 | Ga0065712_10090203 | Ga0065712_100902033 | 382 |
| 1175 | 3300005327 | Ga0070658_10028890 | Ga0070658_100288901 | 382 |
| 1176 | 3300005327 | Ga0070658_10063809 | Ga0070658_100638092 | 382 |
| 1177 | 3300005329 | Ga0070683_100021797 | Ga0070683_1000217971 | 382 |
| 1178 | 3300005330 | Ga0070690_100035152 | Ga0070690_1000351523 | 382 |
| 1179 | 3300005331 | Ga0070670_100000258 | Ga0070670_10000025814 | 382 |
| 1180 | 3300005331 | Ga0070670_100001188 | Ga0070670_1000011884 | 382 |
| 1181 | 3300005331 | Ga0070670_100001386 | Ga0070670_10000138622 | 382 |
| 1182 | 3300005334 | Ga0068869_100001960 | Ga0068869_10000196010 | 382 |
| 1183 | 3300005334 | Ga0068869_100200683 | Ga0068869_1002006831 | 382 |
| 1184 | 3300005335 | Ga0070666_10000016 | Ga0070666_10000016131 | 382 |
| 1185 | 3300005335 | Ga0070666_10016846 | Ga0070666_100168464 | 382 |
| 1186 | 3300005336 | Ga0070680_100010046 | Ga0070680_1000100466 | 382 |
| 1187 | 3300005337 | Ga0070682_100003944 | Ga0070682_1000039445 | 382 |
| 1188 | 3300005337 | Ga0070682_100091778 | Ga0070682_1000917782 | 382 |
| 1189 | 3300005339 | Ga0070660_100000056 | Ga0070660_10000005649 | 382 |
| 1190 | 3300005339 | Ga0070660_100001525 | Ga0070660_1000015255 | 382 |
| 1191 | 3300005339 | Ga0070660_100030905 | Ga0070660_1000309054 | 382 |
| 1192 | 3300005339 | Ga0070660_100097668 | Ga0070660_1000976684 | 382 |
| 1193 | 3300005339 | Ga0070660_100105084 | Ga0070660_1001050842 | 382 |
| 1194 | 3300005339 | Ga0070660_100114547 | Ga0070660_1001145472 | 382 |
| 1195 | 3300005340 | Ga0070689_100020485 | Ga0070689_1000204855 | 382 |
| 1196 | 3300005344 | Ga0070661_100000146 | Ga0070661_10000014611 | 382 |
| 1197 | 3300005344 | Ga0070661_100023158 | Ga0070661_1000231583 | 382 |
| 1198 | 3300005344 | Ga0070661_100028844 | Ga0070661_1000288443 | 382 |
| 1199 | 3300005344 | Ga0070661_100190829 | Ga0070661_1001908292 | 382 |
| 1200 | 3300005347 | Ga0070668_100004033 | Ga0070668_1000040333 | 382 |
| 1201 | 3300005347 | Ga0070668_100024332 | Ga0070668_1000243324 | 382 |
| 1202 | 3300005353 | Ga0070669_100000153 | Ga0070669_10000015321 | 382 |
| 1203 | 3300005353 | Ga0070669_100029899 | Ga0070669_1000298992 | 382 |
| 1204 | 3300005354 | Ga0070675_100039079 | Ga0070675_1000390792 | 382 |
| 1205 | 3300005354 | Ga0070675_100345761 | Ga0070675_1003457611 | 382 |
| 1206 | 3300005355 | Ga0070671_100003307 | Ga0070671_1000033073 | 382 |
| 1207 | 3300005355 | Ga0070671_100046175 | Ga0070671_1000461752 | 382 |
| 1208 | 3300005355 | Ga0070671_100151417 | Ga0070671_1001514173 | 382 |
| 1209 | 3300005364 | Ga0070673_100020736 | Ga0070673_1000207361 | 382 |
| 1210 | 3300005364 | Ga0070673_100021478 | Ga0070673_1000214782 | 382 |
| 1211 | 3300005365 | Ga0070688_100047145 | Ga0070688_1000471452 | 382 |
| 1212 | 3300005365 | Ga0070688_100117600 | Ga0070688_1001176002 | 382 |
| 1213 | 3300005366 | Ga0070659_100000079 | Ga0070659_10000007946 | 382 |
| 1214 | 3300005366 | Ga0070659_100018894 | Ga0070659_1000188942 | 382 |
| 1215 | 3300005366 | Ga0070659_100022360 | Ga0070659_1000223602 | 382 |
| 1216 | 3300005366 | Ga0070659_100217375 | Ga0070659_1002173751 | 382 |
| 1217 | 3300005366 | Ga0070659_100350853 | Ga0070659_1003508531 | 382 |
| 1218 | 3300005367 | Ga0070667_100061137 | Ga0070667_1000611372 | 382 |
| 1219 | 3300005367 | Ga0070667_100101645 | Ga0070667_1001016452 | 382 |
| 1220 | 3300005367 | Ga0070667_100112641 | Ga0070667_1001126412 | 382 |
| 1221 | 3300005367 | Ga0070667_100117535 | Ga0070667_1001175352 | 382 |
| 1222 | 3300005367 | Ga0070667_100235784 | Ga0070667_1002357842 | 382 |
| 1223 | 3300005435 | Ga0070714_100033331 | Ga0070714_1000333315 | 382 |
| 1224 | 3300005435 | Ga0070714_100054626 | Ga0070714_1000546262 | 382 |
| 1225 | 3300005436 | Ga0070713_100166217 | Ga0070713_1001662171 | 382 |
| 1226 | 3300005455 | Ga0070663_100027442 | Ga0070663_1000274425 | 382 |
| 1227 | 3300005455 | Ga0070663_100142519 | Ga0070663_1001425191 | 382 |
| 1228 | 3300005456 | Ga0070678_100009479 | Ga0070678_1000094792 | 382 |
| 1229 | 3300005456 | Ga0070678_100016310 | Ga0070678_1000163102 | 382 |
| 1230 | 3300005456 | Ga0070678_100034861 | Ga0070678_1000348616 | 382 |
| 1231 | 3300005456 | Ga0070678_100221508 | Ga0070678_1002215082 | 382 |
| 1232 | 3300005457 | Ga0070662_100000562 | Ga0070662_10000056221 | 382 |
| 1233 | 3300005457 | Ga0070662_100009714 | Ga0070662_1000097143 | 382 |
| 1234 | 3300005458 | Ga0070681_10058975 | Ga0070681_100589754 | 382 |
| 1235 | 3300005458 | Ga0070681_10117591 | Ga0070681_101175912 | 382 |
| 1236 | 3300005458 | Ga0070681_10424763 | Ga0070681_104247631 | 382 |
| 1237 | 3300005459 | Ga0068867_100002132 | Ga0068867_10000213210 | 382 |
| 1238 | 3300005459 | Ga0068867_100039853 | Ga0068867_1000398535 | 382 |
| 1239 | 3300005530 | Ga0070679_100012938 | Ga0070679_1000129385 | 382 |
| 1240 | 3300005530 | Ga0070679_100013191 | Ga0070679_1000131917 | 382 |
| 1241 | 3300005530 | Ga0070679_100326600 | Ga0070679_1003266001 | 382 |
| 1242 | 3300005535 | Ga0070684_100001235 | Ga0070684_1000012353 | 382 |
| 1243 | 3300005539 | Ga0068853_100000184 | Ga0068853_10000018439 | 382 |
| 1244 | 3300005539 | Ga0068853_100003976 | Ga0068853_1000039768 | 382 |
| 1245 | 3300005539 | Ga0068853_100117246 | Ga0068853_1001172463 | 382 |
| 1246 | 3300005543 | Ga0070672_100107480 | Ga0070672_1001074802 | 382 |
| 1247 | 3300005548 | Ga0070665_100000322 | Ga0070665_10000032246 | 382 |
| 1248 | 3300005548 | Ga0070665_100012164 | Ga0070665_1000121648 | 382 |
| 1249 | 3300005548 | Ga0070665_100012285 | Ga0070665_1000122855 | 382 |
| 1250 | 3300005548 | Ga0070665_100019293 | Ga0070665_1000192933 | 382 |
| 1251 | 3300005548 | Ga0070665_100022869 | Ga0070665_10002286910 | 382 |
| 1252 | 3300005548 | Ga0070665_100034909 | Ga0070665_1000349094 | 382 |
| 1253 | 3300005548 | Ga0070665_100165839 | Ga0070665_1001658393 | 382 |
| 1254 | 3300005563 | Ga0068855_100000423 | Ga0068855_10000042339 | 382 |
| 1255 | 3300005563 | Ga0068855_100000557 | Ga0068855_10000055732 | 382 |
| 1256 | 3300005563 | Ga0068855_100003248 | Ga0068855_1000032484 | 382 |
| 1257 | 3300005563 | Ga0068855_100008781 | Ga0068855_1000087819 | 382 |
| 1258 | 3300005563 | Ga0068855_100015021 | Ga0068855_1000150217 | 382 |
| 1259 | 3300005563 | Ga0068855_100070479 | Ga0068855_1000704792 | 382 |
| 1260 | 3300005563 | Ga0068855_100098068 | Ga0068855_1000980682 | 382 |
| 1261 | 3300005563 | Ga0068855_100106722 | Ga0068855_1001067223 | 382 |
| 1262 | 3300005563 | Ga0068855_100183432 | Ga0068855_1001834322 | 382 |
| 1263 | 3300005563 | Ga0068855_100193924 | Ga0068855_1001939243 | 382 |
| 1264 | 3300005563 | Ga0068855_100247353 | Ga0068855_1002473532 | 382 |
| 1265 | 3300005563 | Ga0068855_100408244 | Ga0068855_1004082442 | 382 |
| 1266 | 3300005564 | Ga0070664_100000049 | Ga0070664_10000004953 | 382 |
| 1267 | 3300005564 | Ga0070664_100055289 | Ga0070664_1000552893 | 382 |
| 1268 | 3300005577 | Ga0068857_100008513 | Ga0068857_1000085134 | 382 |
| 1269 | 3300005577 | Ga0068857_100122495 | Ga0068857_1001224953 | 382 |
| 1270 | 3300005577 | Ga0068857_100143152 | Ga0068857_1001431522 | 382 |
| 1271 | 3300005578 | Ga0068854_100000054 | Ga0068854_10000005419 | 382 |
| 1272 | 3300005578 | Ga0068854_100000699 | Ga0068854_1000006994 | 382 |
| 1273 | 3300005578 | Ga0068854_100002224 | Ga0068854_1000022248 | 382 |
| 1274 | 3300005578 | Ga0068854_100065113 | Ga0068854_1000651133 | 382 |
| 1275 | 3300005578 | Ga0068854_100072572 | Ga0068854_1000725722 | 382 |
| 1276 | 3300005614 | Ga0068856_100000157 | Ga0068856_10000015748 | 382 |
| 1277 | 3300005614 | Ga0068856_100010013 | Ga0068856_1000100135 | 382 |
| 1278 | 3300005614 | Ga0068856_100023950 | Ga0068856_1000239505 | 382 |
| 1279 | 3300005614 | Ga0068856_100071585 | Ga0068856_1000715853 | 382 |
| 1280 | 3300005614 | Ga0068856_100191047 | Ga0068856_1001910473 | 382 |
| 1281 | 3300005614 | Ga0068856_100206281 | Ga0068856_1002062812 | 382 |
| 1282 | 3300005616 | Ga0068852_100001139 | Ga0068852_1000011393 | 382 |
| 1283 | 3300005616 | Ga0068852_100004003 | Ga0068852_1000040037 | 382 |
| 1284 | 3300005616 | Ga0068852_100012051 | Ga0068852_1000120514 | 382 |
| 1285 | 3300005616 | Ga0068852_100030384 | Ga0068852_1000303842 | 382 |
| 1286 | 3300005616 | Ga0068852_100114517 | Ga0068852_1001145172 | 382 |
| 1287 | 3300005616 | Ga0068852_100245786 | Ga0068852_1002457862 | 382 |
| 1288 | 3300005617 | Ga0068859_100011168 | Ga0068859_1000111683 | 382 |
| 1289 | 3300005618 | Ga0068864_100005889 | Ga0068864_1000058897 | 382 |
| 1290 | 3300005718 | Ga0068866_10024422 | Ga0068866_100244224 | 382 |
| 1291 | 3300005719 | Ga0068861_100013381 | Ga0068861_1000133812 | 382 |
| 1292 | 3300005834 | Ga0068851_10000018 | Ga0068851_1000001885 | 382 |
| 1293 | 3300005834 | Ga0068851_10140346 | Ga0068851_101403461 | 382 |
| 1294 | 3300005840 | Ga0068870_10027147 | Ga0068870_100271472 | 382 |
| 1295 | 3300005841 | Ga0068863_100007163 | Ga0068863_1000071633 | 382 |
| 1296 | 3300005842 | Ga0068858_100024178 | Ga0068858_1000241784 | 382 |
| 1297 | 3300005842 | Ga0068858_100069161 | Ga0068858_1000691614 | 382 |
| 1298 | 3300005843 | Ga0068860_100012152 | Ga0068860_1000121526 | 382 |
| 1299 | 3300005843 | Ga0068860_100018457 | Ga0068860_1000184576 | 382 |
| 1300 | 3300005843 | Ga0068860_100070809 | Ga0068860_1000708092 | 382 |
| 1301 | 3300005843 | Ga0068860_100250939 | Ga0068860_1002509391 | 382 |
| 1302 | 3300006042 | Ga0075368_10017657 | Ga0075368_100176571 | 382 |
| 1303 | 3300006051 | Ga0075364_10005396 | Ga0075364_100053962 | 382 |
| 1304 | 3300006058 | Ga0075432_10000316 | Ga0075432_1000031613 | 382 |
| 1305 | 3300006058 | Ga0075432_10008546 | Ga0075432_100085462 | 382 |
| 1306 | 3300006177 | Ga0075362_10054628 | Ga0075362_100546281 | 382 |
| 1307 | 3300006178 | Ga0075367_10171404 | Ga0075367_101714042 | 382 |
| 1308 | 3300006178 | Ga0075367_10203499 | Ga0075367_102034991 | 382 |
| 1309 | 3300006186 | Ga0075369_10018610 | Ga0075369_100186102 | 382 |
| 1310 | 3300006186 | Ga0075369_10065045 | Ga0075369_100650452 | 382 |
| 1311 | 3300006195 | Ga0075366_10001966 | Ga0075366_1000196610 | 382 |
| 1312 | 3300006237 | Ga0097621_100002735 | Ga0097621_1000027356 | 382 |
| 1313 | 3300006237 | Ga0097621_100012639 | Ga0097621_1000126392 | 382 |
| 1314 | 3300006237 | Ga0097621_100025700 | Ga0097621_1000257004 | 382 |
| 1315 | 3300006237 | Ga0097621_100028731 | Ga0097621_1000287313 | 382 |
| 1316 | 3300006237 | Ga0097621_100062541 | Ga0097621_1000625413 | 382 |
| 1317 | 3300006237 | Ga0097621_100101894 | Ga0097621_1001018942 | 382 |
| 1318 | 3300006353 | Ga0075370_10000591 | Ga0075370_1000059111 | 382 |
| 1319 | 3300006353 | Ga0075370_10021524 | Ga0075370_100215242 | 382 |
| 1320 | 3300006358 | Ga0068871_100000329 | Ga0068871_1000003296 | 382 |
| 1321 | 3300006358 | Ga0068871_100011348 | Ga0068871_1000113485 | 382 |
| 1322 | 3300006358 | Ga0068871_100035210 | Ga0068871_1000352103 | 382 |
| 1323 | 3300006358 | Ga0068871_100057184 | Ga0068871_1000571842 | 382 |
| 1324 | 3300006358 | Ga0068871_100128774 | Ga0068871_1001287742 | 382 |
| 1325 | 3300006914 | Ga0075436_100109924 | Ga0075436_1001099242 | 382 |
| 1326 | 3300006931 | Ga0097620_100011168 | Ga0097620_1000111686 | 382 |
| 1327 | 3300006946 | Ga0079104_1000029 | Ga0079104_100002919 | 382 |
| 1328 | 3300006946 | Ga0079104_1000094 | Ga0079104_1000094104 | 382 |
| 1329 | 3300006946 | Ga0079104_1000668 | Ga0079104_10006687 | 382 |
| 1330 | 3300006946 | Ga0079104_1004551 | Ga0079104_10045514 | 382 |
| 1331 | 3300006948 | Ga0099826_10038409 | Ga0099826_100384092 | 382 |
| 1332 | 3300009011 | Ga0105251_10000018 | Ga0105251_1000001858 | 382 |
| 1333 | 3300009011 | Ga0105251_10000047 | Ga0105251_1000004797 | 382 |
| 1334 | 3300009011 | Ga0105251_10000830 | Ga0105251_1000083021 | 382 |
| 1335 | 3300009011 | Ga0105251_10001501 | Ga0105251_100015013 | 382 |
| 1336 | 3300009011 | Ga0105251_10001601 | Ga0105251_1000160117 | 382 |
| 1337 | 3300009011 | Ga0105251_10001924 | Ga0105251_1000192416 | 382 |
| 1338 | 3300009011 | Ga0105251_10002823 | Ga0105251_100028234 | 382 |
| 1339 | 3300009011 | Ga0105251_10004604 | Ga0105251_100046044 | 382 |
| 1340 | 3300009011 | Ga0105251_10011096 | Ga0105251_100110964 | 382 |
| 1341 | 3300009011 | Ga0105251_10014064 | Ga0105251_100140641 | 382 |
| 1342 | 3300009011 | Ga0105251_10016548 | Ga0105251_100165483 | 382 |
| 1343 | 3300009036 | Ga0105244_10001003 | Ga0105244_100010033 | 382 |
| 1344 | 3300009036 | Ga0105244_10002401 | Ga0105244_100024013 | 382 |
| 1345 | 3300009036 | Ga0105244_10013196 | Ga0105244_100131963 | 382 |
| 1346 | 3300009036 | Ga0105244_10014374 | Ga0105244_100143742 | 382 |
| 1347 | 3300009036 | Ga0105244_10014929 | Ga0105244_100149291 | 382 |
| 1348 | 3300009036 | Ga0105244_10023477 | Ga0105244_100234772 | 382 |
| 1349 | 3300009036 | Ga0105244_10031272 | Ga0105244_100312723 | 382 |
| 1350 | 3300009036 | Ga0105244_10045022 | Ga0105244_100450222 | 382 |
| 1351 | 3300009036 | Ga0105244_10045134 | Ga0105244_100451341 | 382 |
| 1352 | 3300009036 | Ga0105244_10045584 | Ga0105244_100455842 | 382 |
| 1353 | 3300009036 | Ga0105244_10052161 | Ga0105244_100521612 | 382 |
| 1354 | 3300009036 | Ga0105244_10055493 | Ga0105244_100554931 | 382 |
| 1355 | 3300009036 | Ga0105244_10067421 | Ga0105244_100674212 | 382 |
| 1356 | 3300009036 | Ga0105244_10099880 | Ga0105244_100998802 | 382 |
| 1357 | 3300009092 | Ga0105250_10000068 | Ga0105250_1000006819 | 382 |
| 1358 | 3300009092 | Ga0105250_10000550 | Ga0105250_1000055021 | 382 |
| 1359 | 3300009092 | Ga0105250_10002212 | Ga0105250_1000221210 | 382 |
| 1360 | 3300009092 | Ga0105250_10002526 | Ga0105250_100025265 | 382 |
| 1361 | 3300009092 | Ga0105250_10004938 | Ga0105250_100049385 | 382 |
| 1362 | 3300009093 | Ga0105240_10000019 | Ga0105240_1000001928 | 382 |
| 1363 | 3300009093 | Ga0105240_10001844 | Ga0105240_100018445 | 382 |
| 1364 | 3300009093 | Ga0105240_10005342 | Ga0105240_1000534210 | 382 |
| 1365 | 3300009093 | Ga0105240_10014642 | Ga0105240_100146426 | 382 |
| 1366 | 3300009093 | Ga0105240_10017316 | Ga0105240_100173165 | 382 |
| 1367 | 3300009093 | Ga0105240_10020280 | Ga0105240_100202805 | 382 |
| 1368 | 3300009093 | Ga0105240_10038888 | Ga0105240_100388884 | 382 |
| 1369 | 3300009093 | Ga0105240_10041264 | Ga0105240_100412642 | 382 |
| 1370 | 3300009093 | Ga0105240_10092593 | Ga0105240_100925934 | 382 |
| 1371 | 3300009093 | Ga0105240_10171679 | Ga0105240_101716792 | 382 |
| 1372 | 3300009093 | Ga0105240_10179199 | Ga0105240_101791993 | 382 |
| 1373 | 3300009093 | Ga0105240_10194506 | Ga0105240_101945062 | 382 |
| 1374 | 3300009093 | Ga0105240_10243222 | Ga0105240_102432222 | 382 |
| 1375 | 3300009093 | Ga0105240_10305407 | Ga0105240_103054072 | 382 |
| 1376 | 3300009098 | Ga0105245_10009081 | Ga0105245_100090814 | 382 |
| 1377 | 3300009148 | Ga0105243_10001011 | Ga0105243_1000101124 | 382 |
| 1378 | 3300009148 | Ga0105243_10005184 | Ga0105243_100051847 | 382 |
| 1379 | 3300009148 | Ga0105243_10005610 | Ga0105243_100056103 | 382 |
| 1380 | 3300009148 | Ga0105243_10124727 | Ga0105243_101247272 | 382 |
| 1381 | 3300009174 | Ga0105241_10031368 | Ga0105241_100313684 | 382 |
| 1382 | 3300009174 | Ga0105241_10152069 | Ga0105241_101520692 | 382 |
| 1383 | 3300009176 | Ga0105242_10001632 | Ga0105242_1000163215 | 382 |
| 1384 | 3300009176 | Ga0105242_10006325 | Ga0105242_100063252 | 382 |
| 1385 | 3300009176 | Ga0105242_10007441 | Ga0105242_100074413 | 382 |
| 1386 | 3300009176 | Ga0105242_10228868 | Ga0105242_102288682 | 382 |
| 1387 | 3300009177 | Ga0105248_10001466 | Ga0105248_100014667 | 382 |
| 1388 | 3300009177 | Ga0105248_10002239 | Ga0105248_100022396 | 382 |
| 1389 | 3300009177 | Ga0105248_10002548 | Ga0105248_1000254814 | 382 |
| 1390 | 3300009177 | Ga0105248_10020178 | Ga0105248_100201785 | 382 |
| 1391 | 3300009177 | Ga0105248_10063147 | Ga0105248_100631475 | 382 |
| 1392 | 3300009177 | Ga0105248_10211088 | Ga0105248_102110883 | 382 |
| 1393 | 3300009545 | Ga0105237_10000036 | Ga0105237_1000003657 | 382 |
| 1394 | 3300009545 | Ga0105237_10000136 | Ga0105237_100001365 | 382 |
| 1395 | 3300009545 | Ga0105237_10002463 | Ga0105237_1000246313 | 382 |
| 1396 | 3300009545 | Ga0105237_10037085 | Ga0105237_100370853 | 382 |
| 1397 | 3300009545 | Ga0105237_10163901 | Ga0105237_101639011 | 382 |
| 1398 | 3300009545 | Ga0105237_10167368 | Ga0105237_101673681 | 382 |
| 1399 | 3300009545 | Ga0105237_10175660 | Ga0105237_101756603 | 382 |
| 1400 | 3300009551 | Ga0105238_10000062 | Ga0105238_1000006279 | 382 |
| 1401 | 3300009551 | Ga0105238_10000315 | Ga0105238_1000031512 | 382 |
| 1402 | 3300009551 | Ga0105238_10013811 | Ga0105238_100138112 | 382 |
| 1403 | 3300009551 | Ga0105238_10018759 | Ga0105238_100187592 | 382 |
| 1404 | 3300009551 | Ga0105238_10025026 | Ga0105238_100250265 | 382 |
| 1405 | 3300009551 | Ga0105238_10025120 | Ga0105238_100251206 | 382 |
| 1406 | 3300009551 | Ga0105238_10033604 | Ga0105238_100336045 | 382 |
| 1407 | 3300009551 | Ga0105238_10136732 | Ga0105238_101367322 | 382 |
| 1408 | 3300009551 | Ga0105238_10262947 | Ga0105238_102629472 | 382 |
| 1409 | 3300009551 | Ga0105238_10320567 | Ga0105238_103205671 | 382 |
| 1410 | 3300009551 | Ga0105238_10333921 | Ga0105238_103339212 | 382 |
| 1411 | 3300009553 | Ga0105249_10001344 | Ga0105249_1000134416 | 382 |
| 1412 | 3300009765 | Ga0123341_1000015 | Ga0123341_100001571 | 382 |
| 1413 | 3300009766 | Ga0123342_1024353 | Ga0123342_10243534 | 382 |
| 1414 | 3300010375 | Ga0105239_10008574 | Ga0105239_100085748 | 382 |
| 1415 | 3300010375 | Ga0105239_10009998 | Ga0105239_100099989 | 382 |
| 1416 | 3300010375 | Ga0105239_10052225 | Ga0105239_100522254 | 382 |
| 1417 | 3300010375 | Ga0105239_10061307 | Ga0105239_100613073 | 382 |
| 1418 | 3300010375 | Ga0105239_10089130 | Ga0105239_100891302 | 382 |
| 1419 | 3300010375 | Ga0105239_10274540 | Ga0105239_102745402 | 382 |
| 1420 | 3300010375 | Ga0105239_10499777 | Ga0105239_104997771 | 382 |
| 1421 | 3300011119 | Ga0105246_10000322 | Ga0105246_100003225 | 382 |
| 1422 | 3300011119 | Ga0105246_10002126 | Ga0105246_100021262 | 382 |
| 1423 | 3300011119 | Ga0105246_10014150 | Ga0105246_100141503 | 382 |
| 1424 | 3300011119 | Ga0105246_10027154 | Ga0105246_100271543 | 382 |
| 1425 | 3300012490 | Ga0157322_1000407 | Ga0157322_10004072 | 382 |
| 1426 | 3300012498 | Ga0157345_1000091 | Ga0157345_100009117 | 382 |
| 1427 | 3300012502 | Ga0157347_1005371 | Ga0157347_10053711 | 382 |
| 1428 | 3300013100 | Ga0157373_10000139 | Ga0157373_1000013918 | 382 |
| 1429 | 3300013100 | Ga0157373_10000568 | Ga0157373_100005686 | 382 |
| 1430 | 3300013100 | Ga0157373_10004735 | Ga0157373_100047357 | 382 |
| 1431 | 3300013100 | Ga0157373_10024574 | Ga0157373_100245742 | 382 |
| 1432 | 3300013100 | Ga0157373_10061803 | Ga0157373_100618032 | 382 |
| 1433 | 3300013100 | Ga0157373_10062418 | Ga0157373_100624183 | 382 |
| 1434 | 3300013100 | Ga0157373_10148867 | Ga0157373_101488671 | 382 |
| 1435 | 3300013102 | Ga0157371_10000592 | Ga0157371_1000059220 | 382 |
| 1436 | 3300013102 | Ga0157371_10003098 | Ga0157371_1000309810 | 382 |
| 1437 | 3300013102 | Ga0157371_10006317 | Ga0157371_100063176 | 382 |
| 1438 | 3300013102 | Ga0157371_10006521 | Ga0157371_100065214 | 382 |
| 1439 | 3300013102 | Ga0157371_10008173 | Ga0157371_100081734 | 382 |
| 1440 | 3300013102 | Ga0157371_10009793 | Ga0157371_100097934 | 382 |
| 1441 | 3300013102 | Ga0157371_10010625 | Ga0157371_100106257 | 382 |
| 1442 | 3300013102 | Ga0157371_10033820 | Ga0157371_100338202 | 382 |
| 1443 | 3300013102 | Ga0157371_10097255 | Ga0157371_100972552 | 382 |
| 1444 | 3300013104 | Ga0157370_10003077 | Ga0157370_1000307713 | 382 |
| 1445 | 3300013104 | Ga0157370_10010853 | Ga0157370_100108537 | 382 |
| 1446 | 3300013104 | Ga0157370_10014219 | Ga0157370_100142192 | 382 |
| 1447 | 3300013104 | Ga0157370_10020670 | Ga0157370_100206705 | 382 |
| 1448 | 3300013104 | Ga0157370_10024308 | Ga0157370_100243081 | 382 |
| 1449 | 3300013104 | Ga0157370_10049765 | Ga0157370_100497653 | 382 |
| 1450 | 3300013104 | Ga0157370_10056432 | Ga0157370_100564322 | 382 |
| 1451 | 3300013104 | Ga0157370_10065537 | Ga0157370_100655373 | 382 |
| 1452 | 3300013104 | Ga0157370_10077206 | Ga0157370_100772063 | 382 |
| 1453 | 3300013104 | Ga0157370_10136690 | Ga0157370_101366902 | 382 |
| 1454 | 3300013104 | Ga0157370_10137004 | Ga0157370_101370042 | 382 |
| 1455 | 3300013104 | Ga0157370_10166021 | Ga0157370_101660212 | 382 |
| 1456 | 3300013105 | Ga0157369_10000280 | Ga0157369_100002809 | 382 |
| 1457 | 3300013105 | Ga0157369_10000525 | Ga0157369_100005252 | 382 |
| 1458 | 3300013105 | Ga0157369_10001737 | Ga0157369_1000173710 | 382 |
| 1459 | 3300013105 | Ga0157369_10001978 | Ga0157369_1000197822 | 382 |
| 1460 | 3300013105 | Ga0157369_10003683 | Ga0157369_100036836 | 382 |
| 1461 | 3300013105 | Ga0157369_10005341 | Ga0157369_100053413 | 382 |
| 1462 | 3300013105 | Ga0157369_10005760 | Ga0157369_1000576010 | 382 |
| 1463 | 3300013105 | Ga0157369_10020129 | Ga0157369_100201296 | 382 |
| 1464 | 3300013105 | Ga0157369_10083106 | Ga0157369_100831062 | 382 |
| 1465 | 3300013105 | Ga0157369_10159836 | Ga0157369_101598362 | 382 |
| 1466 | 3300013105 | Ga0157369_10170224 | Ga0157369_101702242 | 382 |
| 1467 | 3300013105 | Ga0157369_10359731 | Ga0157369_103597312 | 382 |
| 1468 | 3300013249 | Ga0171463_1002 | Ga0171463_1002322 | 382 |
| 1469 | 3300013296 | Ga0157374_10000138 | Ga0157374_1000013852 | 382 |
| 1470 | 3300013296 | Ga0157374_10011805 | Ga0157374_100118052 | 382 |
| 1471 | 3300013296 | Ga0157374_10041310 | Ga0157374_100413103 | 382 |
| 1472 | 3300013297 | Ga0157378_10004718 | Ga0157378_100047183 | 382 |
| 1473 | 3300013306 | Ga0163162_10000239 | Ga0163162_1000023918 | 382 |
| 1474 | 3300013306 | Ga0163162_10000495 | Ga0163162_100004956 | 382 |
| 1475 | 3300013306 | Ga0163162_10001215 | Ga0163162_100012157 | 382 |
| 1476 | 3300013306 | Ga0163162_10135717 | Ga0163162_101357172 | 382 |
| 1477 | 3300013306 | Ga0163162_10142660 | Ga0163162_101426602 | 382 |
| 1478 | 3300013306 | Ga0163162_10182204 | Ga0163162_101822042 | 382 |
| 1479 | 3300013306 | Ga0163162_10258243 | Ga0163162_102582431 | 382 |
| 1480 | 3300013307 | Ga0157372_10008403 | Ga0157372_100084033 | 382 |
| 1481 | 3300013307 | Ga0157372_10026402 | Ga0157372_100264026 | 382 |
| 1482 | 3300013307 | Ga0157372_10043798 | Ga0157372_100437981 | 382 |
| 1483 | 3300013308 | Ga0157375_10002515 | Ga0157375_1000251510 | 382 |
| 1484 | 3300013308 | Ga0157375_10006746 | Ga0157375_100067465 | 382 |
| 1485 | 3300013308 | Ga0157375_10106507 | Ga0157375_101065073 | 382 |
| 1486 | 3300013308 | Ga0157375_10275268 | Ga0157375_102752682 | 382 |
| 1487 | 3300014325 | Ga0163163_10214452 | Ga0163163_102144522 | 382 |
| 1488 | 3300014325 | Ga0163163_10375587 | Ga0163163_103755872 | 382 |
| 1489 | 3300014325 | Ga0163163_10431371 | Ga0163163_104313712 | 382 |
| 1490 | 3300014326 | Ga0157380_10012577 | Ga0157380_100125772 | 382 |
| 1491 | 3300014326 | Ga0157380_10111126 | Ga0157380_101111262 | 382 |
| 1492 | 3300014497 | Ga0182008_10000023 | Ga0182008_1000002374 | 382 |
| 1493 | 3300014497 | Ga0182008_10001995 | Ga0182008_1000199511 | 382 |
| 1494 | 3300014497 | Ga0182008_10002602 | Ga0182008_100026028 | 382 |
| 1495 | 3300014497 | Ga0182008_10009442 | Ga0182008_100094421 | 382 |
| 1496 | 3300014497 | Ga0182008_10014834 | Ga0182008_100148342 | 382 |
| 1497 | 3300014497 | Ga0182008_10022340 | Ga0182008_100223403 | 382 |
| 1498 | 3300014497 | Ga0182008_10027070 | Ga0182008_100270702 | 382 |
| 1499 | 3300014497 | Ga0182008_10033767 | Ga0182008_100337672 | 382 |
| 1500 | 3300014968 | Ga0157379_10044263 | Ga0157379_100442632 | 382 |
| 1501 | 3300014968 | Ga0157379_10275823 | Ga0157379_102758231 | 382 |
| 1502 | 3300014969 | Ga0157376_10011819 | Ga0157376_100118192 | 382 |
| 1503 | 3300014969 | Ga0157376_10025582 | Ga0157376_100255822 | 382 |
| 1504 | 3300014969 | Ga0157376_10025908 | Ga0157376_100259082 | 382 |
| 1505 | 3300014969 | Ga0157376_10109183 | Ga0157376_101091832 | 382 |
| 1506 | 3300015261 | Ga0182006_1000404 | Ga0182006_10004048 | 382 |
| 1507 | 3300015261 | Ga0182006_1000808 | Ga0182006_100080819 | 382 |
| 1508 | 3300015261 | Ga0182006_1000967 | Ga0182006_10009675 | 382 |
| 1509 | 3300015261 | Ga0182006_1006793 | Ga0182006_10067934 | 382 |
| 1510 | 3300015261 | Ga0182006_1053038 | Ga0182006_10530382 | 382 |
| 1511 | 3300015262 | Ga0182007_10000965 | Ga0182007_100009652 | 382 |
| 1512 | 3300015262 | Ga0182007_10003252 | Ga0182007_100032526 | 382 |
| 1513 | 3300015262 | Ga0182007_10003543 | Ga0182007_100035436 | 382 |
| 1514 | 3300015262 | Ga0182007_10030438 | Ga0182007_100304382 | 382 |
| 1515 | 3300015265 | Ga0182005_1000758 | Ga0182005_10007583 | 382 |
| 1516 | 3300015265 | Ga0182005_1003308 | Ga0182005_10033081 | 382 |
| 1517 | 3300015265 | Ga0182005_1013990 | Ga0182005_10139902 | 382 |
| 1518 | 3300015265 | Ga0182005_1016131 | Ga0182005_10161312 | 382 |
| 1519 | 3300015265 | Ga0182005_1021282 | Ga0182005_10212821 | 382 |
| 1520 | 3300015685 | Ga0183369_1011 | Ga0183369_1011227 | 382 |
| 1521 | 3300015687 | Ga0183368_1007 | Ga0183368_1007261 | 382 |
| 1522 | 3300015690 | Ga0183363_1106 | Ga0183363_11067 | 382 |
| 1523 | 3300016635 | Ga0183361_10001 | Ga0183361_1000176 | 382 |
| 1524 | 3300017792 | Ga0163161_10001737 | Ga0163161_1000173714 | 382 |
| 1525 | 3300017792 | Ga0163161_10025774 | Ga0163161_100257744 | 382 |
| 1526 | 3300017792 | Ga0163161_10071262 | Ga0163161_100712623 | 382 |
| 1527 | 3300017792 | Ga0163161_10117200 | Ga0163161_101172001 | 382 |
| 1528 | 3300017792 | Ga0163161_10138268 | Ga0163161_101382682 | 382 |
| 1529 | 3300020070 | Ga0206356_10061609 | Ga0206356_100616092 | 382 |
| 1530 | 3300020070 | Ga0206356_11616746 | Ga0206356_116167463 | 382 |
| 1531 | 3300020082 | Ga0206353_11840038 | Ga0206353_118400384 | 382 |
| 1532 | 3300021384 | Ga0213876_10101399 | Ga0213876_101013991 | 382 |
| 1533 | 3300022467 | Ga0224712_10000090 | Ga0224712_100000908 | 382 |
| 1534 | 3300022739 | Ga0228711_1005754 | Ga0228711_10057543 | 382 |
| 1535 | 3300022739 | Ga0228711_1032337 | Ga0228711_10323372 | 382 |
| 1536 | 3300022740 | Ga0228710_1006542 | Ga0228710_10065423 | 382 |
| 1537 | 3300022740 | Ga0228710_1031661 | Ga0228710_10316613 | 382 |
| 1538 | 3300025206 | Ga0209435_100004 | Ga0209435_10000485 | 382 |
| 1539 | 3300025206 | Ga0209435_100005 | Ga0209435_10000523 | 382 |
| 1540 | 3300025206 | Ga0209435_100866 | Ga0209435_1008665 | 382 |
| 1541 | 3300025207 | Ga0209760_100114 | Ga0209760_10011435 | 382 |
| 1542 | 3300025207 | Ga0209760_100340 | Ga0209760_1003405 | 382 |
| 1543 | 3300025208 | Ga0209436_100026 | Ga0209436_10002641 | 382 |
| 1544 | 3300025224 | Ga0209784_100005 | Ga0209784_100005188 | 382 |
| 1545 | 3300025224 | Ga0209784_100007 | Ga0209784_10000783 | 382 |
| 1546 | 3300025224 | Ga0209784_100049 | Ga0209784_100049169 | 382 |
| 1547 | 3300025224 | Ga0209784_100164 | Ga0209784_10016431 | 382 |
| 1548 | 3300025225 | Ga0209566_100005 | Ga0209566_100005188 | 382 |
| 1549 | 3300025225 | Ga0209566_100009 | Ga0209566_10000983 | 382 |
| 1550 | 3300025225 | Ga0209566_100061 | Ga0209566_100061169 | 382 |
| 1551 | 3300025225 | Ga0209566_100212 | Ga0209566_10021216 | 382 |
| 1552 | 3300025225 | Ga0209566_102109 | Ga0209566_1021092 | 382 |
| 1553 | 3300025226 | Ga0209674_100009 | Ga0209674_100009188 | 382 |
| 1554 | 3300025226 | Ga0209674_100013 | Ga0209674_100013599 | 382 |
| 1555 | 3300025226 | Ga0209674_100021 | Ga0209674_10002183 | 382 |
| 1556 | 3300025226 | Ga0209674_100037 | Ga0209674_10003798 | 382 |
| 1557 | 3300025226 | Ga0209674_100059 | Ga0209674_100059191 | 382 |
| 1558 | 3300025226 | Ga0209674_100069 | Ga0209674_100069218 | 382 |
| 1559 | 3300025226 | Ga0209674_100163 | Ga0209674_1001638 | 382 |
| 1560 | 3300025226 | Ga0209674_100437 | Ga0209674_1004377 | 382 |
| 1561 | 3300025226 | Ga0209674_100560 | Ga0209674_1005604 | 382 |
| 1562 | 3300025226 | Ga0209674_101415 | Ga0209674_1014154 | 382 |
| 1563 | 3300025228 | Ga0209672_100004 | Ga0209672_100004730 | 382 |
| 1564 | 3300025228 | Ga0209672_100008 | Ga0209672_100008635 | 382 |
| 1565 | 3300025228 | Ga0209672_100010 | Ga0209672_100010651 | 382 |
| 1566 | 3300025228 | Ga0209672_100046 | Ga0209672_100046220 | 382 |
| 1567 | 3300025228 | Ga0209672_100047 | Ga0209672_100047137 | 382 |
| 1568 | 3300025228 | Ga0209672_100121 | Ga0209672_10012149 | 382 |
| 1569 | 3300025228 | Ga0209672_100272 | Ga0209672_10027228 | 382 |
| 1570 | 3300025228 | Ga0209672_101050 | Ga0209672_1010502 | 382 |
| 1571 | 3300025228 | Ga0209672_101871 | Ga0209672_1018712 | 382 |
| 1572 | 3300025229 | Ga0209147_100006 | Ga0209147_100006651 | 382 |
| 1573 | 3300025229 | Ga0209147_100009 | Ga0209147_10000983 | 382 |
| 1574 | 3300025229 | Ga0209147_100011 | Ga0209147_100011183 | 382 |
| 1575 | 3300025229 | Ga0209147_100043 | Ga0209147_10004344 | 382 |
| 1576 | 3300025229 | Ga0209147_100059 | Ga0209147_100059137 | 382 |
| 1577 | 3300025229 | Ga0209147_100172 | Ga0209147_10017242 | 382 |
| 1578 | 3300025230 | Ga0209563_100012 | Ga0209563_100012188 | 382 |
| 1579 | 3300025230 | Ga0209563_100018 | Ga0209563_10001883 | 382 |
| 1580 | 3300025230 | Ga0209563_100036 | Ga0209563_100036164 | 382 |
| 1581 | 3300025230 | Ga0209563_100083 | Ga0209563_100083169 | 382 |
| 1582 | 3300025230 | Ga0209563_100379 | Ga0209563_10037913 | 382 |
| 1583 | 3300025230 | Ga0209563_101790 | Ga0209563_1017904 | 382 |
| 1584 | 3300025230 | Ga0209563_102726 | Ga0209563_1027263 | 382 |
| 1585 | 3300025231 | Ga0207427_100008 | Ga0207427_100008439 | 382 |
| 1586 | 3300025231 | Ga0207427_100037 | Ga0207427_100037194 | 382 |
| 1587 | 3300025231 | Ga0207427_100084 | Ga0207427_10008453 | 382 |
| 1588 | 3300025231 | Ga0207427_100134 | Ga0207427_10013442 | 382 |
| 1589 | 3300025231 | Ga0207427_101852 | Ga0207427_1018526 | 382 |
| 1590 | 3300025231 | Ga0207427_101954 | Ga0207427_1019543 | 382 |
| 1591 | 3300025231 | Ga0207427_103135 | Ga0207427_1031353 | 382 |
| 1592 | 3300025233 | Ga0209437_100005 | Ga0209437_100005700 | 382 |
| 1593 | 3300025233 | Ga0209437_100014 | Ga0209437_100014272 | 382 |
| 1594 | 3300025233 | Ga0209437_100037 | Ga0209437_10003770 | 382 |
| 1595 | 3300025233 | Ga0209437_100078 | Ga0209437_10007851 | 382 |
| 1596 | 3300025233 | Ga0209437_100084 | Ga0209437_10008418 | 382 |
| 1597 | 3300025233 | Ga0209437_100091 | Ga0209437_100091217 | 382 |
| 1598 | 3300025233 | Ga0209437_100197 | Ga0209437_100197106 | 382 |
| 1599 | 3300025233 | Ga0209437_100213 | Ga0209437_10021369 | 382 |
| 1600 | 3300025242 | Ga0209258_100003 | Ga0209258_100003730 | 382 |
| 1601 | 3300025242 | Ga0209258_100004 | Ga0209258_100004555 | 382 |
| 1602 | 3300025242 | Ga0209258_100008 | Ga0209258_100008180 | 382 |
| 1603 | 3300025242 | Ga0209258_100010 | Ga0209258_100010651 | 382 |
| 1604 | 3300025242 | Ga0209258_100023 | Ga0209258_100023244 | 382 |
| 1605 | 3300025242 | Ga0209258_100034 | Ga0209258_100034264 | 382 |
| 1606 | 3300025242 | Ga0209258_100057 | Ga0209258_100057118 | 382 |
| 1607 | 3300025242 | Ga0209258_100106 | Ga0209258_100106151 | 382 |
| 1608 | 3300025242 | Ga0209258_100172 | Ga0209258_10017235 | 382 |
| 1609 | 3300025242 | Ga0209258_100237 | Ga0209258_10023783 | 382 |
| 1610 | 3300025242 | Ga0209258_100441 | Ga0209258_10044122 | 382 |
| 1611 | 3300025242 | Ga0209258_100792 | Ga0209258_10079210 | 382 |
| 1612 | 3300025242 | Ga0209258_101200 | Ga0209258_1012005 | 382 |
| 1613 | 3300025245 | Ga0207425_1003167 | Ga0207425_10031672 | 382 |
| 1614 | 3300025245 | Ga0207425_1003464 | Ga0207425_10034645 | 382 |
| 1615 | 3300025245 | Ga0207425_1005523 | Ga0207425_10055233 | 382 |
| 1616 | 3300025246 | Ga0209646_1000011 | Ga0209646_100001123 | 382 |
| 1617 | 3300025246 | Ga0209646_1000032 | Ga0209646_1000032277 | 382 |
| 1618 | 3300025246 | Ga0209646_1000052 | Ga0209646_100005299 | 382 |
| 1619 | 3300025246 | Ga0209646_1000442 | Ga0209646_10004422 | 382 |
| 1620 | 3300025246 | Ga0209646_1000895 | Ga0209646_10008955 | 382 |
| 1621 | 3300025246 | Ga0209646_1001329 | Ga0209646_10013292 | 382 |
| 1622 | 3300025246 | Ga0209646_1001788 | Ga0209646_10017883 | 382 |
| 1623 | 3300025246 | Ga0209646_1002158 | Ga0209646_10021586 | 382 |
| 1624 | 3300025250 | Ga0209026_1000008 | Ga0209026_100000823 | 382 |
| 1625 | 3300025250 | Ga0209026_1000045 | Ga0209026_1000045178 | 382 |
| 1626 | 3300025250 | Ga0209026_1000062 | Ga0209026_1000062137 | 382 |
| 1627 | 3300025250 | Ga0209026_1000187 | Ga0209026_100018739 | 382 |
| 1628 | 3300025250 | Ga0209026_1000223 | Ga0209026_100022311 | 382 |
| 1629 | 3300025250 | Ga0209026_1000761 | Ga0209026_10007615 | 382 |
| 1630 | 3300025250 | Ga0209026_1003142 | Ga0209026_10031425 | 382 |
| 1631 | 3300025253 | Ga0209677_100006 | Ga0209677_100006188 | 382 |
| 1632 | 3300025253 | Ga0209677_100012 | Ga0209677_10001283 | 382 |
| 1633 | 3300025253 | Ga0209677_100039 | Ga0209677_100039218 | 382 |
| 1634 | 3300025253 | Ga0209677_100916 | Ga0209677_1009162 | 382 |
| 1635 | 3300025253 | Ga0209677_102832 | Ga0209677_1028323 | 382 |
| 1636 | 3300025254 | Ga0209148_1000001 | Ga0209148_1000001440 | 382 |
| 1637 | 3300025254 | Ga0209148_1000002 | Ga0209148_1000002394 | 382 |
| 1638 | 3300025254 | Ga0209148_1000002 | Ga0209148_1000002407 | 382 |
| 1639 | 3300025254 | Ga0209148_1000018 | Ga0209148_1000018651 | 382 |
| 1640 | 3300025254 | Ga0209148_1000025 | Ga0209148_100002534 | 382 |
| 1641 | 3300025254 | Ga0209148_1000029 | Ga0209148_1000029310 | 382 |
| 1642 | 3300025254 | Ga0209148_1000042 | Ga0209148_1000042277 | 382 |
| 1643 | 3300025254 | Ga0209148_1000053 | Ga0209148_1000053300 | 382 |
| 1644 | 3300025254 | Ga0209148_1000068 | Ga0209148_1000068118 | 382 |
| 1645 | 3300025254 | Ga0209148_1000925 | Ga0209148_10009253 | 382 |
| 1646 | 3300025254 | Ga0209148_1005322 | Ga0209148_10053222 | 382 |
| 1647 | 3300025256 | Ga0209759_1000004 | Ga0209759_100000423 | 382 |
| 1648 | 3300025256 | Ga0209759_1000054 | Ga0209759_1000054122 | 382 |
| 1649 | 3300025256 | Ga0209759_1000132 | Ga0209759_1000132116 | 382 |
| 1650 | 3300025256 | Ga0209759_1000181 | Ga0209759_100018152 | 382 |
| 1651 | 3300025256 | Ga0209759_1000185 | Ga0209759_100018554 | 382 |
| 1652 | 3300025256 | Ga0209759_1000212 | Ga0209759_100021247 | 382 |
| 1653 | 3300025256 | Ga0209759_1000303 | Ga0209759_10003039 | 382 |
| 1654 | 3300025256 | Ga0209759_1001491 | Ga0209759_10014919 | 382 |
| 1655 | 3300025256 | Ga0209759_1001499 | Ga0209759_10014995 | 382 |
| 1656 | 3300025256 | Ga0209759_1001939 | Ga0209759_10019397 | 382 |
| 1657 | 3300025256 | Ga0209759_1002853 | Ga0209759_10028535 | 382 |
| 1658 | 3300025256 | Ga0209759_1003544 | Ga0209759_10035443 | 382 |
| 1659 | 3300025256 | Ga0209759_1010084 | Ga0209759_10100844 | 382 |
| 1660 | 3300025256 | Ga0209759_1019960 | Ga0209759_10199601 | 382 |
| 1661 | 3300025258 | Ga0209129_1000203 | Ga0209129_100020327 | 382 |
| 1662 | 3300025258 | Ga0209129_1000755 | Ga0209129_10007555 | 382 |
| 1663 | 3300025258 | Ga0209129_1001047 | Ga0209129_10010473 | 382 |
| 1664 | 3300025258 | Ga0209129_1001557 | Ga0209129_10015575 | 382 |
| 1665 | 3300025258 | Ga0209129_1001808 | Ga0209129_10018085 | 382 |
| 1666 | 3300025258 | Ga0209129_1001861 | Ga0209129_10018614 | 382 |
| 1667 | 3300025258 | Ga0209129_1001919 | Ga0209129_10019199 | 382 |
| 1668 | 3300025258 | Ga0209129_1002692 | Ga0209129_10026921 | 382 |
| 1669 | 3300025261 | Ga0209233_1000002 | Ga0209233_10000021791 | 382 |
| 1670 | 3300025261 | Ga0209233_1000006 | Ga0209233_1000006534 | 382 |
| 1671 | 3300025261 | Ga0209233_1000008 | Ga0209233_1000008272 | 382 |
| 1672 | 3300025261 | Ga0209233_1000011 | Ga0209233_1000011242 | 382 |
| 1673 | 3300025261 | Ga0209233_1000093 | Ga0209233_1000093222 | 382 |
| 1674 | 3300025261 | Ga0209233_1000096 | Ga0209233_1000096195 | 382 |
| 1675 | 3300025261 | Ga0209233_1000115 | Ga0209233_1000115217 | 382 |
| 1676 | 3300025261 | Ga0209233_1000163 | Ga0209233_100016351 | 382 |
| 1677 | 3300025261 | Ga0209233_1000199 | Ga0209233_10001996 | 382 |
| 1678 | 3300025261 | Ga0209233_1000397 | Ga0209233_100039728 | 382 |
| 1679 | 3300025263 | Ga0209565_1000024 | Ga0209565_100002491 | 382 |
| 1680 | 3300025263 | Ga0209565_1014397 | Ga0209565_10143972 | 382 |
| 1681 | 3300025272 | Ga0209455_1000004 | Ga0209455_1000004730 | 382 |
| 1682 | 3300025272 | Ga0209455_1000007 | Ga0209455_1000007300 | 382 |
| 1683 | 3300025272 | Ga0209455_1000015 | Ga0209455_1000015651 | 382 |
| 1684 | 3300025272 | Ga0209455_1000016 | Ga0209455_1000016532 | 382 |
| 1685 | 3300025272 | Ga0209455_1000054 | Ga0209455_1000054233 | 382 |
| 1686 | 3300025272 | Ga0209455_1000064 | Ga0209455_100006439 | 382 |
| 1687 | 3300025272 | Ga0209455_1006243 | Ga0209455_10062431 | 382 |
| 1688 | 3300025273 | Ga0209673_1000037 | Ga0209673_100003726 | 382 |
| 1689 | 3300025273 | Ga0209673_1000115 | Ga0209673_100011562 | 382 |
| 1690 | 3300025273 | Ga0209673_1000222 | Ga0209673_100022245 | 382 |
| 1691 | 3300025273 | Ga0209673_1000237 | Ga0209673_100023755 | 382 |
| 1692 | 3300025273 | Ga0209673_1000670 | Ga0209673_100067017 | 382 |
| 1693 | 3300025273 | Ga0209673_1001021 | Ga0209673_100102117 | 382 |
| 1694 | 3300025273 | Ga0209673_1007680 | Ga0209673_10076804 | 382 |
| 1695 | 3300025273 | Ga0209673_1009725 | Ga0209673_10097253 | 382 |
| 1696 | 3300025273 | Ga0209673_1032481 | Ga0209673_10324812 | 382 |
| 1697 | 3300025284 | Ga0209130_1000030 | Ga0209130_100003046 | 382 |
| 1698 | 3300025284 | Ga0209130_1000032 | Ga0209130_1000032252 | 382 |
| 1699 | 3300025284 | Ga0209130_1000033 | Ga0209130_100003328 | 382 |
| 1700 | 3300025284 | Ga0209130_1002498 | Ga0209130_10024985 | 382 |
| 1701 | 3300025284 | Ga0209130_1011655 | Ga0209130_10116552 | 382 |
| 1702 | 3300025291 | Ga0209675_1000011 | Ga0209675_100001119 | 382 |
| 1703 | 3300025291 | Ga0209675_1019504 | Ga0209675_10195042 | 382 |
| 1704 | 3300025291 | Ga0209675_1021539 | Ga0209675_10215392 | 382 |
| 1705 | 3300025291 | Ga0209675_1023592 | Ga0209675_10235922 | 382 |
| 1706 | 3300025292 | Ga0209676_1000010 | Ga0209676_1000010217 | 382 |
| 1707 | 3300025292 | Ga0209676_1000011 | Ga0209676_1000011372 | 382 |
| 1708 | 3300025292 | Ga0209676_1000021 | Ga0209676_1000021378 | 382 |
| 1709 | 3300025292 | Ga0209676_1000345 | Ga0209676_100034529 | 382 |
| 1710 | 3300025292 | Ga0209676_1000440 | Ga0209676_10004405 | 382 |
| 1711 | 3300025292 | Ga0209676_1000605 | Ga0209676_100060543 | 382 |
| 1712 | 3300025292 | Ga0209676_1001461 | Ga0209676_100146120 | 382 |
| 1713 | 3300025292 | Ga0209676_1004038 | Ga0209676_10040384 | 382 |
| 1714 | 3300025292 | Ga0209676_1008671 | Ga0209676_10086714 | 382 |
| 1715 | 3300025292 | Ga0209676_1015940 | Ga0209676_10159402 | 382 |
| 1716 | 3300025294 | Ga0209025_1000032 | Ga0209025_1000032260 | 382 |
| 1717 | 3300025294 | Ga0209025_1000044 | Ga0209025_100004435 | 382 |
| 1718 | 3300025294 | Ga0209025_1000354 | Ga0209025_100035478 | 382 |
| 1719 | 3300025294 | Ga0209025_1000864 | Ga0209025_10008645 | 382 |
| 1720 | 3300025294 | Ga0209025_1001447 | Ga0209025_100144727 | 382 |
| 1721 | 3300025294 | Ga0209025_1003821 | Ga0209025_10038211 | 382 |
| 1722 | 3300025294 | Ga0209025_1005184 | Ga0209025_10051842 | 382 |
| 1723 | 3300025294 | Ga0209025_1029298 | Ga0209025_10292982 | 382 |
| 1724 | 3300025294 | Ga0209025_1032266 | Ga0209025_10322662 | 382 |
| 1725 | 3300025294 | Ga0209025_1036238 | Ga0209025_10362382 | 382 |
| 1726 | 3300025295 | Ga0209564_1000079 | Ga0209564_1000079222 | 382 |
| 1727 | 3300025295 | Ga0209564_1000207 | Ga0209564_100020783 | 382 |
| 1728 | 3300025295 | Ga0209564_1000258 | Ga0209564_100025845 | 382 |
| 1729 | 3300025295 | Ga0209564_1000379 | Ga0209564_100037931 | 382 |
| 1730 | 3300025295 | Ga0209564_1000490 | Ga0209564_100049045 | 382 |
| 1731 | 3300025295 | Ga0209564_1002591 | Ga0209564_100259110 | 382 |
| 1732 | 3300025295 | Ga0209564_1005577 | Ga0209564_10055772 | 382 |
| 1733 | 3300025295 | Ga0209564_1021889 | Ga0209564_10218893 | 382 |
| 1734 | 3300025295 | Ga0209564_1022583 | Ga0209564_10225832 | 382 |
| 1735 | 3300025297 | Ga0209758_1000008 | Ga0209758_1000008425 | 382 |
| 1736 | 3300025297 | Ga0209758_1000586 | Ga0209758_10005866 | 382 |
| 1737 | 3300025297 | Ga0209758_1000674 | Ga0209758_100067431 | 382 |
| 1738 | 3300025297 | Ga0209758_1000983 | Ga0209758_100098322 | 382 |
| 1739 | 3300025297 | Ga0209758_1001007 | Ga0209758_100100714 | 382 |
| 1740 | 3300025297 | Ga0209758_1001098 | Ga0209758_10010983 | 382 |
| 1741 | 3300025297 | Ga0209758_1001230 | Ga0209758_10012303 | 382 |
| 1742 | 3300025297 | Ga0209758_1001815 | Ga0209758_100181518 | 382 |
| 1743 | 3300025297 | Ga0209758_1004625 | Ga0209758_100462510 | 382 |
| 1744 | 3300025297 | Ga0209758_1015519 | Ga0209758_10155192 | 382 |
| 1745 | 3300025297 | Ga0209758_1022030 | Ga0209758_10220303 | 382 |
| 1746 | 3300025298 | Ga0209050_1000032 | Ga0209050_1000032251 | 382 |
| 1747 | 3300025298 | Ga0209050_1000081 | Ga0209050_100008133 | 382 |
| 1748 | 3300025298 | Ga0209050_1000162 | Ga0209050_100016235 | 382 |
| 1749 | 3300025298 | Ga0209050_1000227 | Ga0209050_1000227113 | 382 |
| 1750 | 3300025298 | Ga0209050_1001253 | Ga0209050_100125320 | 382 |
| 1751 | 3300025298 | Ga0209050_1001540 | Ga0209050_100154022 | 382 |
| 1752 | 3300025298 | Ga0209050_1001731 | Ga0209050_10017315 | 382 |
| 1753 | 3300025298 | Ga0209050_1002704 | Ga0209050_100270410 | 382 |
| 1754 | 3300025298 | Ga0209050_1003537 | Ga0209050_10035376 | 382 |
| 1755 | 3300025298 | Ga0209050_1009731 | Ga0209050_10097315 | 382 |
| 1756 | 3300025299 | Ga0209256_1000202 | Ga0209256_100020245 | 382 |
| 1757 | 3300025299 | Ga0209256_1000709 | Ga0209256_100070936 | 382 |
| 1758 | 3300025299 | Ga0209256_1000893 | Ga0209256_100089326 | 382 |
| 1759 | 3300025299 | Ga0209256_1000950 | Ga0209256_10009508 | 382 |
| 1760 | 3300025299 | Ga0209256_1001345 | Ga0209256_10013454 | 382 |
| 1761 | 3300025299 | Ga0209256_1001793 | Ga0209256_100179314 | 382 |
| 1762 | 3300025299 | Ga0209256_1001832 | Ga0209256_10018323 | 382 |
| 1763 | 3300025299 | Ga0209256_1008649 | Ga0209256_10086493 | 382 |
| 1764 | 3300025299 | Ga0209256_1010324 | Ga0209256_10103244 | 382 |
| 1765 | 3300025299 | Ga0209256_1013528 | Ga0209256_10135283 | 382 |
| 1766 | 3300025302 | Ga0207426_1000007 | Ga0207426_1000007148 | 382 |
| 1767 | 3300025302 | Ga0207426_1000047 | Ga0207426_1000047354 | 382 |
| 1768 | 3300025302 | Ga0207426_1000077 | Ga0207426_1000077252 | 382 |
| 1769 | 3300025302 | Ga0207426_1000078 | Ga0207426_100007828 | 382 |
| 1770 | 3300025302 | Ga0207426_1000296 | Ga0207426_100029679 | 382 |
| 1771 | 3300025302 | Ga0207426_1001188 | Ga0207426_100118825 | 382 |
| 1772 | 3300025303 | Ga0209051_1000104 | Ga0209051_100010438 | 382 |
| 1773 | 3300025303 | Ga0209051_1000121 | Ga0209051_1000121117 | 382 |
| 1774 | 3300025303 | Ga0209051_1000164 | Ga0209051_1000164114 | 382 |
| 1775 | 3300025303 | Ga0209051_1000202 | Ga0209051_100020279 | 382 |
| 1776 | 3300025303 | Ga0209051_1000710 | Ga0209051_100071017 | 382 |
| 1777 | 3300025303 | Ga0209051_1000908 | Ga0209051_10009084 | 382 |
| 1778 | 3300025303 | Ga0209051_1000909 | Ga0209051_10009098 | 382 |
| 1779 | 3300025303 | Ga0209051_1001365 | Ga0209051_100136515 | 382 |
| 1780 | 3300025303 | Ga0209051_1003501 | Ga0209051_10035013 | 382 |
| 1781 | 3300025303 | Ga0209051_1005522 | Ga0209051_10055222 | 382 |
| 1782 | 3300025303 | Ga0209051_1013475 | Ga0209051_10134751 | 382 |
| 1783 | 3300025303 | Ga0209051_1021653 | Ga0209051_10216531 | 382 |
| 1784 | 3300025303 | Ga0209051_1030693 | Ga0209051_10306932 | 382 |
| 1785 | 3300025303 | Ga0209051_1030965 | Ga0209051_10309652 | 382 |
| 1786 | 3300025304 | Ga0209257_1000014 | Ga0209257_1000014431 | 382 |
| 1787 | 3300025304 | Ga0209257_1000040 | Ga0209257_1000040308 | 382 |
| 1788 | 3300025304 | Ga0209257_1000065 | Ga0209257_1000065211 | 382 |
| 1789 | 3300025304 | Ga0209257_1000121 | Ga0209257_100012129 | 382 |
| 1790 | 3300025304 | Ga0209257_1000356 | Ga0209257_100035699 | 382 |
| 1791 | 3300025304 | Ga0209257_1000452 | Ga0209257_10004525 | 382 |
| 1792 | 3300025304 | Ga0209257_1001064 | Ga0209257_10010645 | 382 |
| 1793 | 3300025304 | Ga0209257_1004058 | Ga0209257_10040588 | 382 |
| 1794 | 3300025304 | Ga0209257_1004137 | Ga0209257_10041379 | 382 |
| 1795 | 3300025304 | Ga0209257_1007238 | Ga0209257_10072382 | 382 |
| 1796 | 3300025304 | Ga0209257_1012983 | Ga0209257_10129833 | 382 |
| 1797 | 3300025304 | Ga0209257_1013555 | Ga0209257_10135553 | 382 |
| 1798 | 3300025304 | Ga0209257_1028082 | Ga0209257_10280821 | 382 |
| 1799 | 3300025321 | Ga0207656_10000009 | Ga0207656_1000000985 | 382 |
| 1800 | 3300025711 | Ga0207696_1000097 | Ga0207696_100009750 | 382 |
| 1801 | 3300025711 | Ga0207696_1000152 | Ga0207696_100015282 | 382 |
| 1802 | 3300025711 | Ga0207696_1000165 | Ga0207696_100016586 | 382 |
| 1803 | 3300025711 | Ga0207696_1001780 | Ga0207696_100178010 | 382 |
| 1804 | 3300025711 | Ga0207696_1001993 | Ga0207696_10019932 | 382 |
| 1805 | 3300025728 | Ga0207655_1000021 | Ga0207655_100002148 | 382 |
| 1806 | 3300025728 | Ga0207655_1000603 | Ga0207655_100060341 | 382 |
| 1807 | 3300025728 | Ga0207655_1000652 | Ga0207655_100065223 | 382 |
| 1808 | 3300025728 | Ga0207655_1000772 | Ga0207655_10007722 | 382 |
| 1809 | 3300025728 | Ga0207655_1000931 | Ga0207655_100093126 | 382 |
| 1810 | 3300025728 | Ga0207655_1003483 | Ga0207655_10034836 | 382 |
| 1811 | 3300025728 | Ga0207655_1012890 | Ga0207655_10128903 | 382 |
| 1812 | 3300025728 | Ga0207655_1017528 | Ga0207655_10175283 | 382 |
| 1813 | 3300025728 | Ga0207655_1018487 | Ga0207655_10184873 | 382 |
| 1814 | 3300025728 | Ga0207655_1022739 | Ga0207655_10227393 | 382 |
| 1815 | 3300025728 | Ga0207655_1029630 | Ga0207655_10296301 | 382 |
| 1816 | 3300025735 | Ga0207713_1000009 | Ga0207713_1000009435 | 382 |
| 1817 | 3300025735 | Ga0207713_1000041 | Ga0207713_100004196 | 382 |
| 1818 | 3300025735 | Ga0207713_1000692 | Ga0207713_100069216 | 382 |
| 1819 | 3300025735 | Ga0207713_1001034 | Ga0207713_10010346 | 382 |
| 1820 | 3300025735 | Ga0207713_1001400 | Ga0207713_100140017 | 382 |
| 1821 | 3300025735 | Ga0207713_1002103 | Ga0207713_10021037 | 382 |
| 1822 | 3300025735 | Ga0207713_1002787 | Ga0207713_100278710 | 382 |
| 1823 | 3300025735 | Ga0207713_1003713 | Ga0207713_10037136 | 382 |
| 1824 | 3300025735 | Ga0207713_1003965 | Ga0207713_10039655 | 382 |
| 1825 | 3300025735 | Ga0207713_1006559 | Ga0207713_10065594 | 382 |
| 1826 | 3300025735 | Ga0207713_1007252 | Ga0207713_10072523 | 382 |
| 1827 | 3300025735 | Ga0207713_1008559 | Ga0207713_10085594 | 382 |
| 1828 | 3300025735 | Ga0207713_1010947 | Ga0207713_10109474 | 382 |
| 1829 | 3300025735 | Ga0207713_1017746 | Ga0207713_10177462 | 382 |
| 1830 | 3300025899 | Ga0207642_10017216 | Ga0207642_100172164 | 382 |
| 1831 | 3300025903 | Ga0207680_10000003 | Ga0207680_10000003652 | 382 |
| 1832 | 3300025903 | Ga0207680_10010848 | Ga0207680_100108484 | 382 |
| 1833 | 3300025904 | Ga0207647_10000406 | Ga0207647_100004063 | 382 |
| 1834 | 3300025904 | Ga0207647_10005179 | Ga0207647_100051795 | 382 |
| 1835 | 3300025904 | Ga0207647_10006150 | Ga0207647_100061509 | 382 |
| 1836 | 3300025904 | Ga0207647_10020784 | Ga0207647_100207842 | 382 |
| 1837 | 3300025904 | Ga0207647_10047493 | Ga0207647_100474931 | 382 |
| 1838 | 3300025907 | Ga0207645_10020432 | Ga0207645_100204324 | 382 |
| 1839 | 3300025907 | Ga0207645_10025328 | Ga0207645_100253282 | 382 |
| 1840 | 3300025908 | Ga0207643_10021300 | Ga0207643_100213003 | 382 |
| 1841 | 3300025908 | Ga0207643_10028023 | Ga0207643_100280233 | 382 |
| 1842 | 3300025908 | Ga0207643_10074720 | Ga0207643_100747202 | 382 |
| 1843 | 3300025909 | Ga0207705_10002609 | Ga0207705_1000260911 | 382 |
| 1844 | 3300025909 | Ga0207705_10013348 | Ga0207705_100133484 | 382 |
| 1845 | 3300025909 | Ga0207705_10013783 | Ga0207705_100137832 | 382 |
| 1846 | 3300025909 | Ga0207705_10035760 | Ga0207705_100357604 | 382 |
| 1847 | 3300025909 | Ga0207705_10040318 | Ga0207705_100403182 | 382 |
| 1848 | 3300025909 | Ga0207705_10055162 | Ga0207705_100551623 | 382 |
| 1849 | 3300025909 | Ga0207705_10109084 | Ga0207705_101090841 | 382 |
| 1850 | 3300025911 | Ga0207654_10019928 | Ga0207654_100199282 | 382 |
| 1851 | 3300025911 | Ga0207654_10024194 | Ga0207654_100241943 | 382 |
| 1852 | 3300025912 | Ga0207707_10052033 | Ga0207707_100520334 | 382 |
| 1853 | 3300025913 | Ga0207695_10000049 | Ga0207695_1000004929 | 382 |
| 1854 | 3300025913 | Ga0207695_10000429 | Ga0207695_100004298 | 382 |
| 1855 | 3300025913 | Ga0207695_10001702 | Ga0207695_1000170233 | 382 |
| 1856 | 3300025913 | Ga0207695_10003515 | Ga0207695_1000351518 | 382 |
| 1857 | 3300025913 | Ga0207695_10005252 | Ga0207695_100052523 | 382 |
| 1858 | 3300025913 | Ga0207695_10011740 | Ga0207695_100117405 | 382 |
| 1859 | 3300025913 | Ga0207695_10012415 | Ga0207695_100124153 | 382 |
| 1860 | 3300025913 | Ga0207695_10021072 | Ga0207695_100210727 | 382 |
| 1861 | 3300025913 | Ga0207695_10026274 | Ga0207695_100262742 | 382 |
| 1862 | 3300025913 | Ga0207695_10133729 | Ga0207695_101337292 | 382 |
| 1863 | 3300025913 | Ga0207695_10141210 | Ga0207695_101412102 | 382 |
| 1864 | 3300025913 | Ga0207695_10249740 | Ga0207695_102497402 | 382 |
| 1865 | 3300025913 | Ga0207695_10316730 | Ga0207695_103167302 | 382 |
| 1866 | 3300025914 | Ga0207671_10000059 | Ga0207671_100000595 | 382 |
| 1867 | 3300025914 | Ga0207671_10000135 | Ga0207671_1000013547 | 382 |
| 1868 | 3300025914 | Ga0207671_10000556 | Ga0207671_1000055623 | 382 |
| 1869 | 3300025914 | Ga0207671_10000713 | Ga0207671_100007136 | 382 |
| 1870 | 3300025914 | Ga0207671_10004705 | Ga0207671_100047055 | 382 |
| 1871 | 3300025914 | Ga0207671_10034008 | Ga0207671_100340081 | 382 |
| 1872 | 3300025914 | Ga0207671_10060219 | Ga0207671_100602192 | 382 |
| 1873 | 3300025916 | Ga0207663_10142381 | Ga0207663_101423812 | 382 |
| 1874 | 3300025918 | Ga0207662_10001567 | Ga0207662_100015676 | 382 |
| 1875 | 3300025919 | Ga0207657_10000008 | Ga0207657_1000000868 | 382 |
| 1876 | 3300025919 | Ga0207657_10001585 | Ga0207657_1000158522 | 382 |
| 1877 | 3300025919 | Ga0207657_10017790 | Ga0207657_100177902 | 382 |
| 1878 | 3300025919 | Ga0207657_10067795 | Ga0207657_100677952 | 382 |
| 1879 | 3300025920 | Ga0207649_10000007 | Ga0207649_10000007209 | 382 |
| 1880 | 3300025920 | Ga0207649_10014289 | Ga0207649_100142893 | 382 |
| 1881 | 3300025920 | Ga0207649_10237503 | Ga0207649_102375031 | 382 |
| 1882 | 3300025921 | Ga0207652_10015302 | Ga0207652_100153027 | 382 |
| 1883 | 3300025921 | Ga0207652_10041632 | Ga0207652_100416323 | 382 |
| 1884 | 3300025921 | Ga0207652_10125743 | Ga0207652_101257431 | 382 |
| 1885 | 3300025921 | Ga0207652_10129091 | Ga0207652_101290912 | 382 |
| 1886 | 3300025921 | Ga0207652_10132655 | Ga0207652_101326552 | 382 |
| 1887 | 3300025923 | Ga0207681_10000163 | Ga0207681_1000016349 | 382 |
| 1888 | 3300025923 | Ga0207681_10007357 | Ga0207681_100073574 | 382 |
| 1889 | 3300025923 | Ga0207681_10173549 | Ga0207681_101735492 | 382 |
| 1890 | 3300025924 | Ga0207694_10000128 | Ga0207694_1000012854 | 382 |
| 1891 | 3300025924 | Ga0207694_10000359 | Ga0207694_1000035928 | 382 |
| 1892 | 3300025924 | Ga0207694_10019147 | Ga0207694_100191475 | 382 |
| 1893 | 3300025924 | Ga0207694_10032251 | Ga0207694_100322512 | 382 |
| 1894 | 3300025924 | Ga0207694_10042761 | Ga0207694_100427612 | 382 |
| 1895 | 3300025924 | Ga0207694_10064274 | Ga0207694_100642742 | 382 |
| 1896 | 3300025924 | Ga0207694_10186621 | Ga0207694_101866212 | 382 |
| 1897 | 3300025925 | Ga0207650_10000178 | Ga0207650_1000017848 | 382 |
| 1898 | 3300025925 | Ga0207650_10000210 | Ga0207650_1000021029 | 382 |
| 1899 | 3300025925 | Ga0207650_10008117 | Ga0207650_100081174 | 382 |
| 1900 | 3300025925 | Ga0207650_10336585 | Ga0207650_103365851 | 382 |
| 1901 | 3300025926 | Ga0207659_10036901 | Ga0207659_100369015 | 382 |
| 1902 | 3300025926 | Ga0207659_10249400 | Ga0207659_102494001 | 382 |
| 1903 | 3300025927 | Ga0207687_10015209 | Ga0207687_100152094 | 382 |
| 1904 | 3300025929 | Ga0207664_10010237 | Ga0207664_100102372 | 382 |
| 1905 | 3300025929 | Ga0207664_10095916 | Ga0207664_100959162 | 382 |
| 1906 | 3300025931 | Ga0207644_10003369 | Ga0207644_100033695 | 382 |
| 1907 | 3300025932 | Ga0207690_10000013 | Ga0207690_10000013104 | 382 |
| 1908 | 3300025932 | Ga0207690_10014282 | Ga0207690_100142824 | 382 |
| 1909 | 3300025933 | Ga0207706_10000050 | Ga0207706_1000005085 | 382 |
| 1910 | 3300025933 | Ga0207706_10132688 | Ga0207706_101326883 | 382 |
| 1911 | 3300025933 | Ga0207706_10133108 | Ga0207706_101331082 | 382 |
| 1912 | 3300025934 | Ga0207686_10001532 | Ga0207686_100015327 | 382 |
| 1913 | 3300025935 | Ga0207709_10000035 | Ga0207709_10000035215 | 382 |
| 1914 | 3300025935 | Ga0207709_10005638 | Ga0207709_100056387 | 382 |
| 1915 | 3300025935 | Ga0207709_10071412 | Ga0207709_100714122 | 382 |
| 1916 | 3300025935 | Ga0207709_10100678 | Ga0207709_101006781 | 382 |
| 1917 | 3300025936 | Ga0207670_10011958 | Ga0207670_100119582 | 382 |
| 1918 | 3300025936 | Ga0207670_10096398 | Ga0207670_100963981 | 382 |
| 1919 | 3300025937 | Ga0207669_10060191 | Ga0207669_100601912 | 382 |
| 1920 | 3300025938 | Ga0207704_10010676 | Ga0207704_100106764 | 382 |
| 1921 | 3300025938 | Ga0207704_10078039 | Ga0207704_100780393 | 382 |
| 1922 | 3300025940 | Ga0207691_10004858 | Ga0207691_100048583 | 382 |
| 1923 | 3300025940 | Ga0207691_10071976 | Ga0207691_100719763 | 382 |
| 1924 | 3300025940 | Ga0207691_10160767 | Ga0207691_101607672 | 382 |
| 1925 | 3300025941 | Ga0207711_10033204 | Ga0207711_100332044 | 382 |
| 1926 | 3300025941 | Ga0207711_10045097 | Ga0207711_100450972 | 382 |
| 1927 | 3300025941 | Ga0207711_10133059 | Ga0207711_101330591 | 382 |
| 1928 | 3300025941 | Ga0207711_10378763 | Ga0207711_103787632 | 382 |
| 1929 | 3300025942 | Ga0207689_10002599 | Ga0207689_1000259910 | 382 |
| 1930 | 3300025942 | Ga0207689_10015989 | Ga0207689_100159893 | 382 |
| 1931 | 3300025942 | Ga0207689_10092746 | Ga0207689_100927461 | 382 |
| 1932 | 3300025944 | Ga0207661_10013152 | Ga0207661_100131521 | 382 |
| 1933 | 3300025944 | Ga0207661_10041845 | Ga0207661_100418452 | 382 |
| 1934 | 3300025944 | Ga0207661_10102213 | Ga0207661_101022132 | 382 |
| 1935 | 3300025944 | Ga0207661_10208914 | Ga0207661_102089142 | 382 |
| 1936 | 3300025945 | Ga0207679_10000013 | Ga0207679_1000001395 | 382 |
| 1937 | 3300025945 | Ga0207679_10007435 | Ga0207679_100074353 | 382 |
| 1938 | 3300025945 | Ga0207679_10024109 | Ga0207679_100241092 | 382 |
| 1939 | 3300025945 | Ga0207679_10051926 | Ga0207679_100519263 | 382 |
| 1940 | 3300025949 | Ga0207667_10000028 | Ga0207667_10000028165 | 382 |
| 1941 | 3300025949 | Ga0207667_10000062 | Ga0207667_1000006280 | 382 |
| 1942 | 3300025949 | Ga0207667_10000292 | Ga0207667_1000029237 | 382 |
| 1943 | 3300025949 | Ga0207667_10000486 | Ga0207667_1000048614 | 382 |
| 1944 | 3300025949 | Ga0207667_10002564 | Ga0207667_1000256410 | 382 |
| 1945 | 3300025949 | Ga0207667_10013346 | Ga0207667_100133461 | 382 |
| 1946 | 3300025949 | Ga0207667_10013807 | Ga0207667_100138074 | 382 |
| 1947 | 3300025949 | Ga0207667_10015048 | Ga0207667_100150486 | 382 |
| 1948 | 3300025949 | Ga0207667_10070719 | Ga0207667_100707193 | 382 |
| 1949 | 3300025949 | Ga0207667_10081051 | Ga0207667_100810515 | 382 |
| 1950 | 3300025949 | Ga0207667_10106559 | Ga0207667_101065592 | 382 |
| 1951 | 3300025949 | Ga0207667_10121940 | Ga0207667_101219403 | 382 |
| 1952 | 3300025949 | Ga0207667_10132596 | Ga0207667_101325962 | 382 |
| 1953 | 3300025949 | Ga0207667_10208048 | Ga0207667_102080482 | 382 |
| 1954 | 3300025960 | Ga0207651_10012970 | Ga0207651_100129704 | 382 |
| 1955 | 3300025960 | Ga0207651_10119814 | Ga0207651_101198142 | 382 |
| 1956 | 3300025961 | Ga0207712_10033098 | Ga0207712_100330982 | 382 |
| 1957 | 3300025972 | Ga0207668_10008682 | Ga0207668_100086824 | 382 |
| 1958 | 3300025972 | Ga0207668_10082433 | Ga0207668_100824332 | 382 |
| 1959 | 3300025981 | Ga0207640_10000022 | Ga0207640_1000002232 | 382 |
| 1960 | 3300025981 | Ga0207640_10000471 | Ga0207640_100004712 | 382 |
| 1961 | 3300025981 | Ga0207640_10000670 | Ga0207640_1000067013 | 382 |
| 1962 | 3300025981 | Ga0207640_10145962 | Ga0207640_101459621 | 382 |
| 1963 | 3300025986 | Ga0207658_10070348 | Ga0207658_100703483 | 382 |
| 1964 | 3300026035 | Ga0207703_10120948 | Ga0207703_101209482 | 382 |
| 1965 | 3300026041 | Ga0207639_10027540 | Ga0207639_100275403 | 382 |
| 1966 | 3300026067 | Ga0207678_10000969 | Ga0207678_1000096912 | 382 |
| 1967 | 3300026067 | Ga0207678_10001675 | Ga0207678_100016755 | 382 |
| 1968 | 3300026067 | Ga0207678_10095511 | Ga0207678_100955113 | 382 |
| 1969 | 3300026078 | Ga0207702_10000624 | Ga0207702_1000062410 | 382 |
| 1970 | 3300026078 | Ga0207702_10009106 | Ga0207702_100091067 | 382 |
| 1971 | 3300026078 | Ga0207702_10028519 | Ga0207702_100285192 | 382 |
| 1972 | 3300026078 | Ga0207702_10051439 | Ga0207702_100514392 | 382 |
| 1973 | 3300026078 | Ga0207702_10070045 | Ga0207702_100700453 | 382 |
| 1974 | 3300026078 | Ga0207702_10077002 | Ga0207702_100770023 | 382 |
| 1975 | 3300026078 | Ga0207702_10153332 | Ga0207702_101533322 | 382 |
| 1976 | 3300026078 | Ga0207702_10252153 | Ga0207702_102521532 | 382 |
| 1977 | 3300026088 | Ga0207641_10006248 | Ga0207641_100062483 | 382 |
| 1978 | 3300026088 | Ga0207641_10014471 | Ga0207641_100144712 | 382 |
| 1979 | 3300026089 | Ga0207648_10034441 | Ga0207648_100344413 | 382 |
| 1980 | 3300026089 | Ga0207648_10051585 | Ga0207648_100515852 | 382 |
| 1981 | 3300026095 | Ga0207676_10073470 | Ga0207676_100734701 | 382 |
| 1982 | 3300026095 | Ga0207676_10105343 | Ga0207676_101053431 | 382 |
| 1983 | 3300026095 | Ga0207676_10170681 | Ga0207676_101706812 | 382 |
| 1984 | 3300026095 | Ga0207676_10332450 | Ga0207676_103324501 | 382 |
| 1985 | 3300026116 | Ga0207674_10000298 | Ga0207674_100002985 | 382 |
| 1986 | 3300026116 | Ga0207674_10010196 | Ga0207674_100101963 | 382 |
| 1987 | 3300026116 | Ga0207674_10044449 | Ga0207674_100444493 | 382 |
| 1988 | 3300026116 | Ga0207674_10091822 | Ga0207674_100918222 | 382 |
| 1989 | 3300026116 | Ga0207674_10162508 | Ga0207674_101625081 | 382 |
| 1990 | 3300026116 | Ga0207674_10379914 | Ga0207674_103799142 | 382 |
| 1991 | 3300026118 | Ga0207675_100053155 | Ga0207675_1000531555 | 382 |
| 1992 | 3300026118 | Ga0207675_100110860 | Ga0207675_1001108602 | 382 |
| 1993 | 3300026121 | Ga0207683_10014610 | Ga0207683_100146104 | 382 |
| 1994 | 3300026121 | Ga0207683_10016309 | Ga0207683_100163092 | 382 |
| 1995 | 3300026142 | Ga0207698_10014129 | Ga0207698_100141292 | 382 |
| 1996 | 3300026142 | Ga0207698_10015955 | Ga0207698_100159556 | 382 |
| 1997 | 3300026142 | Ga0207698_10019529 | Ga0207698_100195295 | 382 |
| 1998 | 3300026142 | Ga0207698_10232031 | Ga0207698_102320311 | 382 |
| 1999 | 3300027111 | Ga0209281_1000077 | Ga0209281_1000077208 | 382 |
| 2000 | 3300027111 | Ga0209281_1000118 | Ga0209281_100011819 | 382 |
| 2001 | 3300027111 | Ga0209281_1000212 | Ga0209281_100021229 | 382 |
| 2002 | 3300027111 | Ga0209281_1000346 | Ga0209281_100034669 | 382 |
| 2003 | 3300027111 | Ga0209281_1000469 | Ga0209281_100046924 | 382 |
| 2004 | 3300027111 | Ga0209281_1013795 | Ga0209281_10137952 | 382 |
| 2005 | 3300027312 | Ga0209371_1000023 | Ga0209371_1000023184 | 382 |
| 2006 | 3300027312 | Ga0209371_1000065 | Ga0209371_100006593 | 382 |
| 2007 | 3300027312 | Ga0209371_1002067 | Ga0209371_10020679 | 382 |
| 2008 | 3300027312 | Ga0209371_1010681 | Ga0209371_10106812 | 382 |
| 2009 | 3300027666 | Ga0209282_1000038 | Ga0209282_100003824 | 382 |
| 2010 | 3300027666 | Ga0209282_1029815 | Ga0209282_10298152 | 382 |
| 2011 | 3300027866 | Ga0209813_10006468 | Ga0209813_100064682 | 382 |
| 2012 | 3300027907 | Ga0207428_10015977 | Ga0207428_100159777 | 382 |
| 2013 | 3300027907 | Ga0207428_10044995 | Ga0207428_100449951 | 382 |
| 2014 | 3300028379 | Ga0268266_10000011 | Ga0268266_10000011590 | 382 |
| 2015 | 3300028379 | Ga0268266_10000364 | Ga0268266_100003645 | 382 |
| 2016 | 3300028379 | Ga0268266_10000895 | Ga0268266_1000089532 | 382 |
| 2017 | 3300028379 | Ga0268266_10005005 | Ga0268266_1000500512 | 382 |
| 2018 | 3300028379 | Ga0268266_10020541 | Ga0268266_100205414 | 382 |
| 2019 | 3300028379 | Ga0268266_10023157 | Ga0268266_100231572 | 382 |
| 2020 | 3300028379 | Ga0268266_10055690 | Ga0268266_100556903 | 382 |
| 2021 | 3300028379 | Ga0268266_10263051 | Ga0268266_102630512 | 382 |
| 2022 | 3300028381 | Ga0268264_10003867 | Ga0268264_100038678 | 382 |
| 2023 | 3300028381 | Ga0268264_10384530 | Ga0268264_103845301 | 382 |
| 2024 | 3300028381 | Ga0268264_10469945 | Ga0268264_104699451 | 382 |
| 2025 | 3300028794 | Ga0307515_10085133 | Ga0307515_100851333 | 382 |
| 2026 | 3300028794 | Ga0307515_10223914 | Ga0307515_102239142 | 382 |
| 2027 | 3300028800 | Ga0265338_10000476 | Ga0265338_1000047651 | 382 |
| 2028 | 3300028800 | Ga0265338_10143969 | Ga0265338_101439691 | 382 |
| 2029 | 3300030500 | Ga0268256_1000023 | Ga0268256_1000023256 | 382 |
| 2030 | 3300030500 | Ga0268256_1000118 | Ga0268256_100011893 | 382 |
| 2031 | 3300030500 | Ga0268256_1002195 | Ga0268256_10021959 | 382 |
| 2032 | 3300030500 | Ga0268256_1011475 | Ga0268256_10114752 | 382 |
| 2033 | 3300030731 | Ga0316177_1155876 | Ga0316177_11558761 | 382 |
| 2034 | 3300030732 | Ga0316176_1003471 | Ga0316176_10034714 | 382 |
| 2035 | 3300030735 | Ga0316178_1043989 | Ga0316178_104398931 | 382 |
| 2036 | 3300030742 | Ga0316183_1207931 | Ga0316183_12079318 | 382 |
| 2037 | 3300030744 | Ga0316181_1063746 | Ga0316181_10637462 | 382 |
| 2038 | 3300030744 | Ga0316181_1140375 | Ga0316181_114037519 | 382 |
| 2039 | 3300031235 | Ga0265330_10023164 | Ga0265330_100231642 | 382 |
| 2040 | 3300031247 | Ga0265340_10016453 | Ga0265340_100164532 | 382 |
| 2041 | 3300031456 | Ga0307513_10009248 | Ga0307513_100092487 | 382 |
| 2042 | 3300031456 | Ga0307513_10035883 | Ga0307513_100358835 | 382 |
| 2043 | 3300031548 | Ga0307408_100011609 | Ga0307408_1000116093 | 382 |
| 2044 | 3300031548 | Ga0307408_100112000 | Ga0307408_1001120002 | 382 |
| 2045 | 3300031730 | Ga0307516_10019066 | Ga0307516_100190668 | 382 |
| 2046 | 3300031730 | Ga0307516_10097128 | Ga0307516_100971282 | 382 |
| 2047 | 3300031731 | Ga0307405_10000266 | Ga0307405_100002666 | 382 |
| 2048 | 3300031731 | Ga0307405_10046393 | Ga0307405_100463932 | 382 |
| 2049 | 3300031731 | Ga0307405_10086501 | Ga0307405_100865012 | 382 |
| 2050 | 3300031838 | Ga0307518_10000232 | Ga0307518_1000023244 | 382 |
| 2051 | 3300031901 | Ga0307406_10008205 | Ga0307406_100082053 | 382 |
| 2052 | 3300031901 | Ga0307406_10132790 | Ga0307406_101327902 | 382 |
| 2053 | 3300031911 | Ga0307412_10000044 | Ga0307412_1000004412 | 382 |
| 2054 | 3300031911 | Ga0307412_10000086 | Ga0307412_1000008648 | 382 |
| 2055 | 3300031911 | Ga0307412_10000696 | Ga0307412_1000069612 | 382 |
| 2056 | 3300031911 | Ga0307412_10007745 | Ga0307412_100077452 | 382 |
| 2057 | 3300031911 | Ga0307412_10016846 | Ga0307412_100168463 | 382 |
| 2058 | 3300031911 | Ga0307412_10128074 | Ga0307412_101280742 | 382 |
| 2059 | 3300031967 | Ga0315914_1001085 | Ga0315914_100108514 | 382 |
| 2060 | 3300031995 | Ga0307409_100060590 | Ga0307409_1000605902 | 382 |
| 2061 | 3300032004 | Ga0307414_10002474 | Ga0307414_100024749 | 382 |
| 2062 | 3300032004 | Ga0307414_10135333 | Ga0307414_101353332 | 382 |
| 2063 | 3300033180 | Ga0307510_10013166 | Ga0307510_100131668 | 382 |
| 2064 | 3300033180 | Ga0307510_10022649 | Ga0307510_100226492 | 382 |
| 2065 | 3300033430 | Ga0315913_1000342 | Ga0315913_100034223 | 382 |
| 2066 | 3300033464 | Ga0315915_1000018 | Ga0315915_100001824 | 382 |
| 2067 | 3300035113 | Ga0373936_0014950 | Ga0373936_0014950_1644_2792 | 382 |
| 2068 | 3300035691 | Ga0373931_0035536 | Ga0373931_0035536_189_1337 | 382 |
| 2069 | 3300035692 | Ga0373935_0060242 | Ga0373935_0060242_458_1606 | 382 |
| 2070 | 3300036401 | Ga0373937_0035137 | Ga0373937_0035137_1391_2539 | 382 |
| 2071 | 3300036401 | Ga0373937_0064861 | Ga0373937_0064861_2104_3252 | 382 |
| 2072 | 3300036401 | Ga0373937_0236117 | Ga0373937_0236117_103_1251 | 382 |
| 2073 | 3300037312 | Ga0395899_0000031 | Ga0395899_0000031_31281_32480 | 382 |
| 2074 | 3300037312 | Ga0395899_0000226 | Ga0395899_0000226_57049_58197 | 382 |
| 2075 | 3300037312 | Ga0395899_0001543 | Ga0395899_0001543_16098_17246 | 382 |
| 2076 | 3300037312 | Ga0395899_0018763 | Ga0395899_0018763_2671_3819 | 382 |
| 2077 | 3300037312 | Ga0395899_0023189 | Ga0395899_0023189_1067_2215 | 382 |
| 2078 | 3300037312 | Ga0395899_0060569 | Ga0395899_0060569_306_1454 | 382 |
| 2079 | 3300037312 | Ga0395899_0074384 | Ga0395899_0074384_953_2101 | 382 |
| 2080 | 3300037312 | Ga0395899_0105892 | Ga0395899_0105892_692_1840 | 382 |
| 2081 | 3300037312 | Ga0395899_0115276 | Ga0395899_0115276_188_1336 | 382 |
| 2082 | 3300037418 | Ga0395900_0000011 | Ga0395900_0000011_406129_407277 | 382 |
| 2083 | 3300037418 | Ga0395900_0000776 | Ga0395900_0000776_26309_27508 | 382 |
| 2084 | 3300037418 | Ga0395900_0000980 | Ga0395900_0000980_23238_24479 | 382 |
| 2085 | 3300037418 | Ga0395900_0010941 | Ga0395900_0010941_2046_3194 | 382 |
| 2086 | 3300037418 | Ga0395900_0038598 | Ga0395900_0038598_637_1785 | 382 |
| 2087 | 3300037418 | Ga0395900_0124178 | Ga0395900_0124178_931_2079 | 382 |
| 2088 | 3300037466 | Ga0395898_0000029 | Ga0395898_0000029_158699_159847 | 382 |
| 2089 | 3300037466 | Ga0395898_0000040 | Ga0395898_0000040_26309_27508 | 382 |
| 2090 | 3300037466 | Ga0395898_0000202 | Ga0395898_0000202_27752_28900 | 382 |
| 2091 | 3300037466 | Ga0395898_0001962 | Ga0395898_0001962_2240_3481 | 382 |
| 2092 | 3300037466 | Ga0395898_0010632 | Ga0395898_0010632_4187_5335 | 382 |
| 2093 | 3300037466 | Ga0395898_0015160 | Ga0395898_0015160_4825_5973 | 382 |
| 2094 | 3300037466 | Ga0395898_0016122 | Ga0395898_0016122_1335_2573 | 382 |
| 2095 | 3300037466 | Ga0395898_0020527 | Ga0395898_0020527_3586_4833 | 382 |
| 2096 | 3300037466 | Ga0395898_0048473 | Ga0395898_0048473_2979_4127 | 382 |
| 2097 | 3300037471 | Ga0395905_0000014 | Ga0395905_0000014_47526_48674 | 382 |
| 2098 | 3300037471 | Ga0395905_0004763 | Ga0395905_0004763_12436_13584 | 382 |
| 2099 | 3300037471 | Ga0395905_0036820 | Ga0395905_0036820_27_1175 | 382 |
| 2100 | 3300038443 | Ga0395901_0000002 | Ga0395901_0000002_251749_252897 | 382 |
| 2101 | 3300038443 | Ga0395901_0000059 | Ga0395901_0000059_35002_36249 | 382 |
| 2102 | 3300038443 | Ga0395901_0000196 | Ga0395901_0000196_3228_4469 | 382 |
| 2103 | 3300038443 | Ga0395901_0001136 | Ga0395901_0001136_2581_3729 | 382 |
| 2104 | 3300038443 | Ga0395901_0051148 | Ga0395901_0051148_3002_4150 | 382 |
| 2105 | 3300038443 | Ga0395901_0080501 | Ga0395901_0080501_967_2115 | 382 |
| 2106 | 3300038443 | Ga0395901_0100401 | Ga0395901_0100401_544_1692 | 382 |
| 2107 | 3300038443 | Ga0395901_0144106 | Ga0395901_0144106_727_1875 | 382 |
| 2108 | 3300038443 | Ga0395901_0231549 | Ga0395901_0231549_593_1741 | 382 |
| 2109 | 3300038443 | Ga0395901_0312047 | Ga0395901_0312047_290_1438 | 382 |
| 2110 | 3300038443 | Ga0395901_0329189 | Ga0395901_0329189_142_1290 | 382 |
| 2111 | 3300038705 | Ga0237819_00624 | Ga0237819_00624_4880_6028 | 382 |
| 2112 | 3300038726 | Ga0400490_12115 | Ga0400490_12115_1359_2507 | 382 |
| 2113 | 3300038741 | Ga0400488_44097 | Ga0400488_44097_5245_6393 | 382 |
| 2114 | 3300039062 | Ga0400483_095196 | Ga0400483_095196_5017_6165 | 382 |
| 2115 | 3300039093 | Ga0400489_45052 | Ga0400489_45052_187_1335 | 382 |
| 2116 | 3300039437 | Ga0436365_0182246 | Ga0436365_0182246_12137_13285 | 382 |
| 2117 | 3300039447 | Ga0436361_0167540 | Ga0436361_0167540_3181_4329 | 382 |
| 2118 | 3300039447 | Ga0436361_0607146 | Ga0436361_0607146_3177_4325 | 382 |
| 2119 | 3300041404 | Ga0439436_0025860 | Ga0439436_0025860_539_1687 | 382 |
| 2120 | 3300041405 | Ga0439438_001542 | Ga0439438_001542_5041_6189 | 382 |
| 2121 | 3300041405 | Ga0439438_001831 | Ga0439438_001831_7835_8983 | 382 |
| 2122 | 3300041405 | Ga0439438_004000 | Ga0439438_004000_3992_5140 | 382 |
| 2123 | 3300041405 | Ga0439438_004655 | Ga0439438_004655_2987_4135 | 382 |
| 2124 | 3300041405 | Ga0439438_008994 | Ga0439438_008994_1456_2604 | 382 |
| 2125 | 3300041407 | Ga0439447_000377 | Ga0439447_000377_13371_14519 | 382 |
| 2126 | 3300041407 | Ga0439447_001015 | Ga0439447_001015_6902_8050 | 382 |
| 2127 | 3300041407 | Ga0439447_003199 | Ga0439447_003199_1168_2316 | 382 |
| 2128 | 3300041411 | Ga0439466_0000387 | Ga0439466_0000387_3684_4832 | 382 |
| 2129 | 3300041411 | Ga0439466_0003126 | Ga0439466_0003126_4763_5911 | 382 |
| 2130 | 3300041411 | Ga0439466_0007551 | Ga0439466_0007551_1360_2508 | 382 |
| 2131 | 3300041452 | Ga0451793_1027815 | Ga0451793_1027815_4678_5826 | 382 |
| 2132 | 3300041458 | Ga0451798_0992722 | Ga0451798_0992722_243_1391 | 382 |
| 2133 | 3300041507 | Ga0451851_0205038 | Ga0451851_0205038_457_1605 | 382 |
| 2134 | 3300042005 | Ga0439448_0000023 | Ga0439448_0000023_16670_17818 | 382 |
| 2135 | 3300042006 | Ga0439432_000066 | Ga0439432_000066_18626_19774 | 382 |
| 2136 | 3300042006 | Ga0439432_003340 | Ga0439432_003340_54_1202 | 382 |
| 2137 | 3300042006 | Ga0439432_010182 | Ga0439432_010182_1456_2604 | 382 |
| 2138 | 3300042009 | Ga0439451_004420 | Ga0439451_004420_504_1652 | 382 |
| 2139 | 3300042010 | Ga0439452_000281 | Ga0439452_000281_6922_8070 | 382 |
| 2140 | 3300042010 | Ga0439452_000485 | Ga0439452_000485_2962_4110 | 382 |
| 2141 | 3300042010 | Ga0439452_000562 | Ga0439452_000562_13267_14415 | 382 |
| 2142 | 3300042010 | Ga0439452_007303 | Ga0439452_007303_92_1240 | 382 |
| 2143 | 3300042010 | Ga0439452_014090 | Ga0439452_014090_801_1949 | 382 |
| 2144 | 3300042013 | Ga0439456_003411 | Ga0439456_003411_723_1871 | 382 |
| 2145 | 3300042013 | Ga0439456_004142 | Ga0439456_004142_65_1213 | 382 |
| 2146 | 3300042013 | Ga0439456_009259 | Ga0439456_009259_322_1470 | 382 |
| 2147 | 3300042016 | Ga0439463_000226 | Ga0439463_000226_9245_10393 | 382 |
| 2148 | 3300042115 | Ga0450911_000382 | Ga0450911_000382_5872_7020 | 382 |
| 2149 | 3300042127 | Ga0450890_000729 | Ga0450890_000729_36_1184 | 382 |
| 2150 | 3300042137 | Ga0450902_004202 | Ga0450902_004202_154_1302 | 382 |
| 2151 | 3300042145 | Ga0450906_000246 | Ga0450906_000246_1100_2248 | 382 |
| 2152 | 3300042145 | Ga0450906_007766 | Ga0450906_007766_149_1297 | 382 |
| 2153 | 3300042146 | Ga0450907_000139 | Ga0450907_000139_6986_8134 | 382 |
| 2154 | 3300042146 | Ga0450907_000683 | Ga0450907_000683_851_1999 | 382 |
| 2155 | 3300042147 | Ga0450910_001033 | Ga0450910_001033_1973_3121 | 382 |
| 2156 | 3300042156 | Ga0439446_0009091 | Ga0439446_0009091_994_2142 | 382 |
| 2157 | 3300042184 | Ga0450908_010027 | Ga0450908_010027_285_1433 | 382 |
| 2158 | 3300042435 | Ga0439434_0000870 | Ga0439434_0000870_6410_7558 | 382 |
| 2159 | 3300042438 | Ga0439459_0001008 | Ga0439459_0001008_501_1649 | 382 |
| 2160 | 3300044536 | Ga0466988_0054010 | Ga0466988_0054010_222_1370 | 382 |
| 2161 | 3300044656 | Ga0466969_0001020 | Ga0466969_0001020_1373_2521 | 382 |
| 2162 | 3300044656 | Ga0466969_0006226 | Ga0466969_0006226_3749_4897 | 382 |
| 2163 | 3300044656 | Ga0466969_0009536 | Ga0466969_0009536_3227_4375 | 382 |
| 2164 | 3300044656 | Ga0466969_0011611 | Ga0466969_0011611_835_1983 | 382 |
| 2165 | 3300044658 | Ga0466972_0004632 | Ga0466972_0004632_2266_3414 | 382 |
| 2166 | 3300044683 | Ga0466965_0004789 | Ga0466965_0004789_778_1926 | 382 |
| 2167 | 3300044683 | Ga0466965_0045424 | Ga0466965_0045424_541_1689 | 382 |
| 2168 | 3300044683 | Ga0466965_0059186 | Ga0466965_0059186_734_1882 | 382 |
| 2169 | 3300044684 | Ga0466966_0000296 | Ga0466966_0000296_2249_3439 | 382 |
| 2170 | 3300044684 | Ga0466966_0010340 | Ga0466966_0010340_2884_4032 | 382 |
| 2171 | 3300044684 | Ga0466966_0027307 | Ga0466966_0027307_842_1990 | 382 |
| 2172 | 3300044684 | Ga0466966_0028286 | Ga0466966_0028286_2418_3566 | 382 |
| 2173 | 3300044684 | Ga0466966_0053662 | Ga0466966_0053662_148_1296 | 382 |
| 2174 | 3300044693 | Ga0466961_0000272 | Ga0466961_0000272_6204_7352 | 382 |
| 2175 | 3300044693 | Ga0466961_0000689 | Ga0466961_0000689_10257_11405 | 382 |
| 2176 | 3300044693 | Ga0466961_0000696 | Ga0466961_0000696_14397_15587 | 382 |
| 2177 | 3300044693 | Ga0466961_0023239 | Ga0466961_0023239_1511_2659 | 382 |
| 2178 | 3300044693 | Ga0466961_0035401 | Ga0466961_0035401_1800_2948 | 382 |
| 2179 | 3300044693 | Ga0466961_0093036 | Ga0466961_0093036_738_1886 | 382 |
| 2180 | 3300044693 | Ga0466961_0126356 | Ga0466961_0126356_170_1318 | 382 |
| 2181 | 3300044693 | Ga0466961_0177226 | Ga0466961_0177226_47_1195 | 382 |
| 2182 | 3300044694 | Ga0466963_0000764 | Ga0466963_0000764_7812_9002 | 382 |
| 2183 | 3300044694 | Ga0466963_0003166 | Ga0466963_0003166_2949_4097 | 382 |
| 2184 | 3300044694 | Ga0466963_0005273 | Ga0466963_0005273_6176_7324 | 382 |
| 2185 | 3300044719 | Ga0466971_0002420 | Ga0466971_0002420_3809_4957 | 382 |
| 2186 | 3300044719 | Ga0466971_0025461 | Ga0466971_0025461_281_1429 | 382 |
| 2187 | 3300044719 | Ga0466971_0040501 | Ga0466971_0040501_413_1561 | 382 |
| 2188 | 3300044765 | Ga0466970_0000201 | Ga0466970_0000201_4591_5739 | 382 |
| 2189 | 3300044765 | Ga0466970_0003084 | Ga0466970_0003084_2220_3368 | 382 |
| 2190 | 3300044765 | Ga0466970_0035691 | Ga0466970_0035691_91_1239 | 382 |
| 2191 | 3300044842 | Ga0466957_0004013 | Ga0466957_0004013_3914_5062 | 382 |
| 2192 | 3300044842 | Ga0466957_0008763 | Ga0466957_0008763_3419_4567 | 382 |
| 2193 | 3300044901 | Ga0466960_0000049 | Ga0466960_0000049_21171_22319 | 382 |
| 2194 | 3300045049 | Ga0466959_0000006 | Ga0466959_0000006_133851_134999 | 382 |
| 2195 | 3300045049 | Ga0466959_0000958 | Ga0466959_0000958_7372_8520 | 382 |
| 2196 | 3300045049 | Ga0466959_0008194 | Ga0466959_0008194_2644_3792 | 382 |
| 2197 | 3300045049 | Ga0466959_0012533 | Ga0466959_0012533_1261_2409 | 382 |
| 2198 | 3300045049 | Ga0466959_0015829 | Ga0466959_0015829_3774_4922 | 382 |
| 2199 | 3300045049 | Ga0466959_0106109 | Ga0466959_0106109_670_1860 | 382 |
| 2200 | 3300045049 | Ga0466959_0110959 | Ga0466959_0110959_599_1747 | 382 |
| 2201 | 3300045836 | Ga0466958_0001554 | Ga0466958_0001554_7104_8252 | 382 |
| 2202 | 3300045836 | Ga0466958_0026070 | Ga0466958_0026070_1238_2386 | 382 |
| 2203 | 3300045836 | Ga0466958_0035630 | Ga0466958_0035630_1793_2941 | 382 |
| 2204 | 3300045836 | Ga0466958_0038094 | Ga0466958_0038094_1306_2454 | 382 |
| 2205 | 3300046452 | Ga0495617_000225 | Ga0495617_000225_27324_28472 | 382 |
| 2206 | 3300046452 | Ga0495617_006032 | Ga0495617_006032_515_1663 | 382 |
| 2207 | 3300046452 | Ga0495617_011018 | Ga0495617_011018_663_1811 | 382 |
| 2208 | 3300046453 | Ga0495627_000083 | Ga0495627_000083_89786_90934 | 382 |
| 2209 | 3300046453 | Ga0495627_000451 | Ga0495627_000451_28727_29875 | 382 |
| 2210 | 3300046453 | Ga0495627_003061 | Ga0495627_003061_327_1475 | 382 |
| 2211 | 3300046453 | Ga0495627_003650 | Ga0495627_003650_3466_4614 | 382 |
| 2212 | 3300046453 | Ga0495627_010833 | Ga0495627_010833_1162_2310 | 382 |
| 2213 | 3300046454 | Ga0495592_0016556 | Ga0495592_0016556_4348_5496 | 382 |
| 2214 | 3300046454 | Ga0495592_0044971 | Ga0495592_0044971_773_1921 | 382 |
| 2215 | 3300046455 | Ga0495603_0000802 | Ga0495603_0000802_15173_16321 | 382 |
| 2216 | 3300046455 | Ga0495603_0016077 | Ga0495603_0016077_264_1412 | 382 |
| 2217 | 3300046455 | Ga0495603_0016648 | Ga0495603_0016648_2632_3780 | 382 |
| 2218 | 3300046457 | Ga0495590_0001173 | Ga0495590_0001173_7998_9146 | 382 |
| 2219 | 3300046457 | Ga0495590_0001387 | Ga0495590_0001387_7607_8755 | 382 |
| 2220 | 3300046457 | Ga0495590_0002501 | Ga0495590_0002501_4985_6133 | 382 |
| 2221 | 3300046457 | Ga0495590_0005783 | Ga0495590_0005783_3486_4634 | 382 |
| 2222 | 3300046458 | Ga0495591_000037 | Ga0495591_000037_26106_27254 | 382 |
| 2223 | 3300046458 | Ga0495591_000648 | Ga0495591_000648_5389_6537 | 382 |
| 2224 | 3300046458 | Ga0495591_000960 | Ga0495591_000960_15369_16517 | 382 |
| 2225 | 3300046458 | Ga0495591_001346 | Ga0495591_001346_3251_4399 | 382 |
| 2226 | 3300046458 | Ga0495591_001506 | Ga0495591_001506_7082_8230 | 382 |
| 2227 | 3300046458 | Ga0495591_001756 | Ga0495591_001756_1630_2778 | 382 |
| 2228 | 3300046458 | Ga0495591_002170 | Ga0495591_002170_5524_6672 | 382 |
| 2229 | 3300046458 | Ga0495591_016885 | Ga0495591_016885_833_1981 | 382 |
| 2230 | 3300046459 | Ga0495629_0000105 | Ga0495629_0000105_1478_2626 | 382 |
| 2231 | 3300046459 | Ga0495629_0000175 | Ga0495629_0000175_50267_51415 | 382 |
| 2232 | 3300046459 | Ga0495629_0002935 | Ga0495629_0002935_2806_3954 | 382 |
| 2233 | 3300046459 | Ga0495629_0017828 | Ga0495629_0017828_2595_3743 | 382 |
| 2234 | 3300046459 | Ga0495629_0021123 | Ga0495629_0021123_1930_3078 | 382 |
| 2235 | 3300046460 | Ga0495638_0000060 | Ga0495638_0000060_156437_157585 | 382 |
| 2236 | 3300046460 | Ga0495638_0000116 | Ga0495638_0000116_98178_99326 | 382 |
| 2237 | 3300046460 | Ga0495638_0000609 | Ga0495638_0000609_30510_31658 | 382 |
| 2238 | 3300046460 | Ga0495638_0004826 | Ga0495638_0004826_3931_5079 | 382 |
| 2239 | 3300046460 | Ga0495638_0005276 | Ga0495638_0005276_2961_4109 | 382 |
| 2240 | 3300046460 | Ga0495638_0006182 | Ga0495638_0006182_4598_5746 | 382 |
| 2241 | 3300046460 | Ga0495638_0006926 | Ga0495638_0006926_575_1723 | 382 |
| 2242 | 3300046460 | Ga0495638_0053292 | Ga0495638_0053292_764_1912 | 382 |
| 2243 | 3300046462 | Ga0495651_0001526 | Ga0495651_0001526_10063_11211 | 382 |
| 2244 | 3300046462 | Ga0495651_0020487 | Ga0495651_0020487_1534_2682 | 382 |
| 2245 | 3300046462 | Ga0495651_0034950 | Ga0495651_0034950_1274_2422 | 382 |
| 2246 | 3300046463 | Ga0495653_0010928 | Ga0495653_0010928_2535_3683 | 382 |
| 2247 | 3300046463 | Ga0495653_0020160 | Ga0495653_0020160_2912_4060 | 382 |
| 2248 | 3300046463 | Ga0495653_0023003 | Ga0495653_0023003_1748_2896 | 382 |
| 2249 | 3300046463 | Ga0495653_0040343 | Ga0495653_0040343_1511_2659 | 382 |
| 2250 | 3300046463 | Ga0495653_0054893 | Ga0495653_0054893_727_1875 | 382 |
| 2251 | 3300046463 | Ga0495653_0106040 | Ga0495653_0106040_517_1665 | 382 |
| 2252 | 3300046463 | Ga0495653_0209202 | Ga0495653_0209202_145_1293 | 382 |
| 2253 | 3300046471 | Ga0495650_0000064 | Ga0495650_0000064_32715_33863 | 382 |
| 2254 | 3300046471 | Ga0495650_0000075 | Ga0495650_0000075_93386_94534 | 382 |
| 2255 | 3300046471 | Ga0495650_0001163 | Ga0495650_0001163_14566_15714 | 382 |
| 2256 | 3300046471 | Ga0495650_0005547 | Ga0495650_0005547_3087_4235 | 382 |
| 2257 | 3300046471 | Ga0495650_0005976 | Ga0495650_0005976_2883_4031 | 382 |
| 2258 | 3300046471 | Ga0495650_0006437 | Ga0495650_0006437_1555_2703 | 382 |
| 2259 | 3300046471 | Ga0495650_0010142 | Ga0495650_0010142_1812_2960 | 382 |
| 2260 | 3300046471 | Ga0495650_0010597 | Ga0495650_0010597_3817_4965 | 382 |
| 2261 | 3300046472 | Ga0495580_0000125 | Ga0495580_0000125_3738_4886 | 382 |
| 2262 | 3300046472 | Ga0495580_0014113 | Ga0495580_0014113_1067_2215 | 382 |
| 2263 | 3300046472 | Ga0495580_0058472 | Ga0495580_0058472_1047_2303 | 382 |
| 2264 | 3300046473 | Ga0495582_0003710 | Ga0495582_0003710_1062_2210 | 382 |
| 2265 | 3300046473 | Ga0495582_0007857 | Ga0495582_0007857_2581_3729 | 382 |
| 2266 | 3300046473 | Ga0495582_0051955 | Ga0495582_0051955_989_2137 | 382 |
| 2267 | 3300046474 | Ga0495605_0000036 | Ga0495605_0000036_6984_8132 | 382 |
| 2268 | 3300046474 | Ga0495605_0000745 | Ga0495605_0000745_9858_11006 | 382 |
| 2269 | 3300046474 | Ga0495605_0000849 | Ga0495605_0000849_14327_15475 | 382 |
| 2270 | 3300046474 | Ga0495605_0001253 | Ga0495605_0001253_11271_12419 | 382 |
| 2271 | 3300046474 | Ga0495605_0001795 | Ga0495605_0001795_11999_13147 | 382 |
| 2272 | 3300046474 | Ga0495605_0002427 | Ga0495605_0002427_7794_8942 | 382 |
| 2273 | 3300046474 | Ga0495605_0009484 | Ga0495605_0009484_3261_4409 | 382 |
| 2274 | 3300046474 | Ga0495605_0013476 | Ga0495605_0013476_1735_2883 | 382 |
| 2275 | 3300046474 | Ga0495605_0013595 | Ga0495605_0013595_397_1545 | 382 |
| 2276 | 3300046474 | Ga0495605_0019669 | Ga0495605_0019669_1615_2763 | 382 |
| 2277 | 3300046474 | Ga0495605_0020667 | Ga0495605_0020667_1682_2830 | 382 |
| 2278 | 3300046475 | Ga0495639_0000158 | Ga0495639_0000158_28779_29927 | 382 |
| 2279 | 3300046476 | Ga0495662_0003246 | Ga0495662_0003246_6894_8042 | 382 |
| 2280 | 3300046477 | Ga0495664_0006406 | Ga0495664_0006406_1471_2619 | 382 |
| 2281 | 3300046477 | Ga0495664_0081859 | Ga0495664_0081859_432_1580 | 382 |
| 2282 | 3300046477 | Ga0495664_0107807 | Ga0495664_0107807_518_1666 | 382 |
| 2283 | 3300046491 | Ga0495584_0019260 | Ga0495584_0019260_728_1876 | 382 |
| 2284 | 3300046491 | Ga0495584_0108722 | Ga0495584_0108722_157_1305 | 382 |
| 2285 | 3300046491 | Ga0495584_0141953 | Ga0495584_0141953_56_1204 | 382 |
| 2286 | 3300046492 | Ga0495585_0002523 | Ga0495585_0002523_6792_7940 | 382 |
| 2287 | 3300046492 | Ga0495585_0013417 | Ga0495585_0013417_3247_4395 | 382 |
| 2288 | 3300046492 | Ga0495585_0035355 | Ga0495585_0035355_1178_2326 | 382 |
| 2289 | 3300046492 | Ga0495585_0037360 | Ga0495585_0037360_660_1808 | 382 |
| 2290 | 3300046499 | Ga0495594_0001462 | Ga0495594_0001462_10363_11511 | 382 |
| 2291 | 3300046499 | Ga0495594_0001898 | Ga0495594_0001898_2756_3904 | 382 |
| 2292 | 3300046499 | Ga0495594_0002321 | Ga0495594_0002321_1192_2340 | 382 |
| 2293 | 3300046499 | Ga0495594_0005955 | Ga0495594_0005955_4960_6108 | 382 |
| 2294 | 3300046500 | Ga0495596_0000488 | Ga0495596_0000488_5213_6361 | 382 |
| 2295 | 3300046500 | Ga0495596_0003157 | Ga0495596_0003157_5701_6849 | 382 |
| 2296 | 3300046500 | Ga0495596_0022504 | Ga0495596_0022504_357_1505 | 382 |
| 2297 | 3300046501 | Ga0495607_0000860 | Ga0495607_0000860_20361_21509 | 382 |
| 2298 | 3300046501 | Ga0495607_0001076 | Ga0495607_0001076_12943_14091 | 382 |
| 2299 | 3300046501 | Ga0495607_0001283 | Ga0495607_0001283_14239_15387 | 382 |
| 2300 | 3300046501 | Ga0495607_0001388 | Ga0495607_0001388_4997_6145 | 382 |
| 2301 | 3300046501 | Ga0495607_0001475 | Ga0495607_0001475_17389_18537 | 382 |
| 2302 | 3300046501 | Ga0495607_0004512 | Ga0495607_0004512_208_1356 | 382 |
| 2303 | 3300046501 | Ga0495607_0009221 | Ga0495607_0009221_5106_6254 | 382 |
| 2304 | 3300046501 | Ga0495607_0021322 | Ga0495607_0021322_2284_3432 | 382 |
| 2305 | 3300046501 | Ga0495607_0027774 | Ga0495607_0027774_2169_3317 | 382 |
| 2306 | 3300046501 | Ga0495607_0038072 | Ga0495607_0038072_785_1933 | 382 |
| 2307 | 3300046501 | Ga0495607_0059014 | Ga0495607_0059014_373_1521 | 382 |
| 2308 | 3300046506 | Ga0495583_0000028 | Ga0495583_0000028_20232_21380 | 382 |
| 2309 | 3300046506 | Ga0495583_0001522 | Ga0495583_0001522_17227_18375 | 382 |
| 2310 | 3300046506 | Ga0495583_0001875 | Ga0495583_0001875_18278_19426 | 382 |
| 2311 | 3300046506 | Ga0495583_0003346 | Ga0495583_0003346_2878_4026 | 382 |
| 2312 | 3300046506 | Ga0495583_0003399 | Ga0495583_0003399_3799_4947 | 382 |
| 2313 | 3300046506 | Ga0495583_0005967 | Ga0495583_0005967_3309_4457 | 382 |
| 2314 | 3300046506 | Ga0495583_0007570 | Ga0495583_0007570_5590_6738 | 382 |
| 2315 | 3300046506 | Ga0495583_0014990 | Ga0495583_0014990_1661_2917 | 382 |
| 2316 | 3300046506 | Ga0495583_0021529 | Ga0495583_0021529_1897_3045 | 382 |
| 2317 | 3300046507 | Ga0495606_0000042 | Ga0495606_0000042_209757_210905 | 382 |
| 2318 | 3300046507 | Ga0495606_0000094 | Ga0495606_0000094_122835_123983 | 382 |
| 2319 | 3300046507 | Ga0495606_0000415 | Ga0495606_0000415_6750_7898 | 382 |
| 2320 | 3300046507 | Ga0495606_0004342 | Ga0495606_0004342_5467_6615 | 382 |
| 2321 | 3300046507 | Ga0495606_0010458 | Ga0495606_0010458_1838_2986 | 382 |
| 2322 | 3300046507 | Ga0495606_0017134 | Ga0495606_0017134_2643_3791 | 382 |
| 2323 | 3300046507 | Ga0495606_0024275 | Ga0495606_0024275_1667_2815 | 382 |
| 2324 | 3300046507 | Ga0495606_0031645 | Ga0495606_0031645_1801_2949 | 382 |
| 2325 | 3300046507 | Ga0495606_0047270 | Ga0495606_0047270_1522_2670 | 382 |
| 2326 | 3300046507 | Ga0495606_0052374 | Ga0495606_0052374_908_2056 | 382 |
| 2327 | 3300046507 | Ga0495606_0092027 | Ga0495606_0092027_146_1294 | 382 |
| 2328 | 3300046507 | Ga0495606_0101378 | Ga0495606_0101378_72_1220 | 382 |
| 2329 | 3300046507 | Ga0495606_0121684 | Ga0495606_0121684_349_1497 | 382 |
| 2330 | 3300046511 | Ga0495608_0002301 | Ga0495608_0002301_11942_13090 | 382 |
| 2331 | 3300046511 | Ga0495608_0049734 | Ga0495608_0049734_1310_2458 | 382 |
| 2332 | 3300046511 | Ga0495608_0128929 | Ga0495608_0128929_165_1313 | 382 |
| 2333 | 3300046512 | Ga0495610_0001773 | Ga0495610_0001773_12476_13624 | 382 |
| 2334 | 3300046512 | Ga0495610_0002926 | Ga0495610_0002926_12294_13442 | 382 |
| 2335 | 3300046512 | Ga0495610_0006406 | Ga0495610_0006406_5426_6574 | 382 |
| 2336 | 3300046512 | Ga0495610_0007142 | Ga0495610_0007142_4591_5739 | 382 |
| 2337 | 3300046512 | Ga0495610_0009768 | Ga0495610_0009768_2210_3358 | 382 |
| 2338 | 3300046512 | Ga0495610_0011761 | Ga0495610_0011761_816_1964 | 382 |
| 2339 | 3300046512 | Ga0495610_0021121 | Ga0495610_0021121_1521_2669 | 382 |
| 2340 | 3300046512 | Ga0495610_0026266 | Ga0495610_0026266_195_1343 | 382 |
| 2341 | 3300046513 | Ga0495616_0001328 | Ga0495616_0001328_10542_11690 | 382 |
| 2342 | 3300046513 | Ga0495616_0003641 | Ga0495616_0003641_3425_4573 | 382 |
| 2343 | 3300046513 | Ga0495616_0024526 | Ga0495616_0024526_1115_2371 | 382 |
| 2344 | 3300046514 | Ga0495618_0005830 | Ga0495618_0005830_4476_5624 | 382 |
| 2345 | 3300046514 | Ga0495618_0006411 | Ga0495618_0006411_3975_5123 | 382 |
| 2346 | 3300046515 | Ga0495620_0000322 | Ga0495620_0000322_7372_8520 | 382 |
| 2347 | 3300046515 | Ga0495620_0000370 | Ga0495620_0000370_23697_24845 | 382 |
| 2348 | 3300046515 | Ga0495620_0000712 | Ga0495620_0000712_15248_16396 | 382 |
| 2349 | 3300046515 | Ga0495620_0004434 | Ga0495620_0004434_1743_2891 | 382 |
| 2350 | 3300046515 | Ga0495620_0006667 | Ga0495620_0006667_3589_4737 | 382 |
| 2351 | 3300046515 | Ga0495620_0012891 | Ga0495620_0012891_2075_3223 | 382 |
| 2352 | 3300046515 | Ga0495620_0028687 | Ga0495620_0028687_76_1224 | 382 |
| 2353 | 3300046515 | Ga0495620_0039355 | Ga0495620_0039355_891_2039 | 382 |
| 2354 | 3300046515 | Ga0495620_0039358 | Ga0495620_0039358_478_1626 | 382 |
| 2355 | 3300046516 | Ga0495628_0010471 | Ga0495628_0010471_1453_2601 | 382 |
| 2356 | 3300046516 | Ga0495628_0019455 | Ga0495628_0019455_1636_2784 | 382 |
| 2357 | 3300046516 | Ga0495628_0023111 | Ga0495628_0023111_3873_5021 | 382 |
| 2358 | 3300046516 | Ga0495628_0053416 | Ga0495628_0053416_149_1297 | 382 |
| 2359 | 3300046517 | Ga0495630_0007696 | Ga0495630_0007696_3776_4924 | 382 |
| 2360 | 3300046517 | Ga0495630_0120160 | Ga0495630_0120160_244_1392 | 382 |
| 2361 | 3300046517 | Ga0495630_0218900 | Ga0495630_0218900_226_1374 | 382 |
| 2362 | 3300046518 | Ga0495631_0001689 | Ga0495631_0001689_1136_2284 | 382 |
| 2363 | 3300046518 | Ga0495631_0005206 | Ga0495631_0005206_5026_6174 | 382 |
| 2364 | 3300046519 | Ga0495632_0000360 | Ga0495632_0000360_40431_41579 | 382 |
| 2365 | 3300046519 | Ga0495632_0000839 | Ga0495632_0000839_20655_21803 | 382 |
| 2366 | 3300046519 | Ga0495632_0007029 | Ga0495632_0007029_3568_4716 | 382 |
| 2367 | 3300046519 | Ga0495632_0017470 | Ga0495632_0017470_2190_3338 | 382 |
| 2368 | 3300046519 | Ga0495632_0021778 | Ga0495632_0021778_1187_2335 | 382 |
| 2369 | 3300046519 | Ga0495632_0027352 | Ga0495632_0027352_267_1415 | 382 |
| 2370 | 3300046519 | Ga0495632_0081507 | Ga0495632_0081507_120_1268 | 382 |
| 2371 | 3300046519 | Ga0495632_0089107 | Ga0495632_0089107_243_1391 | 382 |
| 2372 | 3300046520 | Ga0495637_0000491 | Ga0495637_0000491_22672_23820 | 382 |
| 2373 | 3300046520 | Ga0495637_0000518 | Ga0495637_0000518_6521_7669 | 382 |
| 2374 | 3300046520 | Ga0495637_0001199 | Ga0495637_0001199_9400_10548 | 382 |
| 2375 | 3300046520 | Ga0495637_0002120 | Ga0495637_0002120_4577_5725 | 382 |
| 2376 | 3300046520 | Ga0495637_0002498 | Ga0495637_0002498_1821_2969 | 382 |
| 2377 | 3300046520 | Ga0495637_0006632 | Ga0495637_0006632_1143_2291 | 382 |
| 2378 | 3300046520 | Ga0495637_0020789 | Ga0495637_0020789_542_1690 | 382 |
| 2379 | 3300046520 | Ga0495637_0038833 | Ga0495637_0038833_773_1921 | 382 |
| 2380 | 3300046522 | Ga0495643_0000086 | Ga0495643_0000086_99422_100570 | 382 |
| 2381 | 3300046522 | Ga0495643_0001985 | Ga0495643_0001985_7314_8462 | 382 |
| 2382 | 3300046522 | Ga0495643_0004073 | Ga0495643_0004073_7420_8568 | 382 |
| 2383 | 3300046522 | Ga0495643_0035642 | Ga0495643_0035642_1550_2698 | 382 |
| 2384 | 3300046522 | Ga0495643_0070422 | Ga0495643_0070422_58_1206 | 382 |
| 2385 | 3300046523 | Ga0495644_0000023 | Ga0495644_0000023_39996_41144 | 382 |
| 2386 | 3300046523 | Ga0495644_0003319 | Ga0495644_0003319_5069_6217 | 382 |
| 2387 | 3300046523 | Ga0495644_0022555 | Ga0495644_0022555_1094_2242 | 382 |
| 2388 | 3300046524 | Ga0495648_0009523 | Ga0495648_0009523_4999_6147 | 382 |
| 2389 | 3300046524 | Ga0495648_0017985 | Ga0495648_0017985_1446_2594 | 382 |
| 2390 | 3300046524 | Ga0495648_0024067 | Ga0495648_0024067_2683_3831 | 382 |
| 2391 | 3300046524 | Ga0495648_0131871 | Ga0495648_0131871_21_1169 | 382 |
| 2392 | 3300046526 | Ga0495666_0001050 | Ga0495666_0001050_11036_12184 | 382 |
| 2393 | 3300046526 | Ga0495666_0004226 | Ga0495666_0004226_3715_4863 | 382 |
| 2394 | 3300046526 | Ga0495666_0012026 | Ga0495666_0012026_2102_3250 | 382 |
| 2395 | 3300046526 | Ga0495666_0015904 | Ga0495666_0015904_1542_2690 | 382 |
| 2396 | 3300046526 | Ga0495666_0016571 | Ga0495666_0016571_1930_3078 | 382 |
| 2397 | 3300046526 | Ga0495666_0104325 | Ga0495666_0104325_97_1245 | 382 |
| 2398 | 3300046528 | Ga0495642_0001013 | Ga0495642_0001013_5041_6189 | 382 |
| 2399 | 3300046528 | Ga0495642_0001683 | Ga0495642_0001683_1605_2753 | 382 |
| 2400 | 3300046529 | Ga0495652_0001674 | Ga0495652_0001674_2218_3366 | 382 |
| 2401 | 3300046529 | Ga0495652_0003383 | Ga0495652_0003383_8463_9611 | 382 |
| 2402 | 3300046529 | Ga0495652_0017996 | Ga0495652_0017996_4639_5787 | 382 |
| 2403 | 3300046529 | Ga0495652_0042949 | Ga0495652_0042949_1671_2819 | 382 |
| 2404 | 3300046529 | Ga0495652_0104061 | Ga0495652_0104061_990_2138 | 382 |
| 2405 | 3300046530 | Ga0495654_0001499 | Ga0495654_0001499_9981_11129 | 382 |
| 2406 | 3300046530 | Ga0495654_0004083 | Ga0495654_0004083_3807_4955 | 382 |
| 2407 | 3300046530 | Ga0495654_0007063 | Ga0495654_0007063_1248_2396 | 382 |
| 2408 | 3300046530 | Ga0495654_0009795 | Ga0495654_0009795_816_1964 | 382 |
| 2409 | 3300046530 | Ga0495654_0010614 | Ga0495654_0010614_3837_4985 | 382 |
| 2410 | 3300046530 | Ga0495654_0018508 | Ga0495654_0018508_571_1719 | 382 |
| 2411 | 3300046530 | Ga0495654_0023907 | Ga0495654_0023907_1603_2751 | 382 |
| 2412 | 3300046530 | Ga0495654_0057801 | Ga0495654_0057801_114_1262 | 382 |
| 2413 | 3300046531 | Ga0495665_0000875 | Ga0495665_0000875_12374_13522 | 382 |
| 2414 | 3300046531 | Ga0495665_0007079 | Ga0495665_0007079_3186_4334 | 382 |
| 2415 | 3300046531 | Ga0495665_0015355 | Ga0495665_0015355_2308_3456 | 382 |
| 2416 | 3300046533 | Ga0495640_0034402 | Ga0495640_0034402_371_1519 | 382 |
| 2417 | 3300046533 | Ga0495640_0123908 | Ga0495640_0123908_11_1159 | 382 |
| 2418 | 3300046535 | Ga0495586_0000896 | Ga0495586_0000896_2998_4146 | 382 |
| 2419 | 3300046536 | Ga0495587_0004691 | Ga0495587_0004691_5051_6199 | 382 |
| 2420 | 3300046536 | Ga0495587_0014198 | Ga0495587_0014198_76_1224 | 382 |
| 2421 | 3300046536 | Ga0495587_0072568 | Ga0495587_0072568_593_1741 | 382 |
| 2422 | 3300046538 | Ga0495609_0000115 | Ga0495609_0000115_6984_8132 | 382 |
| 2423 | 3300046538 | Ga0495609_0000248 | Ga0495609_0000248_27947_29095 | 382 |
| 2424 | 3300046538 | Ga0495609_0000395 | Ga0495609_0000395_19598_20746 | 382 |
| 2425 | 3300046538 | Ga0495609_0088505 | Ga0495609_0088505_77_1282 | 382 |
| 2426 | 3300046539 | Ga0495621_0026915 | Ga0495621_0026915_57_1205 | 382 |
| 2427 | 3300046542 | Ga0495597_0001034 | Ga0495597_0001034_16561_17709 | 382 |
| 2428 | 3300046542 | Ga0495597_0002749 | Ga0495597_0002749_2129_3277 | 382 |
| 2429 | 3300046542 | Ga0495597_0003571 | Ga0495597_0003571_32_1180 | 382 |
| 2430 | 3300046543 | Ga0495645_0002052 | Ga0495645_0002052_11197_12345 | 382 |
| 2431 | 3300046543 | Ga0495645_0002469 | Ga0495645_0002469_1565_2713 | 382 |
| 2432 | 3300046543 | Ga0495645_0015033 | Ga0495645_0015033_3101_4249 | 382 |
| 2433 | 3300046543 | Ga0495645_0041759 | Ga0495645_0041759_1588_2736 | 382 |
| 2434 | 3300046543 | Ga0495645_0096052 | Ga0495645_0096052_32_1180 | 382 |
| 2435 | 3300046557 | Ga0495622_0000575 | Ga0495622_0000575_20102_21250 | 382 |
| 2436 | 3300046557 | Ga0495622_0001521 | Ga0495622_0001521_1345_2493 | 382 |
| 2437 | 3300046557 | Ga0495622_0003706 | Ga0495622_0003706_4861_6009 | 382 |
| 2438 | 3300046557 | Ga0495622_0015667 | Ga0495622_0015667_15_1163 | 382 |
| 2439 | 3300046558 | Ga0495633_0001190 | Ga0495633_0001190_16775_17923 | 382 |
| 2440 | 3300046558 | Ga0495633_0001693 | Ga0495633_0001693_7549_8697 | 382 |
| 2441 | 3300046558 | Ga0495633_0008768 | Ga0495633_0008768_1450_2598 | 382 |
| 2442 | 3300046616 | Ga0495668_0018071 | Ga0495668_0018071_2592_3740 | 382 |
| 2443 | 3300046616 | Ga0495668_0063825 | Ga0495668_0063825_415_1563 | 382 |
| 2444 | 3300046642 | Ga0495634_0005493 | Ga0495634_0005493_7125_8273 | 382 |
| 2445 | 3300046642 | Ga0495634_0019337 | Ga0495634_0019337_1603_2751 | 382 |
| 2446 | 3300046642 | Ga0495634_0042765 | Ga0495634_0042765_935_2083 | 382 |
| 2447 | 3300046648 | Ga0495611_0000736 | Ga0495611_0000736_14533_15681 | 382 |
| 2448 | 3300046648 | Ga0495611_0000932 | Ga0495611_0000932_5283_6431 | 382 |
| 2449 | 3300046648 | Ga0495611_0004344 | Ga0495611_0004344_727_1875 | 382 |
| 2450 | 3300046648 | Ga0495611_0047326 | Ga0495611_0047326_124_1272 | 382 |
| 2451 | 3300046660 | Ga0495625_0000672 | Ga0495625_0000672_26780_27928 | 382 |
| 2452 | 3300046660 | Ga0495625_0001298 | Ga0495625_0001298_15538_16686 | 382 |
| 2453 | 3300046660 | Ga0495625_0003330 | Ga0495625_0003330_8127_9275 | 382 |
| 2454 | 3300046660 | Ga0495625_0007862 | Ga0495625_0007862_5609_6757 | 382 |
| 2455 | 3300046660 | Ga0495625_0010613 | Ga0495625_0010613_3529_4677 | 382 |
| 2456 | 3300046660 | Ga0495625_0013918 | Ga0495625_0013918_1351_2499 | 382 |
| 2457 | 3300046660 | Ga0495625_0018819 | Ga0495625_0018819_2452_3600 | 382 |
| 2458 | 3300046660 | Ga0495625_0020283 | Ga0495625_0020283_1146_2294 | 382 |
| 2459 | 3300046660 | Ga0495625_0024901 | Ga0495625_0024901_1347_2495 | 382 |
| 2460 | 3300046660 | Ga0495625_0036436 | Ga0495625_0036436_889_2037 | 382 |
| 2461 | 3300046660 | Ga0495625_0051875 | Ga0495625_0051875_198_1346 | 382 |
| 2462 | 3300046660 | Ga0495625_0065430 | Ga0495625_0065430_68_1216 | 382 |
| 2463 | 3300046663 | Ga0495635_0027587 | Ga0495635_0027587_338_1486 | 382 |
| 2464 | 3300046663 | Ga0495635_0093110 | Ga0495635_0093110_140_1288 | 382 |
| 2465 | 3300046663 | Ga0495635_0224942 | Ga0495635_0224942_30_1178 | 382 |
| 2466 | 3300046664 | Ga0495659_0000652 | Ga0495659_0000652_10209_11357 | 382 |
| 2467 | 3300046665 | Ga0495661_0000116 | Ga0495661_0000116_88715_89863 | 382 |
| 2468 | 3300046665 | Ga0495661_0000205 | Ga0495661_0000205_14523_15671 | 382 |
| 2469 | 3300046665 | Ga0495661_0000437 | Ga0495661_0000437_19782_20930 | 382 |
| 2470 | 3300046665 | Ga0495661_0000685 | Ga0495661_0000685_7349_8497 | 382 |
| 2471 | 3300046665 | Ga0495661_0001817 | Ga0495661_0001817_11019_12167 | 382 |
| 2472 | 3300046665 | Ga0495661_0017755 | Ga0495661_0017755_2218_3366 | 382 |
| 2473 | 3300046665 | Ga0495661_0017872 | Ga0495661_0017872_3131_4279 | 382 |
| 2474 | 3300046665 | Ga0495661_0020307 | Ga0495661_0020307_1666_2814 | 382 |
| 2475 | 3300046665 | Ga0495661_0024154 | Ga0495661_0024154_2210_3358 | 382 |
| 2476 | 3300046674 | Ga0495588_0077383 | Ga0495588_0077383_569_1717 | 382 |
| 2477 | 3300046678 | Ga0495599_0018977 | Ga0495599_0018977_1957_3105 | 382 |
| 2478 | 3300046678 | Ga0495599_0065919 | Ga0495599_0065919_231_1379 | 382 |
| 2479 | 3300046678 | Ga0495599_0198232 | Ga0495599_0198232_39_1187 | 382 |
| 2480 | 3300046679 | Ga0495623_0006272 | Ga0495623_0006272_6277_7467 | 382 |
| 2481 | 3300046679 | Ga0495623_0011011 | Ga0495623_0011011_3108_4256 | 382 |
| 2482 | 3300046679 | Ga0495623_0025627 | Ga0495623_0025627_20_1168 | 382 |
| 2483 | 3300046679 | Ga0495623_0156254 | Ga0495623_0156254_14_1162 | 382 |
| 2484 | 3300046680 | Ga0495646_0011260 | Ga0495646_0011260_1393_2541 | 382 |
| 2485 | 3300046680 | Ga0495646_0012311 | Ga0495646_0012311_2563_3711 | 382 |
| 2486 | 3300046680 | Ga0495646_0023815 | Ga0495646_0023815_1126_2274 | 382 |
| 2487 | 3300046680 | Ga0495646_0031113 | Ga0495646_0031113_152_1300 | 382 |
| 2488 | 3300046680 | Ga0495646_0044896 | Ga0495646_0044896_748_1896 | 382 |
| 2489 | 3300046684 | Ga0495669_0001481 | Ga0495669_0001481_7824_8972 | 382 |
| 2490 | 3300046684 | Ga0495669_0024735 | Ga0495669_0024735_270_1418 | 382 |
| 2491 | 3300046689 | Ga0495613_0008243 | Ga0495613_0008243_4909_6057 | 382 |
| 2492 | 3300046689 | Ga0495613_0015970 | Ga0495613_0015970_2261_3409 | 382 |
| 2493 | 3300046690 | Ga0495624_0005166 | Ga0495624_0005166_5439_6587 | 382 |
| 2494 | 3300046690 | Ga0495624_0006441 | Ga0495624_0006441_2987_4135 | 382 |
| 2495 | 3300046690 | Ga0495624_0008292 | Ga0495624_0008292_5857_7005 | 382 |
| 2496 | 3300046690 | Ga0495624_0008471 | Ga0495624_0008471_871_2019 | 382 |
| 2497 | 3300046690 | Ga0495624_0010611 | Ga0495624_0010611_3797_4945 | 382 |
| 2498 | 3300046690 | Ga0495624_0021149 | Ga0495624_0021149_2984_4132 | 382 |
| 2499 | 3300046691 | Ga0495670_0001795 | Ga0495670_0001795_4426_5574 | 382 |
| 2500 | 3300046691 | Ga0495670_0003146 | Ga0495670_0003146_5018_6166 | 382 |
| 2501 | 3300046691 | Ga0495670_0007244 | Ga0495670_0007244_2063_3211 | 382 |
| 2502 | 3300046691 | Ga0495670_0020115 | Ga0495670_0020115_1768_2916 | 382 |
| 2503 | 3300046691 | Ga0495670_0082037 | Ga0495670_0082037_117_1265 | 382 |
| 2504 | 3300046692 | Ga0495671_0001279 | Ga0495671_0001279_9986_11134 | 382 |
| 2505 | 3300046692 | Ga0495671_0003674 | Ga0495671_0003674_495_1643 | 382 |
| 2506 | 3300046692 | Ga0495671_0004465 | Ga0495671_0004465_6661_7809 | 382 |
| 2507 | 3300046692 | Ga0495671_0004798 | Ga0495671_0004798_1711_2859 | 382 |
| 2508 | 3300046692 | Ga0495671_0004983 | Ga0495671_0004983_2449_3597 | 382 |
| 2509 | 3300046692 | Ga0495671_0007822 | Ga0495671_0007822_3219_4367 | 382 |
| 2510 | 3300046692 | Ga0495671_0010802 | Ga0495671_0010802_1162_2310 | 382 |
| 2511 | 3300046692 | Ga0495671_0011402 | Ga0495671_0011402_2129_3277 | 382 |
| 2512 | 3300046692 | Ga0495671_0021625 | Ga0495671_0021625_1932_3080 | 382 |
| 2513 | 3300046692 | Ga0495671_0048111 | Ga0495671_0048111_783_1931 | 382 |
| 2514 | 3300046694 | Ga0495649_0000813 | Ga0495649_0000813_20097_21245 | 382 |
| 2515 | 3300046694 | Ga0495649_0000958 | Ga0495649_0000958_19360_20508 | 382 |
| 2516 | 3300046694 | Ga0495649_0001962 | Ga0495649_0001962_11835_12983 | 382 |
| 2517 | 3300046694 | Ga0495649_0002855 | Ga0495649_0002855_1909_3057 | 382 |
| 2518 | 3300046694 | Ga0495649_0022427 | Ga0495649_0022427_585_1733 | 382 |
| 2519 | 3300046694 | Ga0495649_0023047 | Ga0495649_0023047_1084_2232 | 382 |
| 2520 | 3300046694 | Ga0495649_0030996 | Ga0495649_0030996_495_1643 | 382 |
| 2521 | 3300046694 | Ga0495649_0060976 | Ga0495649_0060976_579_1727 | 382 |
| 2522 | 3300046794 | Ga0495589_0000603 | Ga0495589_0000603_16995_18143 | 382 |
| 2523 | 3300046794 | Ga0495589_0001311 | Ga0495589_0001311_13231_14379 | 382 |
| 2524 | 3300046794 | Ga0495589_0002748 | Ga0495589_0002748_1077_2225 | 382 |
| 2525 | 3300046794 | Ga0495589_0003822 | Ga0495589_0003822_583_1731 | 382 |
| 2526 | 3300046794 | Ga0495589_0006874 | Ga0495589_0006874_3843_4991 | 382 |
| 2527 | 3300046794 | Ga0495589_0028661 | Ga0495589_0028661_932_2080 | 382 |
| 2528 | 3300046794 | Ga0495589_0050533 | Ga0495589_0050533_535_1683 | 382 |
| 2529 | 3300046809 | Ga0495600_0002250 | Ga0495600_0002250_142_1290 | 382 |
| 2530 | 3300046809 | Ga0495600_0005056 | Ga0495600_0005056_3141_4289 | 382 |
| 2531 | 3300046809 | Ga0495600_0012956 | Ga0495600_0012956_1900_3048 | 382 |
| 2532 | 3300046809 | Ga0495600_0027878 | Ga0495600_0027878_2076_3224 | 382 |
| 2533 | 3300046810 | Ga0495660_0001767 | Ga0495660_0001767_6976_8124 | 382 |
| 2534 | 3300046810 | Ga0495660_0002709 | Ga0495660_0002709_3055_4203 | 382 |
| 2535 | 3300046810 | Ga0495660_0003160 | Ga0495660_0003160_2048_3196 | 382 |
| 2536 | 3300046810 | Ga0495660_0011688 | Ga0495660_0011688_3193_4341 | 382 |
| 2537 | 3300046810 | Ga0495660_0016648 | Ga0495660_0016648_920_2068 | 382 |
| 2538 | 3300046810 | Ga0495660_0046471 | Ga0495660_0046471_866_2014 | 382 |
| 2539 | 3300046810 | Ga0495660_0051902 | Ga0495660_0051902_221_1369 | 382 |
| 2540 | 3300046810 | Ga0495660_0092925 | Ga0495660_0092925_152_1315 | 382 |
| 2541 | 3300047315 | Ga0495581_0001650 | Ga0495581_0001650_4468_5616 | 382 |
| 2542 | 3300047315 | Ga0495581_0021920 | Ga0495581_0021920_525_1673 | 382 |
| 2543 | 3300047315 | Ga0495581_0023133 | Ga0495581_0023133_674_1822 | 382 |
| 2544 | 3300047315 | Ga0495581_0023908 | Ga0495581_0023908_86_1234 | 382 |
| 2545 | 3300047315 | Ga0495581_0055110 | Ga0495581_0055110_867_2015 | 382 |
| 2546 | 3300047317 | Ga0495604_0002992 | Ga0495604_0002992_2440_3588 | 382 |
| 2547 | 3300047317 | Ga0495604_0008904 | Ga0495604_0008904_6644_7792 | 382 |
| 2548 | 3300047317 | Ga0495604_0012390 | Ga0495604_0012390_491_1639 | 382 |
| 2549 | 3300047317 | Ga0495604_0015148 | Ga0495604_0015148_3039_4187 | 382 |
| 2550 | 3300047317 | Ga0495604_0096008 | Ga0495604_0096008_149_1297 | 382 |
| 2551 | 3300047317 | Ga0495604_0119378 | Ga0495604_0119378_116_1264 | 382 |
| 2552 | 3300047318 | Ga0495636_0006842 | Ga0495636_0006842_1361_2509 | 382 |
| 2553 | 3300047319 | Ga0495674_0009541 | Ga0495674_0009541_4779_5927 | 382 |
| 2554 | 3300047319 | Ga0495674_0020257 | Ga0495674_0020257_948_2096 | 382 |
| 2555 | 3300047319 | Ga0495674_0023860 | Ga0495674_0023860_3595_4743 | 382 |
| 2556 | 3300047319 | Ga0495674_0038522 | Ga0495674_0038522_2865_4013 | 382 |
| 2557 | 3300047320 | Ga0495672_0000006 | Ga0495672_0000006_315860_317008 | 382 |
| 2558 | 3300047320 | Ga0495672_0001599 | Ga0495672_0001599_1613_2761 | 382 |
| 2559 | 3300047320 | Ga0495672_0002422 | Ga0495672_0002422_1734_2882 | 382 |
| 2560 | 3300047320 | Ga0495672_0003165 | Ga0495672_0003165_8497_9645 | 382 |
| 2561 | 3300047320 | Ga0495672_0003648 | Ga0495672_0003648_8604_9752 | 382 |
| 2562 | 3300047320 | Ga0495672_0005788 | Ga0495672_0005788_1432_2580 | 382 |
| 2563 | 3300047320 | Ga0495672_0007469 | Ga0495672_0007469_896_2044 | 382 |
| 2564 | 3300047320 | Ga0495672_0007769 | Ga0495672_0007769_5535_6683 | 382 |
| 2565 | 3300047320 | Ga0495672_0008206 | Ga0495672_0008206_5133_6281 | 382 |
| 2566 | 3300047320 | Ga0495672_0012356 | Ga0495672_0012356_1170_2318 | 382 |
| 2567 | 3300047320 | Ga0495672_0027158 | Ga0495672_0027158_829_1977 | 382 |
| 2568 | 3300047320 | Ga0495672_0029446 | Ga0495672_0029446_540_1688 | 382 |
| 2569 | 3300047320 | Ga0495672_0029976 | Ga0495672_0029976_548_1696 | 382 |
| 2570 | 3300047320 | Ga0495672_0047493 | Ga0495672_0047493_629_1777 | 382 |
| 2571 | 3300047321 | Ga0495676_0000171 | Ga0495676_0000171_22645_23793 | 382 |
| 2572 | 3300047321 | Ga0495676_0001994 | Ga0495676_0001994_5696_6844 | 382 |
| 2573 | 3300047321 | Ga0495676_0014357 | Ga0495676_0014357_4595_5743 | 382 |
| 2574 | 3300047321 | Ga0495676_0021499 | Ga0495676_0021499_2440_3588 | 382 |
| 2575 | 3300047321 | Ga0495676_0139918 | Ga0495676_0139918_234_1382 | 382 |
| 2576 | 3300047321 | Ga0495676_0207857 | Ga0495676_0207857_160_1308 | 382 |
| 2577 | 3300047322 | Ga0495680_0021825 | Ga0495680_0021825_182_1330 | 382 |
| 2578 | 3300047322 | Ga0495680_0046863 | Ga0495680_0046863_2106_3254 | 382 |
| 2579 | 3300047322 | Ga0495680_0241858 | Ga0495680_0241858_17_1207 | 382 |
| 2580 | 3300047323 | Ga0495683_0000122 | Ga0495683_0000122_69298_70446 | 382 |
| 2581 | 3300047323 | Ga0495683_0000507 | Ga0495683_0000507_6985_8133 | 382 |
| 2582 | 3300047323 | Ga0495683_0002187 | Ga0495683_0002187_5813_6961 | 382 |
| 2583 | 3300047323 | Ga0495683_0004452 | Ga0495683_0004452_1657_2805 | 382 |
| 2584 | 3300047323 | Ga0495683_0009029 | Ga0495683_0009029_1552_2700 | 382 |
| 2585 | 3300047323 | Ga0495683_0009650 | Ga0495683_0009650_15_1163 | 382 |
| 2586 | 3300047323 | Ga0495683_0019910 | Ga0495683_0019910_429_1577 | 382 |
| 2587 | 3300047323 | Ga0495683_0033374 | Ga0495683_0033374_879_2027 | 382 |
| 2588 | 3300047323 | Ga0495683_0063995 | Ga0495683_0063995_401_1657 | 382 |
| 2589 | 3300047323 | Ga0495683_0088161 | Ga0495683_0088161_152_1300 | 382 |
| 2590 | 3300047443 | Ga0495687_000011 | Ga0495687_000011_299772_300920 | 382 |
| 2591 | 3300047443 | Ga0495687_006192 | Ga0495687_006192_2359_3507 | 382 |
| 2592 | 3300047443 | Ga0495687_014652 | Ga0495687_014652_2349_3497 | 382 |
| 2593 | 3300047443 | Ga0495687_025890 | Ga0495687_025890_1220_2368 | 382 |
| 2594 | 3300047444 | Ga0495675_0004539 | Ga0495675_0004539_4805_5953 | 382 |
| 2595 | 3300047444 | Ga0495675_0010416 | Ga0495675_0010416_2388_3536 | 382 |
| 2596 | 3300047444 | Ga0495675_0028822 | Ga0495675_0028822_24_1172 | 382 |
| 2597 | 3300047444 | Ga0495675_0039223 | Ga0495675_0039223_1765_2913 | 382 |
| 2598 | 3300047446 | Ga0495679_000119 | Ga0495679_000119_49200_50348 | 382 |
| 2599 | 3300047446 | Ga0495679_000471 | Ga0495679_000471_3797_4945 | 382 |
| 2600 | 3300047446 | Ga0495679_001597 | Ga0495679_001597_10475_11623 | 382 |
| 2601 | 3300047446 | Ga0495679_010672 | Ga0495679_010672_1641_2789 | 382 |
| 2602 | 3300047469 | Ga0495673_0000995 | Ga0495673_0000995_5112_6260 | 382 |
| 2603 | 3300047469 | Ga0495673_0002146 | Ga0495673_0002146_9969_11117 | 382 |
| 2604 | 3300047469 | Ga0495673_0003396 | Ga0495673_0003396_3619_4767 | 382 |
| 2605 | 3300047469 | Ga0495673_0004684 | Ga0495673_0004684_3738_4886 | 382 |
| 2606 | 3300047469 | Ga0495673_0009152 | Ga0495673_0009152_3153_4301 | 382 |
| 2607 | 3300047469 | Ga0495673_0021426 | Ga0495673_0021426_898_2046 | 382 |
| 2608 | 3300047469 | Ga0495673_0022515 | Ga0495673_0022515_266_1414 | 382 |
| 2609 | 3300047469 | Ga0495673_0032777 | Ga0495673_0032777_760_1908 | 382 |
| 2610 | 3300047469 | Ga0495673_0033536 | Ga0495673_0033536_1059_2207 | 382 |
| 2611 | 3300047469 | Ga0495673_0053657 | Ga0495673_0053657_385_1533 | 382 |
| 2612 | 3300047469 | Ga0495673_0078241 | Ga0495673_0078241_195_1343 | 382 |
| 2613 | 3300047470 | Ga0495681_0000588 | Ga0495681_0000588_1363_2511 | 382 |
| 2614 | 3300047470 | Ga0495681_0001141 | Ga0495681_0001141_56_1204 | 382 |
| 2615 | 3300047470 | Ga0495681_0004351 | Ga0495681_0004351_4102_5250 | 382 |
| 2616 | 3300047470 | Ga0495681_0005242 | Ga0495681_0005242_761_1909 | 382 |
| 2617 | 3300047470 | Ga0495681_0007039 | Ga0495681_0007039_5793_6941 | 382 |
| 2618 | 3300047470 | Ga0495681_0008829 | Ga0495681_0008829_4902_6050 | 382 |
| 2619 | 3300047471 | Ga0495684_0027409 | Ga0495684_0027409_2801_3991 | 382 |
| 2620 | 3300047472 | Ga0495686_0000014 | Ga0495686_0000014_441433_442581 | 382 |
| 2621 | 3300047472 | Ga0495686_0000106 | Ga0495686_0000106_103236_104384 | 382 |
| 2622 | 3300047472 | Ga0495686_0002286 | Ga0495686_0002286_16080_17228 | 382 |
| 2623 | 3300047472 | Ga0495686_0005326 | Ga0495686_0005326_4325_5473 | 382 |
| 2624 | 3300047472 | Ga0495686_0013497 | Ga0495686_0013497_2055_3212 | 382 |
| 2625 | 3300047472 | Ga0495686_0027334 | Ga0495686_0027334_1633_2781 | 382 |
| 2626 | 3300047472 | Ga0495686_0052895 | Ga0495686_0052895_532_1680 | 382 |
| 2627 | 3300047673 | Ga0495593_0002465 | Ga0495593_0002465_1238_2386 | 382 |
| 2628 | 3300047673 | Ga0495593_0005528 | Ga0495593_0005528_5822_7012 | 382 |
| 2629 | 3300047673 | Ga0495593_0005604 | Ga0495593_0005604_4064_5212 | 382 |
| 2630 | 3300047673 | Ga0495593_0010719 | Ga0495593_0010719_1285_2433 | 382 |
| 2631 | 3300047673 | Ga0495593_0022884 | Ga0495593_0022884_923_2071 | 382 |
| 2632 | 3300048088 | Ga0495602_0026550 | Ga0495602_0026550_2865_4013 | 382 |
| 2633 | 3300048088 | Ga0495602_0035542 | Ga0495602_0035542_2358_3506 | 382 |
| 2634 | 3300048088 | Ga0495602_0106812 | Ga0495602_0106812_720_1868 | 382 |
| 2635 | 3300048089 | Ga0495614_0004980 | Ga0495614_0004980_1851_2999 | 382 |
| 2636 | 3300048089 | Ga0495614_0006551 | Ga0495614_0006551_2348_3496 | 382 |
| 2637 | 3300048091 | Ga0495626_0000123 | Ga0495626_0000123_23165_24313 | 382 |
| 2638 | 3300048091 | Ga0495626_0000721 | Ga0495626_0000721_4770_5918 | 382 |
| 2639 | 3300048091 | Ga0495626_0001593 | Ga0495626_0001593_10807_11955 | 382 |
| 2640 | 3300048091 | Ga0495626_0002867 | Ga0495626_0002867_5113_6261 | 382 |
| 2641 | 3300048091 | Ga0495626_0003467 | Ga0495626_0003467_7321_8469 | 382 |
| 2642 | 3300048091 | Ga0495626_0009762 | Ga0495626_0009762_1631_2779 | 382 |
| 2643 | 3300048091 | Ga0495626_0012178 | Ga0495626_0012178_1726_2874 | 382 |
| 2644 | 3300048091 | Ga0495626_0015529 | Ga0495626_0015529_2037_3185 | 382 |
| 2645 | 3300048903 | Ga0496100_0024102 | Ga0496100_0024102_2375_3523 | 382 |
| 2646 | 3300048905 | Ga0496102_0004120 | Ga0496102_0004120_5107_6255 | 382 |
| 2647 | 3300048905 | Ga0496102_0240363 | Ga0496102_0240363_215_1363 | 382 |
| 2648 | 3300048906 | Ga0496103_0208661 | Ga0496103_0208661_90_1238 | 382 |
| 2649 | 3300048907 | Ga0496104_0074107 | Ga0496104_0074107_262_1518 | 382 |
| 2650 | 3300048908 | Ga0496105_0012365 | Ga0496105_0012365_2652_3800 | 382 |
| 2651 | 3300048908 | Ga0496105_0175230 | Ga0496105_0175230_513_1661 | 382 |
| 2652 | 3300048909 | Ga0496106_0000026 | Ga0496106_0000026_36330_37478 | 382 |
| 2653 | 3300048909 | Ga0496106_0123578 | Ga0496106_0123578_323_1471 | 382 |
| 2654 | 3300048910 | Ga0496107_0179955 | Ga0496107_0179955_171_1319 | 382 |
| 2655 | 3300048912 | Ga0496109_0051688 | Ga0496109_0051688_2575_3723 | 382 |
| 2656 | 3300048913 | Ga0496110_0000191 | Ga0496110_0000191_22565_23761 | 382 |
| 2657 | 3300048915 | Ga0496112_0284761 | Ga0496112_0284761_179_1354 | 382 |
| 2658 | 3300048916 | Ga0496113_0009261 | Ga0496113_0009261_4342_5598 | 382 |
| 2659 | 3300048916 | Ga0496113_0021787 | Ga0496113_0021787_2167_3315 | 382 |
| 2660 | 3300048916 | Ga0496113_0065923 | Ga0496113_0065923_1248_2396 | 382 |
| 2661 | 3300048916 | Ga0496113_0088449 | Ga0496113_0088449_587_1735 | 382 |
| 2662 | 3300048916 | Ga0496113_0114603 | Ga0496113_0114603_42_1238 | 382 |
| 2663 | 3300048917 | Ga0496114_0095111 | Ga0496114_0095111_746_1894 | 382 |
| 2664 | 3300048918 | Ga0496115_0000272 | Ga0496115_0000272_6550_7698 | 382 |
| 2665 | 3300048918 | Ga0496115_0000603 | Ga0496115_0000603_5862_7010 | 382 |
| 2666 | 3300048918 | Ga0496115_0060115 | Ga0496115_0060115_1720_2868 | 382 |
| 2667 | 3300048919 | Ga0496116_0000194 | Ga0496116_0000194_66890_68038 | 382 |
| 2668 | 3300048919 | Ga0496116_0001102 | Ga0496116_0001102_25228_26376 | 382 |
| 2669 | 3300048919 | Ga0496116_0001261 | Ga0496116_0001261_5118_6266 | 382 |
| 2670 | 3300048919 | Ga0496116_0008312 | Ga0496116_0008312_6546_7694 | 382 |
| 2671 | 3300048919 | Ga0496116_0045898 | Ga0496116_0045898_1325_2473 | 382 |
| 2672 | 3300048919 | Ga0496116_0047289 | Ga0496116_0047289_1677_2825 | 382 |
| 2673 | 3300048920 | Ga0496117_0001360 | Ga0496117_0001360_24182_25330 | 382 |
| 2674 | 3300048920 | Ga0496117_0002501 | Ga0496117_0002501_11454_12602 | 382 |
| 2675 | 3300048920 | Ga0496117_0004110 | Ga0496117_0004110_13906_15054 | 382 |
| 2676 | 3300048920 | Ga0496117_0004748 | Ga0496117_0004748_6654_7802 | 382 |
| 2677 | 3300048920 | Ga0496117_0013894 | Ga0496117_0013894_1134_2282 | 382 |
| 2678 | 3300048920 | Ga0496117_0013964 | Ga0496117_0013964_3224_4372 | 382 |
| 2679 | 3300048920 | Ga0496117_0028254 | Ga0496117_0028254_1166_2314 | 382 |
| 2680 | 3300048920 | Ga0496117_0030977 | Ga0496117_0030977_2901_4049 | 382 |
| 2681 | 3300048920 | Ga0496117_0051200 | Ga0496117_0051200_1053_2201 | 382 |
| 2682 | 3300048921 | Ga0496118_0000110 | Ga0496118_0000110_76400_77548 | 382 |
| 2683 | 3300048921 | Ga0496118_0001537 | Ga0496118_0001537_31236_32384 | 382 |
| 2684 | 3300048921 | Ga0496118_0009650 | Ga0496118_0009650_7647_8795 | 382 |
| 2685 | 3300048921 | Ga0496118_0027773 | Ga0496118_0027773_1849_2997 | 382 |
| 2686 | 3300048921 | Ga0496118_0037297 | Ga0496118_0037297_1422_2570 | 382 |
| 2687 | 3300048921 | Ga0496118_0124363 | Ga0496118_0124363_268_1416 | 382 |
| 2688 | 3300048922 | Ga0496119_0015727 | Ga0496119_0015727_49_1197 | 382 |
| 2689 | 3300048922 | Ga0496119_0040362 | Ga0496119_0040362_1536_2684 | 382 |
| 2690 | 3300048922 | Ga0496119_0041312 | Ga0496119_0041312_298_1446 | 382 |
| 2691 | 3300048923 | Ga0496120_0003794 | Ga0496120_0003794_3083_4231 | 382 |
| 2692 | 3300048923 | Ga0496120_0016041 | Ga0496120_0016041_2013_3161 | 382 |
| 2693 | 3300048923 | Ga0496120_0050582 | Ga0496120_0050582_1071_2219 | 382 |
| 2694 | 3300048924 | Ga0496121_0000005 | Ga0496121_0000005_958976_960124 | 382 |
| 2695 | 3300048924 | Ga0496121_0000396 | Ga0496121_0000396_54523_55671 | 382 |
| 2696 | 3300048924 | Ga0496121_0000742 | Ga0496121_0000742_47554_48702 | 382 |
| 2697 | 3300048924 | Ga0496121_0000791 | Ga0496121_0000791_37776_38924 | 382 |
| 2698 | 3300048924 | Ga0496121_0001329 | Ga0496121_0001329_36040_37203 | 382 |
| 2699 | 3300048924 | Ga0496121_0003265 | Ga0496121_0003265_11282_12430 | 382 |
| 2700 | 3300048924 | Ga0496121_0003863 | Ga0496121_0003863_196_1344 | 382 |
| 2701 | 3300048924 | Ga0496121_0004801 | Ga0496121_0004801_10845_11993 | 382 |
| 2702 | 3300048924 | Ga0496121_0007177 | Ga0496121_0007177_6492_7640 | 382 |
| 2703 | 3300048924 | Ga0496121_0010549 | Ga0496121_0010549_7688_8836 | 382 |
| 2704 | 3300048924 | Ga0496121_0013553 | Ga0496121_0013553_509_1657 | 382 |
| 2705 | 3300048924 | Ga0496121_0022594 | Ga0496121_0022594_1962_3110 | 382 |
| 2706 | 3300048924 | Ga0496121_0073761 | Ga0496121_0073761_592_1740 | 382 |
| 2707 | 3300048925 | Ga0496122_0000156 | Ga0496122_0000156_14788_15936 | 382 |
| 2708 | 3300048925 | Ga0496122_0000203 | Ga0496122_0000203_80494_81642 | 382 |
| 2709 | 3300048925 | Ga0496122_0000249 | Ga0496122_0000249_90573_91721 | 382 |
| 2710 | 3300048925 | Ga0496122_0000266 | Ga0496122_0000266_83169_84317 | 382 |
| 2711 | 3300048925 | Ga0496122_0000451 | Ga0496122_0000451_60731_61879 | 382 |
| 2712 | 3300048925 | Ga0496122_0001854 | Ga0496122_0001854_516_1664 | 382 |
| 2713 | 3300048925 | Ga0496122_0005055 | Ga0496122_0005055_9327_10475 | 382 |
| 2714 | 3300048925 | Ga0496122_0008009 | Ga0496122_0008009_8570_9718 | 382 |
| 2715 | 3300048925 | Ga0496122_0024208 | Ga0496122_0024208_296_1444 | 382 |
| 2716 | 3300048925 | Ga0496122_0035401 | Ga0496122_0035401_1710_2858 | 382 |
| 2717 | 3300048925 | Ga0496122_0123320 | Ga0496122_0123320_319_1467 | 382 |
| 2718 | 3300048926 | Ga0496123_0000018 | Ga0496123_0000018_261214_262362 | 382 |
| 2719 | 3300048926 | Ga0496123_0000087 | Ga0496123_0000087_166857_168005 | 382 |
| 2720 | 3300048926 | Ga0496123_0000164 | Ga0496123_0000164_50907_52055 | 382 |
| 2721 | 3300048926 | Ga0496123_0000347 | Ga0496123_0000347_56224_57372 | 382 |
| 2722 | 3300048926 | Ga0496123_0001482 | Ga0496123_0001482_2639_3787 | 382 |
| 2723 | 3300048926 | Ga0496123_0003910 | Ga0496123_0003910_533_1681 | 382 |
| 2724 | 3300048926 | Ga0496123_0007317 | Ga0496123_0007317_6462_7610 | 382 |
| 2725 | 3300048926 | Ga0496123_0008731 | Ga0496123_0008731_2699_3847 | 382 |
| 2726 | 3300048926 | Ga0496123_0009255 | Ga0496123_0009255_3852_5000 | 382 |
| 2727 | 3300048926 | Ga0496123_0022466 | Ga0496123_0022466_2420_3568 | 382 |
| 2728 | 3300048927 | Ga0496124_0000006 | Ga0496124_0000006_527935_529083 | 382 |
| 2729 | 3300048927 | Ga0496124_0000023 | Ga0496124_0000023_200264_201412 | 382 |
| 2730 | 3300048927 | Ga0496124_0000506 | Ga0496124_0000506_638_1786 | 382 |
| 2731 | 3300048927 | Ga0496124_0000625 | Ga0496124_0000625_12797_13945 | 382 |
| 2732 | 3300048927 | Ga0496124_0004020 | Ga0496124_0004020_7299_8447 | 382 |
| 2733 | 3300048927 | Ga0496124_0014633 | Ga0496124_0014633_530_1678 | 382 |
| 2734 | 3300048927 | Ga0496124_0050176 | Ga0496124_0050176_1863_3011 | 382 |
| 2735 | 3300048927 | Ga0496124_0073391 | Ga0496124_0073391_59_1207 | 382 |
| 2736 | 3300048927 | Ga0496124_0097320 | Ga0496124_0097320_79_1227 | 382 |
| 2737 | 3300048927 | Ga0496124_0108001 | Ga0496124_0108001_674_1822 | 382 |
| 2738 | 3300048928 | Ga0496125_0000023 | Ga0496125_0000023_266556_267704 | 382 |
| 2739 | 3300048928 | Ga0496125_0000144 | Ga0496125_0000144_105331_106479 | 382 |
| 2740 | 3300048928 | Ga0496125_0000159 | Ga0496125_0000159_83100_84248 | 382 |
| 2741 | 3300048928 | Ga0496125_0000215 | Ga0496125_0000215_38448_39596 | 382 |
| 2742 | 3300048928 | Ga0496125_0000453 | Ga0496125_0000453_19922_21070 | 382 |
| 2743 | 3300048928 | Ga0496125_0003794 | Ga0496125_0003794_7610_8758 | 382 |
| 2744 | 3300048928 | Ga0496125_0028662 | Ga0496125_0028662_697_1845 | 382 |
| 2745 | 3300048928 | Ga0496125_0039995 | Ga0496125_0039995_2275_3423 | 382 |
| 2746 | 3300048928 | Ga0496125_0051405 | Ga0496125_0051405_2081_3229 | 382 |
| 2747 | 3300048928 | Ga0496125_0052078 | Ga0496125_0052078_1397_2545 | 382 |
| 2748 | 3300048928 | Ga0496125_0059632 | Ga0496125_0059632_212_1360 | 382 |
| 2749 | 3300048928 | Ga0496125_0194922 | Ga0496125_0194922_129_1277 | 382 |
| 2750 | 3300048929 | Ga0496126_0000061 | Ga0496126_0000061_82509_83657 | 382 |
| 2751 | 3300048929 | Ga0496126_0012736 | Ga0496126_0012736_2664_3812 | 382 |
| 2752 | 3300048929 | Ga0496126_0033969 | Ga0496126_0033969_2589_3737 | 382 |
| 2753 | 3300048929 | Ga0496126_0057325 | Ga0496126_0057325_753_1901 | 382 |
| 2754 | 3300048929 | Ga0496126_0073626 | Ga0496126_0073626_1365_2513 | 382 |
| 2755 | 3300048929 | Ga0496126_0078778 | Ga0496126_0078778_597_1745 | 382 |
| 2756 | 3300048929 | Ga0496126_0097693 | Ga0496126_0097693_827_1975 | 382 |
| 2757 | 3300048929 | Ga0496126_0190670 | Ga0496126_0190670_506_1654 | 382 |
| 2758 | 3300048929 | Ga0496126_0237270 | Ga0496126_0237270_60_1208 | 382 |
| 2759 | 3300049459 | Ga0495678_000020 | Ga0495678_000020_7308_8456 | 382 |
| 2760 | 3300049459 | Ga0495678_001763 | Ga0495678_001763_48_1196 | 382 |
| 2761 | 3300049459 | Ga0495678_003152 | Ga0495678_003152_8420_9568 | 382 |
| 2762 | 3300049459 | Ga0495678_003293 | Ga0495678_003293_5122_6270 | 382 |
| 2763 | 3300049459 | Ga0495678_003507 | Ga0495678_003507_1125_2273 | 382 |
| 2764 | 3300049459 | Ga0495678_007368 | Ga0495678_007368_4362_5510 | 382 |
| 2765 | 3300049459 | Ga0495678_011773 | Ga0495678_011773_340_1488 | 382 |
| 2766 | 3300049459 | Ga0495678_020128 | Ga0495678_020128_1147_2295 | 382 |
| 2767 | 3300049459 | Ga0495678_035839 | Ga0495678_035839_42_1190 | 382 |
| 2768 | 3300049460 | Ga0495682_0000018 | Ga0495682_0000018_189509_190657 | 382 |
| 2769 | 3300049528 | Ga0501312_003177 | Ga0501312_003177_531_1679 | 382 |
| 2770 | 3300049568 | Ga0501031_0010845 | Ga0501031_0010845_2314_3462 | 382 |
| 2771 | 3300049569 | Ga0501032_0005636 | Ga0501032_0005636_3813_4961 | 382 |
| 2772 | 3300049570 | Ga0501033_0005599 | Ga0501033_0005599_2340_3488 | 382 |
| 2773 | 3300049570 | Ga0501033_0006555 | Ga0501033_0006555_6886_8034 | 382 |
| 2774 | 3300049570 | Ga0501033_0054385 | Ga0501033_0054385_982_2130 | 382 |
| 2775 | 3300049571 | Ga0501034_0000160 | Ga0501034_0000160_38023_39231 | 382 |
| 2776 | 3300049571 | Ga0501034_0013846 | Ga0501034_0013846_1380_2528 | 382 |
| 2777 | 3300049571 | Ga0501034_0040386 | Ga0501034_0040386_2145_3293 | 382 |
| 2778 | 3300049571 | Ga0501034_0085625 | Ga0501034_0085625_761_1909 | 382 |
| 2779 | 3300049571 | Ga0501034_0094429 | Ga0501034_0094429_883_2031 | 382 |
| 2780 | 3300049571 | Ga0501034_0110024 | Ga0501034_0110024_271_1419 | 382 |
| 2781 | 3300049571 | Ga0501034_0259127 | Ga0501034_0259127_213_1361 | 382 |
| 2782 | 3300049571 | Ga0501034_0281965 | Ga0501034_0281965_151_1299 | 382 |
| 2783 | 3300049571 | Ga0501034_0344651 | Ga0501034_0344651_173_1321 | 382 |
| 2784 | 3300049571 | Ga0501034_0442255 | Ga0501034_0442255_35_1183 | 382 |
| 2785 | 3300049572 | Ga0501036_0016078 | Ga0501036_0016078_1674_2822 | 382 |
| 2786 | 3300049572 | Ga0501036_0105473 | Ga0501036_0105473_70_1218 | 382 |
| 2787 | 3300049573 | Ga0501037_0005493 | Ga0501037_0005493_5907_7055 | 382 |
| 2788 | 3300049573 | Ga0501037_0014455 | Ga0501037_0014455_1087_2235 | 382 |
| 2789 | 3300049573 | Ga0501037_0046604 | Ga0501037_0046604_384_1532 | 382 |
| 2790 | 3300049574 | Ga0501038_0099312 | Ga0501038_0099312_1051_2199 | 382 |
| 2791 | 3300049574 | Ga0501038_0099393 | Ga0501038_0099393_206_1354 | 382 |
| 2792 | 3300049575 | Ga0501039_0007179 | Ga0501039_0007179_5907_7055 | 382 |
| 2793 | 3300049576 | Ga0501040_0000155 | Ga0501040_0000155_35308_36456 | 382 |
| 2794 | 3300049578 | Ga0501042_0012756 | Ga0501042_0012756_1993_3141 | 382 |
| 2795 | 3300049578 | Ga0501042_0031461 | Ga0501042_0031461_1362_2510 | 382 |
| 2796 | 3300049579 | Ga0501043_0003327 | Ga0501043_0003327_9637_10785 | 382 |
| 2797 | 3300049579 | Ga0501043_0023026 | Ga0501043_0023026_260_1432 | 382 |
| 2798 | 3300049579 | Ga0501043_0038713 | Ga0501043_0038713_893_2041 | 382 |
| 2799 | 3300049579 | Ga0501043_0074265 | Ga0501043_0074265_164_1312 | 382 |
| 2800 | 3300049580 | Ga0501046_0007074 | Ga0501046_0007074_5212_6360 | 382 |
| 2801 | 3300049580 | Ga0501046_0024284 | Ga0501046_0024284_2995_4143 | 382 |
| 2802 | 3300049581 | Ga0501047_0085911 | Ga0501047_0085911_893_2041 | 382 |
| 2803 | 3300049581 | Ga0501047_0090321 | Ga0501047_0090321_1578_2726 | 382 |
| 2804 | 3300049581 | Ga0501047_0140690 | Ga0501047_0140690_160_1308 | 382 |
| 2805 | 3300049581 | Ga0501047_0147189 | Ga0501047_0147189_198_1346 | 382 |
| 2806 | 3300049581 | Ga0501047_0270674 | Ga0501047_0270674_308_1456 | 382 |
| 2807 | 3300049582 | Ga0501048_0001062 | Ga0501048_0001062_16325_17473 | 382 |
| 2808 | 3300049582 | Ga0501048_0021957 | Ga0501048_0021957_1549_2697 | 382 |
| 2809 | 3300049582 | Ga0501048_0043025 | Ga0501048_0043025_1118_2266 | 382 |
| 2810 | 3300049583 | Ga0501067_0000141 | Ga0501067_0000141_994_2142 | 382 |
| 2811 | 3300049584 | Ga0501068_0097096 | Ga0501068_0097096_194_1342 | 382 |
| 2812 | 3300049585 | Ga0501069_0019353 | Ga0501069_0019353_2338_3486 | 382 |
| 2813 | 3300049586 | Ga0501070_0023144 | Ga0501070_0023144_3097_4245 | 382 |
| 2814 | 3300049661 | Ga0501217_015787 | Ga0501217_015787_70_1224 | 382 |
| 2815 | 3300049741 | Ga0501079_0007620 | Ga0501079_0007620_5134_6282 | 382 |
| 2816 | 3300049822 | Ga0501035_0004258 | Ga0501035_0004258_4967_6115 | 382 |
| 2817 | 3300049822 | Ga0501035_0063758 | Ga0501035_0063758_457_1605 | 382 |
| 2818 | 3300049822 | Ga0501035_0137431 | Ga0501035_0137431_696_1844 | 382 |
| 2819 | 3300049823 | Ga0501044_0002363 | Ga0501044_0002363_2470_3618 | 382 |
| 2820 | 3300049823 | Ga0501044_0064616 | Ga0501044_0064616_82_1230 | 382 |
| 2821 | 3300049823 | Ga0501044_0069742 | Ga0501044_0069742_1906_3132 | 382 |
| 2822 | 3300049823 | Ga0501044_0095026 | Ga0501044_0095026_699_1871 | 382 |
| 2823 | 3300049824 | Ga0501045_0026003 | Ga0501045_0026003_193_1341 | 382 |
| 2824 | 3300050489 | nmdc:mga03683_19772_c1 | nmdc:mga03683_19772_c1_242_1390 | 382 |
| 2825 | 3300050491 | nmdc:mga00v17_374_c1 | nmdc:mga00v17_374_c1_13570_14718 | 382 |
| 2826 | 3300050491 | nmdc:mga00v17_57355_c1 | nmdc:mga00v17_57355_c1_498_1646 | 382 |
| 2827 | 3300053087 | Ga0500643_000017 | Ga0500643_000017_69839_70987 | 382 |
| 2828 | 3300053093 | Ga0500651_0001291 | Ga0500651_0001291_9611_10759 | 382 |
| 2829 | 3300053096 | Ga0500641_0013826 | Ga0500641_0013826_42_1190 | 382 |
| 2830 | 3300053119 | Ga0500595_000927 | Ga0500595_000927_552_1700 | 382 |
| 2831 | 3300053119 | Ga0500595_001126 | Ga0500595_001126_6800_7948 | 382 |
| 2832 | 3300053119 | Ga0500595_018414 | Ga0500595_018414_267_1415 | 382 |
| 2833 | 3300053125 | Ga0500618_000126 | Ga0500618_000126_58586_59734 | 382 |
| 2834 | 3300053125 | Ga0500618_002046 | Ga0500618_002046_6939_8087 | 382 |
| 2835 | 3300053134 | Ga0500658_0004601 | Ga0500658_0004601_1613_2761 | 382 |
| 2836 | 3300053139 | Ga0500568_0006096 | Ga0500568_0006096_2411_3643 | 382 |
| 2837 | 3300053140 | Ga0500573_0000055 | Ga0500573_0000055_45576_46724 | 382 |
| 2838 | 3300053153 | Ga0500616_0013230 | Ga0500616_0013230_1229_2377 | 382 |
| 2839 | 3300053156 | Ga0500622_0005062 | Ga0500622_0005062_2061_3209 | 382 |
| 2840 | 3300053161 | Ga0500634_0003859 | Ga0500634_0003859_5188_6336 | 382 |
| 2841 | 3300054114 | Ga0501084_0013919 | Ga0501084_0013919_1196_2344 | 382 |
| 2842 | 3300060353 | Ga0501082_0007757 | Ga0501082_0007757_6348_7496 | 382 |
| 2843 | 3300060353 | Ga0501082_0063322 | Ga0501082_0063322_1088_2269 | 382 |
| 2844 | 3300061719 | Ga0466962_0005308 | Ga0466962_0005308_3341_4489 | 382 |
| 2845 | 3300061719 | Ga0466962_0021384 | Ga0466962_0021384_1000_2148 | 382 |
| 2846 | iso_pu_bacteria | 3001267043 | 3001271742 | 382 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rra-assembly1.cif.gz_B | crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound | 0.9597 | 2 | 381 |
| 3rr1-assembly1.cif.gz_B | crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j | 0.9578 | 2 | 381 |
| 3rra-assembly1.cif.gz_A | crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound | 0.957 | 1 | 381 |
| 3rr1-assembly1.cif.gz_A | crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j | 0.9531 | 2 | 381 |
| 3rra-assembly1.cif.gz_A | crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound | 0.947 | 1 | 381 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6BF17_1_106_3.30.390.10 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 1.004 | 1 | 105 | 3.30.390.10 |
| af_Q6BF17_1_106_3.30.390.10 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.9847 | 1 | 105 | 3.30.390.10 |
| 3rraA01 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.9829 | 1 | 100 | 3.30.390.10 |
| af_P38104_1_104_3.30.390.10 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.9669 | 1 | 98 | 3.30.390.10 |
| 3s47B01 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.964 | 2 | 98 | 3.30.390.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M5DBQ9-F1-model_v4 | deleted | 0.994 | 2 | 367 |
|
| AF-A0A7X3ZHK9-F1-model_v4 | Mandelate racemase/muconate lactonizing enzyme N-terminal domain-containing protein | 0.9813 | 2 | 145 |
GO:0016829
|
| AF-A0A7W9J8H9-F1-model_v4 | Galactonate dehydratase (EC 4.2.1.6) | 0.9792 | 1 | 381 |
GO:0008869
GO:0009063 |
| AF-F5P1T7-F1-model_v4 | Mandelate racemase / muconate lactonizing enzyme, N-terminal domain protein (EC 4.2.1.6) | 0.9756 | 1 | 309 |
GO:0008869
GO:0009063 GO:0034194 |
| AF-F5P1T7-F1-model_v4 | Mandelate racemase / muconate lactonizing enzyme, N-terminal domain protein (EC 4.2.1.6) | 0.9725 | 1 | 309 |
GO:0008869
GO:0009063 GO:0034194 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar