F497097

General Info

Members Datasets Scaffolds Average Seq Length
2846 1441 1885 381

Family's Representative Sequence

Representative Sequence 3300046520|Ga0495637_0046991|Ga0495637_0046991_355_1440
Length 361
Sequence MKITKLTTFIVPPRWCFLKVETDEGVTGWGEPVVEGRAHTVAAAVEELSDYLIGKDPRNIEDIWTVLYRGGFYRGGAIHMSALAGIDQALWDIKGKALGVSVSDLLGGQVRDKIRVYSWIGGDRPADTARAAKEAVSRGFTAVKMNGTEELQFLDTFDKVDLALANVAAVRDAVGPNVGIGVDFHGRVHKPMAKVLMKELDPYKLTSTPIALGERLFSRWDFKRVLSEGYVDIIQPDASHAGGITETRKIANMAEAYDVALALHCPLGPIALAACLQLDAVCYNAFIQEQSLGIHYNESNDLLDYVKDPRVFDYDKGFVKIPNGPGLGIEINEEYVIERAAVGHRWRNPIWRHADGSFAEW

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
4 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
7 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
8 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
9 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
10 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
11 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
12 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
13 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
14 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
15 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
16 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
17 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
18 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
19 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
20 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
21 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
22 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
23 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
24 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
25 2511231004 Pseudomonas sp. GM102 Isolate Nodule
26 2511231007 Pseudomonas sp. GM18 Isolate Nodule
27 2511231008 Pseudomonas sp. GM21 Isolate Nodule
28 2511231010 Pseudomonas sp. GM25 Isolate Nodule
29 2511231011 Pseudomonas sp. GM30 Isolate Nodule
30 2511231012 Pseudomonas sp. GM33 Isolate Nodule
31 2511231014 Pseudomonas sp. GM48 Isolate Nodule
32 2511231015 Pseudomonas sp. GM49 Isolate Nodule
33 2511231016 Pseudomonas sp. GM50 Isolate Nodule
34 2511231017 Pseudomonas sp. GM55 Isolate Nodule
35 2511231018 Pseudomonas sp. GM60 Isolate Nodule
36 2511231019 Pseudomonas sp. GM67 Isolate Nodule
37 2511231020 Pseudomonas sp. GM74 Isolate Nodule
38 2511231021 Pseudomonas sp. GM78 Isolate Nodule
39 2511231022 Pseudomonas sp. GM79 Isolate Nodule
40 2511231023 Pseudomonas sp. GM80 Isolate Nodule
41 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
42 2511231031 Pseudomonas sp. GM16 Isolate Nodule
43 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
44 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
45 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
46 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
47 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
48 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
49 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
50 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
51 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
52 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
53 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
54 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
55 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
56 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
57 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
58 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
59 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
60 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
61 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
62 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
63 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
64 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
65 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
66 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
67 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
68 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
69 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
70 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
71 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
72 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
73 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
74 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
75 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
76 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
77 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
78 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
79 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
80 2519103095 Burkholderia sp. KJ006 Isolate Nodule
81 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
82 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
83 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
84 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
85 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
86 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
87 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
88 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
89 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
90 2547132374 Acidovorax radicis N35 Isolate Unclassified
91 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
92 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
93 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
94 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
95 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
96 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
97 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
98 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
99 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
100 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
101 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
102 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
103 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
104 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
105 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
106 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
107 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
108 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
109 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
110 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
111 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
112 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
113 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
114 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
115 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
116 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
117 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
118 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
119 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
120 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
121 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
122 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
123 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
124 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
125 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
126 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
127 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
128 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
129 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
130 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
131 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
132 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
133 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
134 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
135 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
136 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
137 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
138 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
139 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
140 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
141 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
142 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
143 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
144 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
145 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
146 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
147 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
148 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
149 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
150 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
151 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
152 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
153 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
154 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
155 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
156 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
157 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
158 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
159 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
160 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
161 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
162 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
163 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
164 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
165 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
166 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
167 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
168 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
169 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
170 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
171 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
172 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
173 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
174 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
175 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
176 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
177 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
178 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
179 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
180 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
181 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
182 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
183 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
184 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
185 2643221557 Ensifer sp. Root558 Isolate Unclassified
186 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
187 2643221569 Achromobacter sp. Root565 Isolate Unclassified
188 2643221570 Acidovorax sp. Root568 Isolate Unclassified
189 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
190 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
191 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
192 2643221594 Achromobacter sp. Root170 Isolate Unclassified
193 2643221596 Acidovorax sp. Root70 Isolate Unclassified
194 2643221599 Rhizobium sp. Root708 Isolate Unclassified
195 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
196 2643221607 Rhizobium sp. Root73 Isolate Unclassified
197 2643221609 Acidovorax sp. Root217 Isolate Unclassified
198 2643221610 Ensifer sp. Root74 Isolate Unclassified
199 2643221611 Acidovorax sp. Root219 Isolate Unclassified
200 2643221621 Achromobacter sp. Root83 Isolate Unclassified
201 2643221626 Ensifer sp. Root31 Isolate Unclassified
202 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
203 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
204 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
205 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
206 2643221652 Acidovorax sp. Root402 Isolate Unclassified
207 2643221659 Ensifer sp. Root127 Isolate Unclassified
208 2643221668 Ensifer sp. Root423 Isolate Unclassified
209 2643221675 Ensifer sp. Root1298 Isolate Unclassified
210 2643221680 Ensifer sp. Root1312 Isolate Unclassified
211 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
212 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
213 2643221688 Rhizobium sp. Root482 Isolate Unclassified
214 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
215 2643221698 Ensifer sp. Root142 Isolate Unclassified
216 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
217 2643221717 Acidovorax sp. Root267 Isolate Unclassified
218 2643221723 Ensifer sp. Root278 Isolate Unclassified
219 2643221726 Ensifer sp. Root954 Isolate Unclassified
220 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
221 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
222 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
223 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
224 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
225 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
226 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
227 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
228 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
229 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
230 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
231 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
232 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
233 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
234 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
235 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
236 2718217882 Rhizobium sp. N741 Isolate Nodule
237 2718217927 Rhizobium sp. N324 Isolate Nodule
238 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
239 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
240 2718218009 Rhizobium sp. N561 Isolate Nodule
241 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
242 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
243 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
244 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
245 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
246 2718218363 Rhizobium sp. N113 Isolate Nodule
247 2718218365 Rhizobium sp. N731 Isolate Nodule
248 2718218366 Rhizobium sp. N621 Isolate Nodule
249 2718218423 Rhizobium sp. N941 Isolate Nodule
250 2721755514 Rhizobium sp. N6212 Isolate Nodule
251 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
252 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
253 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
254 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
255 2721755809 Rhizobium sp. N541 Isolate Nodule
256 2721755810 Rhizobium sp. N871 Isolate Nodule
257 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
258 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
259 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
260 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
261 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
262 2728369365 Rhizobium sp. N1341 Isolate Nodule
263 2728369397 Rhizobium sp. N1314 Isolate Nodule
264 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
265 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
266 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
267 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
268 2738541293 Rhizobium sp. GV031 Isolate Unclassified
269 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
270 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
271 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
272 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
273 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
274 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
275 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
276 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
277 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
278 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
279 2738543012 Acidovorax sp. CF301 Isolate Unclassified
280 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
281 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
282 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
283 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
284 2738543024 Aminobacter sp. AP02 Isolate Unclassified
285 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
286 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
287 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
288 2739367700 Dyella sp. YR388 Isolate Unclassified
289 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
290 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
291 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
292 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
293 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
294 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
295 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
296 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
297 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
298 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
299 2773857670 Pseudomonas sp. 478 Isolate Unclassified
300 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
301 2773857673 Pseudomonas sp. 443 Isolate Unclassified
302 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
303 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
304 2784132063 Pseudomonas sp. 424 Isolate Unclassified
305 2784132072 Pseudomonas sp. 460 Isolate Unclassified
306 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
307 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
308 2791355256 Rhizobium sp. M10 Isolate Nodule
309 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
310 2791355260 Rhizobium sp. L9 Isolate Nodule
311 2791355261 Rhizobium sp. J15 Isolate Nodule
312 2791355262 Rhizobium sp. M1 Isolate Nodule
313 2791355263 Rhizobium chutanense C5 Isolate Nodule
314 2791355264 Rhizobium sp. S9 Isolate Nodule
315 2791355265 Rhizobium sp. H4 Isolate Nodule
316 2791355266 Rhizobium sp. L43 Isolate Nodule
317 2791355267 Rhizobium sp. L18 Isolate Nodule
318 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
319 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
320 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
321 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
322 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
323 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
324 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
325 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
326 2802429633 Rhizobium anhuiense J3 Isolate Nodule
327 2802429634 Rhizobium anhuiense S10 Isolate Nodule
328 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
329 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
330 2802429637 Rhizobium anhuiense C15 Isolate Nodule
331 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
332 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
333 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
334 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
335 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
336 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
337 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
338 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
339 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
340 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
341 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
342 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
343 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
344 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
345 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
346 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
347 2808606394 Promicromonospora sp. C35 Isolate Unclassified
348 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
349 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
350 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
351 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
352 2816332133 Acidovorax radicis 2721A Isolate Unclassified
353 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
354 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
355 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
356 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
357 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
358 2818991436 Collimonas arenae 515 Isolate Unclassified
359 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
360 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
361 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
362 2818991450 Burkholderia sp. 604 Isolate Unclassified
363 2818991452 Burkholderia cepacia 561 Isolate Unclassified
364 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
365 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
366 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
367 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
368 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
369 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
370 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
371 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
372 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
373 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
374 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
375 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
376 2838048938 Rhizobium pisi 27/80 Isolate Nodule
377 2838061910 Rhizobium phaseoli L15 Isolate Nodule
378 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
379 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
380 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
381 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
382 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
383 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
384 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
385 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
386 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
387 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
388 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
389 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
390 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
391 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
392 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
393 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
394 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
395 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
396 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
397 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
398 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
399 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
400 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
401 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
402 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
403 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
404 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
405 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
406 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
407 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
408 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
409 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
410 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
411 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
412 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
413 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
414 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
415 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
416 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
417 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
418 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
419 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
420 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
421 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
422 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
423 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
424 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
425 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
426 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
427 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
428 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
429 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
430 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
431 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
432 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
433 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
434 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
435 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
436 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
437 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
438 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
439 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
440 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
441 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
442 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
443 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
444 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
445 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
446 2842682962 Bacillus sp. R-72492 Isolate Unclassified
447 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
448 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
449 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
450 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
451 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
452 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
453 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
454 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
455 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
456 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
457 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
458 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
459 2844163670 Ensifer sp. 1H6 Isolate Unclassified
460 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
461 2849139964 Bacillus sp. R-71875 Isolate Unclassified
462 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
463 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
464 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
465 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
466 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
467 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
468 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
469 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
470 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
471 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
472 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
473 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
474 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
475 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
476 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
477 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
478 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
479 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
480 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
481 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
482 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
483 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
484 2858950400 Achromobacter sp. K91 Isolate Unclassified
485 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
486 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
487 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
488 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
489 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
490 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
491 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
492 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
493 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
494 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
495 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
496 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
497 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
498 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
499 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
500 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
501 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
502 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
503 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
504 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
505 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
506 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
507 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
508 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
509 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
510 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
511 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
512 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
513 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
514 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
515 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
516 2884411467 Dyella sp. AD56 Isolate Rhizosphere
517 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
518 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
519 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
520 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
521 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
522 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
523 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
524 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
525 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
526 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
527 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
528 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
529 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
530 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
531 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
532 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
533 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
534 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
535 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
536 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
537 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
538 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
539 2904564687 Burkholderia sp. 571 Isolate Unclassified
540 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
541 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
542 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
543 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
544 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
545 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
546 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
547 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
548 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
549 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
550 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
551 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
552 2909042592 Labrys sp. LIt4 Isolate Nodule
553 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
554 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
555 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
556 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
557 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
558 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
559 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
560 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
561 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
562 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
563 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
564 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
565 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
566 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
567 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
568 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
569 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
570 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
571 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
572 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
573 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
574 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
575 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
576 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
577 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
578 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
579 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
580 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
581 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
582 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
583 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
584 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
585 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
586 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
587 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
588 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
589 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
590 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
591 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
592 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
593 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
594 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
595 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
596 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
597 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
598 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
599 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
600 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
601 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
602 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
603 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
604 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
605 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
606 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
607 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
608 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
609 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
610 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
611 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
612 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
613 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
614 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
615 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
616 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
617 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
618 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
619 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
620 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
621 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
622 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
623 2928163908 Burkholderia sp. 567 Isolate Unclassified
624 2928170801 Burkholderia sp. 572 Isolate Unclassified
625 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
626 2928536128 Burkholderia sola 565 Isolate Unclassified
627 2928963466 Dyella japonica 1073 Isolate Unclassified
628 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
629 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
630 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
631 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
632 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
633 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
634 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
635 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
636 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
637 2933599457 Rhizobium phaseoli M3 Isolate Nodule
638 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
639 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
640 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
641 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
642 2936381700 Rhizobium chutanense C16 Isolate Unclassified
643 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
644 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
645 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
646 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
647 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
648 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
649 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
650 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
651 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
652 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
653 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
654 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
655 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
656 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
657 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
658 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
659 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
660 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
661 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
662 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
663 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
664 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
665 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
666 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
667 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
668 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
669 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
670 2941479691
671 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
672 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
673 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
674 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
675 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
676 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
677 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
678 2952252522 Salinicola sp. DM10 Isolate Unclassified
679 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
680 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
681 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
682 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
683 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
684 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
685 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
686 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
687 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
688 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
689 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
690 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
691 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
692 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
693 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
694 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
695 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
696 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
697 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
698 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
699 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
700 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
701 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
702 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
703 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
704 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
705 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
706 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
707 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
708 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
709 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
710 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
711 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
712 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
713 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
714 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
715 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
716 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
717 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
718 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
719 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
720 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
721 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
722 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
723 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
724 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
725 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
726 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
727 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
728 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
729 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
730 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
731 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
732 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
733 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
734 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
735 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
736 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
737 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
738 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
739 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
740 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
741 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
742 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
743 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
744 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
745 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
746 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
747 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
748 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
749 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
750 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
751 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
752 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
753 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
754 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
755 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
756 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
757 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
758 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
759 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
760 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
761 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
762 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
763 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
764 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
765 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
766 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
767 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
768 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
769 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
770 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
771 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
772 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
773 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
774 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
775 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
776 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
777 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
778 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
779 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
780 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
781 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
782 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
783 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
784 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
785 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
786 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
787 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
788 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
789 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
790 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
791 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
792 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
793 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
794 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
795 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
796 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
797 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
798 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
799 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
800 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
801 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
802 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
803 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
804 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
805 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
806 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
807 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
808 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
809 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
810 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
811 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
812 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
813 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
814 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
815 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
816 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
817 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
818 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
819 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
820 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
821 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
822 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
823 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
824 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
825 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
826 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
827 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
828 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
829 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
830 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
831 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
832 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
833 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
834 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
835 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
836 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
837 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
838 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
839 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
840 3004167301 Mesorhizobium loti 582 Isolate Unclassified
841 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
842 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
843 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
844 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
845 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
846 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
847 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
848 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
849 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
850 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
851 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
852 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
853 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
854 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
855 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
856 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
857 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
858 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
859 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
860 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
861 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
862 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
863 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
864 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
865 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
866 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
867 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
868 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
869 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
870 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
871 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
872 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
873 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
874 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
875 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
876 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
877 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
878 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
879 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
880 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
881 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
882 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
883 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
884 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
885 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
886 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
887 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
888 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
889 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
890 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
891 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
892 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
893 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
894 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
895 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
896 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
897 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
898 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
899 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
900 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
901 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
902 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
903 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
904 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
905 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
906 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
907 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
908 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
909 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
910 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
911 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
912 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
913 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
914 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
915 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
916 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
917 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
918 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
919 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
920 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
921 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
922 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
923 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
924 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
925 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
926 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
927 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
928 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
929 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
930 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
931 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
932 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
933 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
934 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
935 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
936 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
937 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
938 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
939 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
940 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
941 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
942 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
943 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
944 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
945 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
946 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
947 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
948 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
949 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
950 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
951 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
952 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
953 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
954 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
955 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
956 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
957 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
958 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
959 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
960 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
961 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
962 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
963 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
964 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
965 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
966 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
967 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
968 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
969 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
970 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
971 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
972 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
973 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
974 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
975 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
976 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
977 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
978 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
979 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
980 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
981 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
982 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
983 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
984 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
985 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
986 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
987 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
988 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
989 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
990 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
991 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
992 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
993 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
994 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
995 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
996 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
997 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
998 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
999 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
1000 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
1001 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
1002 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
1003 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
1004 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
1005 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
1006 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
1007 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
1008 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
1009 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
1010 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
1011 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
1012 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
1013 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
1014 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
1015 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
1016 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
1017 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
1018 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
1019 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
1020 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
1021 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
1022 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
1023 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
1024 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
1025 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
1026 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
1027 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
1028 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
1029 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
1030 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
1031 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
1032 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1033 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
1034 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
1035 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
1036 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
1037 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
1038 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1039 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
1040 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
1041 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
1042 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
1043 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
1044 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
1045 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
1046 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
1047 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
1048 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
1049 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
1050 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1051 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1052 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1053 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1054 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1055 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1056 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1057 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
1058 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1059 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1060 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1061 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1062 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1063 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1064 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1065 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1066 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1067 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1068 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1069 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1070 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1071 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1072 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1073 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1074 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1075 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1076 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1077 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1078 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1079 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1080 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1081 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
1082 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1083 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1084 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1085 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1086 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1087 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1088 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1089 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1090 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1091 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1092 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1093 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1094 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1095 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1096 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1097 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1098 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1099 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1106 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
1107 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
1108 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
1109 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
1110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
1111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
1114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
1115 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
1116 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
1117 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
1118 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
1119 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
1120 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
1121 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
1122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
1123 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
1124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
1125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
1126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
1127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
1128 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
1129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
1130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
1131 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
1132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
1133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
1134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
1135 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
1136 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
1137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
1138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
1139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
1140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
1141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1146 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
1147 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
1148 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
1149 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
1150 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
1151 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
1152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
1153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
1154 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
1155 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
1156 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
1157 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
1158 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
1159 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
1160 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
1161 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
1162 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
1163 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
1164 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
1165 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
1166 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
1167 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
1168 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
1169 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
1170 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
1171 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
1172 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
1173 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
1174 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
1175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
1176 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
1177 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
1178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
1179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
1180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
1181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
1182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
1183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
1184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
1185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
1186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
1187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
1188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
1189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
1190 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
1191 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
1192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
1193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
1194 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
1195 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
1196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1197 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
1199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
1200 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
1201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
1202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
1203 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
1205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
1206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
1207 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
1208 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
1210 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
1211 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
1212 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
1213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
1214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
1215 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1216 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
1217 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
1218 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
1219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
1220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
1221 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1222 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
1223 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
1224 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1225 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
1226 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
1228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
1229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
1230 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
1232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
1233 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
1234 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1235 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
1236 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
1237 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
1238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
1239 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
1240 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
1242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
1244 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
1245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
1247 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
1248 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
1249 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
1251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
1252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
1253 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
1254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
1255 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
1256 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
1257 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
1258 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
1259 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
1260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1261 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
1262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
1263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1264 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
1265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1266 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
1268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
1269 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
1270 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
1271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
1272 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
1273 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
1274 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1275 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
1276 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1277 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
1278 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
1279 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
1280 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
1281 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1295 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1297 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1298 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1299 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1301 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1302 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1303 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1306 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
1307 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
1308 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1309 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1310 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1311 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1312 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1313 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1314 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1315 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1316 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1317 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1318 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1319 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1320 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1321 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1322 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1323 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1324 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1325 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1327 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
1328 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
1329 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1330 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
1331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1332 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1333 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1334 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1335 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1336 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1337 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1338 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
1339 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1340 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1341 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1342 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1343 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1344 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1345 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1346 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1347 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1348 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1349 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
1350 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1351 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
1352 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
1353 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
1354 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
1355 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
1356 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
1357 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1358 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1359 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1360 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
1361 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
1362 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1363 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1364 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1365 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1366 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1367 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1368 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1369 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1370 8005275841 Rhizobium sp. N4311 Isolate Nodule
1371 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1372 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1373 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1374 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1375 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1376 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1377 8005382845 Rhizobium sp. R634 Isolate Nodule
1378 8005395548 Rhizobium sp. R339 Isolate Nodule
1379 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1380 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1381 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1382 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1383 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1384 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1385 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1386 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1387 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1388 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1389 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1390 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1391 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1392 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1393 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1394 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
1395 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
1396 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
1397 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1398 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1399 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1400 8018176218 Rhizobium sp. N122 Isolate Nodule
1401 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
1402 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
1403 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
1404 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
1405 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
1406 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
1407 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
1408 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
1409 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1410 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1411 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1412 8024501048 Rhizobium sp. H4 Isolate Nodule
1413 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
1414 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
1415 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
1416 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
1417 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1418 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
1419 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
1420 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
1421 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
1422 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
1423 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
1424 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
1425 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
1426 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
1427 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
1428 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
1429 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
1430 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
1431 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
1432 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
1433 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
1434 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1435 8056382006 Rhizobium croatiense 13T Isolate Nodule
1436 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
1437 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
1438 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
1439 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
1440 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1441 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 66.02
Metatranscriptomes 0.25
Isolates 33.73

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 14.13
Nodule 18.59
Rhizoplane 2.95
Rhizosphere 50.28
Stem 0
Stem Tuber 0
Unclassified 13.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_1574 2124908027 Bacteria 11607
2 MRS2a_Contig_7117 2124908027 Bacteria 3106
3 SwRhRL2b_contig_656453 2162886007 Bacteria 2013
4 LJNas_1000019 3300000546 Bacteria 21615
5 JGI24741J21665_1003171 3300001915 Bacteria 4018
6 JGI24740J21852_10000251 3300001979 Bacteria 22787
7 JGI24740J21852_10025962 3300001979 Bacteria 1967
8 JGI24739J22299_10002246 3300001989 Bacteria 7425
9 JGI24739J22299_10010413 3300001989 Bacteria 3453
10 JGI24739J22299_10016407 3300001989 Bacteria 2681
11 JGI24739J22299_10028970 3300001989 Bacteria 1929
12 JGI24737J22298_10005314 3300001990 Bacteria 4454
13 JGI24737J22298_10013296 3300001990 Bacteria 2680
14 JGI24735J21928_10000746 3300002067 Bacteria 11582
15 JGI24735J21928_10003472 3300002067 Bacteria 5369
16 JGI24735J21928_10034200 3300002067 Bacteria 1499
17 JGI24738J21930_10001078 3300002075 Bacteria 7735
18 JGI25155J39150_1000012 3300002704 Bacteria 199435
19 JGI25155J39150_1000255 3300002704 Bacteria 20336
20 JGI25155J39150_1000546 3300002704 Bacteria 8569
21 JGI25155J39150_1001072 3300002704 Bacteria 2796
22 JGI25156J39149_1000049 3300002705 Bacteria 91988
23 JGI25156J39149_1000527 3300002705 Bacteria 22068
24 JGI25156J39149_1001036 3300002705 Bacteria 12935
25 JGI25156J39149_1002069 3300002705 Bacteria 7619
26 JGI25156J39149_1003564 3300002705 Bacteria 5047
27 JGI25156J39149_1003955 3300002705 Bacteria 4682
28 JGI25162J39368_1000063 3300002737 Bacteria 134747
29 JGI25162J39368_1000287 3300002737 Bacteria 47192
30 JGI25162J39368_1000421 3300002737 Bacteria 34311
31 JGI25162J39368_1000753 3300002737 Bacteria 22009
32 JGI25162J39368_1001046 3300002737 Bacteria 17014
33 JGI25162J39368_1002965 3300002737 Bacteria 5663
34 JGI25154J39366_1000033 3300002738 Bacteria 184379
35 JGI25154J39366_1000732 3300002738 Bacteria 14765
36 JGI25154J39366_1000768 3300002738 Bacteria 14234
37 JGI25154J39366_1005939 3300002738 Bacteria 1861
38 JGI25158J39367_1000032 3300002739 Bacteria 30976
39 JGI25157J39369_1000055 3300002741 Bacteria 107875
40 JGI25157J39369_1000217 3300002741 Bacteria 47210
41 JGI25157J39369_1000549 3300002741 Bacteria 22462
42 JGI25157J39369_1001301 3300002741 Bacteria 9988
43 JGI25163J39215_1000201 3300002771 Bacteria 23245
44 JGI25163J39215_1000677 3300002771 Bacteria 9056
45 JGI25164J39214_1000064 3300002772 Bacteria 107073
46 JGI25164J39214_1000296 3300002772 Bacteria 34311
47 JGI25164J39214_1000412 3300002772 Bacteria 24378
48 JGI25164J39214_1000586 3300002772 Bacteria 16340
49 JGI25164J39214_1000672 3300002772 Bacteria 13810
50 JGI25152J39213_1004254 3300002773 Bacteria 4575
51 JGI25152J39213_1008986 3300002773 Bacteria 2419
52 JGI25152J39213_1008994 3300002773 Bacteria 2416
53 JGI25152J39213_1011389 3300002773 Bacteria 1970
54 JGI25150J39212_1008933 3300002774 Bacteria 1935
55 JGI25159J45721_1000052 3300002987 Bacteria 57175
56 JGI25159J45721_1000123 3300002987 Bacteria 36902
57 JGI25159J45721_1001948 3300002987 Bacteria 8221
58 JGI25151J46595_10000611 3300003187 Bacteria 31284
59 JGI25151J46595_10005785 3300003187 Bacteria 6329
60 JGI25151J46595_10016124 3300003187 Bacteria 3274
61 JGI25151J46595_10036121 3300003187 Bacteria 1868
62 JGI25165J46597_1000035 3300003214 Bacteria 290723
63 JGI25165J46597_1000069 3300003214 Bacteria 195460
64 JGI25165J46597_1000388 3300003214 Bacteria 47192
65 JGI25165J46597_1000528 3300003214 Bacteria 35737
66 JGI25165J46597_1001054 3300003214 Bacteria 17773
67 JGI25165J46597_1001292 3300003214 Bacteria 14518
68 JGI25165J46597_1005308 3300003214 Bacteria 2516
69 JGI25153J46596_10000670 3300003215 Bacteria 20957
70 JGI25153J46596_10001189 3300003215 Bacteria 15728
71 JGI25153J46596_10003140 3300003215 Bacteria 9317
72 JGI25153J46596_10021317 3300003215 Bacteria 2419
73 JGI25153J46596_10021348 3300003215 Bacteria 2416
74 JGI25153J46596_10029685 3300003215 Bacteria 1873
75 JGI25160J50197_1000006 3300003354 Bacteria 316247
76 JGI25160J50197_1000007 3300003354 Bacteria 316012
77 JGI25160J50197_1000112 3300003354 Bacteria 76612
78 JGI25161J50226_1000004 3300003374 Bacteria 316212
79 JGI25161J50226_1000129 3300003374 Bacteria 53598
80 JGI25161J50226_1000648 3300003374 Bacteria 13978
81 JGI25161J50226_1005966 3300003374 Bacteria 2270
82 Ga0006562J51391_1183124 3300003578 Bacteria 5180
83 Ga0006562J51391_1183125 3300003578 Bacteria 4980
84 Ga0055538_1000008 3300003751 Bacteria 398547
85 Ga0055538_1000012 3300003751 Bacteria 353826
86 Ga0055538_1000034 3300003751 Bacteria 195460
87 Ga0055539_1000012 3300003752 Bacteria 398547
88 Ga0055539_1000017 3300003752 Bacteria 353873
89 Ga0055539_1000044 3300003752 Bacteria 195460
90 Ga0055539_1001291 3300003752 Bacteria 4933
91 Ga0055539_1006155 3300003752 Bacteria 1539
92 Ga0055533_1000015 3300003756 Bacteria 398547
93 Ga0055533_1000021 3300003756 Bacteria 353826
94 Ga0055533_1000055 3300003756 Bacteria 195460
95 Ga0055533_1001195 3300003756 Bacteria 7277
96 Ga0055533_1001332 3300003756 Bacteria 6686
97 Ga0055533_1001997 3300003756 Bacteria 4973
98 Ga0055532_1000005 3300003758 Bacteria 458107
99 Ga0055532_1000012 3300003758 Bacteria 382698
100 Ga0055532_1000020 3300003758 Bacteria 270853
101 Ga0055525_1000017 3300003759 Bacteria 398547
102 Ga0055525_1000043 3300003759 Bacteria 268656
103 Ga0055525_1000066 3300003759 Bacteria 195460
104 Ga0055525_1000117 3300003759 Bacteria 120690
105 Ga0055527_1000011 3300003760 Bacteria 354560
106 Ga0055527_1000226 3300003760 Bacteria 36179
107 Ga0055527_1000243 3300003760 Bacteria 33717
108 Ga0055527_1005570 3300003760 Bacteria 1629
109 Ga0055535_1000009 3300003761 Bacteria 382698
110 Ga0055535_1000335 3300003761 Bacteria 47184
111 Ga0055535_1000515 3300003761 Bacteria 33711
112 Ga0055535_1000518 3300003761 Bacteria 33624
113 Ga0055535_1000629 3300003761 Bacteria 28178
114 Ga0055535_1001383 3300003761 Bacteria 12604
115 Ga0055542_1000015 3300003762 Bacteria 382698
116 Ga0055542_1000363 3300003762 Bacteria 47192
117 Ga0055542_1000393 3300003762 Bacteria 43699
118 Ga0055542_1000434 3300003762 Bacteria 40153
119 Ga0055542_1000537 3300003762 Bacteria 33711
120 Ga0055542_1000661 3300003762 Bacteria 28178
121 Ga0055529_1000011 3300003763 Bacteria 382698
122 Ga0055529_1000391 3300003763 Bacteria 47192
123 Ga0055529_1000409 3300003763 Bacteria 45120
124 Ga0055529_1000519 3300003763 Bacteria 33717
125 Ga0055529_1000601 3300003763 Bacteria 27817
126 Ga0055526_1001100 3300003771 Bacteria 19639
127 Ga0055526_1002853 3300003771 Bacteria 11397
128 Ga0055526_1003392 3300003771 Bacteria 10146
129 Ga0055526_1004773 3300003771 Bacteria 8026
130 Ga0055526_1010390 3300003771 Bacteria 4336
131 Ga0055526_1017002 3300003771 Bacteria 2807
132 Ga0055537_1000426 3300003773 Bacteria 27485
133 Ga0055524_1000262 3300003775 Bacteria 53062
134 Ga0055524_1000376 3300003775 Bacteria 38929
135 Ga0055524_1000429 3300003775 Bacteria 35268
136 Ga0055524_1011159 3300003775 Bacteria 3531
137 Ga0055536_1000126 3300003781 Bacteria 65482
138 Ga0055536_1000519 3300003781 Bacteria 26575
139 Ga0055536_1000581 3300003781 Bacteria 24895
140 Ga0055536_1002169 3300003781 Bacteria 11186
141 Ga0055536_1004583 3300003781 Bacteria 7009
142 Ga0055536_1014189 3300003781 Bacteria 2817
143 Ga0055534_1000518 3300003784 Bacteria 20801
144 Ga0055528_1000040 3300003790 Bacteria 112553
145 Ga0055528_1000186 3300003790 Bacteria 52663
146 Ga0055528_1000718 3300003790 Bacteria 23387
147 Ga0055528_1002246 3300003790 Bacteria 10517
148 Ga0055528_1002418 3300003790 Bacteria 10030
149 Ga0055528_1003731 3300003790 Bacteria 7516
150 Ga0055528_1005253 3300003790 Bacteria 6075
151 Ga0055528_1006219 3300003790 Bacteria 5438
152 Ga0055530_10000132 3300003791 Bacteria 65482
153 Ga0055530_10000240 3300003791 Bacteria 49322
154 Ga0055530_10000671 3300003791 Bacteria 29135
155 Ga0055530_10000778 3300003791 Bacteria 26608
156 Ga0055530_10001374 3300003791 Bacteria 18030
157 Ga0055530_10007126 3300003791 Bacteria 4791
158 Ga0055540_1000248 3300003792 Bacteria 49322
159 Ga0055540_1000400 3300003792 Bacteria 35238
160 Ga0055540_1000780 3300003792 Bacteria 21598
161 Ga0055540_1000954 3300003792 Bacteria 18781
162 Ga0055540_1004383 3300003792 Bacteria 6397
163 Ga0055540_1004497 3300003792 Bacteria 6256
164 Ga0055540_1006733 3300003792 Bacteria 4497
165 Ga0055531_10004609 3300003794 Bacteria 8294
166 Ga0055531_10005677 3300003794 Bacteria 7242
167 Ga0055531_10006687 3300003794 Bacteria 6463
168 Ga0055531_10029714 3300003794 Bacteria 1854
169 Ga0055541_1000009 3300003841 Bacteria 398547
170 Ga0055541_1000012 3300003841 Bacteria 353826
171 Ga0055541_1000032 3300003841 Bacteria 195460
172 Ga0058692_1000009 3300003856 Bacteria 349545
173 Ga0058692_1001699 3300003856 Bacteria 7887
174 Ga0058692_1011584 3300003856 Bacteria 2124
175 Ga0055543_1000002 3300004625 Bacteria 390020
176 Ga0055543_1000029 3300004625 Bacteria 131452
177 Ga0055543_1000120 3300004625 Bacteria 66419
178 Ga0065165_1000011 3300005262 Bacteria 316465
179 Ga0065165_1000340 3300005262 Bacteria 76653
180 Ga0065165_1001337 3300005262 Bacteria 27348
181 Ga0065165_1005342 3300005262 Bacteria 7296
182 Ga0065165_1005358 3300005262 Bacteria 7274
183 Ga0065165_1005608 3300005262 Bacteria 6953
184 Ga0065165_1013531 3300005262 Bacteria 3236
185 Ga0065714_10000104 3300005288 Bacteria 10640
186 Ga0065714_10003301 3300005288 Bacteria 14194
187 Ga0065704_10009257 3300005289 Bacteria 4670
188 Ga0065704_10070222 3300005289 Bacteria 63342
189 Ga0065712_10000132 3300005290 Bacteria 73390
190 Ga0065712_10007303 3300005290 Bacteria 3605
191 Ga0065712_10090203 3300005290 Bacteria 2403
192 Ga0070658_10028890 3300005327 Bacteria 4452
193 Ga0070658_10063809 3300005327 Bacteria 3004
194 Ga0070683_100021797 3300005329 Bacteria 5720
195 Ga0070690_100035152 3300005330 Bacteria 3144
196 Ga0070670_100000258 3300005331 Bacteria 47306
197 Ga0070670_100001188 3300005331 Bacteria 20637
198 Ga0070670_100001386 3300005331 Bacteria 19431
199 Ga0068869_100001960 3300005334 Bacteria 12331
200 Ga0068869_100200683 3300005334 Bacteria 1573
201 Ga0070666_10000016 3300005335 Bacteria 198246
202 Ga0070666_10016846 3300005335 Bacteria 4679
203 Ga0070680_100010046 3300005336 Bacteria 7291
204 Ga0070682_100003944 3300005337 Bacteria 8239
205 Ga0070682_100091778 3300005337 Bacteria 1988
206 Ga0070660_100000056 3300005339 Bacteria 66748
207 Ga0070660_100001525 3300005339 Bacteria 15894
208 Ga0070660_100030905 3300005339 Bacteria 4019
209 Ga0070660_100097668 3300005339 Bacteria 2324
210 Ga0070660_100105084 3300005339 Bacteria 2240
211 Ga0070660_100114547 3300005339 Bacteria 2148
212 Ga0070689_100020485 3300005340 Bacteria 4908
213 Ga0070661_100000146 3300005344 Bacteria 58043
214 Ga0070661_100023158 3300005344 Bacteria 4450
215 Ga0070661_100028844 3300005344 Bacteria 4004
216 Ga0070661_100190829 3300005344 Bacteria 1563
217 Ga0070668_100004033 3300005347 Bacteria 10859
218 Ga0070668_100024332 3300005347 Bacteria 4587
219 Ga0070669_100000153 3300005353 Bacteria 62355
220 Ga0070669_100029899 3300005353 Bacteria 3929
221 Ga0070675_100039079 3300005354 Bacteria 3870
222 Ga0070675_100345761 3300005354 Bacteria 1318
223 Ga0070671_100003307 3300005355 Bacteria 12581
224 Ga0070671_100046175 3300005355 Bacteria 3622
225 Ga0070671_100151417 3300005355 Bacteria 1959
226 Ga0070673_100020736 3300005364 Bacteria 4745
227 Ga0070673_100021478 3300005364 Bacteria 4681
228 Ga0070688_100047145 3300005365 Bacteria 2672
229 Ga0070688_100117600 3300005365 Bacteria 1776
230 Ga0070659_100000079 3300005366 Bacteria 74255
231 Ga0070659_100018894 3300005366 Bacteria 5207
232 Ga0070659_100022360 3300005366 Bacteria 4827
233 Ga0070659_100217375 3300005366 Bacteria 1576
234 Ga0070659_100350853 3300005366 Bacteria 1238
235 Ga0070667_100061137 3300005367 Bacteria 3189
236 Ga0070667_100101645 3300005367 Bacteria 2484
237 Ga0070667_100112641 3300005367 Bacteria 2360
238 Ga0070667_100117535 3300005367 Bacteria 2310
239 Ga0070667_100235784 3300005367 Bacteria 1632
240 Ga0070714_100033331 3300005435 Bacteria 4305
241 Ga0070714_100054626 3300005435 Bacteria 3412
242 Ga0070713_100166217 3300005436 Bacteria 1973
243 Ga0070663_100027442 3300005455 Bacteria 3867
244 Ga0070663_100142519 3300005455 Bacteria 1831
245 Ga0070678_100009479 3300005456 Bacteria 5903
246 Ga0070678_100016310 3300005456 Bacteria 4750
247 Ga0070678_100034861 3300005456 Bacteria 3508
248 Ga0070678_100221508 3300005456 Bacteria 1573
249 Ga0070662_100000562 3300005457 Bacteria 22575
250 Ga0070662_100009714 3300005457 Bacteria 6296
251 Ga0070681_10058975 3300005458 Bacteria 3818
252 Ga0070681_10117591 3300005458 Bacteria 2595
253 Ga0070681_10424763 3300005458 Bacteria 1241
254 Ga0068867_100002132 3300005459 Bacteria 13898
255 Ga0068867_100039853 3300005459 Bacteria 3426
256 Ga0070679_100012938 3300005530 Bacteria 7992
257 Ga0070679_100013191 3300005530 Bacteria 7910
258 Ga0070679_100326600 3300005530 Bacteria 1483
259 Ga0070684_100001235 3300005535 Bacteria 18342
260 Ga0068853_100000184 3300005539 Bacteria 43882
261 Ga0068853_100003976 3300005539 Bacteria 11360
262 Ga0068853_100117246 3300005539 Bacteria 2371
263 Ga0070672_100107480 3300005543 Bacteria 2270
264 Ga0070665_100000322 3300005548 Bacteria 73995
265 Ga0070665_100012164 3300005548 Bacteria 8676
266 Ga0070665_100012285 3300005548 Bacteria 8632
267 Ga0070665_100019293 3300005548 Bacteria 6841
268 Ga0070665_100022869 3300005548 Bacteria 6293
269 Ga0070665_100034909 3300005548 Bacteria 5059
270 Ga0070665_100165839 3300005548 Bacteria 2211
271 Ga0068855_100000423 3300005563 Bacteria 52174
272 Ga0068855_100000557 3300005563 Bacteria 45786
273 Ga0068855_100003248 3300005563 Bacteria 19878
274 Ga0068855_100008781 3300005563 Bacteria 12214
275 Ga0068855_100015021 3300005563 Bacteria 9326
276 Ga0068855_100070479 3300005563 Bacteria 4067
277 Ga0068855_100098068 3300005563 Bacteria 3376
278 Ga0068855_100106722 3300005563 Bacteria 3218
279 Ga0068855_100183432 3300005563 Bacteria 2365
280 Ga0068855_100193924 3300005563 Bacteria 2289
281 Ga0068855_100247353 3300005563 Bacteria 1990
282 Ga0068855_100408244 3300005563 Bacteria 1487
283 Ga0070664_100000049 3300005564 Bacteria 71805
284 Ga0070664_100055289 3300005564 Bacteria 3369
285 Ga0068857_100008513 3300005577 Bacteria 8870
286 Ga0068857_100122495 3300005577 Bacteria 2342
287 Ga0068857_100143152 3300005577 Bacteria 2162
288 Ga0068854_100000054 3300005578 Bacteria 84435
289 Ga0068854_100000699 3300005578 Bacteria 19878
290 Ga0068854_100002224 3300005578 Bacteria 11931
291 Ga0068854_100065113 3300005578 Bacteria 2649
292 Ga0068854_100072572 3300005578 Bacteria 2520
293 Ga0068856_100000157 3300005614 Bacteria 70380
294 Ga0068856_100010013 3300005614 Bacteria 9207
295 Ga0068856_100023950 3300005614 Bacteria 5938
296 Ga0068856_100071585 3300005614 Bacteria 3432
297 Ga0068856_100191047 3300005614 Bacteria 2061
298 Ga0068856_100206281 3300005614 Bacteria 1980
299 Ga0068852_100001139 3300005616 Bacteria 17577
300 Ga0068852_100004003 3300005616 Bacteria 10362
301 Ga0068852_100012051 3300005616 Bacteria 6544
302 Ga0068852_100030384 3300005616 Bacteria 4446
303 Ga0068852_100114517 3300005616 Bacteria 2457
304 Ga0068852_100245786 3300005616 Bacteria 1712
305 Ga0068859_100011168 3300005617 Bacteria 9029
306 Ga0068864_100005889 3300005618 Bacteria 10046
307 Ga0068866_10024422 3300005718 Bacteria 2826
308 Ga0068861_100013381 3300005719 Bacteria 5742
309 Ga0068851_10000018 3300005834 Bacteria 137425
310 Ga0068851_10140346 3300005834 Bacteria 1314
311 Ga0068870_10027147 3300005840 Bacteria 2861
312 Ga0068863_100007163 3300005841 Bacteria 10940
313 Ga0068858_100024178 3300005842 Bacteria 5661
314 Ga0068858_100069161 3300005842 Bacteria 3273
315 Ga0068860_100012152 3300005843 Bacteria 8482
316 Ga0068860_100018457 3300005843 Bacteria 6785
317 Ga0068860_100070809 3300005843 Bacteria 3315
318 Ga0068860_100250939 3300005843 Bacteria 1723
319 Ga0075368_10017657 3300006042 Bacteria 2673
320 Ga0075364_10005396 3300006051 Bacteria 7424
321 Ga0075432_10000316 3300006058 Bacteria 13593
322 Ga0075432_10008546 3300006058 Bacteria 3493
323 Ga0075362_10054628 3300006177 Bacteria 1795
324 Ga0075367_10171404 3300006178 Bacteria 1352
325 Ga0075367_10203499 3300006178 Bacteria 1237
326 Ga0075369_10018610 3300006186 Bacteria 2830
327 Ga0075369_10065045 3300006186 Bacteria 1598
328 Ga0075366_10001966 3300006195 Bacteria 10401
329 Ga0097621_100002735 3300006237 Bacteria 12065
330 Ga0097621_100012639 3300006237 Bacteria 6266
331 Ga0097621_100025700 3300006237 Bacteria 4609
332 Ga0097621_100028731 3300006237 Bacteria 4386
333 Ga0097621_100062541 3300006237 Bacteria 3056
334 Ga0097621_100101894 3300006237 Bacteria 2416
335 Ga0075370_10000591 3300006353 Bacteria 14005
336 Ga0075370_10021524 3300006353 Bacteria 3533
337 Ga0068871_100000329 3300006358 Bacteria 33127
338 Ga0068871_100011348 3300006358 Bacteria 6532
339 Ga0068871_100035210 3300006358 Bacteria 3976
340 Ga0068871_100057184 3300006358 Bacteria 3173
341 Ga0068871_100128774 3300006358 Bacteria 2144
342 Ga0075436_100109924 3300006914 Bacteria 1923
343 Ga0097620_100011168 3300006931 Bacteria 9029
344 Ga0079104_1000029 3300006946 Bacteria 207648
345 Ga0079104_1000094 3300006946 Bacteria 130202
346 Ga0079104_1000668 3300006946 Bacteria 32257
347 Ga0079104_1004551 3300006946 Bacteria 5876
348 Ga0099826_10038409 3300006948 Bacteria 3363
349 Ga0105251_10000018 3300009011 Bacteria 142493
350 Ga0105251_10000047 3300009011 Bacteria 110996
351 Ga0105251_10000830 3300009011 Bacteria 27671
352 Ga0105251_10001501 3300009011 Bacteria 20033
353 Ga0105251_10001601 3300009011 Bacteria 19275
354 Ga0105251_10001924 3300009011 Bacteria 17001
355 Ga0105251_10002823 3300009011 Bacteria 13136
356 Ga0105251_10004604 3300009011 Bacteria 9313
357 Ga0105251_10011096 3300009011 Bacteria 5168
358 Ga0105251_10014064 3300009011 Bacteria 4444
359 Ga0105251_10016548 3300009011 Bacteria 3981
360 Ga0105244_10001003 3300009036 Bacteria 23674
361 Ga0105244_10002401 3300009036 Bacteria 14159
362 Ga0105244_10013196 3300009036 Bacteria 4839
363 Ga0105244_10014374 3300009036 Bacteria 4580
364 Ga0105244_10014929 3300009036 Bacteria 4470
365 Ga0105244_10023477 3300009036 Bacteria 3380
366 Ga0105244_10031272 3300009036 Bacteria 2825
367 Ga0105244_10045022 3300009036 Bacteria 2271
368 Ga0105244_10045134 3300009036 Bacteria 2268
369 Ga0105244_10045584 3300009036 Bacteria 2255
370 Ga0105244_10052161 3300009036 Bacteria 2083
371 Ga0105244_10055493 3300009036 Bacteria 2007
372 Ga0105244_10067421 3300009036 Bacteria 1790
373 Ga0105244_10099880 3300009036 Bacteria 1420
374 Ga0105250_10000068 3300009092 Bacteria 98087
375 Ga0105250_10000550 3300009092 Bacteria 25618
376 Ga0105250_10002212 3300009092 Bacteria 9912
377 Ga0105250_10002526 3300009092 Bacteria 9168
378 Ga0105250_10004938 3300009092 Bacteria 6048
379 Ga0105240_10000019 3300009093 Bacteria 406211
380 Ga0105240_10001844 3300009093 Bacteria 35489
381 Ga0105240_10005342 3300009093 Bacteria 19161
382 Ga0105240_10014642 3300009093 Bacteria 10701
383 Ga0105240_10017316 3300009093 Bacteria 9714
384 Ga0105240_10020280 3300009093 Bacteria 8873
385 Ga0105240_10038888 3300009093 Bacteria 6099
386 Ga0105240_10041264 3300009093 Bacteria 5892
387 Ga0105240_10092593 3300009093 Bacteria 3690
388 Ga0105240_10171679 3300009093 Bacteria 2568
389 Ga0105240_10179199 3300009093 Bacteria 2502
390 Ga0105240_10194506 3300009093 Bacteria 2382
391 Ga0105240_10243222 3300009093 Bacteria 2085
392 Ga0105240_10305407 3300009093 Bacteria 1819
393 Ga0105245_10009081 3300009098 Bacteria 8662
394 Ga0105243_10001011 3300009148 Bacteria 25990
395 Ga0105243_10005184 3300009148 Bacteria 10204
396 Ga0105243_10005610 3300009148 Bacteria 9776
397 Ga0105243_10124727 3300009148 Bacteria 2177
398 Ga0105241_10031368 3300009174 Bacteria 3979
399 Ga0105241_10152069 3300009174 Bacteria 1894
400 Ga0105242_10001632 3300009176 Bacteria 17700
401 Ga0105242_10006325 3300009176 Bacteria 9124
402 Ga0105242_10007441 3300009176 Bacteria 8430
403 Ga0105242_10228868 3300009176 Bacteria 1665
404 Ga0105248_10001466 3300009177 Bacteria 26259
405 Ga0105248_10002239 3300009177 Bacteria 21390
406 Ga0105248_10002548 3300009177 Bacteria 20287
407 Ga0105248_10020178 3300009177 Bacteria 7383
408 Ga0105248_10063147 3300009177 Bacteria 4157
409 Ga0105248_10211088 3300009177 Bacteria 2187
410 Ga0105237_10000036 3300009545 Bacteria 191142
411 Ga0105237_10000136 3300009545 Bacteria 103269
412 Ga0105237_10002463 3300009545 Bacteria 22970
413 Ga0105237_10037085 3300009545 Bacteria 4929
414 Ga0105237_10163901 3300009545 Bacteria 2222
415 Ga0105237_10167368 3300009545 Bacteria 2197
416 Ga0105237_10175660 3300009545 Bacteria 2142
417 Ga0105238_10000062 3300009551 Bacteria 126356
418 Ga0105238_10000315 3300009551 Bacteria 52804
419 Ga0105238_10013811 3300009551 Bacteria 8163
420 Ga0105238_10018759 3300009551 Bacteria 7044
421 Ga0105238_10025026 3300009551 Bacteria 6085
422 Ga0105238_10025120 3300009551 Bacteria 6072
423 Ga0105238_10033604 3300009551 Bacteria 5220
424 Ga0105238_10136732 3300009551 Bacteria 2428
425 Ga0105238_10262947 3300009551 Bacteria 1705
426 Ga0105238_10320567 3300009551 Bacteria 1536
427 Ga0105238_10333921 3300009551 Bacteria 1503
428 Ga0105249_10001344 3300009553 Bacteria 21505
429 Ga0123341_1000015 3300009765 Bacteria 86184
430 Ga0123342_1014946 3300009766 Bacteria 7243
431 Ga0123342_1024353 3300009766 Bacteria 3799
432 Ga0105239_10008574 3300010375 Bacteria 11600
433 Ga0105239_10009998 3300010375 Bacteria 10643
434 Ga0105239_10052225 3300010375 Bacteria 4482
435 Ga0105239_10061307 3300010375 Bacteria 4128
436 Ga0105239_10089130 3300010375 Bacteria 3402
437 Ga0105239_10274540 3300010375 Bacteria 1896
438 Ga0105239_10499777 3300010375 Bacteria 1382
439 Ga0105246_10000322 3300011119 Bacteria 25369
440 Ga0105246_10002126 3300011119 Bacteria 11943
441 Ga0105246_10014150 3300011119 Bacteria 5013
442 Ga0105246_10027154 3300011119 Bacteria 3747
443 Ga0157322_1000407 3300012490 Bacteria 1554
444 Ga0157345_1000091 3300012498 Bacteria 19224
445 Ga0157347_1005371 3300012502 Bacteria 1222
446 Ga0157373_10000139 3300013100 Bacteria 57722
447 Ga0157373_10000568 3300013100 Bacteria 28815
448 Ga0157373_10004735 3300013100 Bacteria 10233
449 Ga0157373_10024574 3300013100 Bacteria 4364
450 Ga0157373_10061803 3300013100 Bacteria 2653
451 Ga0157373_10062418 3300013100 Bacteria 2639
452 Ga0157373_10148867 3300013100 Bacteria 1647
453 Ga0157371_10000592 3300013102 Bacteria 43090
454 Ga0157371_10003098 3300013102 Bacteria 15412
455 Ga0157371_10006317 3300013102 Bacteria 9812
456 Ga0157371_10006521 3300013102 Bacteria 9603
457 Ga0157371_10008173 3300013102 Bacteria 8367
458 Ga0157371_10009793 3300013102 Bacteria 7516
459 Ga0157371_10010625 3300013102 Bacteria 7152
460 Ga0157371_10033820 3300013102 Bacteria 3671
461 Ga0157371_10097255 3300013102 Bacteria 2087
462 Ga0157371_10114821 3300013102 Bacteria 1912
463 Ga0157370_10003077 3300013104 Bacteria 19768
464 Ga0157370_10010853 3300013104 Bacteria 9567
465 Ga0157370_10014219 3300013104 Bacteria 8155
466 Ga0157370_10020670 3300013104 Bacteria 6570
467 Ga0157370_10024308 3300013104 Bacteria 6001
468 Ga0157370_10049765 3300013104 Bacteria 4009
469 Ga0157370_10056432 3300013104 Bacteria 3738
470 Ga0157370_10065537 3300013104 Bacteria 3437
471 Ga0157370_10077206 3300013104 Bacteria 3138
472 Ga0157370_10136690 3300013104 Bacteria 2284
473 Ga0157370_10137004 3300013104 Bacteria 2281
474 Ga0157370_10166021 3300013104 Bacteria 2053
475 Ga0157369_10000280 3300013105 Bacteria 68583
476 Ga0157369_10000525 3300013105 Bacteria 50581
477 Ga0157369_10001737 3300013105 Bacteria 26487
478 Ga0157369_10001978 3300013105 Bacteria 24687
479 Ga0157369_10003683 3300013105 Bacteria 18212
480 Ga0157369_10005341 3300013105 Bacteria 14968
481 Ga0157369_10005760 3300013105 Bacteria 14401
482 Ga0157369_10020129 3300013105 Bacteria 7462
483 Ga0157369_10083106 3300013105 Bacteria 3425
484 Ga0157369_10159836 3300013105 Bacteria 2378
485 Ga0157369_10170224 3300013105 Bacteria 2295
486 Ga0157369_10359731 3300013105 Unclassified 1511
487 Ga0171463_1002 3300013249 Bacteria 1274851
488 Ga0157374_10000138 3300013296 Bacteria 65783
489 Ga0157374_10011805 3300013296 Bacteria 7578
490 Ga0157374_10041310 3300013296 Bacteria 4250
491 Ga0157378_10004718 3300013297 Bacteria 11951
492 Ga0163162_10000239 3300013306 Bacteria 50190
493 Ga0163162_10000495 3300013306 Bacteria 36598
494 Ga0163162_10001215 3300013306 Bacteria 24072
495 Ga0163162_10135717 3300013306 Bacteria 2571
496 Ga0163162_10142660 3300013306 Bacteria 2509
497 Ga0163162_10182204 3300013306 Bacteria 2227
498 Ga0163162_10258243 3300013306 Bacteria 1874
499 Ga0157372_10008403 3300013307 Bacteria 10966
500 Ga0157372_10026402 3300013307 Bacteria 6320
501 Ga0157372_10043798 3300013307 Bacteria 4958
502 Ga0157375_10002515 3300013308 Bacteria 15908
503 Ga0157375_10006746 3300013308 Bacteria 9997
504 Ga0157375_10106507 3300013308 Bacteria 2895
505 Ga0157375_10275268 3300013308 Bacteria 1845
506 Ga0163163_10214452 3300014325 Bacteria 1974
507 Ga0163163_10375587 3300014325 Bacteria 1479
508 Ga0163163_10431371 3300014325 Bacteria 1377
509 Ga0157380_10012577 3300014326 Bacteria 6141
510 Ga0157380_10111126 3300014326 Bacteria 2303
511 Ga0182008_10000023 3300014497 Bacteria 201526
512 Ga0182008_10001995 3300014497 Bacteria 13100
513 Ga0182008_10002602 3300014497 Bacteria 11209
514 Ga0182008_10009442 3300014497 Bacteria 5263
515 Ga0182008_10014834 3300014497 Bacteria 4075
516 Ga0182008_10022340 3300014497 Bacteria 3240
517 Ga0182008_10027070 3300014497 Bacteria 2906
518 Ga0182008_10033767 3300014497 Bacteria 2567
519 Ga0157379_10044263 3300014968 Bacteria 3973
520 Ga0157379_10275823 3300014968 Bacteria 1530
521 Ga0157376_10011819 3300014969 Bacteria 6455
522 Ga0157376_10025582 3300014969 Bacteria 4651
523 Ga0157376_10025908 3300014969 Bacteria 4625
524 Ga0157376_10109183 3300014969 Bacteria 2432
525 Ga0182006_1000404 3300015261 Bacteria 35006
526 Ga0182006_1000808 3300015261 Bacteria 20962
527 Ga0182006_1000967 3300015261 Bacteria 19035
528 Ga0182006_1006793 3300015261 Bacteria 5279
529 Ga0182006_1053038 3300015261 Bacteria 1556
530 Ga0182007_10000965 3300015262 Bacteria 15786
531 Ga0182007_10003252 3300015262 Bacteria 7728
532 Ga0182007_10003543 3300015262 Bacteria 7352
533 Ga0182007_10030438 3300015262 Bacteria 1845
534 Ga0182005_1000758 3300015265 Bacteria 14754
535 Ga0182005_1003308 3300015265 Bacteria 5505
536 Ga0182005_1013990 3300015265 Bacteria 2251
537 Ga0182005_1016131 3300015265 Bacteria 2079
538 Ga0182005_1021282 3300015265 Bacteria 1780
539 Ga0183369_1011 3300015685 Bacteria 252490
540 Ga0183368_1007 3300015687 Bacteria 405609
541 Ga0183363_1106 3300015690 Bacteria 23641
542 Ga0183361_10001 3300016635 Bacteria 908583
543 Ga0163161_10001737 3300017792 Bacteria 15947
544 Ga0163161_10025774 3300017792 Bacteria 4164
545 Ga0163161_10071262 3300017792 Bacteria 2543
546 Ga0163161_10117200 3300017792 Bacteria 1997
547 Ga0163161_10138268 3300017792 Bacteria 1843
548 Ga0206356_10061609 3300020070 Bacteria 3827
549 Ga0206356_11616746 3300020070 Bacteria 3414
550 Ga0206353_11840038 3300020082 Bacteria 4348
551 Ga0213876_10101399 3300021384 Bacteria 1526
552 Ga0224712_10000090 3300022467 Bacteria 14205
553 Ga0228711_1005754 3300022739 Bacteria 18767
554 Ga0228711_1032337 3300022739 Bacteria 2464
555 Ga0228710_1006542 3300022740 Bacteria 17603
556 Ga0228710_1031661 3300022740 Bacteria 2464
557 Ga0209435_100004 3300025206 Bacteria 633417
558 Ga0209435_100005 3300025206 Bacteria 573745
559 Ga0209435_100866 3300025206 Bacteria 4653
560 Ga0209760_100114 3300025207 Bacteria 57573
561 Ga0209760_100340 3300025207 Bacteria 13643
562 Ga0209436_100026 3300025208 Bacteria 90859
563 Ga0209784_100005 3300025224 Bacteria 1040422
564 Ga0209784_100007 3300025224 Bacteria 747715
565 Ga0209784_100049 3300025224 Bacteria 195512
566 Ga0209784_100164 3300025224 Bacteria 57421
567 Ga0209566_100005 3300025225 Bacteria 1040422
568 Ga0209566_100009 3300025225 Bacteria 554018
569 Ga0209566_100061 3300025225 Bacteria 195512
570 Ga0209566_100212 3300025225 Bacteria 59180
571 Ga0209566_102109 3300025225 Bacteria 4082
572 Ga0209674_100009 3300025226 Bacteria 1040422
573 Ga0209674_100013 3300025226 Bacteria 813140
574 Ga0209674_100021 3300025226 Bacteria 629811
575 Ga0209674_100037 3300025226 Bacteria 404339
576 Ga0209674_100059 3300025226 Bacteria 282517
577 Ga0209674_100069 3300025226 Bacteria 243948
578 Ga0209674_100163 3300025226 Bacteria 86638
579 Ga0209674_100437 3300025226 Bacteria 19539
580 Ga0209674_100560 3300025226 Bacteria 14677
581 Ga0209674_101415 3300025226 Bacteria 6410
582 Ga0209672_100004 3300025228 Bacteria 1467504
583 Ga0209672_100008 3300025228 Bacteria 946876
584 Ga0209672_100010 3300025228 Bacteria 873151
585 Ga0209672_100046 3300025228 Bacteria 264244
586 Ga0209672_100047 3300025228 Bacteria 250925
587 Ga0209672_100121 3300025228 Bacteria 83609
588 Ga0209672_100272 3300025228 Bacteria 37908
589 Ga0209672_101050 3300025228 Bacteria 11845
590 Ga0209672_101871 3300025228 Bacteria 6222
591 Ga0209147_100006 3300025229 Bacteria 873276
592 Ga0209147_100009 3300025229 Bacteria 747409
593 Ga0209147_100011 3300025229 Bacteria 702140
594 Ga0209147_100043 3300025229 Bacteria 300460
595 Ga0209147_100059 3300025229 Bacteria 250891
596 Ga0209147_100172 3300025229 Bacteria 84617
597 Ga0209563_100012 3300025230 Bacteria 1040422
598 Ga0209563_100018 3300025230 Bacteria 747850
599 Ga0209563_100036 3300025230 Bacteria 448275
600 Ga0209563_100083 3300025230 Bacteria 195512
601 Ga0209563_100379 3300025230 Bacteria 16079
602 Ga0209563_101790 3300025230 Bacteria 5348
603 Ga0209563_102726 3300025230 Bacteria 3878
604 Ga0207427_100008 3300025231 Bacteria 740731
605 Ga0207427_100037 3300025231 Bacteria 303108
606 Ga0207427_100084 3300025231 Bacteria 142663
607 Ga0207427_100134 3300025231 Bacteria 91077
608 Ga0207427_101852 3300025231 Bacteria 6686
609 Ga0207427_101954 3300025231 Bacteria 6328
610 Ga0207427_103135 3300025231 Bacteria 3710
611 Ga0209437_100005 3300025233 Bacteria 1071596
612 Ga0209437_100014 3300025233 Bacteria 740714
613 Ga0209437_100037 3300025233 Bacteria 459730
614 Ga0209437_100078 3300025233 Bacteria 278088
615 Ga0209437_100084 3300025233 Bacteria 255423
616 Ga0209437_100091 3300025233 Bacteria 243344
617 Ga0209437_100197 3300025233 Bacteria 120813
618 Ga0209437_100213 3300025233 Bacteria 107087
619 Ga0209258_100003 3300025242 Bacteria 1467504
620 Ga0209258_100004 3300025242 Bacteria 1376422
621 Ga0209258_100008 3300025242 Bacteria 1009355
622 Ga0209258_100010 3300025242 Bacteria 873276
623 Ga0209258_100023 3300025242 Bacteria 547286
624 Ga0209258_100034 3300025242 Bacteria 437372
625 Ga0209258_100057 3300025242 Bacteria 334259
626 Ga0209258_100106 3300025242 Bacteria 206622
627 Ga0209258_100172 3300025242 Bacteria 144895
628 Ga0209258_100237 3300025242 Bacteria 102220
629 Ga0209258_100441 3300025242 Bacteria 46899
630 Ga0209258_100792 3300025242 Bacteria 18794
631 Ga0209258_101200 3300025242 Bacteria 10284
632 Ga0207425_1003167 3300025245 Bacteria 5382
633 Ga0207425_1003464 3300025245 Bacteria 5042
634 Ga0207425_1005523 3300025245 Bacteria 3591
635 Ga0209646_1000011 3300025246 Bacteria 573745
636 Ga0209646_1000032 3300025246 Bacteria 375315
637 Ga0209646_1000052 3300025246 Bacteria 286370
638 Ga0209646_1000442 3300025246 Bacteria 22332
639 Ga0209646_1000895 3300025246 Bacteria 9727
640 Ga0209646_1001329 3300025246 Bacteria 6884
641 Ga0209646_1001788 3300025246 Bacteria 5375
642 Ga0209646_1002158 3300025246 Bacteria 4565
643 Ga0209026_1000008 3300025250 Bacteria 573745
644 Ga0209026_1000045 3300025250 Bacteria 263431
645 Ga0209026_1000062 3300025250 Bacteria 213298
646 Ga0209026_1000187 3300025250 Bacteria 90872
647 Ga0209026_1000223 3300025250 Bacteria 77328
648 Ga0209026_1000761 3300025250 Bacteria 18064
649 Ga0209026_1003142 3300025250 Bacteria 5616
650 Ga0209677_100006 3300025253 Bacteria 1040422
651 Ga0209677_100012 3300025253 Bacteria 554018
652 Ga0209677_100039 3300025253 Bacteria 243974
653 Ga0209677_100916 3300025253 Bacteria 14407
654 Ga0209677_102832 3300025253 Bacteria 6133
655 Ga0209148_1000001 3300025254 Bacteria 2545271
656 Ga0209148_1000002 3300025254 Bacteria 2399500
657 Ga0209148_1000018 3300025254 Bacteria 756247
658 Ga0209148_1000025 3300025254 Bacteria 663262
659 Ga0209148_1000029 3300025254 Bacteria 579199
660 Ga0209148_1000042 3300025254 Bacteria 464111
661 Ga0209148_1000053 3300025254 Bacteria 373506
662 Ga0209148_1000068 3300025254 Bacteria 335510
663 Ga0209148_1000925 3300025254 Bacteria 19445
664 Ga0209148_1005322 3300025254 Bacteria 2974
665 Ga0209759_1000004 3300025256 Bacteria 573745
666 Ga0209759_1000054 3300025256 Bacteria 211422
667 Ga0209759_1000132 3300025256 Bacteria 127521
668 Ga0209759_1000181 3300025256 Bacteria 103230
669 Ga0209759_1000185 3300025256 Bacteria 100505
670 Ga0209759_1000212 3300025256 Bacteria 89756
671 Ga0209759_1000303 3300025256 Bacteria 67661
672 Ga0209759_1001491 3300025256 Bacteria 12985
673 Ga0209759_1001499 3300025256 Bacteria 12890
674 Ga0209759_1001939 3300025256 Bacteria 10058
675 Ga0209759_1002853 3300025256 Bacteria 7286
676 Ga0209759_1003544 3300025256 Bacteria 6178
677 Ga0209759_1010084 3300025256 Bacteria 2796
678 Ga0209759_1019960 3300025256 Bacteria 1572
679 Ga0209129_1000203 3300025258 Bacteria 70739
680 Ga0209129_1000755 3300025258 Bacteria 20560
681 Ga0209129_1001047 3300025258 Bacteria 16324
682 Ga0209129_1001557 3300025258 Bacteria 12606
683 Ga0209129_1001808 3300025258 Bacteria 11359
684 Ga0209129_1001861 3300025258 Bacteria 11151
685 Ga0209129_1001919 3300025258 Bacteria 10930
686 Ga0209129_1002692 3300025258 Bacteria 8353
687 Ga0209233_1000002 3300025261 Bacteria 2501366
688 Ga0209233_1000006 3300025261 Bacteria 1473685
689 Ga0209233_1000008 3300025261 Bacteria 1356712
690 Ga0209233_1000011 3300025261 Bacteria 1071611
691 Ga0209233_1000093 3300025261 Bacteria 306016
692 Ga0209233_1000096 3300025261 Bacteria 303482
693 Ga0209233_1000115 3300025261 Bacteria 243344
694 Ga0209233_1000163 3300025261 Bacteria 152912
695 Ga0209233_1000199 3300025261 Bacteria 123684
696 Ga0209233_1000397 3300025261 Bacteria 36444
697 Ga0209565_1000024 3300025263 Bacteria 379907
698 Ga0209565_1014397 3300025263 Bacteria 1819
699 Ga0209455_1000004 3300025272 Bacteria 1467504
700 Ga0209455_1000007 3300025272 Bacteria 1157983
701 Ga0209455_1000015 3300025272 Bacteria 756128
702 Ga0209455_1000016 3300025272 Bacteria 753097
703 Ga0209455_1000054 3300025272 Bacteria 358936
704 Ga0209455_1000064 3300025272 Bacteria 332404
705 Ga0209455_1006243 3300025272 Bacteria 3549
706 Ga0209673_1000037 3300025273 Bacteria 313804
707 Ga0209673_1000115 3300025273 Bacteria 176939
708 Ga0209673_1000222 3300025273 Bacteria 112605
709 Ga0209673_1000237 3300025273 Bacteria 106342
710 Ga0209673_1000670 3300025273 Bacteria 49698
711 Ga0209673_1001021 3300025273 Bacteria 33411
712 Ga0209673_1007680 3300025273 Bacteria 4916
713 Ga0209673_1009725 3300025273 Bacteria 4130
714 Ga0209673_1032481 3300025273 Bacteria 1607
715 Ga0209130_1000030 3300025284 Bacteria 323323
716 Ga0209130_1000032 3300025284 Bacteria 316240
717 Ga0209130_1000033 3300025284 Bacteria 316064
718 Ga0209130_1002498 3300025284 Bacteria 9091
719 Ga0209130_1011655 3300025284 Bacteria 2343
720 Ga0209675_1000011 3300025291 Bacteria 520597
721 Ga0209675_1019504 3300025291 Bacteria 1864
722 Ga0209675_1021539 3300025291 Bacteria 1717
723 Ga0209675_1023592 3300025291 Bacteria 1590
724 Ga0209676_1000010 3300025292 Bacteria 954025
725 Ga0209676_1000011 3300025292 Bacteria 860463
726 Ga0209676_1000021 3300025292 Bacteria 609534
727 Ga0209676_1000345 3300025292 Bacteria 88051
728 Ga0209676_1000440 3300025292 Bacteria 71013
729 Ga0209676_1000605 3300025292 Bacteria 52680
730 Ga0209676_1001461 3300025292 Bacteria 22119
731 Ga0209676_1004038 3300025292 Bacteria 8449
732 Ga0209676_1008671 3300025292 Bacteria 4496
733 Ga0209676_1015940 3300025292 Bacteria 2741
734 Ga0209025_1000032 3300025294 Bacteria 416141
735 Ga0209025_1000044 3300025294 Bacteria 349480
736 Ga0209025_1000354 3300025294 Bacteria 98665
737 Ga0209025_1000864 3300025294 Bacteria 47865
738 Ga0209025_1001447 3300025294 Bacteria 31156
739 Ga0209025_1003821 3300025294 Bacteria 13747
740 Ga0209025_1005184 3300025294 Bacteria 10770
741 Ga0209025_1029298 3300025294 Bacteria 2668
742 Ga0209025_1032266 3300025294 Bacteria 2453
743 Ga0209025_1036238 3300025294 Bacteria 2213
744 Ga0209564_1000079 3300025295 Bacteria 266525
745 Ga0209564_1000207 3300025295 Bacteria 135313
746 Ga0209564_1000258 3300025295 Bacteria 112586
747 Ga0209564_1000379 3300025295 Bacteria 81420
748 Ga0209564_1000490 3300025295 Bacteria 65811
749 Ga0209564_1002591 3300025295 Bacteria 13871
750 Ga0209564_1005577 3300025295 Bacteria 7103
751 Ga0209564_1021889 3300025295 Bacteria 2280
752 Ga0209564_1022583 3300025295 Bacteria 2217
753 Ga0209758_1000008 3300025297 Bacteria 1215263
754 Ga0209758_1000586 3300025297 Bacteria 56819
755 Ga0209758_1000674 3300025297 Bacteria 50969
756 Ga0209758_1000983 3300025297 Bacteria 38351
757 Ga0209758_1001007 3300025297 Bacteria 37395
758 Ga0209758_1001098 3300025297 Bacteria 35006
759 Ga0209758_1001230 3300025297 Bacteria 32053
760 Ga0209758_1001815 3300025297 Bacteria 23598
761 Ga0209758_1004625 3300025297 Bacteria 11285
762 Ga0209758_1015519 3300025297 Bacteria 3935
763 Ga0209758_1022030 3300025297 Bacteria 2942
764 Ga0209050_1000032 3300025298 Bacteria 456335
765 Ga0209050_1000081 3300025298 Bacteria 267533
766 Ga0209050_1000162 3300025298 Bacteria 155309
767 Ga0209050_1000227 3300025298 Bacteria 123743
768 Ga0209050_1001253 3300025298 Bacteria 29284
769 Ga0209050_1001540 3300025298 Bacteria 24193
770 Ga0209050_1001731 3300025298 Bacteria 21722
771 Ga0209050_1002704 3300025298 Bacteria 14408
772 Ga0209050_1003537 3300025298 Bacteria 11399
773 Ga0209050_1009731 3300025298 Bacteria 4865
774 Ga0209256_1000202 3300025299 Bacteria 112605
775 Ga0209256_1000709 3300025299 Bacteria 44332
776 Ga0209256_1000893 3300025299 Bacteria 36710
777 Ga0209256_1000950 3300025299 Bacteria 35138
778 Ga0209256_1001345 3300025299 Bacteria 26077
779 Ga0209256_1001793 3300025299 Bacteria 20278
780 Ga0209256_1001832 3300025299 Bacteria 19843
781 Ga0209256_1008649 3300025299 Bacteria 4663
782 Ga0209256_1010324 3300025299 Bacteria 3931
783 Ga0209256_1013528 3300025299 Bacteria 3019
784 Ga0207426_1000007 3300025302 Bacteria 971011
785 Ga0207426_1000047 3300025302 Bacteria 417011
786 Ga0207426_1000077 3300025302 Bacteria 316246
787 Ga0207426_1000078 3300025302 Bacteria 316064
788 Ga0207426_1000296 3300025302 Bacteria 98032
789 Ga0207426_1001188 3300025302 Bacteria 23185
790 Ga0209051_1000104 3300025303 Bacteria 161001
791 Ga0209051_1000121 3300025303 Bacteria 146477
792 Ga0209051_1000164 3300025303 Bacteria 124186
793 Ga0209051_1000202 3300025303 Bacteria 106010
794 Ga0209051_1000710 3300025303 Bacteria 36523
795 Ga0209051_1000908 3300025303 Bacteria 29447
796 Ga0209051_1000909 3300025303 Bacteria 29436
797 Ga0209051_1001365 3300025303 Bacteria 21092
798 Ga0209051_1003501 3300025303 Bacteria 10266
799 Ga0209051_1005522 3300025303 Bacteria 7372
800 Ga0209051_1013475 3300025303 Bacteria 3890
801 Ga0209051_1021653 3300025303 Bacteria 2727
802 Ga0209051_1030693 3300025303 Bacteria 2081
803 Ga0209051_1030965 3300025303 Bacteria 2067
804 Ga0209257_1000014 3300025304 Bacteria 946850
805 Ga0209257_1000040 3300025304 Bacteria 538759
806 Ga0209257_1000065 3300025304 Bacteria 353604
807 Ga0209257_1000121 3300025304 Bacteria 222588
808 Ga0209257_1000356 3300025304 Bacteria 93656
809 Ga0209257_1000452 3300025304 Bacteria 77144
810 Ga0209257_1001064 3300025304 Bacteria 36288
811 Ga0209257_1004058 3300025304 Bacteria 11755
812 Ga0209257_1004137 3300025304 Bacteria 11561
813 Ga0209257_1007238 3300025304 Bacteria 6788
814 Ga0209257_1012983 3300025304 Bacteria 3765
815 Ga0209257_1013555 3300025304 Bacteria 3609
816 Ga0209257_1028082 3300025304 Bacteria 1858
817 Ga0207656_10000009 3300025321 Bacteria 245637
818 Ga0207696_1000097 3300025711 Bacteria 175696
819 Ga0207696_1000152 3300025711 Bacteria 119512
820 Ga0207696_1000165 3300025711 Bacteria 104683
821 Ga0207696_1001780 3300025711 Bacteria 11122
822 Ga0207696_1001993 3300025711 Bacteria 10346
823 Ga0207655_1000021 3300025728 Bacteria 518596
824 Ga0207655_1000603 3300025728 Bacteria 43527
825 Ga0207655_1000652 3300025728 Bacteria 41403
826 Ga0207655_1000772 3300025728 Bacteria 35772
827 Ga0207655_1000931 3300025728 Bacteria 30378
828 Ga0207655_1003483 3300025728 Bacteria 11691
829 Ga0207655_1012890 3300025728 Bacteria 4840
830 Ga0207655_1017528 3300025728 Bacteria 3858
831 Ga0207655_1018487 3300025728 Bacteria 3692
832 Ga0207655_1022739 3300025728 Bacteria 3130
833 Ga0207655_1029630 3300025728 Bacteria 2559
834 Ga0207713_1000009 3300025735 Bacteria 551314
835 Ga0207713_1000041 3300025735 Bacteria 244768
836 Ga0207713_1000692 3300025735 Bacteria 31614
837 Ga0207713_1001034 3300025735 Bacteria 24156
838 Ga0207713_1001400 3300025735 Bacteria 19498
839 Ga0207713_1002103 3300025735 Bacteria 14852
840 Ga0207713_1002787 3300025735 Bacteria 12350
841 Ga0207713_1003713 3300025735 Bacteria 10262
842 Ga0207713_1003965 3300025735 Bacteria 9815
843 Ga0207713_1006559 3300025735 Bacteria 7063
844 Ga0207713_1007252 3300025735 Bacteria 6582
845 Ga0207713_1008559 3300025735 Bacteria 5873
846 Ga0207713_1010947 3300025735 Bacteria 4979
847 Ga0207713_1017746 3300025735 Bacteria 3551
848 Ga0207642_10017216 3300025899 Bacteria 2743
849 Ga0207680_10000003 3300025903 Bacteria 925264
850 Ga0207680_10010848 3300025903 Bacteria 4576
851 Ga0207647_10000406 3300025904 Bacteria 35299
852 Ga0207647_10005179 3300025904 Bacteria 9593
853 Ga0207647_10006150 3300025904 Bacteria 8742
854 Ga0207647_10020784 3300025904 Bacteria 4396
855 Ga0207647_10047493 3300025904 Bacteria 2670
856 Ga0207645_10020432 3300025907 Bacteria 4335
857 Ga0207645_10025328 3300025907 Bacteria 3839
858 Ga0207643_10021300 3300025908 Bacteria 3560
859 Ga0207643_10028023 3300025908 Bacteria 3125
860 Ga0207643_10074720 3300025908 Bacteria 1955
861 Ga0207705_10002609 3300025909 Bacteria 13838
862 Ga0207705_10013348 3300025909 Bacteria 5925
863 Ga0207705_10013783 3300025909 Bacteria 5829
864 Ga0207705_10035760 3300025909 Bacteria 3554
865 Ga0207705_10040318 3300025909 Bacteria 3348
866 Ga0207705_10055162 3300025909 Bacteria 2865
867 Ga0207705_10109084 3300025909 Bacteria 2043
868 Ga0207654_10019928 3300025911 Bacteria 3547
869 Ga0207654_10024194 3300025911 Bacteria 3262
870 Ga0207707_10052033 3300025912 Bacteria 3566
871 Ga0207695_10000049 3300025913 Bacteria 406233
872 Ga0207695_10000429 3300025913 Bacteria 92640
873 Ga0207695_10001702 3300025913 Bacteria 35225
874 Ga0207695_10003515 3300025913 Bacteria 21943
875 Ga0207695_10005252 3300025913 Bacteria 17289
876 Ga0207695_10011740 3300025913 Bacteria 10579
877 Ga0207695_10012415 3300025913 Bacteria 10229
878 Ga0207695_10021072 3300025913 Bacteria 7444
879 Ga0207695_10026274 3300025913 Bacteria 6499
880 Ga0207695_10133729 3300025913 Bacteria 2435
881 Ga0207695_10141210 3300025913 Bacteria 2357
882 Ga0207695_10249740 3300025913 Bacteria 1674
883 Ga0207695_10316730 3300025913 Bacteria 1450
884 Ga0207671_10000059 3300025914 Bacteria 179761
885 Ga0207671_10000135 3300025914 Bacteria 112401
886 Ga0207671_10000556 3300025914 Bacteria 50250
887 Ga0207671_10000713 3300025914 Bacteria 42635
888 Ga0207671_10004705 3300025914 Bacteria 12902
889 Ga0207671_10034008 3300025914 Bacteria 3790
890 Ga0207671_10060219 3300025914 Bacteria 2816
891 Ga0207663_10142381 3300025916 Bacteria 1672
892 Ga0207662_10001567 3300025918 Bacteria 11184
893 Ga0207657_10000008 3300025919 Bacteria 189885
894 Ga0207657_10001585 3300025919 Bacteria 24460
895 Ga0207657_10017790 3300025919 Bacteria 6804
896 Ga0207657_10067795 3300025919 Bacteria 3033
897 Ga0207649_10000007 3300025920 Bacteria 334217
898 Ga0207649_10014289 3300025920 Bacteria 4442
899 Ga0207649_10237503 3300025920 Bacteria 1307
900 Ga0207652_10015302 3300025921 Bacteria 6229
901 Ga0207652_10041632 3300025921 Bacteria 3906
902 Ga0207652_10125743 3300025921 Bacteria 2284
903 Ga0207652_10129091 3300025921 Bacteria 2253
904 Ga0207652_10132655 3300025921 Bacteria 2222
905 Ga0207681_10000163 3300025923 Bacteria 55005
906 Ga0207681_10007357 3300025923 Bacteria 6745
907 Ga0207681_10173549 3300025923 Bacteria 1636
908 Ga0207694_10000128 3300025924 Bacteria 78863
909 Ga0207694_10000359 3300025924 Bacteria 42962
910 Ga0207694_10019147 3300025924 Bacteria 5175
911 Ga0207694_10032251 3300025924 Bacteria 4008
912 Ga0207694_10042761 3300025924 Bacteria 3496
913 Ga0207694_10064274 3300025924 Bacteria 2860
914 Ga0207694_10186621 3300025924 Bacteria 1683
915 Ga0207650_10000178 3300025925 Bacteria 74821
916 Ga0207650_10000210 3300025925 Bacteria 66574
917 Ga0207650_10008117 3300025925 Bacteria 7156
918 Ga0207650_10336585 3300025925 Bacteria 1239
919 Ga0207659_10036901 3300025926 Bacteria 3390
920 Ga0207659_10249400 3300025926 Bacteria 1440
921 Ga0207687_10015209 3300025927 Bacteria 5043
922 Ga0207664_10010237 3300025929 Bacteria 6622
923 Ga0207664_10095916 3300025929 Bacteria 2441
924 Ga0207644_10003369 3300025931 Bacteria 10318
925 Ga0207690_10000013 3300025932 Bacteria 266156
926 Ga0207690_10014282 3300025932 Bacteria 4795
927 Ga0207706_10000050 3300025933 Bacteria 116811
928 Ga0207706_10132688 3300025933 Bacteria 2191
929 Ga0207706_10133108 3300025933 Bacteria 2187
930 Ga0207686_10001532 3300025934 Bacteria 13024
931 Ga0207709_10000035 3300025935 Bacteria 300968
932 Ga0207709_10005638 3300025935 Bacteria 7077
933 Ga0207709_10071412 3300025935 Bacteria 2204
934 Ga0207709_10100678 3300025935 Bacteria 1909
935 Ga0207670_10011958 3300025936 Bacteria 5057
936 Ga0207670_10096398 3300025936 Bacteria 2103
937 Ga0207669_10060191 3300025937 Bacteria 2327
938 Ga0207704_10010676 3300025938 Bacteria 4489
939 Ga0207704_10078039 3300025938 Bacteria 2128
940 Ga0207691_10004858 3300025940 Bacteria 12997
941 Ga0207691_10071976 3300025940 Bacteria 3118
942 Ga0207691_10160767 3300025940 Bacteria 1971
943 Ga0207711_10033204 3300025941 Bacteria 4365
944 Ga0207711_10045097 3300025941 Bacteria 3767
945 Ga0207711_10133059 3300025941 Bacteria 2231
946 Ga0207711_10378763 3300025941 Bacteria 1313
947 Ga0207689_10002599 3300025942 Bacteria 16704
948 Ga0207689_10015989 3300025942 Bacteria 6350
949 Ga0207689_10092746 3300025942 Bacteria 2481
950 Ga0207661_10013152 3300025944 Bacteria 6041
951 Ga0207661_10041845 3300025944 Bacteria 3609
952 Ga0207661_10102213 3300025944 Bacteria 2409
953 Ga0207661_10208914 3300025944 Bacteria 1720
954 Ga0207679_10000013 3300025945 Bacteria 334197
955 Ga0207679_10007435 3300025945 Bacteria 6949
956 Ga0207679_10024109 3300025945 Bacteria 4168
957 Ga0207679_10051926 3300025945 Bacteria 3004
958 Ga0207667_10000028 3300025949 Bacteria 334510
959 Ga0207667_10000062 3300025949 Bacteria 190422
960 Ga0207667_10000292 3300025949 Bacteria 69279
961 Ga0207667_10000486 3300025949 Bacteria 52631
962 Ga0207667_10002564 3300025949 Bacteria 22605
963 Ga0207667_10013346 3300025949 Bacteria 9406
964 Ga0207667_10013807 3300025949 Bacteria 9228
965 Ga0207667_10015048 3300025949 Bacteria 8801
966 Ga0207667_10070719 3300025949 Bacteria 3631
967 Ga0207667_10081051 3300025949 Bacteria 3362
968 Ga0207667_10106559 3300025949 Bacteria 2891
969 Ga0207667_10121940 3300025949 Bacteria 2686
970 Ga0207667_10132596 3300025949 Bacteria 2566
971 Ga0207667_10208048 3300025949 Bacteria 2006
972 Ga0207651_10012970 3300025960 Bacteria 4745
973 Ga0207651_10119814 3300025960 Bacteria 1993
974 Ga0207712_10033098 3300025961 Bacteria 3493
975 Ga0207668_10008682 3300025972 Bacteria 6070
976 Ga0207668_10082433 3300025972 Bacteria 2337
977 Ga0207640_10000022 3300025981 Bacteria 167526
978 Ga0207640_10000471 3300025981 Bacteria 24571
979 Ga0207640_10000670 3300025981 Bacteria 19993
980 Ga0207640_10145962 3300025981 Bacteria 1731
981 Ga0207658_10070348 3300025986 Bacteria 2647
982 Ga0207703_10120948 3300026035 Bacteria 2248
983 Ga0207639_10027540 3300026041 Bacteria 4142
984 Ga0207678_10000969 3300026067 Bacteria 26231
985 Ga0207678_10001675 3300026067 Bacteria 20327
986 Ga0207678_10095511 3300026067 Bacteria 2540
987 Ga0207702_10000624 3300026078 Bacteria 38966
988 Ga0207702_10009106 3300026078 Bacteria 8358
989 Ga0207702_10028519 3300026078 Bacteria 4640
990 Ga0207702_10051439 3300026078 Bacteria 3481
991 Ga0207702_10070045 3300026078 Bacteria 3016
992 Ga0207702_10077002 3300026078 Bacteria 2884
993 Ga0207702_10153332 3300026078 Bacteria 2098
994 Ga0207702_10252153 3300026078 Bacteria 1658
995 Ga0207641_10006248 3300026088 Bacteria 10080
996 Ga0207641_10014471 3300026088 Bacteria 6463
997 Ga0207648_10034441 3300026089 Bacteria 4464
998 Ga0207648_10051585 3300026089 Bacteria 3595
999 Ga0207676_10073470 3300026095 Bacteria 2752
1000 Ga0207676_10105343 3300026095 Bacteria 2348
1001 Ga0207676_10170681 3300026095 Bacteria 1895
1002 Ga0207676_10332450 3300026095 Bacteria 1399
1003 Ga0207674_10000298 3300026116 Bacteria 62902
1004 Ga0207674_10010196 3300026116 Bacteria 10673
1005 Ga0207674_10044449 3300026116 Bacteria 4574
1006 Ga0207674_10056308 3300026116 Bacteria 3994
1007 Ga0207674_10091822 3300026116 Bacteria 3026
1008 Ga0207674_10162508 3300026116 Bacteria 2187
1009 Ga0207674_10379914 3300026116 Bacteria 1366
1010 Ga0207675_100053155 3300026118 Bacteria 3780
1011 Ga0207675_100110860 3300026118 Unclassified 2589
1012 Ga0207683_10014610 3300026121 Bacteria 6686
1013 Ga0207683_10016309 3300026121 Bacteria 6323
1014 Ga0207683_10307360 3300026121 Bacteria 1451
1015 Ga0207698_10014129 3300026142 Bacteria 5294
1016 Ga0207698_10015955 3300026142 Bacteria 5050
1017 Ga0207698_10019529 3300026142 Bacteria 4642
1018 Ga0207698_10232031 3300026142 Bacteria 1676
1019 Ga0209281_1000077 3300027111 Bacteria 262887
1020 Ga0209281_1000118 3300027111 Bacteria 208448
1021 Ga0209281_1000212 3300027111 Bacteria 130216
1022 Ga0209281_1000346 3300027111 Bacteria 77504
1023 Ga0209281_1000469 3300027111 Bacteria 56711
1024 Ga0209281_1013795 3300027111 Bacteria 1731
1025 Ga0209371_1000023 3300027312 Bacteria 519553
1026 Ga0209371_1000065 3300027312 Bacteria 214464
1027 Ga0209371_1002067 3300027312 Bacteria 11970
1028 Ga0209371_1010681 3300027312 Bacteria 2796
1029 Ga0209282_1000038 3300027666 Bacteria 128955
1030 Ga0209282_1029815 3300027666 Bacteria 3363
1031 Ga0209813_10006468 3300027866 Bacteria 2896
1032 Ga0207428_10015977 3300027907 Bacteria 6471
1033 Ga0207428_10044995 3300027907 Bacteria 3559
1034 Ga0268266_10000011 3300028379 Bacteria 757403
1035 Ga0268266_10000364 3300028379 Bacteria 70331
1036 Ga0268266_10000895 3300028379 Bacteria 38492
1037 Ga0268266_10005005 3300028379 Bacteria 12518
1038 Ga0268266_10020541 3300028379 Bacteria 5628
1039 Ga0268266_10023157 3300028379 Bacteria 5287
1040 Ga0268266_10055690 3300028379 Bacteria 3400
1041 Ga0268266_10263051 3300028379 Bacteria 1599
1042 Ga0268264_10003867 3300028381 Bacteria 12847
1043 Ga0268264_10384530 3300028381 Bacteria 1345
1044 Ga0268264_10469945 3300028381 Bacteria 1221
1045 Ga0307515_10085133 3300028794 Bacteria 4050
1046 Ga0307515_10223914 3300028794 Bacteria 1691
1047 Ga0265338_10000476 3300028800 Bacteria 71490
1048 Ga0265338_10143969 3300028800 Bacteria 1862
1049 Ga0268256_1000023 3300030500 Bacteria 519631
1050 Ga0268256_1000118 3300030500 Bacteria 115175
1051 Ga0268256_1002195 3300030500 Bacteria 10299
1052 Ga0268256_1011475 3300030500 Bacteria 2799
1053 Ga0316177_1155876 3300030731 Bacteria 3033
1054 Ga0316176_1003471 3300030732 Bacteria 14957
1055 Ga0316176_1180376 3300030732 Bacteria 1469
1056 Ga0314311_1113156 3300030733 Bacteria 2052
1057 Ga0316178_1043989 3300030735 Bacteria 34199
1058 Ga0316183_1207931 3300030742 Bacteria 24415
1059 Ga0316181_1063746 3300030744 Bacteria 1853
1060 Ga0316181_1140375 3300030744 Bacteria 21291
1061 Ga0265330_10023164 3300031235 Bacteria 2822
1062 Ga0265340_10016453 3300031247 Bacteria 3829
1063 Ga0307513_10009248 3300031456 Bacteria 12473
1064 Ga0307513_10035883 3300031456 Bacteria 5541
1065 Ga0307408_100011609 3300031548 Bacteria 5822
1066 Ga0307408_100112000 3300031548 Bacteria 2097
1067 Ga0307516_10019066 3300031730 Bacteria 7116
1068 Ga0307516_10097128 3300031730 Bacteria 2766
1069 Ga0307405_10000266 3300031731 Bacteria 19217
1070 Ga0307405_10046393 3300031731 Bacteria 2670
1071 Ga0307405_10086501 3300031731 Bacteria 2063
1072 Ga0307518_10000232 3300031838 Bacteria 42086
1073 Ga0307406_10008205 3300031901 Bacteria 5821
1074 Ga0307406_10132790 3300031901 Bacteria 1750
1075 Ga0307412_10000044 3300031911 Bacteria 165237
1076 Ga0307412_10000086 3300031911 Bacteria 85829
1077 Ga0307412_10000696 3300031911 Bacteria 19413
1078 Ga0307412_10007745 3300031911 Bacteria 6107
1079 Ga0307412_10016846 3300031911 Bacteria 4365
1080 Ga0307412_10128074 3300031911 Bacteria 1839
1081 Ga0315914_1001085 3300031967 Bacteria 39130
1082 Ga0307409_100060590 3300031995 Bacteria 2952
1083 Ga0307414_10002474 3300032004 Bacteria 9682
1084 Ga0307414_10135333 3300032004 Bacteria 1920
1085 Ga0307510_10013166 3300033180 Bacteria 9811
1086 Ga0307510_10022649 3300033180 Bacteria 7290
1087 Ga0315913_1000342 3300033430 Bacteria 39072
1088 Ga0315915_1000018 3300033464 Bacteria 129799
1089 Ga0373936_0014950 3300035113 Bacteria 2972
1090 Ga0373931_0035536 3300035691 Bacteria 2592
1091 Ga0373935_0060242 3300035692 Bacteria 2428
1092 Ga0373937_0035137 3300036401 Bacteria 4560
1093 Ga0373937_0064861 3300036401 Bacteria 3361
1094 Ga0373937_0236117 3300036401 Bacteria 1722
1095 Ga0395899_0000031 3300037312 Bacteria 322356
1096 Ga0395899_0000226 3300037312 Bacteria 76657
1097 Ga0395899_0001543 3300037312 Bacteria 19449
1098 Ga0395899_0018763 3300037312 Bacteria 5256
1099 Ga0395899_0023189 3300037312 Bacteria 4704
1100 Ga0395899_0060569 3300037312 Bacteria 2789
1101 Ga0395899_0074384 3300037312 Bacteria 2482
1102 Ga0395899_0105892 3300037312 Bacteria 2025
1103 Ga0395899_0115276 3300037312 Bacteria 1928
1104 Ga0395900_0000011 3300037418 Bacteria 421926
1105 Ga0395900_0000776 3300037418 Bacteria 42484
1106 Ga0395900_0000980 3300037418 Bacteria 37119
1107 Ga0395900_0010941 3300037418 Bacteria 9279
1108 Ga0395900_0038598 3300037418 Bacteria 4923
1109 Ga0395900_0124178 3300037418 Bacteria 2647
1110 Ga0395898_0000029 3300037466 Bacteria 370667
1111 Ga0395898_0000040 3300037466 Bacteria 317329
1112 Ga0395898_0000202 3300037466 Bacteria 153541
1113 Ga0395898_0001962 3300037466 Bacteria 25903
1114 Ga0395898_0010632 3300037466 Bacteria 9614
1115 Ga0395898_0015160 3300037466 Bacteria 7910
1116 Ga0395898_0016122 3300037466 Bacteria 7653
1117 Ga0395898_0020527 3300037466 Bacteria 6709
1118 Ga0395898_0048473 3300037466 Bacteria 4166
1119 Ga0395905_0000014 3300037471 Bacteria 394209
1120 Ga0395905_0004763 3300037471 Bacteria 14022
1121 Ga0395905_0036820 3300037471 Bacteria 4595
1122 Ga0395901_0000002 3300038443 Bacteria 761045
1123 Ga0395901_0000059 3300038443 Bacteria 152667
1124 Ga0395901_0000196 3300038443 Bacteria 77048
1125 Ga0395901_0001136 3300038443 Bacteria 28215
1126 Ga0395901_0051148 3300038443 Bacteria 4294
1127 Ga0395901_0080501 3300038443 Bacteria 3401
1128 Ga0395901_0100401 3300038443 Bacteria 3035
1129 Ga0395901_0144106 3300038443 Bacteria 2504
1130 Ga0395901_0231549 3300038443 Bacteria 1928
1131 Ga0395901_0312047 3300038443 Bacteria 1628
1132 Ga0395901_0329189 3300038443 Bacteria 1579
1133 Ga0237819_00624 3300038705 Bacteria 11567
1134 Ga0400490_12115 3300038726 Bacteria 7150
1135 Ga0400488_44097 3300038741 Bacteria 6429
1136 Ga0400486_01123 3300038742 Bacteria 1740
1137 Ga0400483_095196 3300039062 Bacteria 15889
1138 Ga0400489_45052 3300039093 Bacteria 1434
1139 Ga0436365_0182246 3300039437 Bacteria 13762
1140 Ga0436361_0167540 3300039447 Bacteria 6110
1141 Ga0436361_0607146 3300039447 Bacteria 4347
1142 Ga0439436_0025860 3300041404 Bacteria 1723
1143 Ga0439438_001542 3300041405 Bacteria 10156
1144 Ga0439438_001831 3300041405 Bacteria 9313
1145 Ga0439438_004000 3300041405 Bacteria 5792
1146 Ga0439438_004655 3300041405 Bacteria 5215
1147 Ga0439438_008994 3300041405 Bacteria 3263
1148 Ga0439447_000377 3300041407 Bacteria 16242
1149 Ga0439447_001015 3300041407 Bacteria 10230
1150 Ga0439447_003199 3300041407 Bacteria 5832
1151 Ga0439466_0000387 3300041411 Bacteria 16853
1152 Ga0439466_0003126 3300041411 Bacteria 6442
1153 Ga0439466_0007551 3300041411 Bacteria 4112
1154 Ga0451793_1027815 3300041452 Bacteria 7799
1155 Ga0451798_0992722 3300041458 Bacteria 2997
1156 Ga0451851_0205038 3300041507 Bacteria 2012
1157 Ga0439448_0000023 3300042005 Bacteria 24812
1158 Ga0439432_000066 3300042006 Bacteria 32758
1159 Ga0439432_003340 3300042006 Bacteria 5959
1160 Ga0439432_010182 3300042006 Bacteria 3263
1161 Ga0439451_004420 3300042009 Bacteria 2855
1162 Ga0439452_000281 3300042010 Bacteria 33473
1163 Ga0439452_000485 3300042010 Bacteria 22057
1164 Ga0439452_000562 3300042010 Bacteria 19552
1165 Ga0439452_007303 3300042010 Bacteria 3391
1166 Ga0439452_014090 3300042010 Bacteria 2228
1167 Ga0439456_003411 3300042013 Bacteria 3220
1168 Ga0439456_004142 3300042013 Bacteria 2939
1169 Ga0439456_009259 3300042013 Bacteria 2035
1170 Ga0439463_000226 3300042016 Bacteria 15540
1171 Ga0450911_000382 3300042115 Bacteria 14760
1172 Ga0450890_000729 3300042127 Bacteria 4769
1173 Ga0450902_004202 3300042137 Bacteria 2135
1174 Ga0450906_000246 3300042145 Bacteria 10404
1175 Ga0450906_007766 3300042145 Bacteria 2105
1176 Ga0450907_000139 3300042146 Bacteria 27686
1177 Ga0450907_000683 3300042146 Bacteria 8791
1178 Ga0450910_001033 3300042147 Bacteria 3405
1179 Ga0439446_0009091 3300042156 Bacteria 2652
1180 Ga0450908_010027 3300042184 Bacteria 1752
1181 Ga0439434_0000870 3300042435 Bacteria 8699
1182 Ga0439459_0001008 3300042438 Bacteria 4003
1183 Ga0466988_0054010 3300044536 Bacteria 2362
1184 Ga0466969_0001020 3300044656 Bacteria 15135
1185 Ga0466969_0006226 3300044656 Bacteria 6353
1186 Ga0466969_0009536 3300044656 Bacteria 5144
1187 Ga0466969_0011611 3300044656 Bacteria 4662
1188 Ga0466972_0004632 3300044658 Bacteria 6886
1189 Ga0466965_0004789 3300044683 Bacteria 6035
1190 Ga0466965_0045424 3300044683 Bacteria 2172
1191 Ga0466965_0059186 3300044683 Bacteria 1911
1192 Ga0466966_0000296 3300044684 Bacteria 32722
1193 Ga0466966_0010340 3300044684 Bacteria 6195
1194 Ga0466966_0027307 3300044684 Bacteria 3723
1195 Ga0466966_0028286 3300044684 Bacteria 3652
1196 Ga0466966_0053662 3300044684 Bacteria 2556
1197 Ga0466961_0000272 3300044693 Bacteria 34599
1198 Ga0466961_0000689 3300044693 Bacteria 21338
1199 Ga0466961_0000696 3300044693 Bacteria 21225
1200 Ga0466961_0023239 3300044693 Bacteria 3988
1201 Ga0466961_0035401 3300044693 Bacteria 3206
1202 Ga0466961_0093036 3300044693 Bacteria 1903
1203 Ga0466961_0126356 3300044693 Bacteria 1604
1204 Ga0466961_0177226 3300044693 Bacteria 1324
1205 Ga0466963_0000764 3300044694 Bacteria 15926
1206 Ga0466963_0003166 3300044694 Bacteria 9346
1207 Ga0466963_0005273 3300044694 Bacteria 7548
1208 Ga0466971_0002420 3300044719 Bacteria 7871
1209 Ga0466971_0025461 3300044719 Bacteria 2642
1210 Ga0466971_0040501 3300044719 Bacteria 2092
1211 Ga0466970_0000201 3300044765 Bacteria 28963
1212 Ga0466970_0003084 3300044765 Bacteria 8089
1213 Ga0466970_0035691 3300044765 Bacteria 2634
1214 Ga0466957_0004013 3300044842 Bacteria 8140
1215 Ga0466957_0008763 3300044842 Bacteria 5758
1216 Ga0466960_0000049 3300044901 Bacteria 39790
1217 Ga0466959_0000006 3300045049 Bacteria 192678
1218 Ga0466959_0000958 3300045049 Bacteria 17161
1219 Ga0466959_0008194 3300045049 Bacteria 7374
1220 Ga0466959_0012533 3300045049 Bacteria 6129
1221 Ga0466959_0015829 3300045049 Bacteria 5502
1222 Ga0466959_0096473 3300045049 Bacteria 2119
1223 Ga0466959_0106109 3300045049 Bacteria 2008
1224 Ga0466959_0110959 3300045049 Bacteria 1957
1225 Ga0466958_0001554 3300045836 Bacteria 10999
1226 Ga0466958_0026070 3300045836 Bacteria 3452
1227 Ga0466958_0035630 3300045836 Bacteria 2973
1228 Ga0466958_0038094 3300045836 Bacteria 2883
1229 Ga0495617_000225 3300046452 Bacteria 34294
1230 Ga0495617_006032 3300046452 Bacteria 4270
1231 Ga0495617_011018 3300046452 Bacteria 3090
1232 Ga0495627_000083 3300046453 Bacteria 113227
1233 Ga0495627_000451 3300046453 Bacteria 35736
1234 Ga0495627_003061 3300046453 Bacteria 7616
1235 Ga0495627_003650 3300046453 Bacteria 6678
1236 Ga0495627_010833 3300046453 Bacteria 3296
1237 Ga0495592_0016556 3300046454 Bacteria 5595
1238 Ga0495592_0044971 3300046454 Bacteria 3296
1239 Ga0495603_0000802 3300046455 Bacteria 18008
1240 Ga0495603_0016077 3300046455 Bacteria 4523
1241 Ga0495603_0016648 3300046455 Bacteria 4448
1242 Ga0495590_0001173 3300046457 Bacteria 11470
1243 Ga0495590_0001387 3300046457 Bacteria 10506
1244 Ga0495590_0002501 3300046457 Bacteria 7606
1245 Ga0495590_0005783 3300046457 Bacteria 4859
1246 Ga0495591_000037 3300046458 Bacteria 158323
1247 Ga0495591_000648 3300046458 Bacteria 25749
1248 Ga0495591_000960 3300046458 Bacteria 19699
1249 Ga0495591_001346 3300046458 Bacteria 15427
1250 Ga0495591_001506 3300046458 Bacteria 14373
1251 Ga0495591_001756 3300046458 Bacteria 12889
1252 Ga0495591_002170 3300046458 Bacteria 11235
1253 Ga0495591_016885 3300046458 Bacteria 2524
1254 Ga0495629_0000105 3300046459 Bacteria 74421
1255 Ga0495629_0000175 3300046459 Bacteria 57283
1256 Ga0495629_0002935 3300046459 Bacteria 13003
1257 Ga0495629_0017828 3300046459 Bacteria 5089
1258 Ga0495629_0021123 3300046459 Bacteria 4646
1259 Ga0495638_0000060 3300046460 Bacteria 190580
1260 Ga0495638_0000116 3300046460 Bacteria 128087
1261 Ga0495638_0000609 3300046460 Bacteria 40051
1262 Ga0495638_0004826 3300046460 Bacteria 10156
1263 Ga0495638_0005276 3300046460 Bacteria 9656
1264 Ga0495638_0006182 3300046460 Bacteria 8746
1265 Ga0495638_0006926 3300046460 Bacteria 8178
1266 Ga0495638_0053292 3300046460 Bacteria 2518
1267 Ga0495651_0001526 3300046462 Bacteria 17899
1268 Ga0495651_0020487 3300046462 Bacteria 5134
1269 Ga0495651_0034950 3300046462 Bacteria 3916
1270 Ga0495653_0010928 3300046463 Bacteria 7434
1271 Ga0495653_0020160 3300046463 Bacteria 5405
1272 Ga0495653_0023003 3300046463 Bacteria 5039
1273 Ga0495653_0040343 3300046463 Bacteria 3648
1274 Ga0495653_0054893 3300046463 Bacteria 3042
1275 Ga0495653_0106040 3300046463 Bacteria 2027
1276 Ga0495653_0209202 3300046463 Bacteria 1318
1277 Ga0495650_0000064 3300046471 Bacteria 275412
1278 Ga0495650_0000075 3300046471 Bacteria 250589
1279 Ga0495650_0001163 3300046471 Bacteria 28128
1280 Ga0495650_0005547 3300046471 Bacteria 8151
1281 Ga0495650_0005976 3300046471 Bacteria 7710
1282 Ga0495650_0006437 3300046471 Bacteria 7315
1283 Ga0495650_0010142 3300046471 Bacteria 5282
1284 Ga0495650_0010597 3300046471 Bacteria 5130
1285 Ga0495580_0000125 3300046472 Bacteria 52763
1286 Ga0495580_0014113 3300046472 Bacteria 6073
1287 Ga0495580_0058472 3300046472 Bacteria 2711
1288 Ga0495580_0195520 3300046472 Bacteria 1394
1289 Ga0495582_0003710 3300046473 Bacteria 8597
1290 Ga0495582_0007857 3300046473 Bacteria 5894
1291 Ga0495582_0051955 3300046473 Bacteria 2260
1292 Ga0495605_0000036 3300046474 Bacteria 203902
1293 Ga0495605_0000745 3300046474 Bacteria 23872
1294 Ga0495605_0000849 3300046474 Bacteria 21311
1295 Ga0495605_0001253 3300046474 Bacteria 16834
1296 Ga0495605_0001795 3300046474 Bacteria 13765
1297 Ga0495605_0002427 3300046474 Bacteria 11521
1298 Ga0495605_0009484 3300046474 Bacteria 5466
1299 Ga0495605_0013476 3300046474 Bacteria 4501
1300 Ga0495605_0013595 3300046474 Bacteria 4479
1301 Ga0495605_0019669 3300046474 Bacteria 3603
1302 Ga0495605_0020667 3300046474 Bacteria 3496
1303 Ga0495639_0000158 3300046475 Bacteria 34960
1304 Ga0495662_0003246 3300046476 Bacteria 8218
1305 Ga0495664_0006406 3300046477 Bacteria 6500
1306 Ga0495664_0081859 3300046477 Bacteria 1935
1307 Ga0495664_0107807 3300046477 Bacteria 1680
1308 Ga0495584_0019260 3300046491 Bacteria 3466
1309 Ga0495584_0108722 3300046491 Bacteria 1402
1310 Ga0495584_0141953 3300046491 Bacteria 1219
1311 Ga0495585_0002523 3300046492 Bacteria 13009
1312 Ga0495585_0013417 3300046492 Bacteria 4795
1313 Ga0495585_0035355 3300046492 Bacteria 2824
1314 Ga0495585_0037360 3300046492 Bacteria 2735
1315 Ga0495594_0001462 3300046499 Bacteria 12271
1316 Ga0495594_0001898 3300046499 Bacteria 10887
1317 Ga0495594_0002321 3300046499 Bacteria 9905
1318 Ga0495594_0005955 3300046499 Bacteria 6266
1319 Ga0495596_0000488 3300046500 Bacteria 25168
1320 Ga0495596_0003157 3300046500 Bacteria 8489
1321 Ga0495596_0022504 3300046500 Bacteria 2565
1322 Ga0495607_0000860 3300046501 Bacteria 28560
1323 Ga0495607_0001076 3300046501 Bacteria 24950
1324 Ga0495607_0001283 3300046501 Bacteria 22484
1325 Ga0495607_0001388 3300046501 Bacteria 21548
1326 Ga0495607_0001475 3300046501 Bacteria 20928
1327 Ga0495607_0004512 3300046501 Bacteria 10216
1328 Ga0495607_0009221 3300046501 Bacteria 6704
1329 Ga0495607_0021322 3300046501 Bacteria 4078
1330 Ga0495607_0027774 3300046501 Bacteria 3495
1331 Ga0495607_0038072 3300046501 Bacteria 2883
1332 Ga0495607_0059014 3300046501 Bacteria 2190
1333 Ga0495583_0000028 3300046506 Bacteria 255787
1334 Ga0495583_0001522 3300046506 Bacteria 23003
1335 Ga0495583_0001875 3300046506 Bacteria 19558
1336 Ga0495583_0003346 3300046506 Bacteria 12366
1337 Ga0495583_0003399 3300046506 Bacteria 12174
1338 Ga0495583_0005967 3300046506 Bacteria 8081
1339 Ga0495583_0007570 3300046506 Bacteria 6792
1340 Ga0495583_0014990 3300046506 Bacteria 4241
1341 Ga0495583_0021529 3300046506 Bacteria 3314
1342 Ga0495606_0000042 3300046507 Bacteria 215099
1343 Ga0495606_0000094 3300046507 Bacteria 151840
1344 Ga0495606_0000415 3300046507 Bacteria 71371
1345 Ga0495606_0004342 3300046507 Bacteria 14233
1346 Ga0495606_0010458 3300046507 Bacteria 7697
1347 Ga0495606_0017134 3300046507 Bacteria 5492
1348 Ga0495606_0024275 3300046507 Bacteria 4373
1349 Ga0495606_0031645 3300046507 Bacteria 3674
1350 Ga0495606_0047270 3300046507 Bacteria 2837
1351 Ga0495606_0052374 3300046507 Bacteria 2654
1352 Ga0495606_0092027 3300046507 Bacteria 1863
1353 Ga0495606_0101378 3300046507 Unclassified 1752
1354 Ga0495606_0121684 3300046507 Bacteria 1562
1355 Ga0495608_0002301 3300046511 Bacteria 13788
1356 Ga0495608_0049734 3300046511 Bacteria 2783
1357 Ga0495608_0128929 3300046511 Bacteria 1619
1358 Ga0495610_0001773 3300046512 Bacteria 18869
1359 Ga0495610_0002926 3300046512 Bacteria 13804
1360 Ga0495610_0006406 3300046512 Bacteria 8104
1361 Ga0495610_0007142 3300046512 Bacteria 7527
1362 Ga0495610_0009768 3300046512 Bacteria 6028
1363 Ga0495610_0011761 3300046512 Bacteria 5316
1364 Ga0495610_0021121 3300046512 Bacteria 3587
1365 Ga0495610_0026266 3300046512 Bacteria 3111
1366 Ga0495616_0001328 3300046513 Bacteria 17284
1367 Ga0495616_0003641 3300046513 Bacteria 9840
1368 Ga0495616_0024526 3300046513 Bacteria 3234
1369 Ga0495618_0005830 3300046514 Bacteria 7490
1370 Ga0495618_0006411 3300046514 Bacteria 7141
1371 Ga0495620_0000322 3300046515 Bacteria 33867
1372 Ga0495620_0000370 3300046515 Bacteria 30870
1373 Ga0495620_0000712 3300046515 Bacteria 20529
1374 Ga0495620_0004434 3300046515 Bacteria 7912
1375 Ga0495620_0006667 3300046515 Bacteria 6326
1376 Ga0495620_0012891 3300046515 Bacteria 4297
1377 Ga0495620_0028687 3300046515 Bacteria 2584
1378 Ga0495620_0039355 3300046515 Bacteria 2090
1379 Ga0495620_0039358 3300046515 Bacteria 2090
1380 Ga0495628_0010471 3300046516 Bacteria 7874
1381 Ga0495628_0019455 3300046516 Bacteria 5612
1382 Ga0495628_0023111 3300046516 Bacteria 5105
1383 Ga0495628_0053416 3300046516 Bacteria 3188
1384 Ga0495630_0007696 3300046517 Bacteria 7704
1385 Ga0495630_0120160 3300046517 Bacteria 1993
1386 Ga0495630_0218900 3300046517 Bacteria 1453
1387 Ga0495631_0001689 3300046518 Bacteria 13122
1388 Ga0495631_0005206 3300046518 Bacteria 6849
1389 Ga0495632_0000360 3300046519 Bacteria 43203
1390 Ga0495632_0000839 3300046519 Bacteria 27070
1391 Ga0495632_0007029 3300046519 Bacteria 7136
1392 Ga0495632_0017470 3300046519 Bacteria 3957
1393 Ga0495632_0021778 3300046519 Bacteria 3447
1394 Ga0495632_0027352 3300046519 Bacteria 2988
1395 Ga0495632_0081507 3300046519 Bacteria 1542
1396 Ga0495632_0089107 3300046519 Bacteria 1465
1397 Ga0495637_0000491 3300046520 Bacteria 28683
1398 Ga0495637_0000518 3300046520 Bacteria 27995
1399 Ga0495637_0001199 3300046520 Bacteria 15781
1400 Ga0495637_0002120 3300046520 Bacteria 11144
1401 Ga0495637_0002498 3300046520 Bacteria 10150
1402 Ga0495637_0006632 3300046520 Bacteria 5795
1403 Ga0495637_0020789 3300046520 Bacteria 3013
1404 Ga0495637_0038833 3300046520 Bacteria 2059
1405 Ga0495637_0046991 3300046520 Bacteria 1824
1406 Ga0495643_0000086 3300046522 Bacteria 156793
1407 Ga0495643_0001985 3300046522 Bacteria 17133
1408 Ga0495643_0004073 3300046522 Bacteria 10408
1409 Ga0495643_0035642 3300046522 Bacteria 2738
1410 Ga0495643_0070422 3300046522 Bacteria 1836
1411 Ga0495644_0000023 3300046523 Bacteria 79095
1412 Ga0495644_0003319 3300046523 Bacteria 6361
1413 Ga0495644_0022555 3300046523 Bacteria 2399
1414 Ga0495648_0009523 3300046524 Bacteria 7506
1415 Ga0495648_0017985 3300046524 Bacteria 5028
1416 Ga0495648_0024067 3300046524 Bacteria 4156
1417 Ga0495648_0131871 3300046524 Bacteria 1327
1418 Ga0495666_0001050 3300046526 Bacteria 13112
1419 Ga0495666_0004226 3300046526 Bacteria 7244
1420 Ga0495666_0012026 3300046526 Bacteria 4320
1421 Ga0495666_0015904 3300046526 Bacteria 3747
1422 Ga0495666_0016571 3300046526 Bacteria 3671
1423 Ga0495666_0104325 3300046526 Bacteria 1334
1424 Ga0495642_0001013 3300046528 Bacteria 13045
1425 Ga0495642_0001683 3300046528 Bacteria 9580
1426 Ga0495652_0001674 3300046529 Bacteria 24027
1427 Ga0495652_0003383 3300046529 Bacteria 15774
1428 Ga0495652_0017996 3300046529 Bacteria 6304
1429 Ga0495652_0042949 3300046529 Bacteria 3896
1430 Ga0495652_0104061 3300046529 Bacteria 2296
1431 Ga0495654_0001499 3300046530 Bacteria 15959
1432 Ga0495654_0004083 3300046530 Bacteria 8760
1433 Ga0495654_0007063 3300046530 Bacteria 6318
1434 Ga0495654_0009795 3300046530 Bacteria 5236
1435 Ga0495654_0010614 3300046530 Bacteria 5005
1436 Ga0495654_0018508 3300046530 Bacteria 3649
1437 Ga0495654_0023907 3300046530 Bacteria 3161
1438 Ga0495654_0057801 3300046530 Bacteria 1873
1439 Ga0495665_0000875 3300046531 Bacteria 15751
1440 Ga0495665_0007079 3300046531 Bacteria 6053
1441 Ga0495665_0015355 3300046531 Bacteria 4124
1442 Ga0495640_0034402 3300046533 Bacteria 3593
1443 Ga0495640_0123908 3300046533 Bacteria 1677
1444 Ga0495586_0000896 3300046535 Bacteria 16999
1445 Ga0495587_0004691 3300046536 Bacteria 8972
1446 Ga0495587_0014198 3300046536 Bacteria 4999
1447 Ga0495587_0072568 3300046536 Bacteria 2001
1448 Ga0495609_0000115 3300046538 Bacteria 93419
1449 Ga0495609_0000248 3300046538 Bacteria 51092
1450 Ga0495609_0000395 3300046538 Bacteria 36677
1451 Ga0495609_0088505 3300046538 Bacteria 1348
1452 Ga0495621_0026915 3300046539 Bacteria 1944
1453 Ga0495597_0001034 3300046542 Bacteria 21263
1454 Ga0495597_0002749 3300046542 Bacteria 10826
1455 Ga0495597_0003571 3300046542 Bacteria 8969
1456 Ga0495645_0002052 3300046543 Bacteria 13703
1457 Ga0495645_0002469 3300046543 Bacteria 12554
1458 Ga0495645_0015033 3300046543 Bacteria 5499
1459 Ga0495645_0041759 3300046543 Bacteria 3344
1460 Ga0495645_0096052 3300046543 Bacteria 2112
1461 Ga0495622_0000575 3300046557 Bacteria 22020
1462 Ga0495622_0001521 3300046557 Bacteria 11587
1463 Ga0495622_0003706 3300046557 Bacteria 7156
1464 Ga0495622_0015667 3300046557 Bacteria 3524
1465 Ga0495633_0001190 3300046558 Bacteria 20892
1466 Ga0495633_0001693 3300046558 Bacteria 16578
1467 Ga0495633_0008768 3300046558 Bacteria 5658
1468 Ga0495667_0203396 3300046559 Bacteria 1267
1469 Ga0495668_0018071 3300046616 Bacteria 4080
1470 Ga0495668_0063825 3300046616 Bacteria 2028
1471 Ga0495634_0005493 3300046642 Bacteria 9746
1472 Ga0495634_0019337 3300046642 Bacteria 4841
1473 Ga0495634_0042765 3300046642 Bacteria 3072
1474 Ga0495611_0000736 3300046648 Bacteria 18466
1475 Ga0495611_0000932 3300046648 Bacteria 15712
1476 Ga0495611_0004344 3300046648 Bacteria 6144
1477 Ga0495611_0047326 3300046648 Bacteria 1930
1478 Ga0495625_0000672 3300046660 Bacteria 48741
1479 Ga0495625_0001298 3300046660 Bacteria 31365
1480 Ga0495625_0003330 3300046660 Bacteria 16184
1481 Ga0495625_0007862 3300046660 Bacteria 9187
1482 Ga0495625_0010613 3300046660 Bacteria 7601
1483 Ga0495625_0013918 3300046660 Bacteria 6441
1484 Ga0495625_0018819 3300046660 Bacteria 5378
1485 Ga0495625_0020283 3300046660 Bacteria 5134
1486 Ga0495625_0024901 3300046660 Bacteria 4545
1487 Ga0495625_0036436 3300046660 Bacteria 3616
1488 Ga0495625_0051875 3300046660 Bacteria 2938
1489 Ga0495625_0065430 3300046660 Bacteria 2562
1490 Ga0495635_0027587 3300046663 Bacteria 3949
1491 Ga0495635_0093110 3300046663 Bacteria 2060
1492 Ga0495635_0224942 3300046663 Bacteria 1268
1493 Ga0495659_0000652 3300046664 Bacteria 12561
1494 Ga0495661_0000116 3300046665 Bacteria 95285
1495 Ga0495661_0000205 3300046665 Bacteria 68743
1496 Ga0495661_0000437 3300046665 Bacteria 44095
1497 Ga0495661_0000685 3300046665 Bacteria 33805
1498 Ga0495661_0001817 3300046665 Bacteria 17115
1499 Ga0495661_0017755 3300046665 Bacteria 4690
1500 Ga0495661_0017872 3300046665 Bacteria 4674
1501 Ga0495661_0020307 3300046665 Bacteria 4338
1502 Ga0495661_0024154 3300046665 Bacteria 3935
1503 Ga0495588_0077383 3300046674 Bacteria 1735
1504 Ga0495599_0018977 3300046678 Bacteria 4286
1505 Ga0495599_0065919 3300046678 Bacteria 2262
1506 Ga0495599_0198232 3300046678 Bacteria 1234
1507 Ga0495623_0006272 3300046679 Bacteria 7731
1508 Ga0495623_0011011 3300046679 Bacteria 5853
1509 Ga0495623_0025627 3300046679 Bacteria 3798
1510 Ga0495623_0156254 3300046679 Bacteria 1344
1511 Ga0495623_0206809 3300046679 Bacteria 1125
1512 Ga0495646_0011260 3300046680 Bacteria 5681
1513 Ga0495646_0012311 3300046680 Bacteria 5439
1514 Ga0495646_0023815 3300046680 Bacteria 3855
1515 Ga0495646_0031113 3300046680 Bacteria 3329
1516 Ga0495646_0044896 3300046680 Bacteria 2700
1517 Ga0495669_0001481 3300046684 Bacteria 9682
1518 Ga0495669_0024735 3300046684 Bacteria 2616
1519 Ga0495613_0008243 3300046689 Bacteria 7734
1520 Ga0495613_0015970 3300046689 Bacteria 5589
1521 Ga0495624_0005166 3300046690 Bacteria 9431
1522 Ga0495624_0006441 3300046690 Bacteria 8330
1523 Ga0495624_0008292 3300046690 Bacteria 7263
1524 Ga0495624_0008471 3300046690 Bacteria 7167
1525 Ga0495624_0010611 3300046690 Bacteria 6345
1526 Ga0495624_0021149 3300046690 Bacteria 4318
1527 Ga0495670_0001795 3300046691 Bacteria 10537
1528 Ga0495670_0003146 3300046691 Bacteria 8130
1529 Ga0495670_0007244 3300046691 Bacteria 5455
1530 Ga0495670_0020115 3300046691 Bacteria 3290
1531 Ga0495670_0082037 3300046691 Bacteria 1643
1532 Ga0495671_0001279 3300046692 Bacteria 17169
1533 Ga0495671_0003674 3300046692 Bacteria 9339
1534 Ga0495671_0004465 3300046692 Bacteria 8360
1535 Ga0495671_0004798 3300046692 Bacteria 7989
1536 Ga0495671_0004983 3300046692 Bacteria 7824
1537 Ga0495671_0007822 3300046692 Bacteria 6049
1538 Ga0495671_0010802 3300046692 Bacteria 5047
1539 Ga0495671_0011402 3300046692 Bacteria 4892
1540 Ga0495671_0021625 3300046692 Bacteria 3376
1541 Ga0495671_0048111 3300046692 Bacteria 2128
1542 Ga0495649_0000813 3300046694 Bacteria 25176
1543 Ga0495649_0000958 3300046694 Bacteria 22785
1544 Ga0495649_0001962 3300046694 Bacteria 14916
1545 Ga0495649_0002855 3300046694 Bacteria 11989
1546 Ga0495649_0022427 3300046694 Bacteria 3533
1547 Ga0495649_0023047 3300046694 Bacteria 3478
1548 Ga0495649_0030996 3300046694 Bacteria 2950
1549 Ga0495649_0060976 3300046694 Bacteria 2028
1550 Ga0495589_0000603 3300046794 Bacteria 24337
1551 Ga0495589_0001311 3300046794 Bacteria 14606
1552 Ga0495589_0002748 3300046794 Bacteria 9733
1553 Ga0495589_0003822 3300046794 Bacteria 8093
1554 Ga0495589_0006874 3300046794 Bacteria 5981
1555 Ga0495589_0028661 3300046794 Bacteria 2809
1556 Ga0495589_0050533 3300046794 Bacteria 2056
1557 Ga0495600_0002250 3300046809 Bacteria 10996
1558 Ga0495600_0005056 3300046809 Bacteria 7922
1559 Ga0495600_0012956 3300046809 Bacteria 5226
1560 Ga0495600_0027878 3300046809 Bacteria 3652
1561 Ga0495660_0001767 3300046810 Bacteria 14330
1562 Ga0495660_0002709 3300046810 Bacteria 11186
1563 Ga0495660_0003160 3300046810 Bacteria 10257
1564 Ga0495660_0011688 3300046810 Bacteria 5092
1565 Ga0495660_0016648 3300046810 Bacteria 4237
1566 Ga0495660_0046471 3300046810 Bacteria 2380
1567 Ga0495660_0051902 3300046810 Bacteria 2229
1568 Ga0495660_0092925 3300046810 Bacteria 1565
1569 Ga0495581_0001650 3300047315 Bacteria 12438
1570 Ga0495581_0021920 3300047315 Bacteria 3702
1571 Ga0495581_0023133 3300047315 Bacteria 3601
1572 Ga0495581_0023908 3300047315 Bacteria 3541
1573 Ga0495581_0055110 3300047315 Bacteria 2295
1574 Ga0495604_0002992 3300047317 Bacteria 13531
1575 Ga0495604_0008904 3300047317 Bacteria 7932
1576 Ga0495604_0012390 3300047317 Bacteria 6779
1577 Ga0495604_0015148 3300047317 Bacteria 6153
1578 Ga0495604_0096008 3300047317 Bacteria 2188
1579 Ga0495604_0119378 3300047317 Bacteria 1910
1580 Ga0495636_0006842 3300047318 Bacteria 4484
1581 Ga0495674_0009541 3300047319 Bacteria 9219
1582 Ga0495674_0020257 3300047319 Bacteria 6158
1583 Ga0495674_0023860 3300047319 Bacteria 5629
1584 Ga0495674_0038522 3300047319 Bacteria 4289
1585 Ga0495672_0000006 3300047320 Bacteria 589807
1586 Ga0495672_0001599 3300047320 Bacteria 22097
1587 Ga0495672_0002422 3300047320 Bacteria 17192
1588 Ga0495672_0003165 3300047320 Bacteria 14310
1589 Ga0495672_0003648 3300047320 Bacteria 13034
1590 Ga0495672_0005788 3300047320 Bacteria 9712
1591 Ga0495672_0007469 3300047320 Bacteria 8217
1592 Ga0495672_0007769 3300047320 Bacteria 8024
1593 Ga0495672_0008206 3300047320 Bacteria 7744
1594 Ga0495672_0012356 3300047320 Bacteria 5962
1595 Ga0495672_0027158 3300047320 Bacteria 3642
1596 Ga0495672_0029446 3300047320 Bacteria 3458
1597 Ga0495672_0029976 3300047320 Bacteria 3419
1598 Ga0495672_0047493 3300047320 Bacteria 2552
1599 Ga0495676_0000171 3300047321 Bacteria 50588
1600 Ga0495676_0001994 3300047321 Bacteria 17966
1601 Ga0495676_0014357 3300047321 Bacteria 7089
1602 Ga0495676_0021499 3300047321 Bacteria 5631
1603 Ga0495676_0139918 3300047321 Bacteria 1735
1604 Ga0495676_0207857 3300047321 Bacteria 1356
1605 Ga0495680_0021825 3300047322 Bacteria 5350
1606 Ga0495680_0046863 3300047322 Bacteria 3405
1607 Ga0495680_0241858 3300047322 Bacteria 1281
1608 Ga0495683_0000122 3300047323 Bacteria 77369
1609 Ga0495683_0000507 3300047323 Bacteria 30072
1610 Ga0495683_0002187 3300047323 Bacteria 11984
1611 Ga0495683_0004452 3300047323 Bacteria 7955
1612 Ga0495683_0009029 3300047323 Bacteria 5313
1613 Ga0495683_0009650 3300047323 Bacteria 5138
1614 Ga0495683_0019910 3300047323 Bacteria 3462
1615 Ga0495683_0033374 3300047323 Bacteria 2619
1616 Ga0495683_0063995 3300047323 Bacteria 1816
1617 Ga0495683_0088161 3300047323 Bacteria 1506
1618 Ga0495687_000011 3300047443 Bacteria 397225
1619 Ga0495687_006192 3300047443 Bacteria 7397
1620 Ga0495687_014652 3300047443 Bacteria 4022
1621 Ga0495687_025890 3300047443 Bacteria 2766
1622 Ga0495675_0004539 3300047444 Bacteria 8416
1623 Ga0495675_0010416 3300047444 Bacteria 5812
1624 Ga0495675_0028822 3300047444 Bacteria 3538
1625 Ga0495675_0039223 3300047444 Bacteria 3016
1626 Ga0495679_000119 3300047446 Bacteria 69255
1627 Ga0495679_000471 3300047446 Bacteria 29142
1628 Ga0495679_001597 3300047446 Bacteria 12731
1629 Ga0495679_010672 3300047446 Bacteria 3593
1630 Ga0495673_0000995 3300047469 Bacteria 25228
1631 Ga0495673_0002146 3300047469 Bacteria 14327
1632 Ga0495673_0003396 3300047469 Bacteria 10517
1633 Ga0495673_0004684 3300047469 Bacteria 8491
1634 Ga0495673_0009152 3300047469 Bacteria 5498
1635 Ga0495673_0021426 3300047469 Bacteria 3190
1636 Ga0495673_0022515 3300047469 Bacteria 3085
1637 Ga0495673_0032777 3300047469 Bacteria 2417
1638 Ga0495673_0033536 3300047469 Bacteria 2381
1639 Ga0495673_0053657 3300047469 Bacteria 1756
1640 Ga0495673_0078241 3300047469 Bacteria 1375
1641 Ga0495681_0000588 3300047470 Bacteria 27772
1642 Ga0495681_0001141 3300047470 Bacteria 20191
1643 Ga0495681_0004351 3300047470 Bacteria 9685
1644 Ga0495681_0005242 3300047470 Bacteria 8707
1645 Ga0495681_0007039 3300047470 Bacteria 7263
1646 Ga0495681_0008829 3300047470 Bacteria 6268
1647 Ga0495684_0027409 3300047471 Bacteria 4374
1648 Ga0495686_0000014 3300047472 Bacteria 474014
1649 Ga0495686_0000106 3300047472 Bacteria 175852
1650 Ga0495686_0002286 3300047472 Bacteria 18387
1651 Ga0495686_0005326 3300047472 Bacteria 10190
1652 Ga0495686_0013497 3300047472 Bacteria 5665
1653 Ga0495686_0027334 3300047472 Bacteria 3727
1654 Ga0495686_0052895 3300047472 Bacteria 2545
1655 Ga0495593_0002465 3300047673 Bacteria 11124
1656 Ga0495593_0005528 3300047673 Bacteria 7462
1657 Ga0495593_0005604 3300047673 Bacteria 7412
1658 Ga0495593_0010719 3300047673 Bacteria 5284
1659 Ga0495593_0022884 3300047673 Bacteria 3477
1660 Ga0495602_0026550 3300048088 Bacteria 5582
1661 Ga0495602_0035542 3300048088 Bacteria 4646
1662 Ga0495602_0106812 3300048088 Bacteria 2284
1663 Ga0495614_0004980 3300048089 Bacteria 5996
1664 Ga0495614_0006551 3300048089 Bacteria 5220
1665 Ga0495626_0000123 3300048091 Bacteria 100704
1666 Ga0495626_0000721 3300048091 Bacteria 30932
1667 Ga0495626_0001593 3300048091 Bacteria 17705
1668 Ga0495626_0002867 3300048091 Bacteria 11494
1669 Ga0495626_0003467 3300048091 Bacteria 10110
1670 Ga0495626_0009762 3300048091 Bacteria 5168
1671 Ga0495626_0012178 3300048091 Bacteria 4521
1672 Ga0495626_0015529 3300048091 Bacteria 3893
1673 Ga0496100_0024102 3300048903 Bacteria 3706
1674 Ga0496102_0004120 3300048905 Bacteria 12324
1675 Ga0496102_0240363 3300048905 Bacteria 1707
1676 Ga0496103_0023783 3300048906 Bacteria 3695
1677 Ga0496103_0208661 3300048906 Bacteria 1256
1678 Ga0496104_0074107 3300048907 Bacteria 3240
1679 Ga0496105_0012365 3300048908 Bacteria 6758
1680 Ga0496105_0013547 3300048908 Bacteria 6477
1681 Ga0496105_0175230 3300048908 Bacteria 1757
1682 Ga0496106_0000026 3300048909 Bacteria 150927
1683 Ga0496106_0123578 3300048909 Bacteria 2025
1684 Ga0496107_0179955 3300048910 Bacteria 1570
1685 Ga0496109_0051688 3300048912 Bacteria 3743
1686 Ga0496110_0000191 3300048913 Bacteria 38480
1687 Ga0496111_0172494 3300048914 Bacteria 1607
1688 Ga0496112_0284761 3300048915 Bacteria 1599
1689 Ga0496113_0009261 3300048916 Bacteria 6461
1690 Ga0496113_0021787 3300048916 Bacteria 4525
1691 Ga0496113_0065923 3300048916 Bacteria 2741
1692 Ga0496113_0088449 3300048916 Bacteria 2383
1693 Ga0496113_0114603 3300048916 Bacteria 2102
1694 Ga0496114_0095111 3300048917 Bacteria 2535
1695 Ga0496115_0000272 3300048918 Bacteria 45410
1696 Ga0496115_0000603 3300048918 Bacteria 27521
1697 Ga0496115_0060115 3300048918 Bacteria 3061
1698 Ga0496116_0000194 3300048919 Bacteria 121290
1699 Ga0496116_0001102 3300048919 Bacteria 32408
1700 Ga0496116_0001261 3300048919 Bacteria 29306
1701 Ga0496116_0008312 3300048919 Bacteria 9020
1702 Ga0496116_0045898 3300048919 Bacteria 2953
1703 Ga0496116_0047289 3300048919 Bacteria 2896
1704 Ga0496117_0001360 3300048920 Bacteria 35658
1705 Ga0496117_0002501 3300048920 Bacteria 23069
1706 Ga0496117_0004110 3300048920 Bacteria 16309
1707 Ga0496117_0004748 3300048920 Bacteria 14752
1708 Ga0496117_0013894 3300048920 Bacteria 6981
1709 Ga0496117_0013964 3300048920 Bacteria 6959
1710 Ga0496117_0028254 3300048920 Bacteria 4347
1711 Ga0496117_0030977 3300048920 Bacteria 4092
1712 Ga0496117_0051200 3300048920 Bacteria 2921
1713 Ga0496118_0000110 3300048921 Bacteria 152891
1714 Ga0496118_0001537 3300048921 Bacteria 34298
1715 Ga0496118_0009650 3300048921 Bacteria 9704
1716 Ga0496118_0024278 3300048921 Bacteria 5240
1717 Ga0496118_0027773 3300048921 Bacteria 4780
1718 Ga0496118_0037297 3300048921 Bacteria 3914
1719 Ga0496118_0063680 3300048921 Bacteria 2711
1720 Ga0496118_0124363 3300048921 Bacteria 1673
1721 Ga0496119_0006317 3300048922 Bacteria 11032
1722 Ga0496119_0015727 3300048922 Bacteria 5802
1723 Ga0496119_0040362 3300048922 Bacteria 2986
1724 Ga0496119_0041312 3300048922 Bacteria 2938
1725 Ga0496119_0044682 3300048922 Bacteria 2786
1726 Ga0496120_0003794 3300048923 Bacteria 13325
1727 Ga0496120_0016041 3300048923 Bacteria 4910
1728 Ga0496120_0050582 3300048923 Bacteria 2378
1729 Ga0496121_0000005 3300048924 Bacteria 1034486
1730 Ga0496121_0000396 3300048924 Bacteria 87716
1731 Ga0496121_0000742 3300048924 Bacteria 60012
1732 Ga0496121_0000791 3300048924 Bacteria 57823
1733 Ga0496121_0001329 3300048924 Bacteria 42366
1734 Ga0496121_0003265 3300048924 Bacteria 23309
1735 Ga0496121_0003863 3300048924 Bacteria 20833
1736 Ga0496121_0004801 3300048924 Bacteria 17819
1737 Ga0496121_0007177 3300048924 Bacteria 13499
1738 Ga0496121_0010549 3300048924 Bacteria 10393
1739 Ga0496121_0013553 3300048924 Bacteria 8743
1740 Ga0496121_0022594 3300048924 Bacteria 6093
1741 Ga0496121_0073761 3300048924 Bacteria 2733
1742 Ga0496122_0000156 3300048925 Bacteria 160178
1743 Ga0496122_0000203 3300048925 Bacteria 132679
1744 Ga0496122_0000249 3300048925 Bacteria 121066
1745 Ga0496122_0000266 3300048925 Bacteria 117021
1746 Ga0496122_0000451 3300048925 Bacteria 85677
1747 Ga0496122_0001854 3300048925 Bacteria 32234
1748 Ga0496122_0005055 3300048925 Bacteria 15939
1749 Ga0496122_0008009 3300048925 Bacteria 11541
1750 Ga0496122_0024208 3300048925 Bacteria 5319
1751 Ga0496122_0035401 3300048925 Bacteria 4062
1752 Ga0496122_0123320 3300048925 Bacteria 1665
1753 Ga0496123_0000018 3300048926 Bacteria 404553
1754 Ga0496123_0000087 3300048926 Bacteria 182994
1755 Ga0496123_0000164 3300048926 Bacteria 132565
1756 Ga0496123_0000347 3300048926 Bacteria 86788
1757 Ga0496123_0001482 3300048926 Bacteria 32593
1758 Ga0496123_0003910 3300048926 Bacteria 16191
1759 Ga0496123_0007317 3300048926 Bacteria 10466
1760 Ga0496123_0008731 3300048926 Bacteria 9251
1761 Ga0496123_0009255 3300048926 Bacteria 8900
1762 Ga0496123_0022466 3300048926 Bacteria 4859
1763 Ga0496124_0000006 3300048927 Bacteria 904259
1764 Ga0496124_0000023 3300048927 Bacteria 415226
1765 Ga0496124_0000506 3300048927 Bacteria 67023
1766 Ga0496124_0000625 3300048927 Bacteria 58974
1767 Ga0496124_0004020 3300048927 Bacteria 17509
1768 Ga0496124_0014633 3300048927 Bacteria 7575
1769 Ga0496124_0033021 3300048927 Bacteria 4559
1770 Ga0496124_0050176 3300048927 Bacteria 3557
1771 Ga0496124_0073391 3300048927 Bacteria 2831
1772 Ga0496124_0097320 3300048927 Bacteria 2389
1773 Ga0496124_0108001 3300048927 Bacteria 2245
1774 Ga0496124_0161963 3300048927 Bacteria 1742
1775 Ga0496125_0000023 3300048928 Bacteria 449042
1776 Ga0496125_0000144 3300048928 Bacteria 156270
1777 Ga0496125_0000159 3300048928 Bacteria 151205
1778 Ga0496125_0000215 3300048928 Bacteria 118487
1779 Ga0496125_0000453 3300048928 Bacteria 74032
1780 Ga0496125_0003794 3300048928 Bacteria 17970
1781 Ga0496125_0028662 3300048928 Bacteria 5022
1782 Ga0496125_0039995 3300048928 Bacteria 4029
1783 Ga0496125_0051405 3300048928 Bacteria 3399
1784 Ga0496125_0052078 3300048928 Bacteria 3369
1785 Ga0496125_0059632 3300048928 Bacteria 3073
1786 Ga0496125_0194922 3300048928 Bacteria 1333
1787 Ga0496126_0000061 3300048929 Bacteria 261515
1788 Ga0496126_0012736 3300048929 Bacteria 8596
1789 Ga0496126_0033969 3300048929 Bacteria 4796
1790 Ga0496126_0057325 3300048929 Bacteria 3517
1791 Ga0496126_0073626 3300048929 Bacteria 3036
1792 Ga0496126_0078778 3300048929 Bacteria 2919
1793 Ga0496126_0097693 3300048929 Bacteria 2573
1794 Ga0496126_0190670 3300048929 Bacteria 1736
1795 Ga0496126_0237270 3300048929 Bacteria 1525
1796 Ga0495678_000020 3300049459 Bacteria 253654
1797 Ga0495678_001763 3300049459 Bacteria 16027
1798 Ga0495678_003152 3300049459 Bacteria 10408
1799 Ga0495678_003293 3300049459 Bacteria 10086
1800 Ga0495678_003507 3300049459 Bacteria 9650
1801 Ga0495678_007368 3300049459 Bacteria 5714
1802 Ga0495678_011773 3300049459 Bacteria 4173
1803 Ga0495678_020128 3300049459 Bacteria 2961
1804 Ga0495678_035839 3300049459 Bacteria 2030
1805 Ga0495682_0000018 3300049460 Bacteria 229211
1806 Ga0501312_003177 3300049528 Bacteria 1843
1807 Ga0501031_0010845 3300049568 Bacteria 5934
1808 Ga0501032_0005636 3300049569 Bacteria 9277
1809 Ga0501033_0005599 3300049570 Bacteria 9920
1810 Ga0501033_0006555 3300049570 Bacteria 9105
1811 Ga0501033_0054385 3300049570 Bacteria 2961
1812 Ga0501034_0000160 3300049571 Bacteria 126787
1813 Ga0501034_0013846 3300049571 Bacteria 8302
1814 Ga0501034_0040386 3300049571 Bacteria 4723
1815 Ga0501034_0085625 3300049571 Bacteria 3153
1816 Ga0501034_0094429 3300049571 Unclassified 2987
1817 Ga0501034_0110024 3300049571 Bacteria 2746
1818 Ga0501034_0259127 3300049571 Bacteria 1682
1819 Ga0501034_0281965 3300049571 Bacteria 1601
1820 Ga0501034_0344651 3300049571 Bacteria 1419
1821 Ga0501034_0442255 3300049571 Bacteria 1219
1822 Ga0501036_0016078 3300049572 Bacteria 6252
1823 Ga0501036_0105473 3300049572 Unclassified 2384
1824 Ga0501037_0005493 3300049573 Bacteria 9241
1825 Ga0501037_0014455 3300049573 Bacteria 5809
1826 Ga0501037_0046604 3300049573 Bacteria 3179
1827 Ga0501038_0099312 3300049574 Unclassified 2427
1828 Ga0501038_0099393 3300049574 Bacteria 2425
1829 Ga0501039_0007179 3300049575 Bacteria 8487
1830 Ga0501040_0000155 3300049576 Bacteria 37853
1831 Ga0501042_0012756 3300049578 Bacteria 5702
1832 Ga0501042_0031461 3300049578 Bacteria 3753
1833 Ga0501043_0003327 3300049579 Bacteria 13249
1834 Ga0501043_0023026 3300049579 Bacteria 4886
1835 Ga0501043_0038713 3300049579 Bacteria 3749
1836 Ga0501043_0074265 3300049579 Bacteria 2671
1837 Ga0501046_0007074 3300049580 Bacteria 9879
1838 Ga0501046_0024284 3300049580 Bacteria 4974
1839 Ga0501047_0085911 3300049581 Bacteria 3022
1840 Ga0501047_0090321 3300049581 Bacteria 2940
1841 Ga0501047_0140690 3300049581 Bacteria 2292
1842 Ga0501047_0147189 3300049581 Bacteria 2231
1843 Ga0501047_0270674 3300049581 Bacteria 1545
1844 Ga0501048_0001062 3300049582 Bacteria 20570
1845 Ga0501048_0021957 3300049582 Bacteria 4672
1846 Ga0501048_0043025 3300049582 Bacteria 3233
1847 Ga0501067_0000141 3300049583 Bacteria 39689
1848 Ga0501068_0097096 3300049584 Bacteria 1823
1849 Ga0501069_0019353 3300049585 Bacteria 3680
1850 Ga0501070_0023144 3300049586 Bacteria 5204
1851 Ga0501217_015787 3300049661 Bacteria 1724
1852 Ga0501238_012959 3300049671 Bacteria 1132
1853 Ga0501079_0007620 3300049741 Bacteria 8197
1854 Ga0501280_005389 3300049776 Bacteria 1829
1855 Ga0501035_0004258 3300049822 Bacteria 13582
1856 Ga0501035_0063758 3300049822 Bacteria 3276
1857 Ga0501035_0137431 3300049822 Unclassified 2127
1858 Ga0501044_0002363 3300049823 Bacteria 21502
1859 Ga0501044_0064616 3300049823 Bacteria 3735
1860 Ga0501044_0069742 3300049823 Bacteria 3578
1861 Ga0501044_0095026 3300049823 Bacteria 3004
1862 Ga0501045_0026003 3300049824 Bacteria 4208
1863 nmdc:mga03683_19772_c1 3300050489 Bacteria 2574
1864 nmdc:mga00v17_374_c1 3300050491 Bacteria 25329
1865 nmdc:mga00v17_57355_c1 3300050491 Bacteria 2383
1866 Ga0500643_000017 3300053087 Bacteria 305781
1867 Ga0500651_0001291 3300053093 Bacteria 12489
1868 Ga0500641_0013826 3300053096 Bacteria 2970
1869 Ga0500595_000927 3300053119 Bacteria 16616
1870 Ga0500595_001126 3300053119 Bacteria 14807
1871 Ga0500595_018414 3300053119 Bacteria 2554
1872 Ga0500618_000126 3300053125 Bacteria 63007
1873 Ga0500618_002046 3300053125 Bacteria 8147
1874 Ga0500658_0004601 3300053134 Bacteria 5145
1875 Ga0500568_0006096 3300053139 Bacteria 6112
1876 Ga0500573_0000055 3300053140 Bacteria 82259
1877 Ga0500616_0013230 3300053153 Bacteria 4800
1878 Ga0500622_0005062 3300053156 Bacteria 8024
1879 Ga0500634_0003859 3300053161 Bacteria 6788
1880 Ga0500634_0018233 3300053161 Bacteria 3767
1881 Ga0501084_0013919 3300054114 Bacteria 6660
1882 Ga0501082_0007757 3300060353 Bacteria 9265
1883 Ga0501082_0063322 3300060353 Bacteria 3184
1884 Ga0466962_0005308 3300061719 Bacteria 6191
1885 Ga0466962_0021384 3300061719 Bacteria 3107

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026121 Ga0207683_10307360 Ga0207683_103073601 326
2 3300046679 Ga0495623_0206809 Ga0495623_0206809_107_1114 335
3 3300049671 Ga0501238_012959 Ga0501238_012959_108_1115 335
4 3300048927 Ga0496124_0161963 Ga0496124_0161963_700_1728 342
5 3300053161 Ga0500634_0018233 Ga0500634_0018233_21_1049 342
6 3300013102 Ga0157371_10114821 Ga0157371_101148212 349
7 3300045049 Ga0466959_0096473 Ga0466959_0096473_1046_2095 349
8 3300046472 Ga0495580_0195520 Ga0495580_0195520_25_1077 350
9 3300046559 Ga0495667_0203396 Ga0495667_0203396_204_1256 350
10 3300046520 Ga0495637_0046991 Ga0495637_0046991_355_1440 361
11 3300009766 Ga0123342_1014946 Ga0123342_10149467 367
12 3300038742 Ga0400486_01123 Ga0400486_01123_625_1728 367
13 3300048921 Ga0496118_0024278 Ga0496118_0024278_4118_5221 367
14 3300048921 Ga0496118_0063680 Ga0496118_0063680_33_1136 367
15 3300048922 Ga0496119_0044682 Ga0496119_0044682_30_1133 367
16 3300049776 Ga0501280_005389 Ga0501280_005389_640_1764 371
17 3300048906 Ga0496103_0023783 Ga0496103_0023783_575_1696 373
18 3300048908 Ga0496105_0013547 Ga0496105_0013547_4833_5954 373
19 3300048914 Ga0496111_0172494 Ga0496111_0172494_22_1143 373
20 3300048922 Ga0496119_0006317 Ga0496119_0006317_7345_8466 373
21 3300048927 Ga0496124_0033021 Ga0496124_0033021_725_1846 373
22 iso_pu_bacteria 2738541272 2738693709 373
23 iso_pu_bacteria 2738543027 2739322876 373
24 iso_pu_bacteria 2758568621 2760621549 373
25 iso_pu_bacteria 641228493 641336122 373
26 3300026116 Ga0207674_10056308 Ga0207674_100563082 376
27 2124908027 MRS2a_Contig_7117 MRS2a_00018670 377
28 3300030732 Ga0316176_1180376 Ga0316176_11803761 377
29 3300030733 Ga0314311_1113156 Ga0314311_11131561 377
30 iso_pu_bacteria 8007371054 8007371595 377
31 iso_pu_bacteria 2501025501 2501074232 378
32 iso_pu_bacteria 2501025502 2501081676 378
33 iso_pu_bacteria 2501025504 2501408000 378
34 iso_pu_bacteria 2503198000 2503198287 378
35 iso_pu_bacteria 2508501125 2509130290 378
36 iso_pu_bacteria 2509276018 2509368360 378
37 iso_pu_bacteria 2509276033 2509445857 378
38 iso_pu_bacteria 2510065019 2510134953 378
39 iso_pu_bacteria 2510065045 2510252264 378
40 iso_pu_bacteria 2510065053 2510282949 378
41 iso_pu_bacteria 2510065055 2510293623 378
42 iso_pu_bacteria 2510065057 2510308907 378
43 iso_pu_bacteria 2510065058 2510310771 378
44 iso_pu_bacteria 2510065059 2510314641 378
45 iso_pu_bacteria 2510461076 2510896375 378
46 iso_pu_bacteria 2510917013 2511085617 378
47 iso_pu_bacteria 2510917014 2511095744 378
48 iso_pu_bacteria 2510917015 2511103503 378
49 iso_pu_bacteria 2510917022 2511136004 378
50 iso_pu_bacteria 2510917026 2511169450 378
51 iso_pu_bacteria 2510917030 2511197329 378
52 iso_pu_bacteria 2511231003 2511248248 378
53 iso_pu_bacteria 2511231004 2511256745 378
54 iso_pu_bacteria 2511231007 2511274754 378
55 iso_pu_bacteria 2511231008 2511277723 378
56 iso_pu_bacteria 2511231010 2511287654 378
57 iso_pu_bacteria 2511231011 2511294082 378
58 iso_pu_bacteria 2511231012 2511303120 378
59 iso_pu_bacteria 2511231014 2511314169 378
60 iso_pu_bacteria 2511231015 2511319886 378
61 iso_pu_bacteria 2511231016 2511327729 378
62 iso_pu_bacteria 2511231017 2511331594 378
63 iso_pu_bacteria 2511231018 2511340315 378
64 iso_pu_bacteria 2511231019 2511344955 378
65 iso_pu_bacteria 2511231020 2511348645 378
66 iso_pu_bacteria 2511231021 2511359772 378
67 iso_pu_bacteria 2511231022 2511360795 378
68 iso_pu_bacteria 2511231023 2511371091 378
69 iso_pu_bacteria 2511231026 2511384811 378
70 iso_pu_bacteria 2511231031 2511410728 378
71 iso_pu_bacteria 2511231052 2511496876 378
72 iso_pu_bacteria 2511231156 2511826112 378
73 iso_pu_bacteria 2512047030 2512344814 378
74 iso_pu_bacteria 2512047086 2512528925 378
75 iso_pu_bacteria 2512875026 2512969135 378
76 iso_pu_bacteria 2513237082 2513554279 378
77 iso_pu_bacteria 2513237083 2513562557 378
78 iso_pu_bacteria 2513237084 2513573740 378
79 iso_pu_bacteria 2513237085 2513581541 378
80 iso_pu_bacteria 2513237086 2513583318 378
81 iso_pu_bacteria 2513237089 2513605653 378
82 iso_pu_bacteria 2513237090 2513609745 378
83 iso_pu_bacteria 2513237091 2513615008 378
84 iso_pu_bacteria 2513237093 2513631199 378
85 iso_pu_bacteria 2513237103 2513710904 378
86 iso_pu_bacteria 2513237140 2513884102 378
87 iso_pu_bacteria 2513237143 2513901538 378
88 iso_pu_bacteria 2513237144 2513908079 378
89 iso_pu_bacteria 2513237151 2513963429 378
90 iso_pu_bacteria 2513237160 2514007795 378
91 iso_pu_bacteria 2513237162 2514023264 378
92 iso_pu_bacteria 2513237166 2514047408 378
93 iso_pu_bacteria 2515075009 2515114040 378
94 iso_pu_bacteria 2515154107 2515612261 378
95 iso_pu_bacteria 2515154113 2515637124 378
96 iso_pu_bacteria 2515154114 2515642904 378
97 iso_pu_bacteria 2515154116 2515656652 378
98 iso_pu_bacteria 2515154122 2515682598 378
99 iso_pu_bacteria 2515154123 2515689494 378
100 iso_pu_bacteria 2515154134 2515744512 378
101 iso_pu_bacteria 2515154189 2516021577 378
102 iso_pu_bacteria 2516653046 2516895901 378
103 iso_pu_bacteria 2516653077 2517037676 378
104 iso_pu_bacteria 2516653085 2517077964 378
105 iso_pu_bacteria 2517093000 2517096758 378
106 iso_pu_bacteria 2517287029 2517410471 378
107 iso_pu_bacteria 2517487022 2517566125 378
108 iso_pu_bacteria 2519103095 2519459709 378
109 iso_pu_bacteria 2521172590 2521556902 378
110 iso_pu_bacteria 2522125168 2522552843 378
111 iso_pu_bacteria 2522572158 2523103361 378
112 iso_pu_bacteria 2524023207 2524449101 378
113 iso_pu_bacteria 2524023209 2524461017 378
114 iso_pu_bacteria 2526164713 2527078662 378
115 iso_pu_bacteria 2529292951 2530647072 378
116 iso_pu_bacteria 2534681796 2535520491 378
117 iso_pu_bacteria 2537561587 2537872842 378
118 iso_pu_bacteria 2547132374 2548498719 378
119 iso_pu_bacteria 2548876994 2550697495 378
120 iso_pu_bacteria 2551306084 2551678637 378
121 iso_pu_bacteria 2551306084 2551681875 378
122 iso_pu_bacteria 2551306085 2551683196 378
123 iso_pu_bacteria 2551306086 2551695849 378
124 iso_pu_bacteria 2551306089 2551709188 378
125 iso_pu_bacteria 2551306089 2551714043 378
126 iso_pu_bacteria 2551306093 2551744175 378
127 iso_pu_bacteria 2551306416 2553004692 378
128 iso_pu_bacteria 2554235227 2555230505 378
129 iso_pu_bacteria 2562617112 2563059655 378
130 iso_pu_bacteria 2582581298 2585224665 378
131 iso_pu_bacteria 2582581299 2585227951 378
132 iso_pu_bacteria 2582581304 2585257915 378
133 iso_pu_bacteria 2582581307 2585274424 378
134 iso_pu_bacteria 2582581308 2585282904 378
135 iso_pu_bacteria 2582581311 2585291286 378
136 iso_pu_bacteria 2582581315 2585322365 378
137 iso_pu_bacteria 2582581316 2585331884 378
138 iso_pu_bacteria 2582581316 2585335055 378
139 iso_pu_bacteria 2582581865 2585389116 378
140 iso_pu_bacteria 2585427526 2585530283 378
141 iso_pu_bacteria 2585427527 2585532311 378
142 iso_pu_bacteria 2585427528 2585540903 378
143 iso_pu_bacteria 2585427529 2585547221 378
144 iso_pu_bacteria 2585427530 2585557574 378
145 iso_pu_bacteria 2585427531 2585560876 378
146 iso_pu_bacteria 2585427593 2585839665 378
147 iso_pu_bacteria 2585427594 2585846179 378
148 iso_pu_bacteria 2585427608 2585899075 378
149 iso_pu_bacteria 2585427609 2585903331 378
150 iso_pu_bacteria 2585427649 2586059877 378
151 iso_pu_bacteria 2585428125 2587981550 378
152 iso_pu_bacteria 2593339198 2595320013 378
153 iso_pu_bacteria 2597489888 2597861226 378
154 iso_pu_bacteria 2597489889 2597866973 378
155 iso_pu_bacteria 2599185155 2599326629 378
156 iso_pu_bacteria 2599185156 2599334063 378
157 iso_pu_bacteria 2599185167 2599401113 378
158 iso_pu_bacteria 2599185179 2599449554 378
159 iso_pu_bacteria 2599185188 2599504339 378
160 iso_pu_bacteria 2599185189 2599506053 378
161 iso_pu_bacteria 2599185190 2599511626 378
162 iso_pu_bacteria 2599185191 2599516600 378
163 iso_pu_bacteria 2599185212 2599613629 378
164 iso_pu_bacteria 2599185236 2599723754 378
165 iso_pu_bacteria 2599185239 2599739939 378
166 iso_pu_bacteria 2599185240 2599748137 378
167 iso_pu_bacteria 2599185248 2599773003 378
168 iso_pu_bacteria 2599185288 2599879346 378
169 iso_pu_bacteria 2599185289 2599889370 378
170 iso_pu_bacteria 2599185290 2599893129 378
171 iso_pu_bacteria 2599185291 2599900768 378
172 iso_pu_bacteria 2599185292 2599906010 378
173 iso_pu_bacteria 2599185300 2599933400 378
174 iso_pu_bacteria 2599185301 2599935518 378
175 iso_pu_bacteria 2599185302 2599944147 378
176 iso_pu_bacteria 2599185303 2599948708 378
177 iso_pu_bacteria 2599185304 2599956365 378
178 iso_pu_bacteria 2599185305 2599963411 378
179 iso_pu_bacteria 2599185306 2599966541 378
180 iso_pu_bacteria 2599185307 2599970516 378
181 iso_pu_bacteria 2599185308 2599977678 378
182 iso_pu_bacteria 2599185309 2599985059 378
183 iso_pu_bacteria 2599185310 2599989315 378
184 iso_pu_bacteria 2599185311 2599994228 378
185 iso_pu_bacteria 2599185312 2600000289 378
186 iso_pu_bacteria 2599185313 2600008169 378
187 iso_pu_bacteria 2599185314 2600011847 378
188 iso_pu_bacteria 2599185315 2600019338 378
189 iso_pu_bacteria 2599185316 2600023523 378
190 iso_pu_bacteria 2599185317 2600030675 378
191 iso_pu_bacteria 2599185318 2600037032 378
192 iso_pu_bacteria 2599185319 2600042455 378
193 iso_pu_bacteria 2599185320 2600049549 378
194 iso_pu_bacteria 2599185321 2600053848 378
195 iso_pu_bacteria 2599185322 2600060518 378
196 iso_pu_bacteria 2599185323 2600065617 378
197 iso_pu_bacteria 2599185324 2600070776 378
198 iso_pu_bacteria 2599185325 2600078302 378
199 iso_pu_bacteria 2599185352 2600192557 378
200 iso_pu_bacteria 2599185355 2600209993 378
201 iso_pu_bacteria 2600254930 2600360482 378
202 iso_pu_bacteria 2600255067 2600810445 378
203 iso_pu_bacteria 2600255283 2601624907 378
204 iso_pu_bacteria 2600255296 2601693300 378
205 iso_pu_bacteria 2600255318 2601796377 378
206 iso_pu_bacteria 2603880185 2606073527 378
207 iso_pu_bacteria 2603880199 2606126829 378
208 iso_pu_bacteria 2615840624 2616295671 378
209 iso_pu_bacteria 2615840626 2616307534 378
210 iso_pu_bacteria 2615840698 2616555083 378
211 iso_pu_bacteria 2617270742 2617384290 378
212 iso_pu_bacteria 2619619299 2621296520 378
213 iso_pu_bacteria 2623620443 2624482028 378
214 iso_pu_bacteria 2623620446 2624490891 378
215 iso_pu_bacteria 2643221550 2643772716 378
216 iso_pu_bacteria 2643221557 2643808917 378
217 iso_pu_bacteria 2643221565 2643845071 378
218 iso_pu_bacteria 2643221569 2643858973 378
219 iso_pu_bacteria 2643221570 2643865504 378
220 iso_pu_bacteria 2643221571 2643873516 378
221 iso_pu_bacteria 2643221577 2643895808 378
222 iso_pu_bacteria 2643221589 2643956601 378
223 iso_pu_bacteria 2643221594 2643981843 378
224 iso_pu_bacteria 2643221596 2643992043 378
225 iso_pu_bacteria 2643221599 2644005286 378
226 iso_pu_bacteria 2643221602 2644025356 378
227 iso_pu_bacteria 2643221607 2644048633 378
228 iso_pu_bacteria 2643221609 2644063253 378
229 iso_pu_bacteria 2643221610 2644068002 378
230 iso_pu_bacteria 2643221611 2644071736 378
231 iso_pu_bacteria 2643221621 2644122845 378
232 iso_pu_bacteria 2643221626 2644149354 378
233 iso_pu_bacteria 2643221634 2644196024 378
234 iso_pu_bacteria 2643221636 2644202046 378
235 iso_pu_bacteria 2643221643 2644240801 378
236 iso_pu_bacteria 2643221650 2644286254 378
237 iso_pu_bacteria 2643221652 2644296214 378
238 iso_pu_bacteria 2643221659 2644337198 378
239 iso_pu_bacteria 2643221668 2644378441 378
240 iso_pu_bacteria 2643221675 2644418957 378
241 iso_pu_bacteria 2643221680 2644453412 378
242 iso_pu_bacteria 2643221685 2644478000 378
243 iso_pu_bacteria 2643221686 2644481435 378
244 iso_pu_bacteria 2643221689 2644498077 378
245 iso_pu_bacteria 2643221698 2644540489 378
246 iso_pu_bacteria 2643221713 2644624467 378
247 iso_pu_bacteria 2643221717 2644649450 378
248 iso_pu_bacteria 2643221723 2644677414 378
249 iso_pu_bacteria 2643221726 2644688295 378
250 iso_pu_bacteria 2651869719 2652548001 378
251 iso_pu_bacteria 2654587600 2655034077 378
252 iso_pu_bacteria 2667528170 2671093676 378
253 iso_pu_bacteria 2667528174 2671112316 378
254 iso_pu_bacteria 2667528176 2671129094 378
255 iso_pu_bacteria 2671180139 2671694754 378
256 iso_pu_bacteria 2675903129 2676746409 378
257 iso_pu_bacteria 2675903420 2677900443 378
258 iso_pu_bacteria 2675903515 2678264448 378
259 iso_pu_bacteria 2687453129 2687580970 378
260 iso_pu_bacteria 2687453130 2687584866 378
261 iso_pu_bacteria 2693429784 2694640885 378
262 iso_pu_bacteria 2711768613 2713479396 378
263 iso_pu_bacteria 2713897148 2715751334 378
264 iso_pu_bacteria 2713897149 2715758330 378
265 iso_pu_bacteria 2718217725 2718635271 378
266 iso_pu_bacteria 2718217882 2719182708 378
267 iso_pu_bacteria 2718217927 2719387376 378
268 iso_pu_bacteria 2718217991 2719641357 378
269 iso_pu_bacteria 2718217997 2719667035 378
270 iso_pu_bacteria 2718218009 2719733425 378
271 iso_pu_bacteria 2718218199 2720493455 378
272 iso_pu_bacteria 2718218232 2720614912 378
273 iso_pu_bacteria 2718218233 2720621683 378
274 iso_pu_bacteria 2718218235 2720633011 378
275 iso_pu_bacteria 2718218269 2720776735 378
276 iso_pu_bacteria 2718218363 2721148820 378
277 iso_pu_bacteria 2718218365 2721160204 378
278 iso_pu_bacteria 2718218366 2721165633 378
279 iso_pu_bacteria 2718218423 2721401011 378
280 iso_pu_bacteria 2721755514 2722841803 378
281 iso_pu_bacteria 2721755556 2723028326 378
282 iso_pu_bacteria 2721755607 2723246130 378
283 iso_pu_bacteria 2721755684 2723561953 378
284 iso_pu_bacteria 2721755685 2723568583 378
285 iso_pu_bacteria 2721755809 2724039824 378
286 iso_pu_bacteria 2721755810 2724046181 378
287 iso_pu_bacteria 2721755819 2724091342 378
288 iso_pu_bacteria 2721755822 2724105848 378
289 iso_pu_bacteria 2721755823 2724111676 378
290 iso_pu_bacteria 2724679232 2725950798 378
291 iso_pu_bacteria 2728369352 2730109262 378
292 iso_pu_bacteria 2728369365 2730165943 378
293 iso_pu_bacteria 2728369397 2730299836 378
294 iso_pu_bacteria 2738541265 2738673466 378
295 iso_pu_bacteria 2738541271 2738688497 378
296 iso_pu_bacteria 2738541282 2738751859 378
297 iso_pu_bacteria 2738541293 2738803130 378
298 iso_pu_bacteria 2738541294 2738807570 378
299 iso_pu_bacteria 2738541296 2738821758 378
300 iso_pu_bacteria 2738541298 2738834240 378
301 iso_pu_bacteria 2738541303 2738860900 378
302 iso_pu_bacteria 2738541306 2738875444 378
303 iso_pu_bacteria 2738541309 2738894930 378
304 iso_pu_bacteria 2738541333 2739035459 378
305 iso_pu_bacteria 2738543002 2739187397 378
306 iso_pu_bacteria 2738543004 2739197062 378
307 iso_pu_bacteria 2738543008 2739222042 378
308 iso_pu_bacteria 2738543012 2739246367 378
309 iso_pu_bacteria 2738543015 2739259130 378
310 iso_pu_bacteria 2738543016 2739264229 378
311 iso_pu_bacteria 2738543020 2739284893 378
312 iso_pu_bacteria 2738543021 2739290207 378
313 iso_pu_bacteria 2738543024 2739305544 378
314 iso_pu_bacteria 2738543025 2739315060 378
315 iso_pu_bacteria 2739367654 2739607462 378
316 iso_pu_bacteria 2739367700 2739733514 378
317 iso_pu_bacteria 2744054620 2745004902 378
318 iso_pu_bacteria 2744054900 2746088544 378
319 iso_pu_bacteria 2744054901 2746092583 378
320 iso_pu_bacteria 2751185846 2753569491 378
321 iso_pu_bacteria 2756170246 2756674304 378
322 iso_pu_bacteria 2758568522 2760304641 378
323 iso_pu_bacteria 2765235838 2765568097 378
324 iso_pu_bacteria 2765235840 2765578236 378
325 iso_pu_bacteria 2765235942 2766065204 378
326 iso_pu_bacteria 2773857670 2774122727 378
327 iso_pu_bacteria 2773857672 2774129006 378
328 iso_pu_bacteria 2773857673 2774132929 378
329 iso_pu_bacteria 2775506987 2776614626 378
330 iso_pu_bacteria 2775507266 2778176146 378
331 iso_pu_bacteria 2784132063 2784263207 378
332 iso_pu_bacteria 2784132072 2784317614 378
333 iso_pu_bacteria 2791355137 2792834553 378
334 iso_pu_bacteria 2791355253 2793283600 378
335 iso_pu_bacteria 2791355256 2793293514 378
336 iso_pu_bacteria 2791355259 2793312967 378
337 iso_pu_bacteria 2791355260 2793319613 378
338 iso_pu_bacteria 2791355261 2793327889 378
339 iso_pu_bacteria 2791355262 2793333502 378
340 iso_pu_bacteria 2791355263 2793341975 378
341 iso_pu_bacteria 2791355264 2793347481 378
342 iso_pu_bacteria 2791355265 2793353811 378
343 iso_pu_bacteria 2791355266 2793359584 378
344 iso_pu_bacteria 2791355267 2793371113 378
345 iso_pu_bacteria 2791355520 2794595963 378
346 iso_pu_bacteria 2802428858 2802720765 378
347 iso_pu_bacteria 2802428859 2802727954 378
348 iso_pu_bacteria 2802428860 2802733107 378
349 iso_pu_bacteria 2802428861 2802740321 378
350 iso_pu_bacteria 2802428863 2802753446 378
351 iso_pu_bacteria 2802429605 2805929515 378
352 iso_pu_bacteria 2802429606 2805935304 378
353 iso_pu_bacteria 2802429633 2806044446 378
354 iso_pu_bacteria 2802429634 2806052647 378
355 iso_pu_bacteria 2802429635 2806058947 378
356 iso_pu_bacteria 2802429636 2806068390 378
357 iso_pu_bacteria 2802429637 2806074510 378
358 iso_pu_bacteria 2808606361 2808856904 378
359 iso_pu_bacteria 2808606364 2808868768 378
360 iso_pu_bacteria 2808606376 2808924262 378
361 iso_pu_bacteria 2808606377 2808930710 378
362 iso_pu_bacteria 2808606378 2808936975 378
363 iso_pu_bacteria 2808606380 2808946353 378
364 iso_pu_bacteria 2808606381 2808952832 378
365 iso_pu_bacteria 2808606382 2808957227 378
366 iso_pu_bacteria 2808606383 2808965329 378
367 iso_pu_bacteria 2808606384 2808968196 378
368 iso_pu_bacteria 2808606385 2808980118 378
369 iso_pu_bacteria 2808606386 2808983656 378
370 iso_pu_bacteria 2808606388 2808995838 378
371 iso_pu_bacteria 2808606389 2809000183 378
372 iso_pu_bacteria 2808606390 2809003027 378
373 iso_pu_bacteria 2808606391 2809010304 378
374 iso_pu_bacteria 2808606394 2809026342 378
375 iso_pu_bacteria 2808606395 2809033910 378
376 iso_pu_bacteria 2808606415 2809129320 378
377 iso_pu_bacteria 2808606419 2809149625 378
378 iso_pu_bacteria 2808606445 2809218872 378
379 iso_pu_bacteria 2816332133 2816475417 378
380 iso_pu_bacteria 2816332186 2816864505 378
381 iso_pu_bacteria 2816332253 2817261982 378
382 iso_pu_bacteria 2816332256 2817279700 378
383 iso_pu_bacteria 2816332286 2817453931 378
384 iso_pu_bacteria 2816332298 2817488001 378
385 iso_pu_bacteria 2818991436 2819543540 378
386 iso_pu_bacteria 2818991445 2819595577 378
387 iso_pu_bacteria 2818991448 2819613546 378
388 iso_pu_bacteria 2818991449 2819616916 378
389 iso_pu_bacteria 2818991450 2819623348 378
390 iso_pu_bacteria 2818991452 2819633844 378
391 iso_pu_bacteria 2818991453 2819644056 378
392 iso_pu_bacteria 2818991456 2819655766 378
393 iso_pu_bacteria 2818991461 2819683188 378
394 iso_pu_bacteria 2821123053 2821126739 378
395 iso_pu_bacteria 2825651385 2825656610 378
396 iso_pu_bacteria 2826581358 2826583067 378
397 iso_pu_bacteria 2831905167 2831908032 378
398 iso_pu_bacteria 2834028612 2834031259 378
399 iso_pu_bacteria 2838016132 2838019218 378
400 iso_pu_bacteria 2838022645 2838024192 378
401 iso_pu_bacteria 2838029111 2838034667 378
402 iso_pu_bacteria 2838042994 2838047477 378
403 iso_pu_bacteria 2838048938 2838051064 378
404 iso_pu_bacteria 2838061910 2838063958 378
405 iso_pu_bacteria 2838068647 2838073441 378
406 iso_pu_bacteria 2838074704 2838075779 378
407 iso_pu_bacteria 2838661181 2838664737 378
408 iso_pu_bacteria 2838668709 2838674661 378
409 iso_pu_bacteria 2838680041 2838684848 378
410 iso_pu_bacteria 2838686498 2838691200 378
411 iso_pu_bacteria 2838694306 2838699315 378
412 iso_pu_bacteria 2838701080 2838706982 378
413 iso_pu_bacteria 2838707686 2838712796 378
414 iso_pu_bacteria 2838729681 2838735683 378
415 iso_pu_bacteria 2838736955 2838740346 378
416 iso_pu_bacteria 2838742623 2838748585 378
417 iso_pu_bacteria 2839094727 2839097610 378
418 iso_pu_bacteria 2841840854 2841843530 378
419 iso_pu_bacteria 2841851746 2841853980 378
420 iso_pu_bacteria 2841864319 2841868039 378
421 iso_pu_bacteria 2842077413 2842082273 378
422 iso_pu_bacteria 2842110456 2842113315 378
423 iso_pu_bacteria 2842118031 2842123198 378
424 iso_pu_bacteria 2842140634 2842143250 378
425 iso_pu_bacteria 2842146304 2842151672 378
426 iso_pu_bacteria 2842156927 2842162501 378
427 iso_pu_bacteria 2842163707 2842170397 378
428 iso_pu_bacteria 2842180545 2842184939 378
429 iso_pu_bacteria 2842192696 2842198605 378
430 iso_pu_bacteria 2842198810 2842199733 378
431 iso_pu_bacteria 2842205361 2842208428 378
432 iso_pu_bacteria 2842217011 2842219959 378
433 iso_pu_bacteria 2842229732 2842235688 378
434 iso_pu_bacteria 2842237096 2842241902 378
435 iso_pu_bacteria 2842243621 2842249278 378
436 iso_pu_bacteria 2842250916 2842256810 378
437 iso_pu_bacteria 2842257432 2842263585 378
438 iso_pu_bacteria 2842264693 2842269937 378
439 iso_pu_bacteria 2842271015 2842275675 378
440 iso_pu_bacteria 2842278818 2842281563 378
441 iso_pu_bacteria 2842285085 2842288688 378
442 iso_pu_bacteria 2842291075 2842296274 378
443 iso_pu_bacteria 2842298080 2842298848 378
444 iso_pu_bacteria 2842304105 2842308341 378
445 iso_pu_bacteria 2842311132 2842316386 378
446 iso_pu_bacteria 2842317721 2842321274 378
447 iso_pu_bacteria 2842324504 2842324688 378
448 iso_pu_bacteria 2842341865 2842345143 378
449 iso_pu_bacteria 2842341865 2842347842 378
450 iso_pu_bacteria 2842348783 2842348966 378
451 iso_pu_bacteria 2842357229 2842359284 378
452 iso_pu_bacteria 2842363717 2842369948 378
453 iso_pu_bacteria 2842370503 2842375524 378
454 iso_pu_bacteria 2842377471 2842382674 378
455 iso_pu_bacteria 2842384541 2842390075 378
456 iso_pu_bacteria 2842395702 2842398384 378
457 iso_pu_bacteria 2842402390 2842406645 378
458 iso_pu_bacteria 2842409023 2842412927 378
459 iso_pu_bacteria 2842415677 2842419571 378
460 iso_pu_bacteria 2842422224 2842427076 378
461 iso_pu_bacteria 2842428310 2842433818 378
462 iso_pu_bacteria 2842434925 2842440150 378
463 iso_pu_bacteria 2842441272 2842446839 378
464 iso_pu_bacteria 2842447887 2842453613 378
465 iso_pu_bacteria 2842454564 2842457328 378
466 iso_pu_bacteria 2842462802 2842468233 378
467 iso_pu_bacteria 2842469257 2842474759 378
468 iso_pu_bacteria 2842475841 2842481440 378
469 iso_pu_bacteria 2842482326 2842489090 378
470 iso_pu_bacteria 2842489311 2842495571 378
471 iso_pu_bacteria 2842495871 2842499040 378
472 iso_pu_bacteria 2842502639 2842508314 378
473 iso_pu_bacteria 2842509118 2842510876 378
474 iso_pu_bacteria 2842682962 2842683335 378
475 iso_pu_bacteria 2842780639 2842782427 378
476 iso_pu_bacteria 2842815866 2842817527 378
477 iso_pu_bacteria 2842826826 2842828446 378
478 iso_pu_bacteria 2842832357 2842836627 378
479 iso_pu_bacteria 2842837860 2842838233 378
480 iso_pu_bacteria 2842843487 2842844740 378
481 iso_pu_bacteria 2842849001 2842850678 378
482 iso_pu_bacteria 2842854478 2842859301 378
483 iso_pu_bacteria 2842903701 2842904382 378
484 iso_pu_bacteria 2842922631 2842925656 378
485 iso_pu_bacteria 2844002411 2844003861 378
486 iso_pu_bacteria 2844009547 2844010412 378
487 iso_pu_bacteria 2844163670 2844170986 378
488 iso_pu_bacteria 2844454524 2844457374 378
489 iso_pu_bacteria 2849139964 2849144181 378
490 iso_pu_bacteria 2852387548 2852391375 378
491 iso_pu_bacteria 2852612431 2852616658 378
492 iso_pu_bacteria 2852618963 2852619777 378
493 iso_pu_bacteria 2852657418 2852663018 378
494 iso_pu_bacteria 2852667396 2852671626 378
495 iso_pu_bacteria 2852673933 2852674553 378
496 iso_pu_bacteria 2854681122 2854683263 378
497 iso_pu_bacteria 2854896431 2854896843 378
498 iso_pu_bacteria 2855825444 2855829289 378
499 iso_pu_bacteria 2855839649 2855844389 378
500 iso_pu_bacteria 2856287931 2856291907 378
501 iso_pu_bacteria 2856320880 2856321924 378
502 iso_pu_bacteria 2856328259 2856331782 378
503 iso_pu_bacteria 2856334872 2856340816 378
504 iso_pu_bacteria 2857349434 2857352567 378
505 iso_pu_bacteria 2857357740 2857360458 378
506 iso_pu_bacteria 2857367948 2857373599 378
507 iso_pu_bacteria 2857442823 2857443923 378
508 iso_pu_bacteria 2857516855 2857518785 378
509 iso_pu_bacteria 2857531043 2857535477 378
510 iso_pu_bacteria 2857537821 2857539823 378
511 iso_pu_bacteria 2858800743 2858806151 378
512 iso_pu_bacteria 2858950400 2858955237 378
513 iso_pu_bacteria 2860339153 2860340931 378
514 iso_pu_bacteria 2860867994 2860868026 378
515 iso_pu_bacteria 2863421361 2863427016 378
516 iso_pu_bacteria 2869169390 2869170778 378
517 iso_pu_bacteria 2869234852 2869236920 378
518 iso_pu_bacteria 2869242130 2869243363 378
519 iso_pu_bacteria 2869249662 2869251905 378
520 iso_pu_bacteria 2869256925 2869261818 378
521 iso_pu_bacteria 2869264136 2869264871 378
522 iso_pu_bacteria 2869271264 2869278128 378
523 iso_pu_bacteria 2870068957 2870070265 378
524 iso_pu_bacteria 2871435913 2871440273 378
525 iso_pu_bacteria 2871451962 2871458856 378
526 iso_pu_bacteria 2871459585 2871459637 378
527 iso_pu_bacteria 2871466892 2871468251 378
528 iso_pu_bacteria 2871481445 2871488623 378
529 iso_pu_bacteria 2874109183 2874109954 378
530 iso_pu_bacteria 2874116593 2874123260 378
531 iso_pu_bacteria 2874131515 2874132118 378
532 iso_pu_bacteria 2874162495 2874162917 378
533 iso_pu_bacteria 2876377896 2876385585 378
534 iso_pu_bacteria 2876386047 2876391387 378
535 iso_pu_bacteria 2876399893 2876404228 378
536 iso_pu_bacteria 2876406927 2876412406 378
537 iso_pu_bacteria 2876420981 2876423802 378
538 iso_pu_bacteria 2878029506 2878034010 378
539 iso_pu_bacteria 2878730984 2878736385 378
540 iso_pu_bacteria 2878774303 2878779763 378
541 iso_pu_bacteria 2880230671 2880234630 378
542 iso_pu_bacteria 2881636855 2881638728 378
543 iso_pu_bacteria 2883087390 2883095258 378
544 iso_pu_bacteria 2884411467 2884412792 378
545 iso_pu_bacteria 2884411467 2884414547 378
546 iso_pu_bacteria 2884411467 2884414775 378
547 iso_pu_bacteria 2884811622 2884814583 378
548 iso_pu_bacteria 2884836552 2884839090 378
549 iso_pu_bacteria 2884852848 2884855381 378
550 iso_pu_bacteria 2885270888 2885279860 378
551 iso_pu_bacteria 2889010040 2889014518 378
552 iso_pu_bacteria 2891373044 2891376742 378
553 iso_pu_bacteria 2894817345 2894819204 378
554 iso_pu_bacteria 2896085136 2896086226 378
555 iso_pu_bacteria 2896154374 2896159112 378
556 iso_pu_bacteria 2896384573 2896388228 378
557 iso_pu_bacteria 2898907183 2898911311 378
558 iso_pu_bacteria 2900634093 2900637404 378
559 iso_pu_bacteria 2902682994 2902691133 378
560 iso_pu_bacteria 2903513507 2903517120 378
561 iso_pu_bacteria 2904113452 2904119144 378
562 iso_pu_bacteria 2904434214 2904434670 378
563 iso_pu_bacteria 2904439833 2904440396 378
564 iso_pu_bacteria 2904479285 2904481515 378
565 iso_pu_bacteria 2904483920 2904487776 378
566 iso_pu_bacteria 2904518522 2904521231 378
567 iso_pu_bacteria 2904530477 2904530689 378
568 iso_pu_bacteria 2904550169 2904555285 378
569 iso_pu_bacteria 2904564687 2904570425 378
570 iso_pu_bacteria 2904571731 2904577602 378
571 iso_pu_bacteria 2904584206 2904585898 378
572 iso_pu_bacteria 2904589729 2904592289 378
573 iso_pu_bacteria 2904601388 2904601575 378
574 iso_pu_bacteria 2904615490 2904620516 378
575 iso_pu_bacteria 2906363423 2906370383 378
576 iso_pu_bacteria 2906386501 2906389355 378
577 iso_pu_bacteria 2906393657 2906394367 378
578 iso_pu_bacteria 2906401398 2906404376 378
579 iso_pu_bacteria 2906408224 2906413352 378
580 iso_pu_bacteria 2906427513 2906430011 378
581 iso_pu_bacteria 2908446538 2908446604 378
582 iso_pu_bacteria 2909042592 2909048450 378
583 iso_pu_bacteria 2909399089 2909402904 378
584 iso_pu_bacteria 2910809715 2910811758 378
585 iso_pu_bacteria 2913036834 2913040925 378
586 iso_pu_bacteria 2915980308 2915982829 378
587 iso_pu_bacteria 2915986958 2915990152 378
588 iso_pu_bacteria 2915993759 2915995010 378
589 iso_pu_bacteria 2916000859 2916005536 378
590 iso_pu_bacteria 2916007675 2916013807 378
591 iso_pu_bacteria 2916014648 2916014891 378
592 iso_pu_bacteria 2916021584 2916021587 378
593 iso_pu_bacteria 2916028427 2916028602 378
594 iso_pu_bacteria 2916035215 2916035829 378
595 iso_pu_bacteria 2916041962 2916046559 378
596 iso_pu_bacteria 2916048683 2916048713 378
597 iso_pu_bacteria 2916055098 2916059939 378
598 iso_pu_bacteria 2916061851 2916064625 378
599 iso_pu_bacteria 2916068649 2916074288 378
600 iso_pu_bacteria 2916076590 2916079194 378
601 iso_pu_bacteria 2917832318 2917836878 378
602 iso_pu_bacteria 2919046199 2919049702 378
603 iso_pu_bacteria 2919063839 2919069373 378
604 iso_pu_bacteria 2919079590 2919082773 378
605 iso_pu_bacteria 2919100787 2919104683 378
606 iso_pu_bacteria 2919125081 2919125913 378
607 iso_pu_bacteria 2919385768 2919388106 378
608 iso_pu_bacteria 2919408235 2919410802 378
609 iso_pu_bacteria 2919456309 2919460968 378
610 iso_pu_bacteria 2919481497 2919487276 378
611 iso_pu_bacteria 2919487758 2919489708 378
612 iso_pu_bacteria 2919527303 2919529081 378
613 iso_pu_bacteria 2919697872 2919701883 378
614 iso_pu_bacteria 2919704043 2919707672 378
615 iso_pu_bacteria 2920760137 2920764337 378
616 iso_pu_bacteria 2920822456 2920827080 378
617 iso_pu_bacteria 2921201388 2921206676 378
618 iso_pu_bacteria 2921208531 2921214134 378
619 iso_pu_bacteria 2921237296 2921243572 378
620 iso_pu_bacteria 2921244191 2921249152 378
621 iso_pu_bacteria 2921250672 2921253203 378
622 iso_pu_bacteria 2921257292 2921263698 378
623 iso_pu_bacteria 2921263974 2921268018 378
624 iso_pu_bacteria 2921282425 2921288571 378
625 iso_pu_bacteria 2921289301 2921294295 378
626 iso_pu_bacteria 2921296804 2921302846 378
627 iso_pu_bacteria 2921643360 2921646338 378
628 iso_pu_bacteria 2922172374 2922177241 378
629 iso_pu_bacteria 2922178524 2922183725 378
630 iso_pu_bacteria 2923510766 2923515520 378
631 iso_pu_bacteria 2923586266 2923589962 378
632 iso_pu_bacteria 2924144063 2924150361 378
633 iso_pu_bacteria 2924150972 2924156908 378
634 iso_pu_bacteria 2924158325 2924163870 378
635 iso_pu_bacteria 2924165586 2924171273 378
636 iso_pu_bacteria 2924172951 2924175115 378
637 iso_pu_bacteria 2924179722 2924181303 378
638 iso_pu_bacteria 2924186466 2924192159 378
639 iso_pu_bacteria 2924193448 2924196743 378
640 iso_pu_bacteria 2924200457 2924200475 378
641 iso_pu_bacteria 2924207177 2924212015 378
642 iso_pu_bacteria 2924214083 2924220566 378
643 iso_pu_bacteria 2924221636 2924227708 378
644 iso_pu_bacteria 2924228884 2924233465 378
645 iso_pu_bacteria 2924710171 2924715473 378
646 iso_pu_bacteria 2924733363 2924736703 378
647 iso_pu_bacteria 2924741084 2924743945 378
648 iso_pu_bacteria 2924748358 2924753884 378
649 iso_pu_bacteria 2928108538 2928113492 378
650 iso_pu_bacteria 2928130867 2928134440 378
651 iso_pu_bacteria 2928135762 2928140795 378
652 iso_pu_bacteria 2928157003 2928161198 378
653 iso_pu_bacteria 2928163908 2928168041 378
654 iso_pu_bacteria 2928170801 2928175606 378
655 iso_pu_bacteria 2928503688 2928506087 378
656 iso_pu_bacteria 2928536128 2928542700 378
657 iso_pu_bacteria 2928963466 2928966798 378
658 iso_pu_bacteria 2928963466 2928966809 378
659 iso_pu_bacteria 2929138655 2929142922 378
660 iso_pu_bacteria 2929144301 2929148424 378
661 iso_pu_bacteria 2929189879 2929189909 378
662 iso_pu_bacteria 2931369376 2931374160 378
663 iso_pu_bacteria 2931390751 2931390970 378
664 iso_pu_bacteria 2931396565 2931396673 378
665 iso_pu_bacteria 2933016740 2933019870 378
666 iso_pu_bacteria 2933016740 2933020680 378
667 iso_pu_bacteria 2933570622 2933574790 378
668 iso_pu_bacteria 2933586486 2933589394 378
669 iso_pu_bacteria 2933599457 2933603429 378
670 iso_pu_bacteria 2935894831 2935901173 378
671 iso_pu_bacteria 2935901341 2935908259 378
672 iso_pu_bacteria 2936367885 2936374758 378
673 iso_pu_bacteria 2936375103 2936380450 378
674 iso_pu_bacteria 2936381700 2936382387 378
675 iso_pu_bacteria 2936996657 2936998336 378
676 iso_pu_bacteria 2937002841 2937002930 378
677 iso_pu_bacteria 2937009748 2937009779 378
678 iso_pu_bacteria 2937016420 2937021605 378
679 iso_pu_bacteria 2937023124 2937025089 378
680 iso_pu_bacteria 2937029754 2937034053 378
681 iso_pu_bacteria 2937036028 2937038142 378
682 iso_pu_bacteria 2937042894 2937049162 378
683 iso_pu_bacteria 2937049772 2937054217 378
684 iso_pu_bacteria 2937056579 2937063847 378
685 iso_pu_bacteria 2937063883 2937070833 378
686 iso_pu_bacteria 2937071275 2937077669 378
687 iso_pu_bacteria 2937078374 2937081214 378
688 iso_pu_bacteria 2937084907 2937087175 378
689 iso_pu_bacteria 2937091812 2937097765 378
690 iso_pu_bacteria 2937098957 2937105098 378
691 iso_pu_bacteria 2937106411 2937107973 378
692 iso_pu_bacteria 2937113482 2937115353 378
693 iso_pu_bacteria 2937119839 2937121081 378
694 iso_pu_bacteria 2937126314 2937128287 378
695 iso_pu_bacteria 2937861824 2937868897 378
696 iso_pu_bacteria 2937868953 2937874718 378
697 iso_pu_bacteria 2937980651 2937986207 378
698 iso_pu_bacteria 2938014810 2938016665 378
699 iso_pu_bacteria 2939589442 2939591610 378
700 iso_pu_bacteria 2939622612 2939623925 378
701 iso_pu_bacteria 2939636861 2939637520 378
702 iso_pu_bacteria 2941479691 2941479789 378
703 iso_pu_bacteria 2941499720 2941503273 378
704 iso_pu_bacteria 2945928738 2945930575 378
705 iso_pu_bacteria 2945934425 2945938050 378
706 iso_pu_bacteria 2945961074 2945967179 378
707 iso_pu_bacteria 2946006987 2946012922 378
708 iso_pu_bacteria 2946027586 2946028214 378
709 iso_pu_bacteria 2947233263 2947234735 378
710 iso_pu_bacteria 2952252522 2952254407 378
711 iso_pu_bacteria 2957375807 2957377280 378
712 iso_pu_bacteria 2957382221 2957386189 378
713 iso_pu_bacteria 2957388812 2957393495 378
714 iso_pu_bacteria 2957395598 2957397909 378
715 iso_pu_bacteria 2957402308 2957406594 378
716 iso_pu_bacteria 2957408893 2957412381 378
717 iso_pu_bacteria 2957415311 2957419713 378
718 iso_pu_bacteria 2957422303 2957429844 378
719 iso_pu_bacteria 2957430029 2957432949 378
720 iso_pu_bacteria 2957437181 2957439012 378
721 iso_pu_bacteria 2957443900 2957446083 378
722 iso_pu_bacteria 2957450854 2957451621 378
723 iso_pu_bacteria 2957457609 2957463667 378
724 iso_pu_bacteria 2957464669 2957465901 378
725 iso_pu_bacteria 2957471148 2957477063 378
726 iso_pu_bacteria 2957478035 2957483220 378
727 iso_pu_bacteria 2957484790 2957491202 378
728 iso_pu_bacteria 2957491536 2957494732 378
729 iso_pu_bacteria 2957498199 2957504431 378
730 iso_pu_bacteria 2957505466 2957505471 378
731 iso_pu_bacteria 2958064165 2958068059 378
732 iso_pu_bacteria 2958108152 2958114697 378
733 iso_pu_bacteria 2958122699 2958129387 378
734 iso_pu_bacteria 2958137437 2958138514 378
735 iso_pu_bacteria 2958158011 2958164034 378
736 iso_pu_bacteria 2960584000 2960587782 378
737 iso_pu_bacteria 2960591022 2960593821 378
738 iso_pu_bacteria 2960597568 2960600298 378
739 iso_pu_bacteria 2960603979 2960604220 378
740 iso_pu_bacteria 2960610863 2960610870 378
741 iso_pu_bacteria 2960617483 2960624013 378
742 iso_pu_bacteria 2960624210 2960624305 378
743 iso_pu_bacteria 2960631154 2960636447 378
744 iso_pu_bacteria 2960637947 2960638045 378
745 iso_pu_bacteria 2960645483 2960649521 378
746 iso_pu_bacteria 2960652885 2960659731 378
747 iso_pu_bacteria 2960660292 2960663617 378
748 iso_pu_bacteria 2960667422 2960667446 378
749 iso_pu_bacteria 2960674078 2960678987 378
750 iso_pu_bacteria 2960680706 2960683320 378
751 iso_pu_bacteria 2960693952 2960700303 378
752 iso_pu_bacteria 2961136820 2961142041 378
753 iso_pu_bacteria 2961183825 2961184117 378
754 iso_pu_bacteria 2964607997 2964608308 378
755 iso_pu_bacteria 2964615318 2964615392 378
756 iso_pu_bacteria 2964621998 2964628235 378
757 iso_pu_bacteria 2964628898 2964628902 378
758 iso_pu_bacteria 2964636051 2964640758 378
759 iso_pu_bacteria 2964643177 2964643496 378
760 iso_pu_bacteria 2964649959 2964653192 378
761 iso_pu_bacteria 2964656573 2964656595 378
762 iso_pu_bacteria 2964663802 2964664125 378
763 iso_pu_bacteria 2964670856 2964674387 378
764 iso_pu_bacteria 2964678106 2964683687 378
765 iso_pu_bacteria 2964685014 2964690803 378
766 iso_pu_bacteria 2964691889 2964698360 378
767 iso_pu_bacteria 2964698721 2964698790 378
768 iso_pu_bacteria 2964705432 2964707657 378
769 iso_pu_bacteria 2964712639 2964715806 378
770 iso_pu_bacteria 2964719344 2964726103 378
771 iso_pu_bacteria 2965025482 2965028591 378
772 iso_pu_bacteria 2965032056 2965038518 378
773 iso_pu_bacteria 2965047637 2965050226 378
774 iso_pu_bacteria 2965089291 2965094523 378
775 iso_pu_bacteria 2965102966 2965105084 378
776 iso_pu_bacteria 2967664464 2967670206 378
777 iso_pu_bacteria 2967671571 2967673370 378
778 iso_pu_bacteria 2967678726 2967679410 378
779 iso_pu_bacteria 2967686174 2967689669 378
780 iso_pu_bacteria 2967693043 2967696011 378
781 iso_pu_bacteria 2967699805 2967704741 378
782 iso_pu_bacteria 2967706974 2967711226 378
783 iso_pu_bacteria 2967714385 2967718336 378
784 iso_pu_bacteria 2967721400 2967722306 378
785 iso_pu_bacteria 2967728569 2967729927 378
786 iso_pu_bacteria 2967735183 2967738726 378
787 iso_pu_bacteria 2967742019 2967747604 378
788 iso_pu_bacteria 2967748971 2967749300 378
789 iso_pu_bacteria 2967755722 2967757355 378
790 iso_pu_bacteria 2967762386 2967762597 378
791 iso_pu_bacteria 2967769361 2967774087 378
792 iso_pu_bacteria 2967775926 2967780877 378
793 iso_pu_bacteria 2968117919 2968121909 378
794 iso_pu_bacteria 2969304461 2969308784 378
795 iso_pu_bacteria 2970019648 2970025819 378
796 iso_pu_bacteria 2970026789 2970027110 378
797 iso_pu_bacteria 2970033650 2970037728 378
798 iso_pu_bacteria 2970040964 2970045777 378
799 iso_pu_bacteria 2970047711 2970053946 378
800 iso_pu_bacteria 2970054988 2970058977 378
801 iso_pu_bacteria 2970061556 2970064789 378
802 iso_pu_bacteria 2970068827 2970075782 378
803 iso_pu_bacteria 2970076120 2970079677 378
804 iso_pu_bacteria 2970082768 2970084142 378
805 iso_pu_bacteria 2970088815 2970093398 378
806 iso_pu_bacteria 2970095765 2970099225 378
807 iso_pu_bacteria 2970102677 2970103007 378
808 iso_pu_bacteria 2970109326 2970115353 378
809 iso_pu_bacteria 2970116247 2970118939 378
810 iso_pu_bacteria 2970122695 2970124002 378
811 iso_pu_bacteria 2970129317 2970133319 378
812 iso_pu_bacteria 2970136068 2970140050 378
813 iso_pu_bacteria 2970143518 2970149168 378
814 iso_pu_bacteria 2970149975 2970152245 378
815 iso_pu_bacteria 2970156795 2970163005 378
816 iso_pu_bacteria 2970164137 2970164892 378
817 iso_pu_bacteria 2970170962 2970171309 378
818 iso_pu_bacteria 2970177841 2970179894 378
819 iso_pu_bacteria 2970191845 2970197726 378
820 iso_pu_bacteria 2970489779 2970493896 378
821 iso_pu_bacteria 2970510686 2970510791 378
822 iso_pu_bacteria 2970532167 2970533099 378
823 iso_pu_bacteria 2970547951 2970548449 378
824 iso_pu_bacteria 2970619444 2970622143 378
825 iso_pu_bacteria 2970627176 2970632800 378
826 iso_pu_bacteria 2971403814 2971404269 378
827 iso_pu_bacteria 2971410472 2971416463 378
828 iso_pu_bacteria 2974289157 2974289833 378
829 iso_pu_bacteria 2974298342 2974302579 378
830 iso_pu_bacteria 2974307012 2974308854 378
831 iso_pu_bacteria 2977247770 2977249570 378
832 iso_pu_bacteria 2977516862 2977521655 378
833 iso_pu_bacteria 2977523885 2977525746 378
834 iso_pu_bacteria 2977530762 2977534911 378
835 iso_pu_bacteria 2977537788 2977539953 378
836 iso_pu_bacteria 2977544691 2977545580 378
837 iso_pu_bacteria 2977551784 2977557648 378
838 iso_pu_bacteria 2977558990 2977559178 378
839 iso_pu_bacteria 2977565890 2977565956 378
840 iso_pu_bacteria 2977572785 2977574475 378
841 iso_pu_bacteria 2977579622 2977584658 378
842 iso_pu_bacteria 2977851361 2977856414 378
843 iso_pu_bacteria 2977872689 2977875348 378
844 iso_pu_bacteria 2977898635 2977901987 378
845 iso_pu_bacteria 2977907340 2977910899 378
846 iso_pu_bacteria 2977915119 2977919778 378
847 iso_pu_bacteria 2977935797 2977938538 378
848 iso_pu_bacteria 2977942078 2977950644 378
849 iso_pu_bacteria 2977950692 2977951693 378
850 iso_pu_bacteria 2977957713 2977964801 378
851 iso_pu_bacteria 2979764755 2979770471 378
852 iso_pu_bacteria 2979772303 2979773482 378
853 iso_pu_bacteria 2981990288 2981997189 378
854 iso_pu_bacteria 2984499530 2984499835 378
855 iso_pu_bacteria 2984504281 2984506266 378
856 iso_pu_bacteria 2984514374 2984515938 378
857 iso_pu_bacteria 2987636660 2987641159 378
858 iso_pu_bacteria 2987645492 2987650592 378
859 iso_pu_bacteria 2987652177 2987659177 378
860 iso_pu_bacteria 2988728565 2988730025 378
861 iso_pu_bacteria 2989349275 2989354662 378
862 iso_pu_bacteria 2989771324 2989776632 378
863 iso_pu_bacteria 2990703756 2990705234 378
864 iso_pu_bacteria 2990710928 2990712093 378
865 iso_pu_bacteria 2995392953 2995394847 378
866 iso_pu_bacteria 2996386984 2996388046 378
867 iso_pu_bacteria 2998139840 2998144087 378
868 iso_pu_bacteria 3000135777 3000142619 378
869 iso_pu_bacteria 3001267043 3001268606 378
870 iso_pu_bacteria 3001272096 3001274083 378
871 iso_pu_bacteria 3001892409 3001898537 378
872 iso_pu_bacteria 3004167301 3004172818 378
873 iso_pu_bacteria 3004195979 3004203247 378
874 iso_pu_bacteria 3004232784 3004235419 378
875 iso_pu_bacteria 3004239961 3004245565 378
876 iso_pu_bacteria 3004248173 3004254617 378
877 iso_pu_bacteria 3005416602 3005418348 378
878 iso_pu_bacteria 3005445848 3005449389 378
879 iso_pu_bacteria 3005445848 3005450712 378
880 iso_pu_bacteria 3005452660 3005457503 378
881 iso_pu_bacteria 3006826541 3006831294 378
882 iso_pu_bacteria 3006984091 3006984336 378
883 iso_pu_bacteria 3006988479 3006988752 378
884 iso_pu_bacteria 3006988479 3006991066 378
885 iso_pu_bacteria 3007395558 3007400968 378
886 iso_pu_bacteria 3007419365 3007425133 378
887 iso_pu_bacteria 3007511990 3007515728 378
888 iso_pu_bacteria 3007614139 3007617864 378
889 iso_pu_bacteria 3007619802 3007619928 378
890 iso_pu_bacteria 3007718800 3007719018 378
891 iso_pu_bacteria 3007855910 3007858926 378
892 iso_pu_bacteria 3007861166 3007865518 378
893 iso_pu_bacteria 3007866637 3007868138 378
894 iso_pu_bacteria 639633055 639650112 378
895 iso_pu_bacteria 641736151 642424252 378
896 iso_pu_bacteria 641736154 642416009 378
897 iso_pu_bacteria 642555112 642592197 378
898 iso_pu_bacteria 642555113 642622877 378
899 iso_pu_bacteria 643348555 643389922 378
900 iso_pu_bacteria 648276728 648735401 378
901 iso_pu_bacteria 649633066 649870181 378
902 iso_pu_bacteria 8002285264 8002289603 378
903 iso_pu_bacteria 8003014200 8003015637 378
904 iso_pu_bacteria 8003955200 8003959765 378
905 iso_pu_bacteria 8003992118 8003996913 378
906 iso_pu_bacteria 8003999396 8004004582 378
907 iso_pu_bacteria 8004300914 8004303693 378
908 iso_pu_bacteria 8004312739 8004317385 378
909 iso_pu_bacteria 8004361976 8004364251 378
910 iso_pu_bacteria 8004640170 8004644302 378
911 iso_pu_bacteria 8004695233 8004703460 378
912 iso_pu_bacteria 8004727605 8004732836 378
913 iso_pu_bacteria 8005275841 8005282123 378
914 iso_pu_bacteria 8005282627 8005285062 378
915 iso_pu_bacteria 8005289223 8005294155 378
916 iso_pu_bacteria 8005301065 8005306569 378
917 iso_pu_bacteria 8005307578 8005312151 378
918 iso_pu_bacteria 8005314921 8005318760 378
919 iso_pu_bacteria 8005376324 8005378441 378
920 iso_pu_bacteria 8005382845 8005383732 378
921 iso_pu_bacteria 8005395548 8005401059 378
922 iso_pu_bacteria 8005430974 8005434013 378
923 iso_pu_bacteria 8005460587 8005464728 378
924 iso_pu_bacteria 8005484373 8005486841 378
925 iso_pu_bacteria 8005497431 8005501774 378
926 iso_pu_bacteria 8005542996 8005548246 378
927 iso_pu_bacteria 8005556819 8005559049 378
928 iso_pu_bacteria 8005563573 8005566893 378
929 iso_pu_bacteria 8005570704 8005574832 378
930 iso_pu_bacteria 8005619151 8005623128 378
931 iso_pu_bacteria 8005626139 8005631564 378
932 iso_pu_bacteria 8005645114 8005647278 378
933 iso_pu_bacteria 8005668836 8005673196 378
934 iso_pu_bacteria 8005682033 8005682061 378
935 iso_pu_bacteria 8005688590 8005693735 378
936 iso_pu_bacteria 8005695170 8005700992 378
937 iso_pu_bacteria 8015687852 8015689650 378
938 iso_pu_bacteria 8016728285 8016731743 378
939 iso_pu_bacteria 8018127388 8018133508 378
940 iso_pu_bacteria 8018150411 8018155567 378
941 iso_pu_bacteria 8018163183 8018170335 378
942 iso_pu_bacteria 8018176218 8018178343 378
943 iso_pu_bacteria 8018845410 8018851639 378
944 iso_pu_bacteria 8019775933 8019779382 378
945 iso_pu_bacteria 8020807995 8020808332 378
946 iso_pu_bacteria 8020938398 8020945226 378
947 iso_pu_bacteria 8020945358 8020950661 378
948 iso_pu_bacteria 8020953355 8020955689 378
949 iso_pu_bacteria 8021120328 8021125700 378
950 iso_pu_bacteria 8022948649 8022953559 378
951 iso_pu_bacteria 8023680758 8023687428 378
952 iso_pu_bacteria 8024479707 8024482060 378
953 iso_pu_bacteria 8024486573 8024489071 378
954 iso_pu_bacteria 8024501048 8024505829 378
955 iso_pu_bacteria 8029995093 8029996791 378
956 iso_pu_bacteria 8039098773 8039100980 378
957 iso_pu_bacteria 8040167225 8040169792 378
958 iso_pu_bacteria 8040173305 8040178034 378
959 iso_pu_bacteria 8046767195 8046769213 378
960 iso_pu_bacteria 8054285046 8054290015 378
961 iso_pu_bacteria 8054347763 8054349281 378
962 iso_pu_bacteria 8054503363 8054503577 378
963 iso_pu_bacteria 8054929484 8054929881 378
964 iso_pu_bacteria 8055266321 8055267354 378
965 iso_pu_bacteria 8055301274 8055301346 378
966 iso_pu_bacteria 8055817908 8055817939 378
967 iso_pu_bacteria 8056125926 8056127470 378
968 iso_pu_bacteria 8056131705 8056131910 378
969 iso_pu_bacteria 8056143049 8056144947 378
970 iso_pu_bacteria 8056148874 8056151192 378
971 iso_pu_bacteria 8056155041 8056155139 378
972 iso_pu_bacteria 8056161164 8056163935 378
973 iso_pu_bacteria 8056166840 8056167195 378
974 iso_pu_bacteria 8056172158 8056173163 378
975 iso_pu_bacteria 8056177738 8056180093 378
976 iso_pu_bacteria 8056375014 8056379681 378
977 iso_pu_bacteria 8056382006 8056387133 378
978 iso_pu_bacteria 8056533031 8056534486 378
979 iso_pu_bacteria 8056569372 8056572827 378
980 iso_pu_bacteria 8056579771 8056583268 378
981 iso_pu_bacteria 8057160832 8057163130 378
982 iso_pu_bacteria 8057575449 8057581244 378
983 iso_pu_bacteria 8057874678 8057877111 378
984 iso_pu_bacteria 2643221688 2644491941 381
985 2124908027 MRS2a_Contig_1574 MRS2a_00446730 382
986 2162886007 SwRhRL2b_contig_656453 SwRhRL2b_0247.00007830 382
987 3300000546 LJNas_1000019 LJNas_10000198 382
988 3300001915 JGI24741J21665_1003171 JGI24741J21665_10031713 382
989 3300001979 JGI24740J21852_10000251 JGI24740J21852_1000025114 382
990 3300001979 JGI24740J21852_10025962 JGI24740J21852_100259622 382
991 3300001989 JGI24739J22299_10002246 JGI24739J22299_100022465 382
992 3300001989 JGI24739J22299_10010413 JGI24739J22299_100104134 382
993 3300001989 JGI24739J22299_10016407 JGI24739J22299_100164071 382
994 3300001989 JGI24739J22299_10028970 JGI24739J22299_100289702 382
995 3300001990 JGI24737J22298_10005314 JGI24737J22298_100053142 382
996 3300001990 JGI24737J22298_10013296 JGI24737J22298_100132963 382
997 3300002067 JGI24735J21928_10000746 JGI24735J21928_100007469 382
998 3300002067 JGI24735J21928_10003472 JGI24735J21928_100034724 382
999 3300002067 JGI24735J21928_10034200 JGI24735J21928_100342001 382
1000 3300002075 JGI24738J21930_10001078 JGI24738J21930_100010784 382
1001 3300002704 JGI25155J39150_1000012 JGI25155J39150_100001223 382
1002 3300002704 JGI25155J39150_1000255 JGI25155J39150_100025510 382
1003 3300002704 JGI25155J39150_1000546 JGI25155J39150_10005461 382
1004 3300002704 JGI25155J39150_1001072 JGI25155J39150_10010722 382
1005 3300002705 JGI25156J39149_1000049 JGI25156J39149_100004970 382
1006 3300002705 JGI25156J39149_1000527 JGI25156J39149_100052711 382
1007 3300002705 JGI25156J39149_1001036 JGI25156J39149_100103610 382
1008 3300002705 JGI25156J39149_1002069 JGI25156J39149_10020696 382
1009 3300002705 JGI25156J39149_1003564 JGI25156J39149_10035643 382
1010 3300002705 JGI25156J39149_1003955 JGI25156J39149_10039554 382
1011 3300002737 JGI25162J39368_1000063 JGI25162J39368_100006314 382
1012 3300002737 JGI25162J39368_1000287 JGI25162J39368_10002875 382
1013 3300002737 JGI25162J39368_1000421 JGI25162J39368_100042116 382
1014 3300002737 JGI25162J39368_1000753 JGI25162J39368_10007537 382
1015 3300002737 JGI25162J39368_1001046 JGI25162J39368_10010463 382
1016 3300002737 JGI25162J39368_1002965 JGI25162J39368_10029651 382
1017 3300002738 JGI25154J39366_1000033 JGI25154J39366_1000033150 382
1018 3300002738 JGI25154J39366_1000732 JGI25154J39366_10007328 382
1019 3300002738 JGI25154J39366_1000768 JGI25154J39366_10007686 382
1020 3300002738 JGI25154J39366_1005939 JGI25154J39366_10059392 382
1021 3300002739 JGI25158J39367_1000032 JGI25158J39367_10000327 382
1022 3300002741 JGI25157J39369_1000055 JGI25157J39369_100005523 382
1023 3300002741 JGI25157J39369_1000217 JGI25157J39369_100021732 382
1024 3300002741 JGI25157J39369_1000549 JGI25157J39369_10005499 382
1025 3300002741 JGI25157J39369_1001301 JGI25157J39369_10013016 382
1026 3300002771 JGI25163J39215_1000201 JGI25163J39215_100020113 382
1027 3300002771 JGI25163J39215_1000677 JGI25163J39215_10006773 382
1028 3300002772 JGI25164J39214_1000064 JGI25164J39214_100006470 382
1029 3300002772 JGI25164J39214_1000296 JGI25164J39214_100029619 382
1030 3300002772 JGI25164J39214_1000412 JGI25164J39214_100041211 382
1031 3300002772 JGI25164J39214_1000586 JGI25164J39214_10005865 382
1032 3300002772 JGI25164J39214_1000672 JGI25164J39214_10006727 382
1033 3300002773 JGI25152J39213_1004254 JGI25152J39213_10042544 382
1034 3300002773 JGI25152J39213_1008986 JGI25152J39213_10089862 382
1035 3300002773 JGI25152J39213_1008994 JGI25152J39213_10089942 382
1036 3300002773 JGI25152J39213_1011389 JGI25152J39213_10113892 382
1037 3300002774 JGI25150J39212_1008933 JGI25150J39212_10089332 382
1038 3300002987 JGI25159J45721_1000052 JGI25159J45721_100005229 382
1039 3300002987 JGI25159J45721_1000123 JGI25159J45721_100012324 382
1040 3300002987 JGI25159J45721_1001948 JGI25159J45721_10019487 382
1041 3300003187 JGI25151J46595_10000611 JGI25151J46595_1000061118 382
1042 3300003187 JGI25151J46595_10005785 JGI25151J46595_100057852 382
1043 3300003187 JGI25151J46595_10016124 JGI25151J46595_100161243 382
1044 3300003187 JGI25151J46595_10036121 JGI25151J46595_100361212 382
1045 3300003214 JGI25165J46597_1000035 JGI25165J46597_100003539 382
1046 3300003214 JGI25165J46597_1000069 JGI25165J46597_100006914 382
1047 3300003214 JGI25165J46597_1000388 JGI25165J46597_100038832 382
1048 3300003214 JGI25165J46597_1000528 JGI25165J46597_100052819 382
1049 3300003214 JGI25165J46597_1001054 JGI25165J46597_10010549 382
1050 3300003214 JGI25165J46597_1001292 JGI25165J46597_100129213 382
1051 3300003214 JGI25165J46597_1005308 JGI25165J46597_10053082 382
1052 3300003215 JGI25153J46596_10000670 JGI25153J46596_100006704 382
1053 3300003215 JGI25153J46596_10001189 JGI25153J46596_100011897 382
1054 3300003215 JGI25153J46596_10003140 JGI25153J46596_100031405 382
1055 3300003215 JGI25153J46596_10021317 JGI25153J46596_100213172 382
1056 3300003215 JGI25153J46596_10021348 JGI25153J46596_100213482 382
1057 3300003215 JGI25153J46596_10029685 JGI25153J46596_100296851 382
1058 3300003354 JGI25160J50197_1000006 JGI25160J50197_1000006261 382
1059 3300003354 JGI25160J50197_1000007 JGI25160J50197_1000007266 382
1060 3300003354 JGI25160J50197_1000112 JGI25160J50197_100011216 382
1061 3300003374 JGI25161J50226_1000004 JGI25161J50226_1000004261 382
1062 3300003374 JGI25161J50226_1000129 JGI25161J50226_100012911 382
1063 3300003374 JGI25161J50226_1000648 JGI25161J50226_10006484 382
1064 3300003374 JGI25161J50226_1005966 JGI25161J50226_10059662 382
1065 3300003578 Ga0006562J51391_1183124 Ga0006562J51391_11831241 382
1066 3300003578 Ga0006562J51391_1183125 Ga0006562J51391_11831255 382
1067 3300003751 Ga0055538_1000008 Ga0055538_1000008190 382
1068 3300003751 Ga0055538_1000012 Ga0055538_100001283 382
1069 3300003751 Ga0055538_1000034 Ga0055538_100003413 382
1070 3300003752 Ga0055539_1000012 Ga0055539_1000012190 382
1071 3300003752 Ga0055539_1000017 Ga0055539_100001783 382
1072 3300003752 Ga0055539_1000044 Ga0055539_100004413 382
1073 3300003752 Ga0055539_1001291 Ga0055539_10012912 382
1074 3300003752 Ga0055539_1006155 Ga0055539_10061552 382
1075 3300003756 Ga0055533_1000015 Ga0055533_1000015190 382
1076 3300003756 Ga0055533_1000021 Ga0055533_100002183 382
1077 3300003756 Ga0055533_1000055 Ga0055533_100005513 382
1078 3300003756 Ga0055533_1001195 Ga0055533_10011954 382
1079 3300003756 Ga0055533_1001332 Ga0055533_10013325 382
1080 3300003756 Ga0055533_1001997 Ga0055533_10019974 382
1081 3300003758 Ga0055532_1000005 Ga0055532_1000005251 382
1082 3300003758 Ga0055532_1000012 Ga0055532_100001249 382
1083 3300003758 Ga0055532_1000020 Ga0055532_1000020159 382
1084 3300003759 Ga0055525_1000017 Ga0055525_1000017153 382
1085 3300003759 Ga0055525_1000043 Ga0055525_100004337 382
1086 3300003759 Ga0055525_1000066 Ga0055525_1000066169 382
1087 3300003759 Ga0055525_1000117 Ga0055525_100011733 382
1088 3300003760 Ga0055527_1000011 Ga0055527_1000011292 382
1089 3300003760 Ga0055527_1000226 Ga0055527_100022610 382
1090 3300003760 Ga0055527_1000243 Ga0055527_100024316 382
1091 3300003760 Ga0055527_1005570 Ga0055527_10055702 382
1092 3300003761 Ga0055535_1000009 Ga0055535_100000949 382
1093 3300003761 Ga0055535_1000335 Ga0055535_10003355 382
1094 3300003761 Ga0055535_1000515 Ga0055535_100051513 382
1095 3300003761 Ga0055535_1000518 Ga0055535_100051813 382
1096 3300003761 Ga0055535_1000629 Ga0055535_100062910 382
1097 3300003761 Ga0055535_1001383 Ga0055535_10013834 382
1098 3300003762 Ga0055542_1000015 Ga0055542_100001549 382
1099 3300003762 Ga0055542_1000363 Ga0055542_100036332 382
1100 3300003762 Ga0055542_1000393 Ga0055542_100039317 382
1101 3300003762 Ga0055542_1000434 Ga0055542_100043418 382
1102 3300003762 Ga0055542_1000537 Ga0055542_100053713 382
1103 3300003762 Ga0055542_1000661 Ga0055542_100066110 382
1104 3300003763 Ga0055529_1000011 Ga0055529_100001149 382
1105 3300003763 Ga0055529_1000391 Ga0055529_100039132 382
1106 3300003763 Ga0055529_1000409 Ga0055529_100040917 382
1107 3300003763 Ga0055529_1000519 Ga0055529_100051916 382
1108 3300003763 Ga0055529_1000601 Ga0055529_100060110 382
1109 3300003771 Ga0055526_1001100 Ga0055526_10011008 382
1110 3300003771 Ga0055526_1002853 Ga0055526_10028533 382
1111 3300003771 Ga0055526_1003392 Ga0055526_10033923 382
1112 3300003771 Ga0055526_1004773 Ga0055526_10047736 382
1113 3300003771 Ga0055526_1010390 Ga0055526_10103902 382
1114 3300003771 Ga0055526_1017002 Ga0055526_10170022 382
1115 3300003773 Ga0055537_1000426 Ga0055537_10004265 382
1116 3300003775 Ga0055524_1000262 Ga0055524_10002622 382
1117 3300003775 Ga0055524_1000376 Ga0055524_100037617 382
1118 3300003775 Ga0055524_1000429 Ga0055524_100042926 382
1119 3300003775 Ga0055524_1011159 Ga0055524_10111593 382
1120 3300003781 Ga0055536_1000126 Ga0055536_100012610 382
1121 3300003781 Ga0055536_1000519 Ga0055536_10005197 382
1122 3300003781 Ga0055536_1000581 Ga0055536_10005817 382
1123 3300003781 Ga0055536_1002169 Ga0055536_10021694 382
1124 3300003781 Ga0055536_1004583 Ga0055536_10045832 382
1125 3300003781 Ga0055536_1014189 Ga0055536_10141892 382
1126 3300003784 Ga0055534_1000518 Ga0055534_10005187 382
1127 3300003790 Ga0055528_1000040 Ga0055528_100004058 382
1128 3300003790 Ga0055528_1000186 Ga0055528_100018623 382
1129 3300003790 Ga0055528_1000718 Ga0055528_100071816 382
1130 3300003790 Ga0055528_1002246 Ga0055528_10022464 382
1131 3300003790 Ga0055528_1002418 Ga0055528_10024186 382
1132 3300003790 Ga0055528_1003731 Ga0055528_10037316 382
1133 3300003790 Ga0055528_1005253 Ga0055528_10052535 382
1134 3300003790 Ga0055528_1006219 Ga0055528_10062194 382
1135 3300003791 Ga0055530_10000132 Ga0055530_1000013210 382
1136 3300003791 Ga0055530_10000240 Ga0055530_1000024028 382
1137 3300003791 Ga0055530_10000671 Ga0055530_100006717 382
1138 3300003791 Ga0055530_10000778 Ga0055530_100007786 382
1139 3300003791 Ga0055530_10001374 Ga0055530_100013745 382
1140 3300003791 Ga0055530_10007126 Ga0055530_100071264 382
1141 3300003792 Ga0055540_1000248 Ga0055540_100024828 382
1142 3300003792 Ga0055540_1000400 Ga0055540_10004007 382
1143 3300003792 Ga0055540_1000780 Ga0055540_100078019 382
1144 3300003792 Ga0055540_1000954 Ga0055540_100095417 382
1145 3300003792 Ga0055540_1004383 Ga0055540_10043833 382
1146 3300003792 Ga0055540_1004497 Ga0055540_10044972 382
1147 3300003792 Ga0055540_1006733 Ga0055540_10067332 382
1148 3300003794 Ga0055531_10004609 Ga0055531_100046097 382
1149 3300003794 Ga0055531_10005677 Ga0055531_100056776 382
1150 3300003794 Ga0055531_10006687 Ga0055531_100066875 382
1151 3300003794 Ga0055531_10029714 Ga0055531_100297141 382
1152 3300003841 Ga0055541_1000009 Ga0055541_1000009190 382
1153 3300003841 Ga0055541_1000012 Ga0055541_100001283 382
1154 3300003841 Ga0055541_1000032 Ga0055541_1000032170 382
1155 3300003856 Ga0058692_1000009 Ga0058692_1000009260 382
1156 3300003856 Ga0058692_1001699 Ga0058692_10016993 382
1157 3300003856 Ga0058692_1011584 Ga0058692_10115842 382
1158 3300004625 Ga0055543_1000002 Ga0055543_100000274 382
1159 3300004625 Ga0055543_1000029 Ga0055543_100002980 382
1160 3300004625 Ga0055543_1000120 Ga0055543_100012028 382
1161 3300005262 Ga0065165_1000011 Ga0065165_100001128 382
1162 3300005262 Ga0065165_1000340 Ga0065165_100034016 382
1163 3300005262 Ga0065165_1001337 Ga0065165_100133720 382
1164 3300005262 Ga0065165_1005342 Ga0065165_10053425 382
1165 3300005262 Ga0065165_1005358 Ga0065165_10053584 382
1166 3300005262 Ga0065165_1005608 Ga0065165_10056086 382
1167 3300005262 Ga0065165_1013531 Ga0065165_10135314 382
1168 3300005288 Ga0065714_10000104 Ga0065714_100001049 382
1169 3300005288 Ga0065714_10003301 Ga0065714_100033012 382
1170 3300005289 Ga0065704_10009257 Ga0065704_100092575 382
1171 3300005289 Ga0065704_10070222 Ga0065704_1007022259 382
1172 3300005290 Ga0065712_10000132 Ga0065712_100001326 382
1173 3300005290 Ga0065712_10007303 Ga0065712_100073034 382
1174 3300005290 Ga0065712_10090203 Ga0065712_100902033 382
1175 3300005327 Ga0070658_10028890 Ga0070658_100288901 382
1176 3300005327 Ga0070658_10063809 Ga0070658_100638092 382
1177 3300005329 Ga0070683_100021797 Ga0070683_1000217971 382
1178 3300005330 Ga0070690_100035152 Ga0070690_1000351523 382
1179 3300005331 Ga0070670_100000258 Ga0070670_10000025814 382
1180 3300005331 Ga0070670_100001188 Ga0070670_1000011884 382
1181 3300005331 Ga0070670_100001386 Ga0070670_10000138622 382
1182 3300005334 Ga0068869_100001960 Ga0068869_10000196010 382
1183 3300005334 Ga0068869_100200683 Ga0068869_1002006831 382
1184 3300005335 Ga0070666_10000016 Ga0070666_10000016131 382
1185 3300005335 Ga0070666_10016846 Ga0070666_100168464 382
1186 3300005336 Ga0070680_100010046 Ga0070680_1000100466 382
1187 3300005337 Ga0070682_100003944 Ga0070682_1000039445 382
1188 3300005337 Ga0070682_100091778 Ga0070682_1000917782 382
1189 3300005339 Ga0070660_100000056 Ga0070660_10000005649 382
1190 3300005339 Ga0070660_100001525 Ga0070660_1000015255 382
1191 3300005339 Ga0070660_100030905 Ga0070660_1000309054 382
1192 3300005339 Ga0070660_100097668 Ga0070660_1000976684 382
1193 3300005339 Ga0070660_100105084 Ga0070660_1001050842 382
1194 3300005339 Ga0070660_100114547 Ga0070660_1001145472 382
1195 3300005340 Ga0070689_100020485 Ga0070689_1000204855 382
1196 3300005344 Ga0070661_100000146 Ga0070661_10000014611 382
1197 3300005344 Ga0070661_100023158 Ga0070661_1000231583 382
1198 3300005344 Ga0070661_100028844 Ga0070661_1000288443 382
1199 3300005344 Ga0070661_100190829 Ga0070661_1001908292 382
1200 3300005347 Ga0070668_100004033 Ga0070668_1000040333 382
1201 3300005347 Ga0070668_100024332 Ga0070668_1000243324 382
1202 3300005353 Ga0070669_100000153 Ga0070669_10000015321 382
1203 3300005353 Ga0070669_100029899 Ga0070669_1000298992 382
1204 3300005354 Ga0070675_100039079 Ga0070675_1000390792 382
1205 3300005354 Ga0070675_100345761 Ga0070675_1003457611 382
1206 3300005355 Ga0070671_100003307 Ga0070671_1000033073 382
1207 3300005355 Ga0070671_100046175 Ga0070671_1000461752 382
1208 3300005355 Ga0070671_100151417 Ga0070671_1001514173 382
1209 3300005364 Ga0070673_100020736 Ga0070673_1000207361 382
1210 3300005364 Ga0070673_100021478 Ga0070673_1000214782 382
1211 3300005365 Ga0070688_100047145 Ga0070688_1000471452 382
1212 3300005365 Ga0070688_100117600 Ga0070688_1001176002 382
1213 3300005366 Ga0070659_100000079 Ga0070659_10000007946 382
1214 3300005366 Ga0070659_100018894 Ga0070659_1000188942 382
1215 3300005366 Ga0070659_100022360 Ga0070659_1000223602 382
1216 3300005366 Ga0070659_100217375 Ga0070659_1002173751 382
1217 3300005366 Ga0070659_100350853 Ga0070659_1003508531 382
1218 3300005367 Ga0070667_100061137 Ga0070667_1000611372 382
1219 3300005367 Ga0070667_100101645 Ga0070667_1001016452 382
1220 3300005367 Ga0070667_100112641 Ga0070667_1001126412 382
1221 3300005367 Ga0070667_100117535 Ga0070667_1001175352 382
1222 3300005367 Ga0070667_100235784 Ga0070667_1002357842 382
1223 3300005435 Ga0070714_100033331 Ga0070714_1000333315 382
1224 3300005435 Ga0070714_100054626 Ga0070714_1000546262 382
1225 3300005436 Ga0070713_100166217 Ga0070713_1001662171 382
1226 3300005455 Ga0070663_100027442 Ga0070663_1000274425 382
1227 3300005455 Ga0070663_100142519 Ga0070663_1001425191 382
1228 3300005456 Ga0070678_100009479 Ga0070678_1000094792 382
1229 3300005456 Ga0070678_100016310 Ga0070678_1000163102 382
1230 3300005456 Ga0070678_100034861 Ga0070678_1000348616 382
1231 3300005456 Ga0070678_100221508 Ga0070678_1002215082 382
1232 3300005457 Ga0070662_100000562 Ga0070662_10000056221 382
1233 3300005457 Ga0070662_100009714 Ga0070662_1000097143 382
1234 3300005458 Ga0070681_10058975 Ga0070681_100589754 382
1235 3300005458 Ga0070681_10117591 Ga0070681_101175912 382
1236 3300005458 Ga0070681_10424763 Ga0070681_104247631 382
1237 3300005459 Ga0068867_100002132 Ga0068867_10000213210 382
1238 3300005459 Ga0068867_100039853 Ga0068867_1000398535 382
1239 3300005530 Ga0070679_100012938 Ga0070679_1000129385 382
1240 3300005530 Ga0070679_100013191 Ga0070679_1000131917 382
1241 3300005530 Ga0070679_100326600 Ga0070679_1003266001 382
1242 3300005535 Ga0070684_100001235 Ga0070684_1000012353 382
1243 3300005539 Ga0068853_100000184 Ga0068853_10000018439 382
1244 3300005539 Ga0068853_100003976 Ga0068853_1000039768 382
1245 3300005539 Ga0068853_100117246 Ga0068853_1001172463 382
1246 3300005543 Ga0070672_100107480 Ga0070672_1001074802 382
1247 3300005548 Ga0070665_100000322 Ga0070665_10000032246 382
1248 3300005548 Ga0070665_100012164 Ga0070665_1000121648 382
1249 3300005548 Ga0070665_100012285 Ga0070665_1000122855 382
1250 3300005548 Ga0070665_100019293 Ga0070665_1000192933 382
1251 3300005548 Ga0070665_100022869 Ga0070665_10002286910 382
1252 3300005548 Ga0070665_100034909 Ga0070665_1000349094 382
1253 3300005548 Ga0070665_100165839 Ga0070665_1001658393 382
1254 3300005563 Ga0068855_100000423 Ga0068855_10000042339 382
1255 3300005563 Ga0068855_100000557 Ga0068855_10000055732 382
1256 3300005563 Ga0068855_100003248 Ga0068855_1000032484 382
1257 3300005563 Ga0068855_100008781 Ga0068855_1000087819 382
1258 3300005563 Ga0068855_100015021 Ga0068855_1000150217 382
1259 3300005563 Ga0068855_100070479 Ga0068855_1000704792 382
1260 3300005563 Ga0068855_100098068 Ga0068855_1000980682 382
1261 3300005563 Ga0068855_100106722 Ga0068855_1001067223 382
1262 3300005563 Ga0068855_100183432 Ga0068855_1001834322 382
1263 3300005563 Ga0068855_100193924 Ga0068855_1001939243 382
1264 3300005563 Ga0068855_100247353 Ga0068855_1002473532 382
1265 3300005563 Ga0068855_100408244 Ga0068855_1004082442 382
1266 3300005564 Ga0070664_100000049 Ga0070664_10000004953 382
1267 3300005564 Ga0070664_100055289 Ga0070664_1000552893 382
1268 3300005577 Ga0068857_100008513 Ga0068857_1000085134 382
1269 3300005577 Ga0068857_100122495 Ga0068857_1001224953 382
1270 3300005577 Ga0068857_100143152 Ga0068857_1001431522 382
1271 3300005578 Ga0068854_100000054 Ga0068854_10000005419 382
1272 3300005578 Ga0068854_100000699 Ga0068854_1000006994 382
1273 3300005578 Ga0068854_100002224 Ga0068854_1000022248 382
1274 3300005578 Ga0068854_100065113 Ga0068854_1000651133 382
1275 3300005578 Ga0068854_100072572 Ga0068854_1000725722 382
1276 3300005614 Ga0068856_100000157 Ga0068856_10000015748 382
1277 3300005614 Ga0068856_100010013 Ga0068856_1000100135 382
1278 3300005614 Ga0068856_100023950 Ga0068856_1000239505 382
1279 3300005614 Ga0068856_100071585 Ga0068856_1000715853 382
1280 3300005614 Ga0068856_100191047 Ga0068856_1001910473 382
1281 3300005614 Ga0068856_100206281 Ga0068856_1002062812 382
1282 3300005616 Ga0068852_100001139 Ga0068852_1000011393 382
1283 3300005616 Ga0068852_100004003 Ga0068852_1000040037 382
1284 3300005616 Ga0068852_100012051 Ga0068852_1000120514 382
1285 3300005616 Ga0068852_100030384 Ga0068852_1000303842 382
1286 3300005616 Ga0068852_100114517 Ga0068852_1001145172 382
1287 3300005616 Ga0068852_100245786 Ga0068852_1002457862 382
1288 3300005617 Ga0068859_100011168 Ga0068859_1000111683 382
1289 3300005618 Ga0068864_100005889 Ga0068864_1000058897 382
1290 3300005718 Ga0068866_10024422 Ga0068866_100244224 382
1291 3300005719 Ga0068861_100013381 Ga0068861_1000133812 382
1292 3300005834 Ga0068851_10000018 Ga0068851_1000001885 382
1293 3300005834 Ga0068851_10140346 Ga0068851_101403461 382
1294 3300005840 Ga0068870_10027147 Ga0068870_100271472 382
1295 3300005841 Ga0068863_100007163 Ga0068863_1000071633 382
1296 3300005842 Ga0068858_100024178 Ga0068858_1000241784 382
1297 3300005842 Ga0068858_100069161 Ga0068858_1000691614 382
1298 3300005843 Ga0068860_100012152 Ga0068860_1000121526 382
1299 3300005843 Ga0068860_100018457 Ga0068860_1000184576 382
1300 3300005843 Ga0068860_100070809 Ga0068860_1000708092 382
1301 3300005843 Ga0068860_100250939 Ga0068860_1002509391 382
1302 3300006042 Ga0075368_10017657 Ga0075368_100176571 382
1303 3300006051 Ga0075364_10005396 Ga0075364_100053962 382
1304 3300006058 Ga0075432_10000316 Ga0075432_1000031613 382
1305 3300006058 Ga0075432_10008546 Ga0075432_100085462 382
1306 3300006177 Ga0075362_10054628 Ga0075362_100546281 382
1307 3300006178 Ga0075367_10171404 Ga0075367_101714042 382
1308 3300006178 Ga0075367_10203499 Ga0075367_102034991 382
1309 3300006186 Ga0075369_10018610 Ga0075369_100186102 382
1310 3300006186 Ga0075369_10065045 Ga0075369_100650452 382
1311 3300006195 Ga0075366_10001966 Ga0075366_1000196610 382
1312 3300006237 Ga0097621_100002735 Ga0097621_1000027356 382
1313 3300006237 Ga0097621_100012639 Ga0097621_1000126392 382
1314 3300006237 Ga0097621_100025700 Ga0097621_1000257004 382
1315 3300006237 Ga0097621_100028731 Ga0097621_1000287313 382
1316 3300006237 Ga0097621_100062541 Ga0097621_1000625413 382
1317 3300006237 Ga0097621_100101894 Ga0097621_1001018942 382
1318 3300006353 Ga0075370_10000591 Ga0075370_1000059111 382
1319 3300006353 Ga0075370_10021524 Ga0075370_100215242 382
1320 3300006358 Ga0068871_100000329 Ga0068871_1000003296 382
1321 3300006358 Ga0068871_100011348 Ga0068871_1000113485 382
1322 3300006358 Ga0068871_100035210 Ga0068871_1000352103 382
1323 3300006358 Ga0068871_100057184 Ga0068871_1000571842 382
1324 3300006358 Ga0068871_100128774 Ga0068871_1001287742 382
1325 3300006914 Ga0075436_100109924 Ga0075436_1001099242 382
1326 3300006931 Ga0097620_100011168 Ga0097620_1000111686 382
1327 3300006946 Ga0079104_1000029 Ga0079104_100002919 382
1328 3300006946 Ga0079104_1000094 Ga0079104_1000094104 382
1329 3300006946 Ga0079104_1000668 Ga0079104_10006687 382
1330 3300006946 Ga0079104_1004551 Ga0079104_10045514 382
1331 3300006948 Ga0099826_10038409 Ga0099826_100384092 382
1332 3300009011 Ga0105251_10000018 Ga0105251_1000001858 382
1333 3300009011 Ga0105251_10000047 Ga0105251_1000004797 382
1334 3300009011 Ga0105251_10000830 Ga0105251_1000083021 382
1335 3300009011 Ga0105251_10001501 Ga0105251_100015013 382
1336 3300009011 Ga0105251_10001601 Ga0105251_1000160117 382
1337 3300009011 Ga0105251_10001924 Ga0105251_1000192416 382
1338 3300009011 Ga0105251_10002823 Ga0105251_100028234 382
1339 3300009011 Ga0105251_10004604 Ga0105251_100046044 382
1340 3300009011 Ga0105251_10011096 Ga0105251_100110964 382
1341 3300009011 Ga0105251_10014064 Ga0105251_100140641 382
1342 3300009011 Ga0105251_10016548 Ga0105251_100165483 382
1343 3300009036 Ga0105244_10001003 Ga0105244_100010033 382
1344 3300009036 Ga0105244_10002401 Ga0105244_100024013 382
1345 3300009036 Ga0105244_10013196 Ga0105244_100131963 382
1346 3300009036 Ga0105244_10014374 Ga0105244_100143742 382
1347 3300009036 Ga0105244_10014929 Ga0105244_100149291 382
1348 3300009036 Ga0105244_10023477 Ga0105244_100234772 382
1349 3300009036 Ga0105244_10031272 Ga0105244_100312723 382
1350 3300009036 Ga0105244_10045022 Ga0105244_100450222 382
1351 3300009036 Ga0105244_10045134 Ga0105244_100451341 382
1352 3300009036 Ga0105244_10045584 Ga0105244_100455842 382
1353 3300009036 Ga0105244_10052161 Ga0105244_100521612 382
1354 3300009036 Ga0105244_10055493 Ga0105244_100554931 382
1355 3300009036 Ga0105244_10067421 Ga0105244_100674212 382
1356 3300009036 Ga0105244_10099880 Ga0105244_100998802 382
1357 3300009092 Ga0105250_10000068 Ga0105250_1000006819 382
1358 3300009092 Ga0105250_10000550 Ga0105250_1000055021 382
1359 3300009092 Ga0105250_10002212 Ga0105250_1000221210 382
1360 3300009092 Ga0105250_10002526 Ga0105250_100025265 382
1361 3300009092 Ga0105250_10004938 Ga0105250_100049385 382
1362 3300009093 Ga0105240_10000019 Ga0105240_1000001928 382
1363 3300009093 Ga0105240_10001844 Ga0105240_100018445 382
1364 3300009093 Ga0105240_10005342 Ga0105240_1000534210 382
1365 3300009093 Ga0105240_10014642 Ga0105240_100146426 382
1366 3300009093 Ga0105240_10017316 Ga0105240_100173165 382
1367 3300009093 Ga0105240_10020280 Ga0105240_100202805 382
1368 3300009093 Ga0105240_10038888 Ga0105240_100388884 382
1369 3300009093 Ga0105240_10041264 Ga0105240_100412642 382
1370 3300009093 Ga0105240_10092593 Ga0105240_100925934 382
1371 3300009093 Ga0105240_10171679 Ga0105240_101716792 382
1372 3300009093 Ga0105240_10179199 Ga0105240_101791993 382
1373 3300009093 Ga0105240_10194506 Ga0105240_101945062 382
1374 3300009093 Ga0105240_10243222 Ga0105240_102432222 382
1375 3300009093 Ga0105240_10305407 Ga0105240_103054072 382
1376 3300009098 Ga0105245_10009081 Ga0105245_100090814 382
1377 3300009148 Ga0105243_10001011 Ga0105243_1000101124 382
1378 3300009148 Ga0105243_10005184 Ga0105243_100051847 382
1379 3300009148 Ga0105243_10005610 Ga0105243_100056103 382
1380 3300009148 Ga0105243_10124727 Ga0105243_101247272 382
1381 3300009174 Ga0105241_10031368 Ga0105241_100313684 382
1382 3300009174 Ga0105241_10152069 Ga0105241_101520692 382
1383 3300009176 Ga0105242_10001632 Ga0105242_1000163215 382
1384 3300009176 Ga0105242_10006325 Ga0105242_100063252 382
1385 3300009176 Ga0105242_10007441 Ga0105242_100074413 382
1386 3300009176 Ga0105242_10228868 Ga0105242_102288682 382
1387 3300009177 Ga0105248_10001466 Ga0105248_100014667 382
1388 3300009177 Ga0105248_10002239 Ga0105248_100022396 382
1389 3300009177 Ga0105248_10002548 Ga0105248_1000254814 382
1390 3300009177 Ga0105248_10020178 Ga0105248_100201785 382
1391 3300009177 Ga0105248_10063147 Ga0105248_100631475 382
1392 3300009177 Ga0105248_10211088 Ga0105248_102110883 382
1393 3300009545 Ga0105237_10000036 Ga0105237_1000003657 382
1394 3300009545 Ga0105237_10000136 Ga0105237_100001365 382
1395 3300009545 Ga0105237_10002463 Ga0105237_1000246313 382
1396 3300009545 Ga0105237_10037085 Ga0105237_100370853 382
1397 3300009545 Ga0105237_10163901 Ga0105237_101639011 382
1398 3300009545 Ga0105237_10167368 Ga0105237_101673681 382
1399 3300009545 Ga0105237_10175660 Ga0105237_101756603 382
1400 3300009551 Ga0105238_10000062 Ga0105238_1000006279 382
1401 3300009551 Ga0105238_10000315 Ga0105238_1000031512 382
1402 3300009551 Ga0105238_10013811 Ga0105238_100138112 382
1403 3300009551 Ga0105238_10018759 Ga0105238_100187592 382
1404 3300009551 Ga0105238_10025026 Ga0105238_100250265 382
1405 3300009551 Ga0105238_10025120 Ga0105238_100251206 382
1406 3300009551 Ga0105238_10033604 Ga0105238_100336045 382
1407 3300009551 Ga0105238_10136732 Ga0105238_101367322 382
1408 3300009551 Ga0105238_10262947 Ga0105238_102629472 382
1409 3300009551 Ga0105238_10320567 Ga0105238_103205671 382
1410 3300009551 Ga0105238_10333921 Ga0105238_103339212 382
1411 3300009553 Ga0105249_10001344 Ga0105249_1000134416 382
1412 3300009765 Ga0123341_1000015 Ga0123341_100001571 382
1413 3300009766 Ga0123342_1024353 Ga0123342_10243534 382
1414 3300010375 Ga0105239_10008574 Ga0105239_100085748 382
1415 3300010375 Ga0105239_10009998 Ga0105239_100099989 382
1416 3300010375 Ga0105239_10052225 Ga0105239_100522254 382
1417 3300010375 Ga0105239_10061307 Ga0105239_100613073 382
1418 3300010375 Ga0105239_10089130 Ga0105239_100891302 382
1419 3300010375 Ga0105239_10274540 Ga0105239_102745402 382
1420 3300010375 Ga0105239_10499777 Ga0105239_104997771 382
1421 3300011119 Ga0105246_10000322 Ga0105246_100003225 382
1422 3300011119 Ga0105246_10002126 Ga0105246_100021262 382
1423 3300011119 Ga0105246_10014150 Ga0105246_100141503 382
1424 3300011119 Ga0105246_10027154 Ga0105246_100271543 382
1425 3300012490 Ga0157322_1000407 Ga0157322_10004072 382
1426 3300012498 Ga0157345_1000091 Ga0157345_100009117 382
1427 3300012502 Ga0157347_1005371 Ga0157347_10053711 382
1428 3300013100 Ga0157373_10000139 Ga0157373_1000013918 382
1429 3300013100 Ga0157373_10000568 Ga0157373_100005686 382
1430 3300013100 Ga0157373_10004735 Ga0157373_100047357 382
1431 3300013100 Ga0157373_10024574 Ga0157373_100245742 382
1432 3300013100 Ga0157373_10061803 Ga0157373_100618032 382
1433 3300013100 Ga0157373_10062418 Ga0157373_100624183 382
1434 3300013100 Ga0157373_10148867 Ga0157373_101488671 382
1435 3300013102 Ga0157371_10000592 Ga0157371_1000059220 382
1436 3300013102 Ga0157371_10003098 Ga0157371_1000309810 382
1437 3300013102 Ga0157371_10006317 Ga0157371_100063176 382
1438 3300013102 Ga0157371_10006521 Ga0157371_100065214 382
1439 3300013102 Ga0157371_10008173 Ga0157371_100081734 382
1440 3300013102 Ga0157371_10009793 Ga0157371_100097934 382
1441 3300013102 Ga0157371_10010625 Ga0157371_100106257 382
1442 3300013102 Ga0157371_10033820 Ga0157371_100338202 382
1443 3300013102 Ga0157371_10097255 Ga0157371_100972552 382
1444 3300013104 Ga0157370_10003077 Ga0157370_1000307713 382
1445 3300013104 Ga0157370_10010853 Ga0157370_100108537 382
1446 3300013104 Ga0157370_10014219 Ga0157370_100142192 382
1447 3300013104 Ga0157370_10020670 Ga0157370_100206705 382
1448 3300013104 Ga0157370_10024308 Ga0157370_100243081 382
1449 3300013104 Ga0157370_10049765 Ga0157370_100497653 382
1450 3300013104 Ga0157370_10056432 Ga0157370_100564322 382
1451 3300013104 Ga0157370_10065537 Ga0157370_100655373 382
1452 3300013104 Ga0157370_10077206 Ga0157370_100772063 382
1453 3300013104 Ga0157370_10136690 Ga0157370_101366902 382
1454 3300013104 Ga0157370_10137004 Ga0157370_101370042 382
1455 3300013104 Ga0157370_10166021 Ga0157370_101660212 382
1456 3300013105 Ga0157369_10000280 Ga0157369_100002809 382
1457 3300013105 Ga0157369_10000525 Ga0157369_100005252 382
1458 3300013105 Ga0157369_10001737 Ga0157369_1000173710 382
1459 3300013105 Ga0157369_10001978 Ga0157369_1000197822 382
1460 3300013105 Ga0157369_10003683 Ga0157369_100036836 382
1461 3300013105 Ga0157369_10005341 Ga0157369_100053413 382
1462 3300013105 Ga0157369_10005760 Ga0157369_1000576010 382
1463 3300013105 Ga0157369_10020129 Ga0157369_100201296 382
1464 3300013105 Ga0157369_10083106 Ga0157369_100831062 382
1465 3300013105 Ga0157369_10159836 Ga0157369_101598362 382
1466 3300013105 Ga0157369_10170224 Ga0157369_101702242 382
1467 3300013105 Ga0157369_10359731 Ga0157369_103597312 382
1468 3300013249 Ga0171463_1002 Ga0171463_1002322 382
1469 3300013296 Ga0157374_10000138 Ga0157374_1000013852 382
1470 3300013296 Ga0157374_10011805 Ga0157374_100118052 382
1471 3300013296 Ga0157374_10041310 Ga0157374_100413103 382
1472 3300013297 Ga0157378_10004718 Ga0157378_100047183 382
1473 3300013306 Ga0163162_10000239 Ga0163162_1000023918 382
1474 3300013306 Ga0163162_10000495 Ga0163162_100004956 382
1475 3300013306 Ga0163162_10001215 Ga0163162_100012157 382
1476 3300013306 Ga0163162_10135717 Ga0163162_101357172 382
1477 3300013306 Ga0163162_10142660 Ga0163162_101426602 382
1478 3300013306 Ga0163162_10182204 Ga0163162_101822042 382
1479 3300013306 Ga0163162_10258243 Ga0163162_102582431 382
1480 3300013307 Ga0157372_10008403 Ga0157372_100084033 382
1481 3300013307 Ga0157372_10026402 Ga0157372_100264026 382
1482 3300013307 Ga0157372_10043798 Ga0157372_100437981 382
1483 3300013308 Ga0157375_10002515 Ga0157375_1000251510 382
1484 3300013308 Ga0157375_10006746 Ga0157375_100067465 382
1485 3300013308 Ga0157375_10106507 Ga0157375_101065073 382
1486 3300013308 Ga0157375_10275268 Ga0157375_102752682 382
1487 3300014325 Ga0163163_10214452 Ga0163163_102144522 382
1488 3300014325 Ga0163163_10375587 Ga0163163_103755872 382
1489 3300014325 Ga0163163_10431371 Ga0163163_104313712 382
1490 3300014326 Ga0157380_10012577 Ga0157380_100125772 382
1491 3300014326 Ga0157380_10111126 Ga0157380_101111262 382
1492 3300014497 Ga0182008_10000023 Ga0182008_1000002374 382
1493 3300014497 Ga0182008_10001995 Ga0182008_1000199511 382
1494 3300014497 Ga0182008_10002602 Ga0182008_100026028 382
1495 3300014497 Ga0182008_10009442 Ga0182008_100094421 382
1496 3300014497 Ga0182008_10014834 Ga0182008_100148342 382
1497 3300014497 Ga0182008_10022340 Ga0182008_100223403 382
1498 3300014497 Ga0182008_10027070 Ga0182008_100270702 382
1499 3300014497 Ga0182008_10033767 Ga0182008_100337672 382
1500 3300014968 Ga0157379_10044263 Ga0157379_100442632 382
1501 3300014968 Ga0157379_10275823 Ga0157379_102758231 382
1502 3300014969 Ga0157376_10011819 Ga0157376_100118192 382
1503 3300014969 Ga0157376_10025582 Ga0157376_100255822 382
1504 3300014969 Ga0157376_10025908 Ga0157376_100259082 382
1505 3300014969 Ga0157376_10109183 Ga0157376_101091832 382
1506 3300015261 Ga0182006_1000404 Ga0182006_10004048 382
1507 3300015261 Ga0182006_1000808 Ga0182006_100080819 382
1508 3300015261 Ga0182006_1000967 Ga0182006_10009675 382
1509 3300015261 Ga0182006_1006793 Ga0182006_10067934 382
1510 3300015261 Ga0182006_1053038 Ga0182006_10530382 382
1511 3300015262 Ga0182007_10000965 Ga0182007_100009652 382
1512 3300015262 Ga0182007_10003252 Ga0182007_100032526 382
1513 3300015262 Ga0182007_10003543 Ga0182007_100035436 382
1514 3300015262 Ga0182007_10030438 Ga0182007_100304382 382
1515 3300015265 Ga0182005_1000758 Ga0182005_10007583 382
1516 3300015265 Ga0182005_1003308 Ga0182005_10033081 382
1517 3300015265 Ga0182005_1013990 Ga0182005_10139902 382
1518 3300015265 Ga0182005_1016131 Ga0182005_10161312 382
1519 3300015265 Ga0182005_1021282 Ga0182005_10212821 382
1520 3300015685 Ga0183369_1011 Ga0183369_1011227 382
1521 3300015687 Ga0183368_1007 Ga0183368_1007261 382
1522 3300015690 Ga0183363_1106 Ga0183363_11067 382
1523 3300016635 Ga0183361_10001 Ga0183361_1000176 382
1524 3300017792 Ga0163161_10001737 Ga0163161_1000173714 382
1525 3300017792 Ga0163161_10025774 Ga0163161_100257744 382
1526 3300017792 Ga0163161_10071262 Ga0163161_100712623 382
1527 3300017792 Ga0163161_10117200 Ga0163161_101172001 382
1528 3300017792 Ga0163161_10138268 Ga0163161_101382682 382
1529 3300020070 Ga0206356_10061609 Ga0206356_100616092 382
1530 3300020070 Ga0206356_11616746 Ga0206356_116167463 382
1531 3300020082 Ga0206353_11840038 Ga0206353_118400384 382
1532 3300021384 Ga0213876_10101399 Ga0213876_101013991 382
1533 3300022467 Ga0224712_10000090 Ga0224712_100000908 382
1534 3300022739 Ga0228711_1005754 Ga0228711_10057543 382
1535 3300022739 Ga0228711_1032337 Ga0228711_10323372 382
1536 3300022740 Ga0228710_1006542 Ga0228710_10065423 382
1537 3300022740 Ga0228710_1031661 Ga0228710_10316613 382
1538 3300025206 Ga0209435_100004 Ga0209435_10000485 382
1539 3300025206 Ga0209435_100005 Ga0209435_10000523 382
1540 3300025206 Ga0209435_100866 Ga0209435_1008665 382
1541 3300025207 Ga0209760_100114 Ga0209760_10011435 382
1542 3300025207 Ga0209760_100340 Ga0209760_1003405 382
1543 3300025208 Ga0209436_100026 Ga0209436_10002641 382
1544 3300025224 Ga0209784_100005 Ga0209784_100005188 382
1545 3300025224 Ga0209784_100007 Ga0209784_10000783 382
1546 3300025224 Ga0209784_100049 Ga0209784_100049169 382
1547 3300025224 Ga0209784_100164 Ga0209784_10016431 382
1548 3300025225 Ga0209566_100005 Ga0209566_100005188 382
1549 3300025225 Ga0209566_100009 Ga0209566_10000983 382
1550 3300025225 Ga0209566_100061 Ga0209566_100061169 382
1551 3300025225 Ga0209566_100212 Ga0209566_10021216 382
1552 3300025225 Ga0209566_102109 Ga0209566_1021092 382
1553 3300025226 Ga0209674_100009 Ga0209674_100009188 382
1554 3300025226 Ga0209674_100013 Ga0209674_100013599 382
1555 3300025226 Ga0209674_100021 Ga0209674_10002183 382
1556 3300025226 Ga0209674_100037 Ga0209674_10003798 382
1557 3300025226 Ga0209674_100059 Ga0209674_100059191 382
1558 3300025226 Ga0209674_100069 Ga0209674_100069218 382
1559 3300025226 Ga0209674_100163 Ga0209674_1001638 382
1560 3300025226 Ga0209674_100437 Ga0209674_1004377 382
1561 3300025226 Ga0209674_100560 Ga0209674_1005604 382
1562 3300025226 Ga0209674_101415 Ga0209674_1014154 382
1563 3300025228 Ga0209672_100004 Ga0209672_100004730 382
1564 3300025228 Ga0209672_100008 Ga0209672_100008635 382
1565 3300025228 Ga0209672_100010 Ga0209672_100010651 382
1566 3300025228 Ga0209672_100046 Ga0209672_100046220 382
1567 3300025228 Ga0209672_100047 Ga0209672_100047137 382
1568 3300025228 Ga0209672_100121 Ga0209672_10012149 382
1569 3300025228 Ga0209672_100272 Ga0209672_10027228 382
1570 3300025228 Ga0209672_101050 Ga0209672_1010502 382
1571 3300025228 Ga0209672_101871 Ga0209672_1018712 382
1572 3300025229 Ga0209147_100006 Ga0209147_100006651 382
1573 3300025229 Ga0209147_100009 Ga0209147_10000983 382
1574 3300025229 Ga0209147_100011 Ga0209147_100011183 382
1575 3300025229 Ga0209147_100043 Ga0209147_10004344 382
1576 3300025229 Ga0209147_100059 Ga0209147_100059137 382
1577 3300025229 Ga0209147_100172 Ga0209147_10017242 382
1578 3300025230 Ga0209563_100012 Ga0209563_100012188 382
1579 3300025230 Ga0209563_100018 Ga0209563_10001883 382
1580 3300025230 Ga0209563_100036 Ga0209563_100036164 382
1581 3300025230 Ga0209563_100083 Ga0209563_100083169 382
1582 3300025230 Ga0209563_100379 Ga0209563_10037913 382
1583 3300025230 Ga0209563_101790 Ga0209563_1017904 382
1584 3300025230 Ga0209563_102726 Ga0209563_1027263 382
1585 3300025231 Ga0207427_100008 Ga0207427_100008439 382
1586 3300025231 Ga0207427_100037 Ga0207427_100037194 382
1587 3300025231 Ga0207427_100084 Ga0207427_10008453 382
1588 3300025231 Ga0207427_100134 Ga0207427_10013442 382
1589 3300025231 Ga0207427_101852 Ga0207427_1018526 382
1590 3300025231 Ga0207427_101954 Ga0207427_1019543 382
1591 3300025231 Ga0207427_103135 Ga0207427_1031353 382
1592 3300025233 Ga0209437_100005 Ga0209437_100005700 382
1593 3300025233 Ga0209437_100014 Ga0209437_100014272 382
1594 3300025233 Ga0209437_100037 Ga0209437_10003770 382
1595 3300025233 Ga0209437_100078 Ga0209437_10007851 382
1596 3300025233 Ga0209437_100084 Ga0209437_10008418 382
1597 3300025233 Ga0209437_100091 Ga0209437_100091217 382
1598 3300025233 Ga0209437_100197 Ga0209437_100197106 382
1599 3300025233 Ga0209437_100213 Ga0209437_10021369 382
1600 3300025242 Ga0209258_100003 Ga0209258_100003730 382
1601 3300025242 Ga0209258_100004 Ga0209258_100004555 382
1602 3300025242 Ga0209258_100008 Ga0209258_100008180 382
1603 3300025242 Ga0209258_100010 Ga0209258_100010651 382
1604 3300025242 Ga0209258_100023 Ga0209258_100023244 382
1605 3300025242 Ga0209258_100034 Ga0209258_100034264 382
1606 3300025242 Ga0209258_100057 Ga0209258_100057118 382
1607 3300025242 Ga0209258_100106 Ga0209258_100106151 382
1608 3300025242 Ga0209258_100172 Ga0209258_10017235 382
1609 3300025242 Ga0209258_100237 Ga0209258_10023783 382
1610 3300025242 Ga0209258_100441 Ga0209258_10044122 382
1611 3300025242 Ga0209258_100792 Ga0209258_10079210 382
1612 3300025242 Ga0209258_101200 Ga0209258_1012005 382
1613 3300025245 Ga0207425_1003167 Ga0207425_10031672 382
1614 3300025245 Ga0207425_1003464 Ga0207425_10034645 382
1615 3300025245 Ga0207425_1005523 Ga0207425_10055233 382
1616 3300025246 Ga0209646_1000011 Ga0209646_100001123 382
1617 3300025246 Ga0209646_1000032 Ga0209646_1000032277 382
1618 3300025246 Ga0209646_1000052 Ga0209646_100005299 382
1619 3300025246 Ga0209646_1000442 Ga0209646_10004422 382
1620 3300025246 Ga0209646_1000895 Ga0209646_10008955 382
1621 3300025246 Ga0209646_1001329 Ga0209646_10013292 382
1622 3300025246 Ga0209646_1001788 Ga0209646_10017883 382
1623 3300025246 Ga0209646_1002158 Ga0209646_10021586 382
1624 3300025250 Ga0209026_1000008 Ga0209026_100000823 382
1625 3300025250 Ga0209026_1000045 Ga0209026_1000045178 382
1626 3300025250 Ga0209026_1000062 Ga0209026_1000062137 382
1627 3300025250 Ga0209026_1000187 Ga0209026_100018739 382
1628 3300025250 Ga0209026_1000223 Ga0209026_100022311 382
1629 3300025250 Ga0209026_1000761 Ga0209026_10007615 382
1630 3300025250 Ga0209026_1003142 Ga0209026_10031425 382
1631 3300025253 Ga0209677_100006 Ga0209677_100006188 382
1632 3300025253 Ga0209677_100012 Ga0209677_10001283 382
1633 3300025253 Ga0209677_100039 Ga0209677_100039218 382
1634 3300025253 Ga0209677_100916 Ga0209677_1009162 382
1635 3300025253 Ga0209677_102832 Ga0209677_1028323 382
1636 3300025254 Ga0209148_1000001 Ga0209148_1000001440 382
1637 3300025254 Ga0209148_1000002 Ga0209148_1000002394 382
1638 3300025254 Ga0209148_1000002 Ga0209148_1000002407 382
1639 3300025254 Ga0209148_1000018 Ga0209148_1000018651 382
1640 3300025254 Ga0209148_1000025 Ga0209148_100002534 382
1641 3300025254 Ga0209148_1000029 Ga0209148_1000029310 382
1642 3300025254 Ga0209148_1000042 Ga0209148_1000042277 382
1643 3300025254 Ga0209148_1000053 Ga0209148_1000053300 382
1644 3300025254 Ga0209148_1000068 Ga0209148_1000068118 382
1645 3300025254 Ga0209148_1000925 Ga0209148_10009253 382
1646 3300025254 Ga0209148_1005322 Ga0209148_10053222 382
1647 3300025256 Ga0209759_1000004 Ga0209759_100000423 382
1648 3300025256 Ga0209759_1000054 Ga0209759_1000054122 382
1649 3300025256 Ga0209759_1000132 Ga0209759_1000132116 382
1650 3300025256 Ga0209759_1000181 Ga0209759_100018152 382
1651 3300025256 Ga0209759_1000185 Ga0209759_100018554 382
1652 3300025256 Ga0209759_1000212 Ga0209759_100021247 382
1653 3300025256 Ga0209759_1000303 Ga0209759_10003039 382
1654 3300025256 Ga0209759_1001491 Ga0209759_10014919 382
1655 3300025256 Ga0209759_1001499 Ga0209759_10014995 382
1656 3300025256 Ga0209759_1001939 Ga0209759_10019397 382
1657 3300025256 Ga0209759_1002853 Ga0209759_10028535 382
1658 3300025256 Ga0209759_1003544 Ga0209759_10035443 382
1659 3300025256 Ga0209759_1010084 Ga0209759_10100844 382
1660 3300025256 Ga0209759_1019960 Ga0209759_10199601 382
1661 3300025258 Ga0209129_1000203 Ga0209129_100020327 382
1662 3300025258 Ga0209129_1000755 Ga0209129_10007555 382
1663 3300025258 Ga0209129_1001047 Ga0209129_10010473 382
1664 3300025258 Ga0209129_1001557 Ga0209129_10015575 382
1665 3300025258 Ga0209129_1001808 Ga0209129_10018085 382
1666 3300025258 Ga0209129_1001861 Ga0209129_10018614 382
1667 3300025258 Ga0209129_1001919 Ga0209129_10019199 382
1668 3300025258 Ga0209129_1002692 Ga0209129_10026921 382
1669 3300025261 Ga0209233_1000002 Ga0209233_10000021791 382
1670 3300025261 Ga0209233_1000006 Ga0209233_1000006534 382
1671 3300025261 Ga0209233_1000008 Ga0209233_1000008272 382
1672 3300025261 Ga0209233_1000011 Ga0209233_1000011242 382
1673 3300025261 Ga0209233_1000093 Ga0209233_1000093222 382
1674 3300025261 Ga0209233_1000096 Ga0209233_1000096195 382
1675 3300025261 Ga0209233_1000115 Ga0209233_1000115217 382
1676 3300025261 Ga0209233_1000163 Ga0209233_100016351 382
1677 3300025261 Ga0209233_1000199 Ga0209233_10001996 382
1678 3300025261 Ga0209233_1000397 Ga0209233_100039728 382
1679 3300025263 Ga0209565_1000024 Ga0209565_100002491 382
1680 3300025263 Ga0209565_1014397 Ga0209565_10143972 382
1681 3300025272 Ga0209455_1000004 Ga0209455_1000004730 382
1682 3300025272 Ga0209455_1000007 Ga0209455_1000007300 382
1683 3300025272 Ga0209455_1000015 Ga0209455_1000015651 382
1684 3300025272 Ga0209455_1000016 Ga0209455_1000016532 382
1685 3300025272 Ga0209455_1000054 Ga0209455_1000054233 382
1686 3300025272 Ga0209455_1000064 Ga0209455_100006439 382
1687 3300025272 Ga0209455_1006243 Ga0209455_10062431 382
1688 3300025273 Ga0209673_1000037 Ga0209673_100003726 382
1689 3300025273 Ga0209673_1000115 Ga0209673_100011562 382
1690 3300025273 Ga0209673_1000222 Ga0209673_100022245 382
1691 3300025273 Ga0209673_1000237 Ga0209673_100023755 382
1692 3300025273 Ga0209673_1000670 Ga0209673_100067017 382
1693 3300025273 Ga0209673_1001021 Ga0209673_100102117 382
1694 3300025273 Ga0209673_1007680 Ga0209673_10076804 382
1695 3300025273 Ga0209673_1009725 Ga0209673_10097253 382
1696 3300025273 Ga0209673_1032481 Ga0209673_10324812 382
1697 3300025284 Ga0209130_1000030 Ga0209130_100003046 382
1698 3300025284 Ga0209130_1000032 Ga0209130_1000032252 382
1699 3300025284 Ga0209130_1000033 Ga0209130_100003328 382
1700 3300025284 Ga0209130_1002498 Ga0209130_10024985 382
1701 3300025284 Ga0209130_1011655 Ga0209130_10116552 382
1702 3300025291 Ga0209675_1000011 Ga0209675_100001119 382
1703 3300025291 Ga0209675_1019504 Ga0209675_10195042 382
1704 3300025291 Ga0209675_1021539 Ga0209675_10215392 382
1705 3300025291 Ga0209675_1023592 Ga0209675_10235922 382
1706 3300025292 Ga0209676_1000010 Ga0209676_1000010217 382
1707 3300025292 Ga0209676_1000011 Ga0209676_1000011372 382
1708 3300025292 Ga0209676_1000021 Ga0209676_1000021378 382
1709 3300025292 Ga0209676_1000345 Ga0209676_100034529 382
1710 3300025292 Ga0209676_1000440 Ga0209676_10004405 382
1711 3300025292 Ga0209676_1000605 Ga0209676_100060543 382
1712 3300025292 Ga0209676_1001461 Ga0209676_100146120 382
1713 3300025292 Ga0209676_1004038 Ga0209676_10040384 382
1714 3300025292 Ga0209676_1008671 Ga0209676_10086714 382
1715 3300025292 Ga0209676_1015940 Ga0209676_10159402 382
1716 3300025294 Ga0209025_1000032 Ga0209025_1000032260 382
1717 3300025294 Ga0209025_1000044 Ga0209025_100004435 382
1718 3300025294 Ga0209025_1000354 Ga0209025_100035478 382
1719 3300025294 Ga0209025_1000864 Ga0209025_10008645 382
1720 3300025294 Ga0209025_1001447 Ga0209025_100144727 382
1721 3300025294 Ga0209025_1003821 Ga0209025_10038211 382
1722 3300025294 Ga0209025_1005184 Ga0209025_10051842 382
1723 3300025294 Ga0209025_1029298 Ga0209025_10292982 382
1724 3300025294 Ga0209025_1032266 Ga0209025_10322662 382
1725 3300025294 Ga0209025_1036238 Ga0209025_10362382 382
1726 3300025295 Ga0209564_1000079 Ga0209564_1000079222 382
1727 3300025295 Ga0209564_1000207 Ga0209564_100020783 382
1728 3300025295 Ga0209564_1000258 Ga0209564_100025845 382
1729 3300025295 Ga0209564_1000379 Ga0209564_100037931 382
1730 3300025295 Ga0209564_1000490 Ga0209564_100049045 382
1731 3300025295 Ga0209564_1002591 Ga0209564_100259110 382
1732 3300025295 Ga0209564_1005577 Ga0209564_10055772 382
1733 3300025295 Ga0209564_1021889 Ga0209564_10218893 382
1734 3300025295 Ga0209564_1022583 Ga0209564_10225832 382
1735 3300025297 Ga0209758_1000008 Ga0209758_1000008425 382
1736 3300025297 Ga0209758_1000586 Ga0209758_10005866 382
1737 3300025297 Ga0209758_1000674 Ga0209758_100067431 382
1738 3300025297 Ga0209758_1000983 Ga0209758_100098322 382
1739 3300025297 Ga0209758_1001007 Ga0209758_100100714 382
1740 3300025297 Ga0209758_1001098 Ga0209758_10010983 382
1741 3300025297 Ga0209758_1001230 Ga0209758_10012303 382
1742 3300025297 Ga0209758_1001815 Ga0209758_100181518 382
1743 3300025297 Ga0209758_1004625 Ga0209758_100462510 382
1744 3300025297 Ga0209758_1015519 Ga0209758_10155192 382
1745 3300025297 Ga0209758_1022030 Ga0209758_10220303 382
1746 3300025298 Ga0209050_1000032 Ga0209050_1000032251 382
1747 3300025298 Ga0209050_1000081 Ga0209050_100008133 382
1748 3300025298 Ga0209050_1000162 Ga0209050_100016235 382
1749 3300025298 Ga0209050_1000227 Ga0209050_1000227113 382
1750 3300025298 Ga0209050_1001253 Ga0209050_100125320 382
1751 3300025298 Ga0209050_1001540 Ga0209050_100154022 382
1752 3300025298 Ga0209050_1001731 Ga0209050_10017315 382
1753 3300025298 Ga0209050_1002704 Ga0209050_100270410 382
1754 3300025298 Ga0209050_1003537 Ga0209050_10035376 382
1755 3300025298 Ga0209050_1009731 Ga0209050_10097315 382
1756 3300025299 Ga0209256_1000202 Ga0209256_100020245 382
1757 3300025299 Ga0209256_1000709 Ga0209256_100070936 382
1758 3300025299 Ga0209256_1000893 Ga0209256_100089326 382
1759 3300025299 Ga0209256_1000950 Ga0209256_10009508 382
1760 3300025299 Ga0209256_1001345 Ga0209256_10013454 382
1761 3300025299 Ga0209256_1001793 Ga0209256_100179314 382
1762 3300025299 Ga0209256_1001832 Ga0209256_10018323 382
1763 3300025299 Ga0209256_1008649 Ga0209256_10086493 382
1764 3300025299 Ga0209256_1010324 Ga0209256_10103244 382
1765 3300025299 Ga0209256_1013528 Ga0209256_10135283 382
1766 3300025302 Ga0207426_1000007 Ga0207426_1000007148 382
1767 3300025302 Ga0207426_1000047 Ga0207426_1000047354 382
1768 3300025302 Ga0207426_1000077 Ga0207426_1000077252 382
1769 3300025302 Ga0207426_1000078 Ga0207426_100007828 382
1770 3300025302 Ga0207426_1000296 Ga0207426_100029679 382
1771 3300025302 Ga0207426_1001188 Ga0207426_100118825 382
1772 3300025303 Ga0209051_1000104 Ga0209051_100010438 382
1773 3300025303 Ga0209051_1000121 Ga0209051_1000121117 382
1774 3300025303 Ga0209051_1000164 Ga0209051_1000164114 382
1775 3300025303 Ga0209051_1000202 Ga0209051_100020279 382
1776 3300025303 Ga0209051_1000710 Ga0209051_100071017 382
1777 3300025303 Ga0209051_1000908 Ga0209051_10009084 382
1778 3300025303 Ga0209051_1000909 Ga0209051_10009098 382
1779 3300025303 Ga0209051_1001365 Ga0209051_100136515 382
1780 3300025303 Ga0209051_1003501 Ga0209051_10035013 382
1781 3300025303 Ga0209051_1005522 Ga0209051_10055222 382
1782 3300025303 Ga0209051_1013475 Ga0209051_10134751 382
1783 3300025303 Ga0209051_1021653 Ga0209051_10216531 382
1784 3300025303 Ga0209051_1030693 Ga0209051_10306932 382
1785 3300025303 Ga0209051_1030965 Ga0209051_10309652 382
1786 3300025304 Ga0209257_1000014 Ga0209257_1000014431 382
1787 3300025304 Ga0209257_1000040 Ga0209257_1000040308 382
1788 3300025304 Ga0209257_1000065 Ga0209257_1000065211 382
1789 3300025304 Ga0209257_1000121 Ga0209257_100012129 382
1790 3300025304 Ga0209257_1000356 Ga0209257_100035699 382
1791 3300025304 Ga0209257_1000452 Ga0209257_10004525 382
1792 3300025304 Ga0209257_1001064 Ga0209257_10010645 382
1793 3300025304 Ga0209257_1004058 Ga0209257_10040588 382
1794 3300025304 Ga0209257_1004137 Ga0209257_10041379 382
1795 3300025304 Ga0209257_1007238 Ga0209257_10072382 382
1796 3300025304 Ga0209257_1012983 Ga0209257_10129833 382
1797 3300025304 Ga0209257_1013555 Ga0209257_10135553 382
1798 3300025304 Ga0209257_1028082 Ga0209257_10280821 382
1799 3300025321 Ga0207656_10000009 Ga0207656_1000000985 382
1800 3300025711 Ga0207696_1000097 Ga0207696_100009750 382
1801 3300025711 Ga0207696_1000152 Ga0207696_100015282 382
1802 3300025711 Ga0207696_1000165 Ga0207696_100016586 382
1803 3300025711 Ga0207696_1001780 Ga0207696_100178010 382
1804 3300025711 Ga0207696_1001993 Ga0207696_10019932 382
1805 3300025728 Ga0207655_1000021 Ga0207655_100002148 382
1806 3300025728 Ga0207655_1000603 Ga0207655_100060341 382
1807 3300025728 Ga0207655_1000652 Ga0207655_100065223 382
1808 3300025728 Ga0207655_1000772 Ga0207655_10007722 382
1809 3300025728 Ga0207655_1000931 Ga0207655_100093126 382
1810 3300025728 Ga0207655_1003483 Ga0207655_10034836 382
1811 3300025728 Ga0207655_1012890 Ga0207655_10128903 382
1812 3300025728 Ga0207655_1017528 Ga0207655_10175283 382
1813 3300025728 Ga0207655_1018487 Ga0207655_10184873 382
1814 3300025728 Ga0207655_1022739 Ga0207655_10227393 382
1815 3300025728 Ga0207655_1029630 Ga0207655_10296301 382
1816 3300025735 Ga0207713_1000009 Ga0207713_1000009435 382
1817 3300025735 Ga0207713_1000041 Ga0207713_100004196 382
1818 3300025735 Ga0207713_1000692 Ga0207713_100069216 382
1819 3300025735 Ga0207713_1001034 Ga0207713_10010346 382
1820 3300025735 Ga0207713_1001400 Ga0207713_100140017 382
1821 3300025735 Ga0207713_1002103 Ga0207713_10021037 382
1822 3300025735 Ga0207713_1002787 Ga0207713_100278710 382
1823 3300025735 Ga0207713_1003713 Ga0207713_10037136 382
1824 3300025735 Ga0207713_1003965 Ga0207713_10039655 382
1825 3300025735 Ga0207713_1006559 Ga0207713_10065594 382
1826 3300025735 Ga0207713_1007252 Ga0207713_10072523 382
1827 3300025735 Ga0207713_1008559 Ga0207713_10085594 382
1828 3300025735 Ga0207713_1010947 Ga0207713_10109474 382
1829 3300025735 Ga0207713_1017746 Ga0207713_10177462 382
1830 3300025899 Ga0207642_10017216 Ga0207642_100172164 382
1831 3300025903 Ga0207680_10000003 Ga0207680_10000003652 382
1832 3300025903 Ga0207680_10010848 Ga0207680_100108484 382
1833 3300025904 Ga0207647_10000406 Ga0207647_100004063 382
1834 3300025904 Ga0207647_10005179 Ga0207647_100051795 382
1835 3300025904 Ga0207647_10006150 Ga0207647_100061509 382
1836 3300025904 Ga0207647_10020784 Ga0207647_100207842 382
1837 3300025904 Ga0207647_10047493 Ga0207647_100474931 382
1838 3300025907 Ga0207645_10020432 Ga0207645_100204324 382
1839 3300025907 Ga0207645_10025328 Ga0207645_100253282 382
1840 3300025908 Ga0207643_10021300 Ga0207643_100213003 382
1841 3300025908 Ga0207643_10028023 Ga0207643_100280233 382
1842 3300025908 Ga0207643_10074720 Ga0207643_100747202 382
1843 3300025909 Ga0207705_10002609 Ga0207705_1000260911 382
1844 3300025909 Ga0207705_10013348 Ga0207705_100133484 382
1845 3300025909 Ga0207705_10013783 Ga0207705_100137832 382
1846 3300025909 Ga0207705_10035760 Ga0207705_100357604 382
1847 3300025909 Ga0207705_10040318 Ga0207705_100403182 382
1848 3300025909 Ga0207705_10055162 Ga0207705_100551623 382
1849 3300025909 Ga0207705_10109084 Ga0207705_101090841 382
1850 3300025911 Ga0207654_10019928 Ga0207654_100199282 382
1851 3300025911 Ga0207654_10024194 Ga0207654_100241943 382
1852 3300025912 Ga0207707_10052033 Ga0207707_100520334 382
1853 3300025913 Ga0207695_10000049 Ga0207695_1000004929 382
1854 3300025913 Ga0207695_10000429 Ga0207695_100004298 382
1855 3300025913 Ga0207695_10001702 Ga0207695_1000170233 382
1856 3300025913 Ga0207695_10003515 Ga0207695_1000351518 382
1857 3300025913 Ga0207695_10005252 Ga0207695_100052523 382
1858 3300025913 Ga0207695_10011740 Ga0207695_100117405 382
1859 3300025913 Ga0207695_10012415 Ga0207695_100124153 382
1860 3300025913 Ga0207695_10021072 Ga0207695_100210727 382
1861 3300025913 Ga0207695_10026274 Ga0207695_100262742 382
1862 3300025913 Ga0207695_10133729 Ga0207695_101337292 382
1863 3300025913 Ga0207695_10141210 Ga0207695_101412102 382
1864 3300025913 Ga0207695_10249740 Ga0207695_102497402 382
1865 3300025913 Ga0207695_10316730 Ga0207695_103167302 382
1866 3300025914 Ga0207671_10000059 Ga0207671_100000595 382
1867 3300025914 Ga0207671_10000135 Ga0207671_1000013547 382
1868 3300025914 Ga0207671_10000556 Ga0207671_1000055623 382
1869 3300025914 Ga0207671_10000713 Ga0207671_100007136 382
1870 3300025914 Ga0207671_10004705 Ga0207671_100047055 382
1871 3300025914 Ga0207671_10034008 Ga0207671_100340081 382
1872 3300025914 Ga0207671_10060219 Ga0207671_100602192 382
1873 3300025916 Ga0207663_10142381 Ga0207663_101423812 382
1874 3300025918 Ga0207662_10001567 Ga0207662_100015676 382
1875 3300025919 Ga0207657_10000008 Ga0207657_1000000868 382
1876 3300025919 Ga0207657_10001585 Ga0207657_1000158522 382
1877 3300025919 Ga0207657_10017790 Ga0207657_100177902 382
1878 3300025919 Ga0207657_10067795 Ga0207657_100677952 382
1879 3300025920 Ga0207649_10000007 Ga0207649_10000007209 382
1880 3300025920 Ga0207649_10014289 Ga0207649_100142893 382
1881 3300025920 Ga0207649_10237503 Ga0207649_102375031 382
1882 3300025921 Ga0207652_10015302 Ga0207652_100153027 382
1883 3300025921 Ga0207652_10041632 Ga0207652_100416323 382
1884 3300025921 Ga0207652_10125743 Ga0207652_101257431 382
1885 3300025921 Ga0207652_10129091 Ga0207652_101290912 382
1886 3300025921 Ga0207652_10132655 Ga0207652_101326552 382
1887 3300025923 Ga0207681_10000163 Ga0207681_1000016349 382
1888 3300025923 Ga0207681_10007357 Ga0207681_100073574 382
1889 3300025923 Ga0207681_10173549 Ga0207681_101735492 382
1890 3300025924 Ga0207694_10000128 Ga0207694_1000012854 382
1891 3300025924 Ga0207694_10000359 Ga0207694_1000035928 382
1892 3300025924 Ga0207694_10019147 Ga0207694_100191475 382
1893 3300025924 Ga0207694_10032251 Ga0207694_100322512 382
1894 3300025924 Ga0207694_10042761 Ga0207694_100427612 382
1895 3300025924 Ga0207694_10064274 Ga0207694_100642742 382
1896 3300025924 Ga0207694_10186621 Ga0207694_101866212 382
1897 3300025925 Ga0207650_10000178 Ga0207650_1000017848 382
1898 3300025925 Ga0207650_10000210 Ga0207650_1000021029 382
1899 3300025925 Ga0207650_10008117 Ga0207650_100081174 382
1900 3300025925 Ga0207650_10336585 Ga0207650_103365851 382
1901 3300025926 Ga0207659_10036901 Ga0207659_100369015 382
1902 3300025926 Ga0207659_10249400 Ga0207659_102494001 382
1903 3300025927 Ga0207687_10015209 Ga0207687_100152094 382
1904 3300025929 Ga0207664_10010237 Ga0207664_100102372 382
1905 3300025929 Ga0207664_10095916 Ga0207664_100959162 382
1906 3300025931 Ga0207644_10003369 Ga0207644_100033695 382
1907 3300025932 Ga0207690_10000013 Ga0207690_10000013104 382
1908 3300025932 Ga0207690_10014282 Ga0207690_100142824 382
1909 3300025933 Ga0207706_10000050 Ga0207706_1000005085 382
1910 3300025933 Ga0207706_10132688 Ga0207706_101326883 382
1911 3300025933 Ga0207706_10133108 Ga0207706_101331082 382
1912 3300025934 Ga0207686_10001532 Ga0207686_100015327 382
1913 3300025935 Ga0207709_10000035 Ga0207709_10000035215 382
1914 3300025935 Ga0207709_10005638 Ga0207709_100056387 382
1915 3300025935 Ga0207709_10071412 Ga0207709_100714122 382
1916 3300025935 Ga0207709_10100678 Ga0207709_101006781 382
1917 3300025936 Ga0207670_10011958 Ga0207670_100119582 382
1918 3300025936 Ga0207670_10096398 Ga0207670_100963981 382
1919 3300025937 Ga0207669_10060191 Ga0207669_100601912 382
1920 3300025938 Ga0207704_10010676 Ga0207704_100106764 382
1921 3300025938 Ga0207704_10078039 Ga0207704_100780393 382
1922 3300025940 Ga0207691_10004858 Ga0207691_100048583 382
1923 3300025940 Ga0207691_10071976 Ga0207691_100719763 382
1924 3300025940 Ga0207691_10160767 Ga0207691_101607672 382
1925 3300025941 Ga0207711_10033204 Ga0207711_100332044 382
1926 3300025941 Ga0207711_10045097 Ga0207711_100450972 382
1927 3300025941 Ga0207711_10133059 Ga0207711_101330591 382
1928 3300025941 Ga0207711_10378763 Ga0207711_103787632 382
1929 3300025942 Ga0207689_10002599 Ga0207689_1000259910 382
1930 3300025942 Ga0207689_10015989 Ga0207689_100159893 382
1931 3300025942 Ga0207689_10092746 Ga0207689_100927461 382
1932 3300025944 Ga0207661_10013152 Ga0207661_100131521 382
1933 3300025944 Ga0207661_10041845 Ga0207661_100418452 382
1934 3300025944 Ga0207661_10102213 Ga0207661_101022132 382
1935 3300025944 Ga0207661_10208914 Ga0207661_102089142 382
1936 3300025945 Ga0207679_10000013 Ga0207679_1000001395 382
1937 3300025945 Ga0207679_10007435 Ga0207679_100074353 382
1938 3300025945 Ga0207679_10024109 Ga0207679_100241092 382
1939 3300025945 Ga0207679_10051926 Ga0207679_100519263 382
1940 3300025949 Ga0207667_10000028 Ga0207667_10000028165 382
1941 3300025949 Ga0207667_10000062 Ga0207667_1000006280 382
1942 3300025949 Ga0207667_10000292 Ga0207667_1000029237 382
1943 3300025949 Ga0207667_10000486 Ga0207667_1000048614 382
1944 3300025949 Ga0207667_10002564 Ga0207667_1000256410 382
1945 3300025949 Ga0207667_10013346 Ga0207667_100133461 382
1946 3300025949 Ga0207667_10013807 Ga0207667_100138074 382
1947 3300025949 Ga0207667_10015048 Ga0207667_100150486 382
1948 3300025949 Ga0207667_10070719 Ga0207667_100707193 382
1949 3300025949 Ga0207667_10081051 Ga0207667_100810515 382
1950 3300025949 Ga0207667_10106559 Ga0207667_101065592 382
1951 3300025949 Ga0207667_10121940 Ga0207667_101219403 382
1952 3300025949 Ga0207667_10132596 Ga0207667_101325962 382
1953 3300025949 Ga0207667_10208048 Ga0207667_102080482 382
1954 3300025960 Ga0207651_10012970 Ga0207651_100129704 382
1955 3300025960 Ga0207651_10119814 Ga0207651_101198142 382
1956 3300025961 Ga0207712_10033098 Ga0207712_100330982 382
1957 3300025972 Ga0207668_10008682 Ga0207668_100086824 382
1958 3300025972 Ga0207668_10082433 Ga0207668_100824332 382
1959 3300025981 Ga0207640_10000022 Ga0207640_1000002232 382
1960 3300025981 Ga0207640_10000471 Ga0207640_100004712 382
1961 3300025981 Ga0207640_10000670 Ga0207640_1000067013 382
1962 3300025981 Ga0207640_10145962 Ga0207640_101459621 382
1963 3300025986 Ga0207658_10070348 Ga0207658_100703483 382
1964 3300026035 Ga0207703_10120948 Ga0207703_101209482 382
1965 3300026041 Ga0207639_10027540 Ga0207639_100275403 382
1966 3300026067 Ga0207678_10000969 Ga0207678_1000096912 382
1967 3300026067 Ga0207678_10001675 Ga0207678_100016755 382
1968 3300026067 Ga0207678_10095511 Ga0207678_100955113 382
1969 3300026078 Ga0207702_10000624 Ga0207702_1000062410 382
1970 3300026078 Ga0207702_10009106 Ga0207702_100091067 382
1971 3300026078 Ga0207702_10028519 Ga0207702_100285192 382
1972 3300026078 Ga0207702_10051439 Ga0207702_100514392 382
1973 3300026078 Ga0207702_10070045 Ga0207702_100700453 382
1974 3300026078 Ga0207702_10077002 Ga0207702_100770023 382
1975 3300026078 Ga0207702_10153332 Ga0207702_101533322 382
1976 3300026078 Ga0207702_10252153 Ga0207702_102521532 382
1977 3300026088 Ga0207641_10006248 Ga0207641_100062483 382
1978 3300026088 Ga0207641_10014471 Ga0207641_100144712 382
1979 3300026089 Ga0207648_10034441 Ga0207648_100344413 382
1980 3300026089 Ga0207648_10051585 Ga0207648_100515852 382
1981 3300026095 Ga0207676_10073470 Ga0207676_100734701 382
1982 3300026095 Ga0207676_10105343 Ga0207676_101053431 382
1983 3300026095 Ga0207676_10170681 Ga0207676_101706812 382
1984 3300026095 Ga0207676_10332450 Ga0207676_103324501 382
1985 3300026116 Ga0207674_10000298 Ga0207674_100002985 382
1986 3300026116 Ga0207674_10010196 Ga0207674_100101963 382
1987 3300026116 Ga0207674_10044449 Ga0207674_100444493 382
1988 3300026116 Ga0207674_10091822 Ga0207674_100918222 382
1989 3300026116 Ga0207674_10162508 Ga0207674_101625081 382
1990 3300026116 Ga0207674_10379914 Ga0207674_103799142 382
1991 3300026118 Ga0207675_100053155 Ga0207675_1000531555 382
1992 3300026118 Ga0207675_100110860 Ga0207675_1001108602 382
1993 3300026121 Ga0207683_10014610 Ga0207683_100146104 382
1994 3300026121 Ga0207683_10016309 Ga0207683_100163092 382
1995 3300026142 Ga0207698_10014129 Ga0207698_100141292 382
1996 3300026142 Ga0207698_10015955 Ga0207698_100159556 382
1997 3300026142 Ga0207698_10019529 Ga0207698_100195295 382
1998 3300026142 Ga0207698_10232031 Ga0207698_102320311 382
1999 3300027111 Ga0209281_1000077 Ga0209281_1000077208 382
2000 3300027111 Ga0209281_1000118 Ga0209281_100011819 382
2001 3300027111 Ga0209281_1000212 Ga0209281_100021229 382
2002 3300027111 Ga0209281_1000346 Ga0209281_100034669 382
2003 3300027111 Ga0209281_1000469 Ga0209281_100046924 382
2004 3300027111 Ga0209281_1013795 Ga0209281_10137952 382
2005 3300027312 Ga0209371_1000023 Ga0209371_1000023184 382
2006 3300027312 Ga0209371_1000065 Ga0209371_100006593 382
2007 3300027312 Ga0209371_1002067 Ga0209371_10020679 382
2008 3300027312 Ga0209371_1010681 Ga0209371_10106812 382
2009 3300027666 Ga0209282_1000038 Ga0209282_100003824 382
2010 3300027666 Ga0209282_1029815 Ga0209282_10298152 382
2011 3300027866 Ga0209813_10006468 Ga0209813_100064682 382
2012 3300027907 Ga0207428_10015977 Ga0207428_100159777 382
2013 3300027907 Ga0207428_10044995 Ga0207428_100449951 382
2014 3300028379 Ga0268266_10000011 Ga0268266_10000011590 382
2015 3300028379 Ga0268266_10000364 Ga0268266_100003645 382
2016 3300028379 Ga0268266_10000895 Ga0268266_1000089532 382
2017 3300028379 Ga0268266_10005005 Ga0268266_1000500512 382
2018 3300028379 Ga0268266_10020541 Ga0268266_100205414 382
2019 3300028379 Ga0268266_10023157 Ga0268266_100231572 382
2020 3300028379 Ga0268266_10055690 Ga0268266_100556903 382
2021 3300028379 Ga0268266_10263051 Ga0268266_102630512 382
2022 3300028381 Ga0268264_10003867 Ga0268264_100038678 382
2023 3300028381 Ga0268264_10384530 Ga0268264_103845301 382
2024 3300028381 Ga0268264_10469945 Ga0268264_104699451 382
2025 3300028794 Ga0307515_10085133 Ga0307515_100851333 382
2026 3300028794 Ga0307515_10223914 Ga0307515_102239142 382
2027 3300028800 Ga0265338_10000476 Ga0265338_1000047651 382
2028 3300028800 Ga0265338_10143969 Ga0265338_101439691 382
2029 3300030500 Ga0268256_1000023 Ga0268256_1000023256 382
2030 3300030500 Ga0268256_1000118 Ga0268256_100011893 382
2031 3300030500 Ga0268256_1002195 Ga0268256_10021959 382
2032 3300030500 Ga0268256_1011475 Ga0268256_10114752 382
2033 3300030731 Ga0316177_1155876 Ga0316177_11558761 382
2034 3300030732 Ga0316176_1003471 Ga0316176_10034714 382
2035 3300030735 Ga0316178_1043989 Ga0316178_104398931 382
2036 3300030742 Ga0316183_1207931 Ga0316183_12079318 382
2037 3300030744 Ga0316181_1063746 Ga0316181_10637462 382
2038 3300030744 Ga0316181_1140375 Ga0316181_114037519 382
2039 3300031235 Ga0265330_10023164 Ga0265330_100231642 382
2040 3300031247 Ga0265340_10016453 Ga0265340_100164532 382
2041 3300031456 Ga0307513_10009248 Ga0307513_100092487 382
2042 3300031456 Ga0307513_10035883 Ga0307513_100358835 382
2043 3300031548 Ga0307408_100011609 Ga0307408_1000116093 382
2044 3300031548 Ga0307408_100112000 Ga0307408_1001120002 382
2045 3300031730 Ga0307516_10019066 Ga0307516_100190668 382
2046 3300031730 Ga0307516_10097128 Ga0307516_100971282 382
2047 3300031731 Ga0307405_10000266 Ga0307405_100002666 382
2048 3300031731 Ga0307405_10046393 Ga0307405_100463932 382
2049 3300031731 Ga0307405_10086501 Ga0307405_100865012 382
2050 3300031838 Ga0307518_10000232 Ga0307518_1000023244 382
2051 3300031901 Ga0307406_10008205 Ga0307406_100082053 382
2052 3300031901 Ga0307406_10132790 Ga0307406_101327902 382
2053 3300031911 Ga0307412_10000044 Ga0307412_1000004412 382
2054 3300031911 Ga0307412_10000086 Ga0307412_1000008648 382
2055 3300031911 Ga0307412_10000696 Ga0307412_1000069612 382
2056 3300031911 Ga0307412_10007745 Ga0307412_100077452 382
2057 3300031911 Ga0307412_10016846 Ga0307412_100168463 382
2058 3300031911 Ga0307412_10128074 Ga0307412_101280742 382
2059 3300031967 Ga0315914_1001085 Ga0315914_100108514 382
2060 3300031995 Ga0307409_100060590 Ga0307409_1000605902 382
2061 3300032004 Ga0307414_10002474 Ga0307414_100024749 382
2062 3300032004 Ga0307414_10135333 Ga0307414_101353332 382
2063 3300033180 Ga0307510_10013166 Ga0307510_100131668 382
2064 3300033180 Ga0307510_10022649 Ga0307510_100226492 382
2065 3300033430 Ga0315913_1000342 Ga0315913_100034223 382
2066 3300033464 Ga0315915_1000018 Ga0315915_100001824 382
2067 3300035113 Ga0373936_0014950 Ga0373936_0014950_1644_2792 382
2068 3300035691 Ga0373931_0035536 Ga0373931_0035536_189_1337 382
2069 3300035692 Ga0373935_0060242 Ga0373935_0060242_458_1606 382
2070 3300036401 Ga0373937_0035137 Ga0373937_0035137_1391_2539 382
2071 3300036401 Ga0373937_0064861 Ga0373937_0064861_2104_3252 382
2072 3300036401 Ga0373937_0236117 Ga0373937_0236117_103_1251 382
2073 3300037312 Ga0395899_0000031 Ga0395899_0000031_31281_32480 382
2074 3300037312 Ga0395899_0000226 Ga0395899_0000226_57049_58197 382
2075 3300037312 Ga0395899_0001543 Ga0395899_0001543_16098_17246 382
2076 3300037312 Ga0395899_0018763 Ga0395899_0018763_2671_3819 382
2077 3300037312 Ga0395899_0023189 Ga0395899_0023189_1067_2215 382
2078 3300037312 Ga0395899_0060569 Ga0395899_0060569_306_1454 382
2079 3300037312 Ga0395899_0074384 Ga0395899_0074384_953_2101 382
2080 3300037312 Ga0395899_0105892 Ga0395899_0105892_692_1840 382
2081 3300037312 Ga0395899_0115276 Ga0395899_0115276_188_1336 382
2082 3300037418 Ga0395900_0000011 Ga0395900_0000011_406129_407277 382
2083 3300037418 Ga0395900_0000776 Ga0395900_0000776_26309_27508 382
2084 3300037418 Ga0395900_0000980 Ga0395900_0000980_23238_24479 382
2085 3300037418 Ga0395900_0010941 Ga0395900_0010941_2046_3194 382
2086 3300037418 Ga0395900_0038598 Ga0395900_0038598_637_1785 382
2087 3300037418 Ga0395900_0124178 Ga0395900_0124178_931_2079 382
2088 3300037466 Ga0395898_0000029 Ga0395898_0000029_158699_159847 382
2089 3300037466 Ga0395898_0000040 Ga0395898_0000040_26309_27508 382
2090 3300037466 Ga0395898_0000202 Ga0395898_0000202_27752_28900 382
2091 3300037466 Ga0395898_0001962 Ga0395898_0001962_2240_3481 382
2092 3300037466 Ga0395898_0010632 Ga0395898_0010632_4187_5335 382
2093 3300037466 Ga0395898_0015160 Ga0395898_0015160_4825_5973 382
2094 3300037466 Ga0395898_0016122 Ga0395898_0016122_1335_2573 382
2095 3300037466 Ga0395898_0020527 Ga0395898_0020527_3586_4833 382
2096 3300037466 Ga0395898_0048473 Ga0395898_0048473_2979_4127 382
2097 3300037471 Ga0395905_0000014 Ga0395905_0000014_47526_48674 382
2098 3300037471 Ga0395905_0004763 Ga0395905_0004763_12436_13584 382
2099 3300037471 Ga0395905_0036820 Ga0395905_0036820_27_1175 382
2100 3300038443 Ga0395901_0000002 Ga0395901_0000002_251749_252897 382
2101 3300038443 Ga0395901_0000059 Ga0395901_0000059_35002_36249 382
2102 3300038443 Ga0395901_0000196 Ga0395901_0000196_3228_4469 382
2103 3300038443 Ga0395901_0001136 Ga0395901_0001136_2581_3729 382
2104 3300038443 Ga0395901_0051148 Ga0395901_0051148_3002_4150 382
2105 3300038443 Ga0395901_0080501 Ga0395901_0080501_967_2115 382
2106 3300038443 Ga0395901_0100401 Ga0395901_0100401_544_1692 382
2107 3300038443 Ga0395901_0144106 Ga0395901_0144106_727_1875 382
2108 3300038443 Ga0395901_0231549 Ga0395901_0231549_593_1741 382
2109 3300038443 Ga0395901_0312047 Ga0395901_0312047_290_1438 382
2110 3300038443 Ga0395901_0329189 Ga0395901_0329189_142_1290 382
2111 3300038705 Ga0237819_00624 Ga0237819_00624_4880_6028 382
2112 3300038726 Ga0400490_12115 Ga0400490_12115_1359_2507 382
2113 3300038741 Ga0400488_44097 Ga0400488_44097_5245_6393 382
2114 3300039062 Ga0400483_095196 Ga0400483_095196_5017_6165 382
2115 3300039093 Ga0400489_45052 Ga0400489_45052_187_1335 382
2116 3300039437 Ga0436365_0182246 Ga0436365_0182246_12137_13285 382
2117 3300039447 Ga0436361_0167540 Ga0436361_0167540_3181_4329 382
2118 3300039447 Ga0436361_0607146 Ga0436361_0607146_3177_4325 382
2119 3300041404 Ga0439436_0025860 Ga0439436_0025860_539_1687 382
2120 3300041405 Ga0439438_001542 Ga0439438_001542_5041_6189 382
2121 3300041405 Ga0439438_001831 Ga0439438_001831_7835_8983 382
2122 3300041405 Ga0439438_004000 Ga0439438_004000_3992_5140 382
2123 3300041405 Ga0439438_004655 Ga0439438_004655_2987_4135 382
2124 3300041405 Ga0439438_008994 Ga0439438_008994_1456_2604 382
2125 3300041407 Ga0439447_000377 Ga0439447_000377_13371_14519 382
2126 3300041407 Ga0439447_001015 Ga0439447_001015_6902_8050 382
2127 3300041407 Ga0439447_003199 Ga0439447_003199_1168_2316 382
2128 3300041411 Ga0439466_0000387 Ga0439466_0000387_3684_4832 382
2129 3300041411 Ga0439466_0003126 Ga0439466_0003126_4763_5911 382
2130 3300041411 Ga0439466_0007551 Ga0439466_0007551_1360_2508 382
2131 3300041452 Ga0451793_1027815 Ga0451793_1027815_4678_5826 382
2132 3300041458 Ga0451798_0992722 Ga0451798_0992722_243_1391 382
2133 3300041507 Ga0451851_0205038 Ga0451851_0205038_457_1605 382
2134 3300042005 Ga0439448_0000023 Ga0439448_0000023_16670_17818 382
2135 3300042006 Ga0439432_000066 Ga0439432_000066_18626_19774 382
2136 3300042006 Ga0439432_003340 Ga0439432_003340_54_1202 382
2137 3300042006 Ga0439432_010182 Ga0439432_010182_1456_2604 382
2138 3300042009 Ga0439451_004420 Ga0439451_004420_504_1652 382
2139 3300042010 Ga0439452_000281 Ga0439452_000281_6922_8070 382
2140 3300042010 Ga0439452_000485 Ga0439452_000485_2962_4110 382
2141 3300042010 Ga0439452_000562 Ga0439452_000562_13267_14415 382
2142 3300042010 Ga0439452_007303 Ga0439452_007303_92_1240 382
2143 3300042010 Ga0439452_014090 Ga0439452_014090_801_1949 382
2144 3300042013 Ga0439456_003411 Ga0439456_003411_723_1871 382
2145 3300042013 Ga0439456_004142 Ga0439456_004142_65_1213 382
2146 3300042013 Ga0439456_009259 Ga0439456_009259_322_1470 382
2147 3300042016 Ga0439463_000226 Ga0439463_000226_9245_10393 382
2148 3300042115 Ga0450911_000382 Ga0450911_000382_5872_7020 382
2149 3300042127 Ga0450890_000729 Ga0450890_000729_36_1184 382
2150 3300042137 Ga0450902_004202 Ga0450902_004202_154_1302 382
2151 3300042145 Ga0450906_000246 Ga0450906_000246_1100_2248 382
2152 3300042145 Ga0450906_007766 Ga0450906_007766_149_1297 382
2153 3300042146 Ga0450907_000139 Ga0450907_000139_6986_8134 382
2154 3300042146 Ga0450907_000683 Ga0450907_000683_851_1999 382
2155 3300042147 Ga0450910_001033 Ga0450910_001033_1973_3121 382
2156 3300042156 Ga0439446_0009091 Ga0439446_0009091_994_2142 382
2157 3300042184 Ga0450908_010027 Ga0450908_010027_285_1433 382
2158 3300042435 Ga0439434_0000870 Ga0439434_0000870_6410_7558 382
2159 3300042438 Ga0439459_0001008 Ga0439459_0001008_501_1649 382
2160 3300044536 Ga0466988_0054010 Ga0466988_0054010_222_1370 382
2161 3300044656 Ga0466969_0001020 Ga0466969_0001020_1373_2521 382
2162 3300044656 Ga0466969_0006226 Ga0466969_0006226_3749_4897 382
2163 3300044656 Ga0466969_0009536 Ga0466969_0009536_3227_4375 382
2164 3300044656 Ga0466969_0011611 Ga0466969_0011611_835_1983 382
2165 3300044658 Ga0466972_0004632 Ga0466972_0004632_2266_3414 382
2166 3300044683 Ga0466965_0004789 Ga0466965_0004789_778_1926 382
2167 3300044683 Ga0466965_0045424 Ga0466965_0045424_541_1689 382
2168 3300044683 Ga0466965_0059186 Ga0466965_0059186_734_1882 382
2169 3300044684 Ga0466966_0000296 Ga0466966_0000296_2249_3439 382
2170 3300044684 Ga0466966_0010340 Ga0466966_0010340_2884_4032 382
2171 3300044684 Ga0466966_0027307 Ga0466966_0027307_842_1990 382
2172 3300044684 Ga0466966_0028286 Ga0466966_0028286_2418_3566 382
2173 3300044684 Ga0466966_0053662 Ga0466966_0053662_148_1296 382
2174 3300044693 Ga0466961_0000272 Ga0466961_0000272_6204_7352 382
2175 3300044693 Ga0466961_0000689 Ga0466961_0000689_10257_11405 382
2176 3300044693 Ga0466961_0000696 Ga0466961_0000696_14397_15587 382
2177 3300044693 Ga0466961_0023239 Ga0466961_0023239_1511_2659 382
2178 3300044693 Ga0466961_0035401 Ga0466961_0035401_1800_2948 382
2179 3300044693 Ga0466961_0093036 Ga0466961_0093036_738_1886 382
2180 3300044693 Ga0466961_0126356 Ga0466961_0126356_170_1318 382
2181 3300044693 Ga0466961_0177226 Ga0466961_0177226_47_1195 382
2182 3300044694 Ga0466963_0000764 Ga0466963_0000764_7812_9002 382
2183 3300044694 Ga0466963_0003166 Ga0466963_0003166_2949_4097 382
2184 3300044694 Ga0466963_0005273 Ga0466963_0005273_6176_7324 382
2185 3300044719 Ga0466971_0002420 Ga0466971_0002420_3809_4957 382
2186 3300044719 Ga0466971_0025461 Ga0466971_0025461_281_1429 382
2187 3300044719 Ga0466971_0040501 Ga0466971_0040501_413_1561 382
2188 3300044765 Ga0466970_0000201 Ga0466970_0000201_4591_5739 382
2189 3300044765 Ga0466970_0003084 Ga0466970_0003084_2220_3368 382
2190 3300044765 Ga0466970_0035691 Ga0466970_0035691_91_1239 382
2191 3300044842 Ga0466957_0004013 Ga0466957_0004013_3914_5062 382
2192 3300044842 Ga0466957_0008763 Ga0466957_0008763_3419_4567 382
2193 3300044901 Ga0466960_0000049 Ga0466960_0000049_21171_22319 382
2194 3300045049 Ga0466959_0000006 Ga0466959_0000006_133851_134999 382
2195 3300045049 Ga0466959_0000958 Ga0466959_0000958_7372_8520 382
2196 3300045049 Ga0466959_0008194 Ga0466959_0008194_2644_3792 382
2197 3300045049 Ga0466959_0012533 Ga0466959_0012533_1261_2409 382
2198 3300045049 Ga0466959_0015829 Ga0466959_0015829_3774_4922 382
2199 3300045049 Ga0466959_0106109 Ga0466959_0106109_670_1860 382
2200 3300045049 Ga0466959_0110959 Ga0466959_0110959_599_1747 382
2201 3300045836 Ga0466958_0001554 Ga0466958_0001554_7104_8252 382
2202 3300045836 Ga0466958_0026070 Ga0466958_0026070_1238_2386 382
2203 3300045836 Ga0466958_0035630 Ga0466958_0035630_1793_2941 382
2204 3300045836 Ga0466958_0038094 Ga0466958_0038094_1306_2454 382
2205 3300046452 Ga0495617_000225 Ga0495617_000225_27324_28472 382
2206 3300046452 Ga0495617_006032 Ga0495617_006032_515_1663 382
2207 3300046452 Ga0495617_011018 Ga0495617_011018_663_1811 382
2208 3300046453 Ga0495627_000083 Ga0495627_000083_89786_90934 382
2209 3300046453 Ga0495627_000451 Ga0495627_000451_28727_29875 382
2210 3300046453 Ga0495627_003061 Ga0495627_003061_327_1475 382
2211 3300046453 Ga0495627_003650 Ga0495627_003650_3466_4614 382
2212 3300046453 Ga0495627_010833 Ga0495627_010833_1162_2310 382
2213 3300046454 Ga0495592_0016556 Ga0495592_0016556_4348_5496 382
2214 3300046454 Ga0495592_0044971 Ga0495592_0044971_773_1921 382
2215 3300046455 Ga0495603_0000802 Ga0495603_0000802_15173_16321 382
2216 3300046455 Ga0495603_0016077 Ga0495603_0016077_264_1412 382
2217 3300046455 Ga0495603_0016648 Ga0495603_0016648_2632_3780 382
2218 3300046457 Ga0495590_0001173 Ga0495590_0001173_7998_9146 382
2219 3300046457 Ga0495590_0001387 Ga0495590_0001387_7607_8755 382
2220 3300046457 Ga0495590_0002501 Ga0495590_0002501_4985_6133 382
2221 3300046457 Ga0495590_0005783 Ga0495590_0005783_3486_4634 382
2222 3300046458 Ga0495591_000037 Ga0495591_000037_26106_27254 382
2223 3300046458 Ga0495591_000648 Ga0495591_000648_5389_6537 382
2224 3300046458 Ga0495591_000960 Ga0495591_000960_15369_16517 382
2225 3300046458 Ga0495591_001346 Ga0495591_001346_3251_4399 382
2226 3300046458 Ga0495591_001506 Ga0495591_001506_7082_8230 382
2227 3300046458 Ga0495591_001756 Ga0495591_001756_1630_2778 382
2228 3300046458 Ga0495591_002170 Ga0495591_002170_5524_6672 382
2229 3300046458 Ga0495591_016885 Ga0495591_016885_833_1981 382
2230 3300046459 Ga0495629_0000105 Ga0495629_0000105_1478_2626 382
2231 3300046459 Ga0495629_0000175 Ga0495629_0000175_50267_51415 382
2232 3300046459 Ga0495629_0002935 Ga0495629_0002935_2806_3954 382
2233 3300046459 Ga0495629_0017828 Ga0495629_0017828_2595_3743 382
2234 3300046459 Ga0495629_0021123 Ga0495629_0021123_1930_3078 382
2235 3300046460 Ga0495638_0000060 Ga0495638_0000060_156437_157585 382
2236 3300046460 Ga0495638_0000116 Ga0495638_0000116_98178_99326 382
2237 3300046460 Ga0495638_0000609 Ga0495638_0000609_30510_31658 382
2238 3300046460 Ga0495638_0004826 Ga0495638_0004826_3931_5079 382
2239 3300046460 Ga0495638_0005276 Ga0495638_0005276_2961_4109 382
2240 3300046460 Ga0495638_0006182 Ga0495638_0006182_4598_5746 382
2241 3300046460 Ga0495638_0006926 Ga0495638_0006926_575_1723 382
2242 3300046460 Ga0495638_0053292 Ga0495638_0053292_764_1912 382
2243 3300046462 Ga0495651_0001526 Ga0495651_0001526_10063_11211 382
2244 3300046462 Ga0495651_0020487 Ga0495651_0020487_1534_2682 382
2245 3300046462 Ga0495651_0034950 Ga0495651_0034950_1274_2422 382
2246 3300046463 Ga0495653_0010928 Ga0495653_0010928_2535_3683 382
2247 3300046463 Ga0495653_0020160 Ga0495653_0020160_2912_4060 382
2248 3300046463 Ga0495653_0023003 Ga0495653_0023003_1748_2896 382
2249 3300046463 Ga0495653_0040343 Ga0495653_0040343_1511_2659 382
2250 3300046463 Ga0495653_0054893 Ga0495653_0054893_727_1875 382
2251 3300046463 Ga0495653_0106040 Ga0495653_0106040_517_1665 382
2252 3300046463 Ga0495653_0209202 Ga0495653_0209202_145_1293 382
2253 3300046471 Ga0495650_0000064 Ga0495650_0000064_32715_33863 382
2254 3300046471 Ga0495650_0000075 Ga0495650_0000075_93386_94534 382
2255 3300046471 Ga0495650_0001163 Ga0495650_0001163_14566_15714 382
2256 3300046471 Ga0495650_0005547 Ga0495650_0005547_3087_4235 382
2257 3300046471 Ga0495650_0005976 Ga0495650_0005976_2883_4031 382
2258 3300046471 Ga0495650_0006437 Ga0495650_0006437_1555_2703 382
2259 3300046471 Ga0495650_0010142 Ga0495650_0010142_1812_2960 382
2260 3300046471 Ga0495650_0010597 Ga0495650_0010597_3817_4965 382
2261 3300046472 Ga0495580_0000125 Ga0495580_0000125_3738_4886 382
2262 3300046472 Ga0495580_0014113 Ga0495580_0014113_1067_2215 382
2263 3300046472 Ga0495580_0058472 Ga0495580_0058472_1047_2303 382
2264 3300046473 Ga0495582_0003710 Ga0495582_0003710_1062_2210 382
2265 3300046473 Ga0495582_0007857 Ga0495582_0007857_2581_3729 382
2266 3300046473 Ga0495582_0051955 Ga0495582_0051955_989_2137 382
2267 3300046474 Ga0495605_0000036 Ga0495605_0000036_6984_8132 382
2268 3300046474 Ga0495605_0000745 Ga0495605_0000745_9858_11006 382
2269 3300046474 Ga0495605_0000849 Ga0495605_0000849_14327_15475 382
2270 3300046474 Ga0495605_0001253 Ga0495605_0001253_11271_12419 382
2271 3300046474 Ga0495605_0001795 Ga0495605_0001795_11999_13147 382
2272 3300046474 Ga0495605_0002427 Ga0495605_0002427_7794_8942 382
2273 3300046474 Ga0495605_0009484 Ga0495605_0009484_3261_4409 382
2274 3300046474 Ga0495605_0013476 Ga0495605_0013476_1735_2883 382
2275 3300046474 Ga0495605_0013595 Ga0495605_0013595_397_1545 382
2276 3300046474 Ga0495605_0019669 Ga0495605_0019669_1615_2763 382
2277 3300046474 Ga0495605_0020667 Ga0495605_0020667_1682_2830 382
2278 3300046475 Ga0495639_0000158 Ga0495639_0000158_28779_29927 382
2279 3300046476 Ga0495662_0003246 Ga0495662_0003246_6894_8042 382
2280 3300046477 Ga0495664_0006406 Ga0495664_0006406_1471_2619 382
2281 3300046477 Ga0495664_0081859 Ga0495664_0081859_432_1580 382
2282 3300046477 Ga0495664_0107807 Ga0495664_0107807_518_1666 382
2283 3300046491 Ga0495584_0019260 Ga0495584_0019260_728_1876 382
2284 3300046491 Ga0495584_0108722 Ga0495584_0108722_157_1305 382
2285 3300046491 Ga0495584_0141953 Ga0495584_0141953_56_1204 382
2286 3300046492 Ga0495585_0002523 Ga0495585_0002523_6792_7940 382
2287 3300046492 Ga0495585_0013417 Ga0495585_0013417_3247_4395 382
2288 3300046492 Ga0495585_0035355 Ga0495585_0035355_1178_2326 382
2289 3300046492 Ga0495585_0037360 Ga0495585_0037360_660_1808 382
2290 3300046499 Ga0495594_0001462 Ga0495594_0001462_10363_11511 382
2291 3300046499 Ga0495594_0001898 Ga0495594_0001898_2756_3904 382
2292 3300046499 Ga0495594_0002321 Ga0495594_0002321_1192_2340 382
2293 3300046499 Ga0495594_0005955 Ga0495594_0005955_4960_6108 382
2294 3300046500 Ga0495596_0000488 Ga0495596_0000488_5213_6361 382
2295 3300046500 Ga0495596_0003157 Ga0495596_0003157_5701_6849 382
2296 3300046500 Ga0495596_0022504 Ga0495596_0022504_357_1505 382
2297 3300046501 Ga0495607_0000860 Ga0495607_0000860_20361_21509 382
2298 3300046501 Ga0495607_0001076 Ga0495607_0001076_12943_14091 382
2299 3300046501 Ga0495607_0001283 Ga0495607_0001283_14239_15387 382
2300 3300046501 Ga0495607_0001388 Ga0495607_0001388_4997_6145 382
2301 3300046501 Ga0495607_0001475 Ga0495607_0001475_17389_18537 382
2302 3300046501 Ga0495607_0004512 Ga0495607_0004512_208_1356 382
2303 3300046501 Ga0495607_0009221 Ga0495607_0009221_5106_6254 382
2304 3300046501 Ga0495607_0021322 Ga0495607_0021322_2284_3432 382
2305 3300046501 Ga0495607_0027774 Ga0495607_0027774_2169_3317 382
2306 3300046501 Ga0495607_0038072 Ga0495607_0038072_785_1933 382
2307 3300046501 Ga0495607_0059014 Ga0495607_0059014_373_1521 382
2308 3300046506 Ga0495583_0000028 Ga0495583_0000028_20232_21380 382
2309 3300046506 Ga0495583_0001522 Ga0495583_0001522_17227_18375 382
2310 3300046506 Ga0495583_0001875 Ga0495583_0001875_18278_19426 382
2311 3300046506 Ga0495583_0003346 Ga0495583_0003346_2878_4026 382
2312 3300046506 Ga0495583_0003399 Ga0495583_0003399_3799_4947 382
2313 3300046506 Ga0495583_0005967 Ga0495583_0005967_3309_4457 382
2314 3300046506 Ga0495583_0007570 Ga0495583_0007570_5590_6738 382
2315 3300046506 Ga0495583_0014990 Ga0495583_0014990_1661_2917 382
2316 3300046506 Ga0495583_0021529 Ga0495583_0021529_1897_3045 382
2317 3300046507 Ga0495606_0000042 Ga0495606_0000042_209757_210905 382
2318 3300046507 Ga0495606_0000094 Ga0495606_0000094_122835_123983 382
2319 3300046507 Ga0495606_0000415 Ga0495606_0000415_6750_7898 382
2320 3300046507 Ga0495606_0004342 Ga0495606_0004342_5467_6615 382
2321 3300046507 Ga0495606_0010458 Ga0495606_0010458_1838_2986 382
2322 3300046507 Ga0495606_0017134 Ga0495606_0017134_2643_3791 382
2323 3300046507 Ga0495606_0024275 Ga0495606_0024275_1667_2815 382
2324 3300046507 Ga0495606_0031645 Ga0495606_0031645_1801_2949 382
2325 3300046507 Ga0495606_0047270 Ga0495606_0047270_1522_2670 382
2326 3300046507 Ga0495606_0052374 Ga0495606_0052374_908_2056 382
2327 3300046507 Ga0495606_0092027 Ga0495606_0092027_146_1294 382
2328 3300046507 Ga0495606_0101378 Ga0495606_0101378_72_1220 382
2329 3300046507 Ga0495606_0121684 Ga0495606_0121684_349_1497 382
2330 3300046511 Ga0495608_0002301 Ga0495608_0002301_11942_13090 382
2331 3300046511 Ga0495608_0049734 Ga0495608_0049734_1310_2458 382
2332 3300046511 Ga0495608_0128929 Ga0495608_0128929_165_1313 382
2333 3300046512 Ga0495610_0001773 Ga0495610_0001773_12476_13624 382
2334 3300046512 Ga0495610_0002926 Ga0495610_0002926_12294_13442 382
2335 3300046512 Ga0495610_0006406 Ga0495610_0006406_5426_6574 382
2336 3300046512 Ga0495610_0007142 Ga0495610_0007142_4591_5739 382
2337 3300046512 Ga0495610_0009768 Ga0495610_0009768_2210_3358 382
2338 3300046512 Ga0495610_0011761 Ga0495610_0011761_816_1964 382
2339 3300046512 Ga0495610_0021121 Ga0495610_0021121_1521_2669 382
2340 3300046512 Ga0495610_0026266 Ga0495610_0026266_195_1343 382
2341 3300046513 Ga0495616_0001328 Ga0495616_0001328_10542_11690 382
2342 3300046513 Ga0495616_0003641 Ga0495616_0003641_3425_4573 382
2343 3300046513 Ga0495616_0024526 Ga0495616_0024526_1115_2371 382
2344 3300046514 Ga0495618_0005830 Ga0495618_0005830_4476_5624 382
2345 3300046514 Ga0495618_0006411 Ga0495618_0006411_3975_5123 382
2346 3300046515 Ga0495620_0000322 Ga0495620_0000322_7372_8520 382
2347 3300046515 Ga0495620_0000370 Ga0495620_0000370_23697_24845 382
2348 3300046515 Ga0495620_0000712 Ga0495620_0000712_15248_16396 382
2349 3300046515 Ga0495620_0004434 Ga0495620_0004434_1743_2891 382
2350 3300046515 Ga0495620_0006667 Ga0495620_0006667_3589_4737 382
2351 3300046515 Ga0495620_0012891 Ga0495620_0012891_2075_3223 382
2352 3300046515 Ga0495620_0028687 Ga0495620_0028687_76_1224 382
2353 3300046515 Ga0495620_0039355 Ga0495620_0039355_891_2039 382
2354 3300046515 Ga0495620_0039358 Ga0495620_0039358_478_1626 382
2355 3300046516 Ga0495628_0010471 Ga0495628_0010471_1453_2601 382
2356 3300046516 Ga0495628_0019455 Ga0495628_0019455_1636_2784 382
2357 3300046516 Ga0495628_0023111 Ga0495628_0023111_3873_5021 382
2358 3300046516 Ga0495628_0053416 Ga0495628_0053416_149_1297 382
2359 3300046517 Ga0495630_0007696 Ga0495630_0007696_3776_4924 382
2360 3300046517 Ga0495630_0120160 Ga0495630_0120160_244_1392 382
2361 3300046517 Ga0495630_0218900 Ga0495630_0218900_226_1374 382
2362 3300046518 Ga0495631_0001689 Ga0495631_0001689_1136_2284 382
2363 3300046518 Ga0495631_0005206 Ga0495631_0005206_5026_6174 382
2364 3300046519 Ga0495632_0000360 Ga0495632_0000360_40431_41579 382
2365 3300046519 Ga0495632_0000839 Ga0495632_0000839_20655_21803 382
2366 3300046519 Ga0495632_0007029 Ga0495632_0007029_3568_4716 382
2367 3300046519 Ga0495632_0017470 Ga0495632_0017470_2190_3338 382
2368 3300046519 Ga0495632_0021778 Ga0495632_0021778_1187_2335 382
2369 3300046519 Ga0495632_0027352 Ga0495632_0027352_267_1415 382
2370 3300046519 Ga0495632_0081507 Ga0495632_0081507_120_1268 382
2371 3300046519 Ga0495632_0089107 Ga0495632_0089107_243_1391 382
2372 3300046520 Ga0495637_0000491 Ga0495637_0000491_22672_23820 382
2373 3300046520 Ga0495637_0000518 Ga0495637_0000518_6521_7669 382
2374 3300046520 Ga0495637_0001199 Ga0495637_0001199_9400_10548 382
2375 3300046520 Ga0495637_0002120 Ga0495637_0002120_4577_5725 382
2376 3300046520 Ga0495637_0002498 Ga0495637_0002498_1821_2969 382
2377 3300046520 Ga0495637_0006632 Ga0495637_0006632_1143_2291 382
2378 3300046520 Ga0495637_0020789 Ga0495637_0020789_542_1690 382
2379 3300046520 Ga0495637_0038833 Ga0495637_0038833_773_1921 382
2380 3300046522 Ga0495643_0000086 Ga0495643_0000086_99422_100570 382
2381 3300046522 Ga0495643_0001985 Ga0495643_0001985_7314_8462 382
2382 3300046522 Ga0495643_0004073 Ga0495643_0004073_7420_8568 382
2383 3300046522 Ga0495643_0035642 Ga0495643_0035642_1550_2698 382
2384 3300046522 Ga0495643_0070422 Ga0495643_0070422_58_1206 382
2385 3300046523 Ga0495644_0000023 Ga0495644_0000023_39996_41144 382
2386 3300046523 Ga0495644_0003319 Ga0495644_0003319_5069_6217 382
2387 3300046523 Ga0495644_0022555 Ga0495644_0022555_1094_2242 382
2388 3300046524 Ga0495648_0009523 Ga0495648_0009523_4999_6147 382
2389 3300046524 Ga0495648_0017985 Ga0495648_0017985_1446_2594 382
2390 3300046524 Ga0495648_0024067 Ga0495648_0024067_2683_3831 382
2391 3300046524 Ga0495648_0131871 Ga0495648_0131871_21_1169 382
2392 3300046526 Ga0495666_0001050 Ga0495666_0001050_11036_12184 382
2393 3300046526 Ga0495666_0004226 Ga0495666_0004226_3715_4863 382
2394 3300046526 Ga0495666_0012026 Ga0495666_0012026_2102_3250 382
2395 3300046526 Ga0495666_0015904 Ga0495666_0015904_1542_2690 382
2396 3300046526 Ga0495666_0016571 Ga0495666_0016571_1930_3078 382
2397 3300046526 Ga0495666_0104325 Ga0495666_0104325_97_1245 382
2398 3300046528 Ga0495642_0001013 Ga0495642_0001013_5041_6189 382
2399 3300046528 Ga0495642_0001683 Ga0495642_0001683_1605_2753 382
2400 3300046529 Ga0495652_0001674 Ga0495652_0001674_2218_3366 382
2401 3300046529 Ga0495652_0003383 Ga0495652_0003383_8463_9611 382
2402 3300046529 Ga0495652_0017996 Ga0495652_0017996_4639_5787 382
2403 3300046529 Ga0495652_0042949 Ga0495652_0042949_1671_2819 382
2404 3300046529 Ga0495652_0104061 Ga0495652_0104061_990_2138 382
2405 3300046530 Ga0495654_0001499 Ga0495654_0001499_9981_11129 382
2406 3300046530 Ga0495654_0004083 Ga0495654_0004083_3807_4955 382
2407 3300046530 Ga0495654_0007063 Ga0495654_0007063_1248_2396 382
2408 3300046530 Ga0495654_0009795 Ga0495654_0009795_816_1964 382
2409 3300046530 Ga0495654_0010614 Ga0495654_0010614_3837_4985 382
2410 3300046530 Ga0495654_0018508 Ga0495654_0018508_571_1719 382
2411 3300046530 Ga0495654_0023907 Ga0495654_0023907_1603_2751 382
2412 3300046530 Ga0495654_0057801 Ga0495654_0057801_114_1262 382
2413 3300046531 Ga0495665_0000875 Ga0495665_0000875_12374_13522 382
2414 3300046531 Ga0495665_0007079 Ga0495665_0007079_3186_4334 382
2415 3300046531 Ga0495665_0015355 Ga0495665_0015355_2308_3456 382
2416 3300046533 Ga0495640_0034402 Ga0495640_0034402_371_1519 382
2417 3300046533 Ga0495640_0123908 Ga0495640_0123908_11_1159 382
2418 3300046535 Ga0495586_0000896 Ga0495586_0000896_2998_4146 382
2419 3300046536 Ga0495587_0004691 Ga0495587_0004691_5051_6199 382
2420 3300046536 Ga0495587_0014198 Ga0495587_0014198_76_1224 382
2421 3300046536 Ga0495587_0072568 Ga0495587_0072568_593_1741 382
2422 3300046538 Ga0495609_0000115 Ga0495609_0000115_6984_8132 382
2423 3300046538 Ga0495609_0000248 Ga0495609_0000248_27947_29095 382
2424 3300046538 Ga0495609_0000395 Ga0495609_0000395_19598_20746 382
2425 3300046538 Ga0495609_0088505 Ga0495609_0088505_77_1282 382
2426 3300046539 Ga0495621_0026915 Ga0495621_0026915_57_1205 382
2427 3300046542 Ga0495597_0001034 Ga0495597_0001034_16561_17709 382
2428 3300046542 Ga0495597_0002749 Ga0495597_0002749_2129_3277 382
2429 3300046542 Ga0495597_0003571 Ga0495597_0003571_32_1180 382
2430 3300046543 Ga0495645_0002052 Ga0495645_0002052_11197_12345 382
2431 3300046543 Ga0495645_0002469 Ga0495645_0002469_1565_2713 382
2432 3300046543 Ga0495645_0015033 Ga0495645_0015033_3101_4249 382
2433 3300046543 Ga0495645_0041759 Ga0495645_0041759_1588_2736 382
2434 3300046543 Ga0495645_0096052 Ga0495645_0096052_32_1180 382
2435 3300046557 Ga0495622_0000575 Ga0495622_0000575_20102_21250 382
2436 3300046557 Ga0495622_0001521 Ga0495622_0001521_1345_2493 382
2437 3300046557 Ga0495622_0003706 Ga0495622_0003706_4861_6009 382
2438 3300046557 Ga0495622_0015667 Ga0495622_0015667_15_1163 382
2439 3300046558 Ga0495633_0001190 Ga0495633_0001190_16775_17923 382
2440 3300046558 Ga0495633_0001693 Ga0495633_0001693_7549_8697 382
2441 3300046558 Ga0495633_0008768 Ga0495633_0008768_1450_2598 382
2442 3300046616 Ga0495668_0018071 Ga0495668_0018071_2592_3740 382
2443 3300046616 Ga0495668_0063825 Ga0495668_0063825_415_1563 382
2444 3300046642 Ga0495634_0005493 Ga0495634_0005493_7125_8273 382
2445 3300046642 Ga0495634_0019337 Ga0495634_0019337_1603_2751 382
2446 3300046642 Ga0495634_0042765 Ga0495634_0042765_935_2083 382
2447 3300046648 Ga0495611_0000736 Ga0495611_0000736_14533_15681 382
2448 3300046648 Ga0495611_0000932 Ga0495611_0000932_5283_6431 382
2449 3300046648 Ga0495611_0004344 Ga0495611_0004344_727_1875 382
2450 3300046648 Ga0495611_0047326 Ga0495611_0047326_124_1272 382
2451 3300046660 Ga0495625_0000672 Ga0495625_0000672_26780_27928 382
2452 3300046660 Ga0495625_0001298 Ga0495625_0001298_15538_16686 382
2453 3300046660 Ga0495625_0003330 Ga0495625_0003330_8127_9275 382
2454 3300046660 Ga0495625_0007862 Ga0495625_0007862_5609_6757 382
2455 3300046660 Ga0495625_0010613 Ga0495625_0010613_3529_4677 382
2456 3300046660 Ga0495625_0013918 Ga0495625_0013918_1351_2499 382
2457 3300046660 Ga0495625_0018819 Ga0495625_0018819_2452_3600 382
2458 3300046660 Ga0495625_0020283 Ga0495625_0020283_1146_2294 382
2459 3300046660 Ga0495625_0024901 Ga0495625_0024901_1347_2495 382
2460 3300046660 Ga0495625_0036436 Ga0495625_0036436_889_2037 382
2461 3300046660 Ga0495625_0051875 Ga0495625_0051875_198_1346 382
2462 3300046660 Ga0495625_0065430 Ga0495625_0065430_68_1216 382
2463 3300046663 Ga0495635_0027587 Ga0495635_0027587_338_1486 382
2464 3300046663 Ga0495635_0093110 Ga0495635_0093110_140_1288 382
2465 3300046663 Ga0495635_0224942 Ga0495635_0224942_30_1178 382
2466 3300046664 Ga0495659_0000652 Ga0495659_0000652_10209_11357 382
2467 3300046665 Ga0495661_0000116 Ga0495661_0000116_88715_89863 382
2468 3300046665 Ga0495661_0000205 Ga0495661_0000205_14523_15671 382
2469 3300046665 Ga0495661_0000437 Ga0495661_0000437_19782_20930 382
2470 3300046665 Ga0495661_0000685 Ga0495661_0000685_7349_8497 382
2471 3300046665 Ga0495661_0001817 Ga0495661_0001817_11019_12167 382
2472 3300046665 Ga0495661_0017755 Ga0495661_0017755_2218_3366 382
2473 3300046665 Ga0495661_0017872 Ga0495661_0017872_3131_4279 382
2474 3300046665 Ga0495661_0020307 Ga0495661_0020307_1666_2814 382
2475 3300046665 Ga0495661_0024154 Ga0495661_0024154_2210_3358 382
2476 3300046674 Ga0495588_0077383 Ga0495588_0077383_569_1717 382
2477 3300046678 Ga0495599_0018977 Ga0495599_0018977_1957_3105 382
2478 3300046678 Ga0495599_0065919 Ga0495599_0065919_231_1379 382
2479 3300046678 Ga0495599_0198232 Ga0495599_0198232_39_1187 382
2480 3300046679 Ga0495623_0006272 Ga0495623_0006272_6277_7467 382
2481 3300046679 Ga0495623_0011011 Ga0495623_0011011_3108_4256 382
2482 3300046679 Ga0495623_0025627 Ga0495623_0025627_20_1168 382
2483 3300046679 Ga0495623_0156254 Ga0495623_0156254_14_1162 382
2484 3300046680 Ga0495646_0011260 Ga0495646_0011260_1393_2541 382
2485 3300046680 Ga0495646_0012311 Ga0495646_0012311_2563_3711 382
2486 3300046680 Ga0495646_0023815 Ga0495646_0023815_1126_2274 382
2487 3300046680 Ga0495646_0031113 Ga0495646_0031113_152_1300 382
2488 3300046680 Ga0495646_0044896 Ga0495646_0044896_748_1896 382
2489 3300046684 Ga0495669_0001481 Ga0495669_0001481_7824_8972 382
2490 3300046684 Ga0495669_0024735 Ga0495669_0024735_270_1418 382
2491 3300046689 Ga0495613_0008243 Ga0495613_0008243_4909_6057 382
2492 3300046689 Ga0495613_0015970 Ga0495613_0015970_2261_3409 382
2493 3300046690 Ga0495624_0005166 Ga0495624_0005166_5439_6587 382
2494 3300046690 Ga0495624_0006441 Ga0495624_0006441_2987_4135 382
2495 3300046690 Ga0495624_0008292 Ga0495624_0008292_5857_7005 382
2496 3300046690 Ga0495624_0008471 Ga0495624_0008471_871_2019 382
2497 3300046690 Ga0495624_0010611 Ga0495624_0010611_3797_4945 382
2498 3300046690 Ga0495624_0021149 Ga0495624_0021149_2984_4132 382
2499 3300046691 Ga0495670_0001795 Ga0495670_0001795_4426_5574 382
2500 3300046691 Ga0495670_0003146 Ga0495670_0003146_5018_6166 382
2501 3300046691 Ga0495670_0007244 Ga0495670_0007244_2063_3211 382
2502 3300046691 Ga0495670_0020115 Ga0495670_0020115_1768_2916 382
2503 3300046691 Ga0495670_0082037 Ga0495670_0082037_117_1265 382
2504 3300046692 Ga0495671_0001279 Ga0495671_0001279_9986_11134 382
2505 3300046692 Ga0495671_0003674 Ga0495671_0003674_495_1643 382
2506 3300046692 Ga0495671_0004465 Ga0495671_0004465_6661_7809 382
2507 3300046692 Ga0495671_0004798 Ga0495671_0004798_1711_2859 382
2508 3300046692 Ga0495671_0004983 Ga0495671_0004983_2449_3597 382
2509 3300046692 Ga0495671_0007822 Ga0495671_0007822_3219_4367 382
2510 3300046692 Ga0495671_0010802 Ga0495671_0010802_1162_2310 382
2511 3300046692 Ga0495671_0011402 Ga0495671_0011402_2129_3277 382
2512 3300046692 Ga0495671_0021625 Ga0495671_0021625_1932_3080 382
2513 3300046692 Ga0495671_0048111 Ga0495671_0048111_783_1931 382
2514 3300046694 Ga0495649_0000813 Ga0495649_0000813_20097_21245 382
2515 3300046694 Ga0495649_0000958 Ga0495649_0000958_19360_20508 382
2516 3300046694 Ga0495649_0001962 Ga0495649_0001962_11835_12983 382
2517 3300046694 Ga0495649_0002855 Ga0495649_0002855_1909_3057 382
2518 3300046694 Ga0495649_0022427 Ga0495649_0022427_585_1733 382
2519 3300046694 Ga0495649_0023047 Ga0495649_0023047_1084_2232 382
2520 3300046694 Ga0495649_0030996 Ga0495649_0030996_495_1643 382
2521 3300046694 Ga0495649_0060976 Ga0495649_0060976_579_1727 382
2522 3300046794 Ga0495589_0000603 Ga0495589_0000603_16995_18143 382
2523 3300046794 Ga0495589_0001311 Ga0495589_0001311_13231_14379 382
2524 3300046794 Ga0495589_0002748 Ga0495589_0002748_1077_2225 382
2525 3300046794 Ga0495589_0003822 Ga0495589_0003822_583_1731 382
2526 3300046794 Ga0495589_0006874 Ga0495589_0006874_3843_4991 382
2527 3300046794 Ga0495589_0028661 Ga0495589_0028661_932_2080 382
2528 3300046794 Ga0495589_0050533 Ga0495589_0050533_535_1683 382
2529 3300046809 Ga0495600_0002250 Ga0495600_0002250_142_1290 382
2530 3300046809 Ga0495600_0005056 Ga0495600_0005056_3141_4289 382
2531 3300046809 Ga0495600_0012956 Ga0495600_0012956_1900_3048 382
2532 3300046809 Ga0495600_0027878 Ga0495600_0027878_2076_3224 382
2533 3300046810 Ga0495660_0001767 Ga0495660_0001767_6976_8124 382
2534 3300046810 Ga0495660_0002709 Ga0495660_0002709_3055_4203 382
2535 3300046810 Ga0495660_0003160 Ga0495660_0003160_2048_3196 382
2536 3300046810 Ga0495660_0011688 Ga0495660_0011688_3193_4341 382
2537 3300046810 Ga0495660_0016648 Ga0495660_0016648_920_2068 382
2538 3300046810 Ga0495660_0046471 Ga0495660_0046471_866_2014 382
2539 3300046810 Ga0495660_0051902 Ga0495660_0051902_221_1369 382
2540 3300046810 Ga0495660_0092925 Ga0495660_0092925_152_1315 382
2541 3300047315 Ga0495581_0001650 Ga0495581_0001650_4468_5616 382
2542 3300047315 Ga0495581_0021920 Ga0495581_0021920_525_1673 382
2543 3300047315 Ga0495581_0023133 Ga0495581_0023133_674_1822 382
2544 3300047315 Ga0495581_0023908 Ga0495581_0023908_86_1234 382
2545 3300047315 Ga0495581_0055110 Ga0495581_0055110_867_2015 382
2546 3300047317 Ga0495604_0002992 Ga0495604_0002992_2440_3588 382
2547 3300047317 Ga0495604_0008904 Ga0495604_0008904_6644_7792 382
2548 3300047317 Ga0495604_0012390 Ga0495604_0012390_491_1639 382
2549 3300047317 Ga0495604_0015148 Ga0495604_0015148_3039_4187 382
2550 3300047317 Ga0495604_0096008 Ga0495604_0096008_149_1297 382
2551 3300047317 Ga0495604_0119378 Ga0495604_0119378_116_1264 382
2552 3300047318 Ga0495636_0006842 Ga0495636_0006842_1361_2509 382
2553 3300047319 Ga0495674_0009541 Ga0495674_0009541_4779_5927 382
2554 3300047319 Ga0495674_0020257 Ga0495674_0020257_948_2096 382
2555 3300047319 Ga0495674_0023860 Ga0495674_0023860_3595_4743 382
2556 3300047319 Ga0495674_0038522 Ga0495674_0038522_2865_4013 382
2557 3300047320 Ga0495672_0000006 Ga0495672_0000006_315860_317008 382
2558 3300047320 Ga0495672_0001599 Ga0495672_0001599_1613_2761 382
2559 3300047320 Ga0495672_0002422 Ga0495672_0002422_1734_2882 382
2560 3300047320 Ga0495672_0003165 Ga0495672_0003165_8497_9645 382
2561 3300047320 Ga0495672_0003648 Ga0495672_0003648_8604_9752 382
2562 3300047320 Ga0495672_0005788 Ga0495672_0005788_1432_2580 382
2563 3300047320 Ga0495672_0007469 Ga0495672_0007469_896_2044 382
2564 3300047320 Ga0495672_0007769 Ga0495672_0007769_5535_6683 382
2565 3300047320 Ga0495672_0008206 Ga0495672_0008206_5133_6281 382
2566 3300047320 Ga0495672_0012356 Ga0495672_0012356_1170_2318 382
2567 3300047320 Ga0495672_0027158 Ga0495672_0027158_829_1977 382
2568 3300047320 Ga0495672_0029446 Ga0495672_0029446_540_1688 382
2569 3300047320 Ga0495672_0029976 Ga0495672_0029976_548_1696 382
2570 3300047320 Ga0495672_0047493 Ga0495672_0047493_629_1777 382
2571 3300047321 Ga0495676_0000171 Ga0495676_0000171_22645_23793 382
2572 3300047321 Ga0495676_0001994 Ga0495676_0001994_5696_6844 382
2573 3300047321 Ga0495676_0014357 Ga0495676_0014357_4595_5743 382
2574 3300047321 Ga0495676_0021499 Ga0495676_0021499_2440_3588 382
2575 3300047321 Ga0495676_0139918 Ga0495676_0139918_234_1382 382
2576 3300047321 Ga0495676_0207857 Ga0495676_0207857_160_1308 382
2577 3300047322 Ga0495680_0021825 Ga0495680_0021825_182_1330 382
2578 3300047322 Ga0495680_0046863 Ga0495680_0046863_2106_3254 382
2579 3300047322 Ga0495680_0241858 Ga0495680_0241858_17_1207 382
2580 3300047323 Ga0495683_0000122 Ga0495683_0000122_69298_70446 382
2581 3300047323 Ga0495683_0000507 Ga0495683_0000507_6985_8133 382
2582 3300047323 Ga0495683_0002187 Ga0495683_0002187_5813_6961 382
2583 3300047323 Ga0495683_0004452 Ga0495683_0004452_1657_2805 382
2584 3300047323 Ga0495683_0009029 Ga0495683_0009029_1552_2700 382
2585 3300047323 Ga0495683_0009650 Ga0495683_0009650_15_1163 382
2586 3300047323 Ga0495683_0019910 Ga0495683_0019910_429_1577 382
2587 3300047323 Ga0495683_0033374 Ga0495683_0033374_879_2027 382
2588 3300047323 Ga0495683_0063995 Ga0495683_0063995_401_1657 382
2589 3300047323 Ga0495683_0088161 Ga0495683_0088161_152_1300 382
2590 3300047443 Ga0495687_000011 Ga0495687_000011_299772_300920 382
2591 3300047443 Ga0495687_006192 Ga0495687_006192_2359_3507 382
2592 3300047443 Ga0495687_014652 Ga0495687_014652_2349_3497 382
2593 3300047443 Ga0495687_025890 Ga0495687_025890_1220_2368 382
2594 3300047444 Ga0495675_0004539 Ga0495675_0004539_4805_5953 382
2595 3300047444 Ga0495675_0010416 Ga0495675_0010416_2388_3536 382
2596 3300047444 Ga0495675_0028822 Ga0495675_0028822_24_1172 382
2597 3300047444 Ga0495675_0039223 Ga0495675_0039223_1765_2913 382
2598 3300047446 Ga0495679_000119 Ga0495679_000119_49200_50348 382
2599 3300047446 Ga0495679_000471 Ga0495679_000471_3797_4945 382
2600 3300047446 Ga0495679_001597 Ga0495679_001597_10475_11623 382
2601 3300047446 Ga0495679_010672 Ga0495679_010672_1641_2789 382
2602 3300047469 Ga0495673_0000995 Ga0495673_0000995_5112_6260 382
2603 3300047469 Ga0495673_0002146 Ga0495673_0002146_9969_11117 382
2604 3300047469 Ga0495673_0003396 Ga0495673_0003396_3619_4767 382
2605 3300047469 Ga0495673_0004684 Ga0495673_0004684_3738_4886 382
2606 3300047469 Ga0495673_0009152 Ga0495673_0009152_3153_4301 382
2607 3300047469 Ga0495673_0021426 Ga0495673_0021426_898_2046 382
2608 3300047469 Ga0495673_0022515 Ga0495673_0022515_266_1414 382
2609 3300047469 Ga0495673_0032777 Ga0495673_0032777_760_1908 382
2610 3300047469 Ga0495673_0033536 Ga0495673_0033536_1059_2207 382
2611 3300047469 Ga0495673_0053657 Ga0495673_0053657_385_1533 382
2612 3300047469 Ga0495673_0078241 Ga0495673_0078241_195_1343 382
2613 3300047470 Ga0495681_0000588 Ga0495681_0000588_1363_2511 382
2614 3300047470 Ga0495681_0001141 Ga0495681_0001141_56_1204 382
2615 3300047470 Ga0495681_0004351 Ga0495681_0004351_4102_5250 382
2616 3300047470 Ga0495681_0005242 Ga0495681_0005242_761_1909 382
2617 3300047470 Ga0495681_0007039 Ga0495681_0007039_5793_6941 382
2618 3300047470 Ga0495681_0008829 Ga0495681_0008829_4902_6050 382
2619 3300047471 Ga0495684_0027409 Ga0495684_0027409_2801_3991 382
2620 3300047472 Ga0495686_0000014 Ga0495686_0000014_441433_442581 382
2621 3300047472 Ga0495686_0000106 Ga0495686_0000106_103236_104384 382
2622 3300047472 Ga0495686_0002286 Ga0495686_0002286_16080_17228 382
2623 3300047472 Ga0495686_0005326 Ga0495686_0005326_4325_5473 382
2624 3300047472 Ga0495686_0013497 Ga0495686_0013497_2055_3212 382
2625 3300047472 Ga0495686_0027334 Ga0495686_0027334_1633_2781 382
2626 3300047472 Ga0495686_0052895 Ga0495686_0052895_532_1680 382
2627 3300047673 Ga0495593_0002465 Ga0495593_0002465_1238_2386 382
2628 3300047673 Ga0495593_0005528 Ga0495593_0005528_5822_7012 382
2629 3300047673 Ga0495593_0005604 Ga0495593_0005604_4064_5212 382
2630 3300047673 Ga0495593_0010719 Ga0495593_0010719_1285_2433 382
2631 3300047673 Ga0495593_0022884 Ga0495593_0022884_923_2071 382
2632 3300048088 Ga0495602_0026550 Ga0495602_0026550_2865_4013 382
2633 3300048088 Ga0495602_0035542 Ga0495602_0035542_2358_3506 382
2634 3300048088 Ga0495602_0106812 Ga0495602_0106812_720_1868 382
2635 3300048089 Ga0495614_0004980 Ga0495614_0004980_1851_2999 382
2636 3300048089 Ga0495614_0006551 Ga0495614_0006551_2348_3496 382
2637 3300048091 Ga0495626_0000123 Ga0495626_0000123_23165_24313 382
2638 3300048091 Ga0495626_0000721 Ga0495626_0000721_4770_5918 382
2639 3300048091 Ga0495626_0001593 Ga0495626_0001593_10807_11955 382
2640 3300048091 Ga0495626_0002867 Ga0495626_0002867_5113_6261 382
2641 3300048091 Ga0495626_0003467 Ga0495626_0003467_7321_8469 382
2642 3300048091 Ga0495626_0009762 Ga0495626_0009762_1631_2779 382
2643 3300048091 Ga0495626_0012178 Ga0495626_0012178_1726_2874 382
2644 3300048091 Ga0495626_0015529 Ga0495626_0015529_2037_3185 382
2645 3300048903 Ga0496100_0024102 Ga0496100_0024102_2375_3523 382
2646 3300048905 Ga0496102_0004120 Ga0496102_0004120_5107_6255 382
2647 3300048905 Ga0496102_0240363 Ga0496102_0240363_215_1363 382
2648 3300048906 Ga0496103_0208661 Ga0496103_0208661_90_1238 382
2649 3300048907 Ga0496104_0074107 Ga0496104_0074107_262_1518 382
2650 3300048908 Ga0496105_0012365 Ga0496105_0012365_2652_3800 382
2651 3300048908 Ga0496105_0175230 Ga0496105_0175230_513_1661 382
2652 3300048909 Ga0496106_0000026 Ga0496106_0000026_36330_37478 382
2653 3300048909 Ga0496106_0123578 Ga0496106_0123578_323_1471 382
2654 3300048910 Ga0496107_0179955 Ga0496107_0179955_171_1319 382
2655 3300048912 Ga0496109_0051688 Ga0496109_0051688_2575_3723 382
2656 3300048913 Ga0496110_0000191 Ga0496110_0000191_22565_23761 382
2657 3300048915 Ga0496112_0284761 Ga0496112_0284761_179_1354 382
2658 3300048916 Ga0496113_0009261 Ga0496113_0009261_4342_5598 382
2659 3300048916 Ga0496113_0021787 Ga0496113_0021787_2167_3315 382
2660 3300048916 Ga0496113_0065923 Ga0496113_0065923_1248_2396 382
2661 3300048916 Ga0496113_0088449 Ga0496113_0088449_587_1735 382
2662 3300048916 Ga0496113_0114603 Ga0496113_0114603_42_1238 382
2663 3300048917 Ga0496114_0095111 Ga0496114_0095111_746_1894 382
2664 3300048918 Ga0496115_0000272 Ga0496115_0000272_6550_7698 382
2665 3300048918 Ga0496115_0000603 Ga0496115_0000603_5862_7010 382
2666 3300048918 Ga0496115_0060115 Ga0496115_0060115_1720_2868 382
2667 3300048919 Ga0496116_0000194 Ga0496116_0000194_66890_68038 382
2668 3300048919 Ga0496116_0001102 Ga0496116_0001102_25228_26376 382
2669 3300048919 Ga0496116_0001261 Ga0496116_0001261_5118_6266 382
2670 3300048919 Ga0496116_0008312 Ga0496116_0008312_6546_7694 382
2671 3300048919 Ga0496116_0045898 Ga0496116_0045898_1325_2473 382
2672 3300048919 Ga0496116_0047289 Ga0496116_0047289_1677_2825 382
2673 3300048920 Ga0496117_0001360 Ga0496117_0001360_24182_25330 382
2674 3300048920 Ga0496117_0002501 Ga0496117_0002501_11454_12602 382
2675 3300048920 Ga0496117_0004110 Ga0496117_0004110_13906_15054 382
2676 3300048920 Ga0496117_0004748 Ga0496117_0004748_6654_7802 382
2677 3300048920 Ga0496117_0013894 Ga0496117_0013894_1134_2282 382
2678 3300048920 Ga0496117_0013964 Ga0496117_0013964_3224_4372 382
2679 3300048920 Ga0496117_0028254 Ga0496117_0028254_1166_2314 382
2680 3300048920 Ga0496117_0030977 Ga0496117_0030977_2901_4049 382
2681 3300048920 Ga0496117_0051200 Ga0496117_0051200_1053_2201 382
2682 3300048921 Ga0496118_0000110 Ga0496118_0000110_76400_77548 382
2683 3300048921 Ga0496118_0001537 Ga0496118_0001537_31236_32384 382
2684 3300048921 Ga0496118_0009650 Ga0496118_0009650_7647_8795 382
2685 3300048921 Ga0496118_0027773 Ga0496118_0027773_1849_2997 382
2686 3300048921 Ga0496118_0037297 Ga0496118_0037297_1422_2570 382
2687 3300048921 Ga0496118_0124363 Ga0496118_0124363_268_1416 382
2688 3300048922 Ga0496119_0015727 Ga0496119_0015727_49_1197 382
2689 3300048922 Ga0496119_0040362 Ga0496119_0040362_1536_2684 382
2690 3300048922 Ga0496119_0041312 Ga0496119_0041312_298_1446 382
2691 3300048923 Ga0496120_0003794 Ga0496120_0003794_3083_4231 382
2692 3300048923 Ga0496120_0016041 Ga0496120_0016041_2013_3161 382
2693 3300048923 Ga0496120_0050582 Ga0496120_0050582_1071_2219 382
2694 3300048924 Ga0496121_0000005 Ga0496121_0000005_958976_960124 382
2695 3300048924 Ga0496121_0000396 Ga0496121_0000396_54523_55671 382
2696 3300048924 Ga0496121_0000742 Ga0496121_0000742_47554_48702 382
2697 3300048924 Ga0496121_0000791 Ga0496121_0000791_37776_38924 382
2698 3300048924 Ga0496121_0001329 Ga0496121_0001329_36040_37203 382
2699 3300048924 Ga0496121_0003265 Ga0496121_0003265_11282_12430 382
2700 3300048924 Ga0496121_0003863 Ga0496121_0003863_196_1344 382
2701 3300048924 Ga0496121_0004801 Ga0496121_0004801_10845_11993 382
2702 3300048924 Ga0496121_0007177 Ga0496121_0007177_6492_7640 382
2703 3300048924 Ga0496121_0010549 Ga0496121_0010549_7688_8836 382
2704 3300048924 Ga0496121_0013553 Ga0496121_0013553_509_1657 382
2705 3300048924 Ga0496121_0022594 Ga0496121_0022594_1962_3110 382
2706 3300048924 Ga0496121_0073761 Ga0496121_0073761_592_1740 382
2707 3300048925 Ga0496122_0000156 Ga0496122_0000156_14788_15936 382
2708 3300048925 Ga0496122_0000203 Ga0496122_0000203_80494_81642 382
2709 3300048925 Ga0496122_0000249 Ga0496122_0000249_90573_91721 382
2710 3300048925 Ga0496122_0000266 Ga0496122_0000266_83169_84317 382
2711 3300048925 Ga0496122_0000451 Ga0496122_0000451_60731_61879 382
2712 3300048925 Ga0496122_0001854 Ga0496122_0001854_516_1664 382
2713 3300048925 Ga0496122_0005055 Ga0496122_0005055_9327_10475 382
2714 3300048925 Ga0496122_0008009 Ga0496122_0008009_8570_9718 382
2715 3300048925 Ga0496122_0024208 Ga0496122_0024208_296_1444 382
2716 3300048925 Ga0496122_0035401 Ga0496122_0035401_1710_2858 382
2717 3300048925 Ga0496122_0123320 Ga0496122_0123320_319_1467 382
2718 3300048926 Ga0496123_0000018 Ga0496123_0000018_261214_262362 382
2719 3300048926 Ga0496123_0000087 Ga0496123_0000087_166857_168005 382
2720 3300048926 Ga0496123_0000164 Ga0496123_0000164_50907_52055 382
2721 3300048926 Ga0496123_0000347 Ga0496123_0000347_56224_57372 382
2722 3300048926 Ga0496123_0001482 Ga0496123_0001482_2639_3787 382
2723 3300048926 Ga0496123_0003910 Ga0496123_0003910_533_1681 382
2724 3300048926 Ga0496123_0007317 Ga0496123_0007317_6462_7610 382
2725 3300048926 Ga0496123_0008731 Ga0496123_0008731_2699_3847 382
2726 3300048926 Ga0496123_0009255 Ga0496123_0009255_3852_5000 382
2727 3300048926 Ga0496123_0022466 Ga0496123_0022466_2420_3568 382
2728 3300048927 Ga0496124_0000006 Ga0496124_0000006_527935_529083 382
2729 3300048927 Ga0496124_0000023 Ga0496124_0000023_200264_201412 382
2730 3300048927 Ga0496124_0000506 Ga0496124_0000506_638_1786 382
2731 3300048927 Ga0496124_0000625 Ga0496124_0000625_12797_13945 382
2732 3300048927 Ga0496124_0004020 Ga0496124_0004020_7299_8447 382
2733 3300048927 Ga0496124_0014633 Ga0496124_0014633_530_1678 382
2734 3300048927 Ga0496124_0050176 Ga0496124_0050176_1863_3011 382
2735 3300048927 Ga0496124_0073391 Ga0496124_0073391_59_1207 382
2736 3300048927 Ga0496124_0097320 Ga0496124_0097320_79_1227 382
2737 3300048927 Ga0496124_0108001 Ga0496124_0108001_674_1822 382
2738 3300048928 Ga0496125_0000023 Ga0496125_0000023_266556_267704 382
2739 3300048928 Ga0496125_0000144 Ga0496125_0000144_105331_106479 382
2740 3300048928 Ga0496125_0000159 Ga0496125_0000159_83100_84248 382
2741 3300048928 Ga0496125_0000215 Ga0496125_0000215_38448_39596 382
2742 3300048928 Ga0496125_0000453 Ga0496125_0000453_19922_21070 382
2743 3300048928 Ga0496125_0003794 Ga0496125_0003794_7610_8758 382
2744 3300048928 Ga0496125_0028662 Ga0496125_0028662_697_1845 382
2745 3300048928 Ga0496125_0039995 Ga0496125_0039995_2275_3423 382
2746 3300048928 Ga0496125_0051405 Ga0496125_0051405_2081_3229 382
2747 3300048928 Ga0496125_0052078 Ga0496125_0052078_1397_2545 382
2748 3300048928 Ga0496125_0059632 Ga0496125_0059632_212_1360 382
2749 3300048928 Ga0496125_0194922 Ga0496125_0194922_129_1277 382
2750 3300048929 Ga0496126_0000061 Ga0496126_0000061_82509_83657 382
2751 3300048929 Ga0496126_0012736 Ga0496126_0012736_2664_3812 382
2752 3300048929 Ga0496126_0033969 Ga0496126_0033969_2589_3737 382
2753 3300048929 Ga0496126_0057325 Ga0496126_0057325_753_1901 382
2754 3300048929 Ga0496126_0073626 Ga0496126_0073626_1365_2513 382
2755 3300048929 Ga0496126_0078778 Ga0496126_0078778_597_1745 382
2756 3300048929 Ga0496126_0097693 Ga0496126_0097693_827_1975 382
2757 3300048929 Ga0496126_0190670 Ga0496126_0190670_506_1654 382
2758 3300048929 Ga0496126_0237270 Ga0496126_0237270_60_1208 382
2759 3300049459 Ga0495678_000020 Ga0495678_000020_7308_8456 382
2760 3300049459 Ga0495678_001763 Ga0495678_001763_48_1196 382
2761 3300049459 Ga0495678_003152 Ga0495678_003152_8420_9568 382
2762 3300049459 Ga0495678_003293 Ga0495678_003293_5122_6270 382
2763 3300049459 Ga0495678_003507 Ga0495678_003507_1125_2273 382
2764 3300049459 Ga0495678_007368 Ga0495678_007368_4362_5510 382
2765 3300049459 Ga0495678_011773 Ga0495678_011773_340_1488 382
2766 3300049459 Ga0495678_020128 Ga0495678_020128_1147_2295 382
2767 3300049459 Ga0495678_035839 Ga0495678_035839_42_1190 382
2768 3300049460 Ga0495682_0000018 Ga0495682_0000018_189509_190657 382
2769 3300049528 Ga0501312_003177 Ga0501312_003177_531_1679 382
2770 3300049568 Ga0501031_0010845 Ga0501031_0010845_2314_3462 382
2771 3300049569 Ga0501032_0005636 Ga0501032_0005636_3813_4961 382
2772 3300049570 Ga0501033_0005599 Ga0501033_0005599_2340_3488 382
2773 3300049570 Ga0501033_0006555 Ga0501033_0006555_6886_8034 382
2774 3300049570 Ga0501033_0054385 Ga0501033_0054385_982_2130 382
2775 3300049571 Ga0501034_0000160 Ga0501034_0000160_38023_39231 382
2776 3300049571 Ga0501034_0013846 Ga0501034_0013846_1380_2528 382
2777 3300049571 Ga0501034_0040386 Ga0501034_0040386_2145_3293 382
2778 3300049571 Ga0501034_0085625 Ga0501034_0085625_761_1909 382
2779 3300049571 Ga0501034_0094429 Ga0501034_0094429_883_2031 382
2780 3300049571 Ga0501034_0110024 Ga0501034_0110024_271_1419 382
2781 3300049571 Ga0501034_0259127 Ga0501034_0259127_213_1361 382
2782 3300049571 Ga0501034_0281965 Ga0501034_0281965_151_1299 382
2783 3300049571 Ga0501034_0344651 Ga0501034_0344651_173_1321 382
2784 3300049571 Ga0501034_0442255 Ga0501034_0442255_35_1183 382
2785 3300049572 Ga0501036_0016078 Ga0501036_0016078_1674_2822 382
2786 3300049572 Ga0501036_0105473 Ga0501036_0105473_70_1218 382
2787 3300049573 Ga0501037_0005493 Ga0501037_0005493_5907_7055 382
2788 3300049573 Ga0501037_0014455 Ga0501037_0014455_1087_2235 382
2789 3300049573 Ga0501037_0046604 Ga0501037_0046604_384_1532 382
2790 3300049574 Ga0501038_0099312 Ga0501038_0099312_1051_2199 382
2791 3300049574 Ga0501038_0099393 Ga0501038_0099393_206_1354 382
2792 3300049575 Ga0501039_0007179 Ga0501039_0007179_5907_7055 382
2793 3300049576 Ga0501040_0000155 Ga0501040_0000155_35308_36456 382
2794 3300049578 Ga0501042_0012756 Ga0501042_0012756_1993_3141 382
2795 3300049578 Ga0501042_0031461 Ga0501042_0031461_1362_2510 382
2796 3300049579 Ga0501043_0003327 Ga0501043_0003327_9637_10785 382
2797 3300049579 Ga0501043_0023026 Ga0501043_0023026_260_1432 382
2798 3300049579 Ga0501043_0038713 Ga0501043_0038713_893_2041 382
2799 3300049579 Ga0501043_0074265 Ga0501043_0074265_164_1312 382
2800 3300049580 Ga0501046_0007074 Ga0501046_0007074_5212_6360 382
2801 3300049580 Ga0501046_0024284 Ga0501046_0024284_2995_4143 382
2802 3300049581 Ga0501047_0085911 Ga0501047_0085911_893_2041 382
2803 3300049581 Ga0501047_0090321 Ga0501047_0090321_1578_2726 382
2804 3300049581 Ga0501047_0140690 Ga0501047_0140690_160_1308 382
2805 3300049581 Ga0501047_0147189 Ga0501047_0147189_198_1346 382
2806 3300049581 Ga0501047_0270674 Ga0501047_0270674_308_1456 382
2807 3300049582 Ga0501048_0001062 Ga0501048_0001062_16325_17473 382
2808 3300049582 Ga0501048_0021957 Ga0501048_0021957_1549_2697 382
2809 3300049582 Ga0501048_0043025 Ga0501048_0043025_1118_2266 382
2810 3300049583 Ga0501067_0000141 Ga0501067_0000141_994_2142 382
2811 3300049584 Ga0501068_0097096 Ga0501068_0097096_194_1342 382
2812 3300049585 Ga0501069_0019353 Ga0501069_0019353_2338_3486 382
2813 3300049586 Ga0501070_0023144 Ga0501070_0023144_3097_4245 382
2814 3300049661 Ga0501217_015787 Ga0501217_015787_70_1224 382
2815 3300049741 Ga0501079_0007620 Ga0501079_0007620_5134_6282 382
2816 3300049822 Ga0501035_0004258 Ga0501035_0004258_4967_6115 382
2817 3300049822 Ga0501035_0063758 Ga0501035_0063758_457_1605 382
2818 3300049822 Ga0501035_0137431 Ga0501035_0137431_696_1844 382
2819 3300049823 Ga0501044_0002363 Ga0501044_0002363_2470_3618 382
2820 3300049823 Ga0501044_0064616 Ga0501044_0064616_82_1230 382
2821 3300049823 Ga0501044_0069742 Ga0501044_0069742_1906_3132 382
2822 3300049823 Ga0501044_0095026 Ga0501044_0095026_699_1871 382
2823 3300049824 Ga0501045_0026003 Ga0501045_0026003_193_1341 382
2824 3300050489 nmdc:mga03683_19772_c1 nmdc:mga03683_19772_c1_242_1390 382
2825 3300050491 nmdc:mga00v17_374_c1 nmdc:mga00v17_374_c1_13570_14718 382
2826 3300050491 nmdc:mga00v17_57355_c1 nmdc:mga00v17_57355_c1_498_1646 382
2827 3300053087 Ga0500643_000017 Ga0500643_000017_69839_70987 382
2828 3300053093 Ga0500651_0001291 Ga0500651_0001291_9611_10759 382
2829 3300053096 Ga0500641_0013826 Ga0500641_0013826_42_1190 382
2830 3300053119 Ga0500595_000927 Ga0500595_000927_552_1700 382
2831 3300053119 Ga0500595_001126 Ga0500595_001126_6800_7948 382
2832 3300053119 Ga0500595_018414 Ga0500595_018414_267_1415 382
2833 3300053125 Ga0500618_000126 Ga0500618_000126_58586_59734 382
2834 3300053125 Ga0500618_002046 Ga0500618_002046_6939_8087 382
2835 3300053134 Ga0500658_0004601 Ga0500658_0004601_1613_2761 382
2836 3300053139 Ga0500568_0006096 Ga0500568_0006096_2411_3643 382
2837 3300053140 Ga0500573_0000055 Ga0500573_0000055_45576_46724 382
2838 3300053153 Ga0500616_0013230 Ga0500616_0013230_1229_2377 382
2839 3300053156 Ga0500622_0005062 Ga0500622_0005062_2061_3209 382
2840 3300053161 Ga0500634_0003859 Ga0500634_0003859_5188_6336 382
2841 3300054114 Ga0501084_0013919 Ga0501084_0013919_1196_2344 382
2842 3300060353 Ga0501082_0007757 Ga0501082_0007757_6348_7496 382
2843 3300060353 Ga0501082_0063322 Ga0501082_0063322_1088_2269 382
2844 3300061719 Ga0466962_0005308 Ga0466962_0005308_3341_4489 382
2845 3300061719 Ga0466962_0021384 Ga0466962_0021384_1000_2148 382
2846 iso_pu_bacteria 3001267043 3001271742 382

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

7

107

0.97

PF13378

MR_MLE_C

Enolase C-terminal domain-like

204

335

0.97

PF13378

MR_MLE_C

Enolase C-terminal domain-like

127

208

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rra-assembly1.cif.gz_B crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound 0.9597 2 381
3rr1-assembly1.cif.gz_B crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j 0.9578 2 381
3rra-assembly1.cif.gz_A crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound 0.957 1 381
3rr1-assembly1.cif.gz_A crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j 0.9531 2 381
3rra-assembly1.cif.gz_A crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound 0.947 1 381
ID Description Score Start End Superfamily
af_Q6BF17_1_106_3.30.390.10 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 1.004 1 105 3.30.390.10
af_Q6BF17_1_106_3.30.390.10 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9847 1 105 3.30.390.10
3rraA01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9829 1 100 3.30.390.10
af_P38104_1_104_3.30.390.10 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9669 1 98 3.30.390.10
3s47B01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.964 2 98 3.30.390.10
ID Description Score Start End GO Terms
AF-A0A3M5DBQ9-F1-model_v4 deleted 0.994 2 367
AF-A0A7X3ZHK9-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme N-terminal domain-containing protein 0.9813 2 145 GO:0016829
AF-A0A7W9J8H9-F1-model_v4 Galactonate dehydratase (EC 4.2.1.6) 0.9792 1 381 GO:0008869
GO:0009063
AF-F5P1T7-F1-model_v4 Mandelate racemase / muconate lactonizing enzyme, N-terminal domain protein (EC 4.2.1.6) 0.9756 1 309 GO:0008869
GO:0009063
GO:0034194
AF-F5P1T7-F1-model_v4 Mandelate racemase / muconate lactonizing enzyme, N-terminal domain protein (EC 4.2.1.6) 0.9725 1 309 GO:0008869
GO:0009063
GO:0034194

Feature Viewer

pLDDT pTM Quality
92.68 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map