F496960

General Info

Members Datasets Scaffolds Average Seq Length
2625 983 2396 104

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100002370|Ga0070714_10000237020
Length 108
Sequence MSAKIKKGDKVVVLTGRDKGRTGEVFEVRPDDDRALVRGINMVKRHQRQTAQQEGGIVSKEASVHLSNLALADPKDGKPTRVGFKFVGEGDNRRKVRVAKRSGVEIDG

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
6 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
7 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
8 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
9 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
10 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
11 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
12 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
13 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
14 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
15 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
16 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
17 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
18 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
19 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
20 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
21 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
22 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
23 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
24 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
25 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
26 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
27 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
28 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
29 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
30 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
31 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
32 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
33 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
34 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
35 2791355199
36 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
37 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
38 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
39 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
40 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
41 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
42 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
43 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
44 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
45 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
46 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
47 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
48 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
49 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
50 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
51 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
52 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
53 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
54 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
55 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
56 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
57 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
58 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
59 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
60 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
61 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
62 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
63 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
64 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
65 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
66 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
67 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
68 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
69 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
70 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
71 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
72 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
73 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
74 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
75 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
76 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
77 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
78 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
79 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
80 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
81 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
82 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
83 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
84 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
85 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
86 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
87 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
88 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
89 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
90 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
91 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
92 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
93 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
94 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
95 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
96 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
97 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
98 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
99 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
100 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
101 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
102 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
103 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
104 2904699407
105 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
106 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
107 2906610324
108 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
109 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
110 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
111 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
112 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
113 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
114 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
115 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
116 2922368715
117 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
118 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
119 2922425934
120 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
121 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
122 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
123 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
124 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
125 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
126 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
127 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
128 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
129 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
130 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
131 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
132 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
133 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
134 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
135 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
136 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
137 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
138 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
139 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
140 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
141 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
142 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
143 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
144 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
145 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
146 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
147 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
148 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
149 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
150 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
151 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
152 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
153 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
154 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
155 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
156 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
157 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
158 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
159 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
160 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
161 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
162 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
163 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
164 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
165 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
166 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
167 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
168 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
169 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
170 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
171 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
172 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
173 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
174 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
175 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
176 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
177 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
178 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
179 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
180 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
181 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
182 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
183 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
184 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
185 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
186 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
187 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
188 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
189 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
190 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
191 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
192 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
193 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
194 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
195 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
196 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
197 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
198 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
199 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
200 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
201 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
202 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
203 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
204 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
205 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
206 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
207 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
208 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
209 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
210 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
211 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
212 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
213 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
214 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
215 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
216 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
217 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
219 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
220 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
221 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
222 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
223 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
224 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
225 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
226 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
227 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
228 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
231 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
233 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
234 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
235 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
236 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
237 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
238 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
239 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
240 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
241 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
242 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
243 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
244 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
245 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
246 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
247 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
248 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
249 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
250 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
251 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
252 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
253 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
254 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
255 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
256 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
257 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
258 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
259 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
260 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
261 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
262 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
263 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
264 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
265 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
266 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
267 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
268 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
269 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
270 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
271 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
272 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
273 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
274 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
275 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
276 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
277 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
278 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
279 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
280 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
281 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
282 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
283 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
284 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
285 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
286 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
287 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
288 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
289 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
290 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
291 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
292 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
293 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
294 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
295 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
296 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
297 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
298 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
299 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
300 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
301 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
302 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
303 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
304 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
305 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
306 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
307 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
308 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
309 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
310 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
311 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
312 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
313 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
314 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
315 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
316 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
317 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
318 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
319 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
320 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
321 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
322 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
323 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
324 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
325 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
326 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
327 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
328 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
329 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
330 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
331 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
332 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
333 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
334 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
335 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
336 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
337 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
338 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
339 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
340 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
341 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
342 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
343 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
344 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
345 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
346 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
347 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
348 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
349 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
350 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
351 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
352 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
353 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
354 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
355 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
356 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
357 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
358 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
359 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
360 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
361 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
362 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
363 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
364 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
365 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
366 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
367 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
368 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
369 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
370 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
371 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
372 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
373 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
374 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
375 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
376 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
377 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
378 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
379 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
380 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
381 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
382 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
383 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
384 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
385 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
387 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
388 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
389 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
390 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
391 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
392 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
393 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
394 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
395 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
396 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
397 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
398 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
399 3300024123 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 Metagenome Unclassified
400 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025227 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in- M7 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
403 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
404 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
405 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
406 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
407 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
409 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
410 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
411 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
412 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
413 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
414 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
415 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
416 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
417 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
418 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
463 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
465 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
466 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
467 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
471 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
472 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
476 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
477 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
478 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
479 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
480 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
481 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
482 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
483 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
484 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
485 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
486 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
487 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
488 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
489 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
490 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
491 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
492 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
493 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
494 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
495 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
496 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
497 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
498 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
499 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
500 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
501 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
502 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
503 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
504 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
505 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
506 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
507 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
508 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
509 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
510 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
511 3300029272 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 Metatranscriptome Rhizosphere
512 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
513 3300029283 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 Metatranscriptome Rhizosphere
514 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
515 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
516 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
517 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
518 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
519 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
520 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
521 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
522 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
523 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
524 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
525 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
526 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
527 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
528 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
529 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
530 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
531 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
532 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
533 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
534 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
535 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
536 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
537 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
538 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
539 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
540 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
541 3300031815 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
542 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
543 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
544 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
545 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
546 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
547 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
548 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
549 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
550 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
551 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
552 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
553 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
554 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
555 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
556 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
557 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
558 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
559 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
560 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
561 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
562 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
563 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
564 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
565 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
566 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
567 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
568 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
569 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
570 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
571 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
572 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
573 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
574 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
575 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
576 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
577 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
578 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
579 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
580 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
581 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
582 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
583 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
584 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
585 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
586 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
587 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
588 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
589 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
590 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
591 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
592 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
593 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
594 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
595 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
596 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
597 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
598 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
599 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
600 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
601 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
602 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
603 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
604 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
605 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
606 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
607 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
608 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
609 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
610 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
611 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
612 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
613 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
614 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
615 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
616 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
617 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
618 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
619 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
620 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
621 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
622 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
623 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
624 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
625 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
626 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
627 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
628 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
629 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
630 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
631 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
632 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
633 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
634 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
635 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
636 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
637 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
638 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
639 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
640 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
641 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
642 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
643 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
644 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
645 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
646 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
647 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
648 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
649 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
650 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
651 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
652 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
653 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
654 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
655 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
656 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
657 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
658 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
659 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
660 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
661 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
662 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
663 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
664 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
665 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
666 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
667 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
668 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
669 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
670 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
671 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
672 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
673 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
674 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
675 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
676 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
677 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
678 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
679 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
680 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
681 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
682 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
683 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
684 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
685 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
686 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
687 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
688 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
689 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
690 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
691 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
692 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
693 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
694 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
695 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
696 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
697 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
698 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
699 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
700 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
701 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
702 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
703 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
704 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
705 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
706 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
707 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
708 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
709 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
710 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
711 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
712 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
713 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
714 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
715 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
716 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
717 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
718 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
719 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
720 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
721 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
722 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
723 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
724 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
725 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
726 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
727 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
728 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
729 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
730 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
731 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
732 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
733 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
734 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
735 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
736 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
737 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
738 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
739 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
740 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
741 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
742 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
743 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
744 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
745 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
746 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
747 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
748 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
749 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
750 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
751 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
752 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
753 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
754 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
755 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
756 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
757 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
758 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
759 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
760 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
761 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
762 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
763 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
764 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
765 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
766 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
767 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
768 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
769 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
770 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
771 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
772 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
773 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
774 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
775 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
776 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
777 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
778 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
779 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
780 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
781 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
782 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
783 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
784 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
785 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
786 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
787 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
788 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
789 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
790 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
791 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
792 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
793 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
794 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
795 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
796 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
797 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
798 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
799 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
800 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
801 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
802 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
803 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
804 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
805 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
806 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
807 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
808 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
809 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
810 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
811 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
812 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
813 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
814 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
815 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
816 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
817 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
818 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
819 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
820 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
821 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
822 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
823 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
824 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
825 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
826 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
827 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
828 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
829 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
830 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
831 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
832 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
833 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
834 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
835 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
836 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
837 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
838 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
839 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
840 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
841 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
842 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
843 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
844 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
845 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
846 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
847 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
848 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
849 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
850 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
851 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
852 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
853 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
854 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
855 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
856 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
857 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
858 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
859 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
860 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
861 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
862 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
863 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
864 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
865 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
866 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
867 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
868 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
869 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
870 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
871 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
872 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
873 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
874 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
875 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
876 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
877 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
878 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
879 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
880 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
881 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
882 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
883 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
884 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
885 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
886 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
887 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
888 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
889 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
890 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
891 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
892 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
893 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
894 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
895 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
896 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
897 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
898 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
899 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
900 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
901 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
902 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
903 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
904 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
905 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
906 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
907 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
908 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
909 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
910 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
911 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
912 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
913 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
914 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
915 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
916 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
917 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
918 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
919 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
920 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
921 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
922 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
923 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
924 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
925 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
926 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
927 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
928 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
929 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
930 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
931 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
932 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
933 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
934 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
935 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
936 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
937 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
938 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
939 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
940 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
941 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
942 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
943 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
944 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
945 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
946 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
947 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
948 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
949 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
950 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
951 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
952 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
953 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
954 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
955 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
956 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
957 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
958 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
959 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
960 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
961 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
962 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
963 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
964 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
965 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
966 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
967 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
968 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
969 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
970 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
971 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
972 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
973 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
974 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
975 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
976 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
977 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
978 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
979 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
980 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
981 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
982 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
983 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.93
Metatranscriptomes 2.52
Isolates 8.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.2
Nodule 6.9
Rhizoplane 6.1
Rhizosphere 67.81
Stem 0
Stem Tuber 0
Unclassified 8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C5874 2010549000 Bacteria 961
2 CNAas_1005690 3300000532 Bacteria 799
3 LJQas_1018455 3300000549 Bacteria 812
4 JGI24736J21556_1073790 3300001904 Bacteria 533
5 JGI24741J21665_1027565 3300001915 Bacteria 861
6 JGI24741J21665_1057490 3300001915 Bacteria 573
7 JGI24746J21847_1026022 3300001977 Bacteria 809
8 JGI24747J21853_1015344 3300001978 Bacteria 803
9 JGI24740J21852_10083972 3300001979 Bacteria 830
10 JGI24740J21852_10093120 3300001979 Bacteria 775
11 JGI24740J21852_10110192 3300001979 Bacteria 695
12 JGI24739J22299_10021424 3300001989 Bacteria 2300
13 JGI24739J22299_10034294 3300001989 Bacteria 1730
14 JGI24739J22299_10048104 3300001989 Bacteria 1388
15 JGI24739J22299_10145934 3300001989 Bacteria 700
16 JGI24739J22299_10189131 3300001989 Bacteria 605
17 JGI24737J22298_10008861 3300001990 Bacteria 3357
18 JGI24737J22298_10132603 3300001990 Bacteria 736
19 JGI24735J21928_10014623 3300002067 Bacteria 2456
20 JGI24735J21928_10124774 3300002067 Bacteria 742
21 JGI24750J21931_1008775 3300002070 Bacteria 1292
22 JGI24745J21846_1044293 3300002073 Bacteria 555
23 JGI24748J21848_1020628 3300002074 Bacteria 794
24 JGI24738J21930_10006734 3300002075 Bacteria 2674
25 JGI24738J21930_10110199 3300002075 Bacteria 593
26 JGI24749J21850_1062373 3300002076 Bacteria 568
27 JGI24744J21845_10033365 3300002077 Bacteria 980
28 JGI24033J26618_1015106 3300002155 Bacteria 950
29 JGI24033J26618_1041773 3300002155 Bacteria 641
30 JGI24033J26618_1063387 3300002155 Bacteria 547
31 JGI24034J26672_10017113 3300002239 Bacteria 1121
32 JGI24034J26672_10019005 3300002239 Bacteria 1070
33 JGI24742J22300_10013172 3300002244 Bacteria 1384
34 JGI25406J46586_10000078 3300003203 Bacteria 44054
35 JGI25406J46586_10040734 3300003203 Bacteria 1643
36 JGI25406J46586_10108005 3300003203 Bacteria 825
37 JGI25165J46597_1006932 3300003214 Bacteria 1950
38 JGI25165J46597_1020572 3300003214 Bacteria 864
39 JGI25153J46596_10001601 3300003215 Bacteria 13411
40 Ga0006777J48905_1054038 3300003308 Bacteria 1116
41 Ga0007410J51695_1028777 3300003574 Bacteria 1142
42 Ga0007409J51694_1030207 3300003575 Bacteria 880
43 JGI25404J52841_10013637 3300003659 Bacteria 1763
44 JGI25404J52841_10096617 3300003659 Bacteria 619
45 Ga0032354_1106446 3300003693 Bacteria 757
46 Ga0006780_1016914 3300003735 Bacteria 1313
47 Ga0055539_1002237 3300003752 Bacteria 3065
48 Ga0055539_1002356 3300003752 Bacteria 2939
49 Ga0055542_1003192 3300003762 Bacteria 4611
50 Ga0055529_1005440 3300003763 Bacteria 1844
51 Ga0055526_1040086 3300003771 Bacteria 1185
52 Ga0055524_1022189 3300003775 Bacteria 2082
53 Ga0055536_1016913 3300003781 Bacteria 2413
54 Ga0055531_10005825 3300003794 Bacteria 7128
55 Ga0055531_10028999 3300003794 Bacteria 1894
56 JGI25405J52794_10079350 3300003911 Bacteria 721
57 Ga0055543_1065234 3300004625 Bacteria 578
58 Ga0058863_11733669 3300004799 Bacteria 659
59 Ga0058861_12073627 3300004800 Bacteria 1361
60 Ga0058860_12214667 3300004801 Bacteria 985
61 Ga0058862_12847737 3300004803 Bacteria 1692
62 Ga0065712_10595092 3300005290 Bacteria 593
63 Ga0065707_10024721 3300005295 Bacteria 1250
64 Ga0070658_10178129 3300005327 Bacteria 1788
65 Ga0070658_10729550 3300005327 Bacteria 860
66 Ga0070658_11180486 3300005327 Bacteria 665
67 Ga0070658_11431767 3300005327 Bacteria 599
68 Ga0070676_10636849 3300005328 Bacteria 772
69 Ga0070676_11503215 3300005328 Bacteria 519
70 Ga0070676_11528723 3300005328 Bacteria 514
71 Ga0070683_100017855 3300005329 Bacteria 6272
72 Ga0070683_100038770 3300005329 Bacteria 4369
73 Ga0070683_100132890 3300005329 Bacteria 2355
74 Ga0070683_100479650 3300005329 Bacteria 1187
75 Ga0070683_102029653 3300005329 Bacteria 552
76 Ga0070690_100835458 3300005330 Bacteria 716
77 Ga0070690_101245664 3300005330 Bacteria 594
78 Ga0070670_100258867 3300005331 Bacteria 1516
79 Ga0070677_10466040 3300005333 Bacteria 679
80 Ga0068869_101943267 3300005334 Bacteria 527
81 Ga0068869_101965520 3300005334 Bacteria 524
82 Ga0070666_10320043 3300005335 Bacteria 1106
83 Ga0070666_10710114 3300005335 Bacteria 737
84 Ga0070666_11426162 3300005335 Bacteria 517
85 Ga0070680_100097692 3300005336 Bacteria 2435
86 Ga0070680_100098152 3300005336 Bacteria 2429
87 Ga0070680_100128267 3300005336 Bacteria 2120
88 Ga0070680_100174605 3300005336 Bacteria 1809
89 Ga0070680_100291776 3300005336 Bacteria 1382
90 Ga0070680_100399538 3300005336 Bacteria 1171
91 Ga0070680_100552917 3300005336 Bacteria 987
92 Ga0070680_100946105 3300005336 Bacteria 744
93 Ga0070682_100295472 3300005337 Bacteria 1186
94 Ga0070682_100316068 3300005337 Bacteria 1151
95 Ga0070682_100517447 3300005337 Bacteria 928
96 Ga0070682_100644439 3300005337 Bacteria 842
97 Ga0070682_100942182 3300005337 Bacteria 712
98 Ga0068868_100320964 3300005338 Bacteria 1319
99 Ga0068868_100345413 3300005338 Bacteria 1273
100 Ga0068868_100561056 3300005338 Bacteria 1007
101 Ga0068868_101267718 3300005338 Bacteria 684
102 Ga0070660_100242109 3300005339 Bacteria 1469
103 Ga0070660_100362134 3300005339 Bacteria 1195
104 Ga0070660_100414849 3300005339 Bacteria 1114
105 Ga0070660_100700018 3300005339 Bacteria 849
106 Ga0070689_100175086 3300005340 Bacteria 1740
107 Ga0070689_100269008 3300005340 Bacteria 1410
108 Ga0070689_100307743 3300005340 Bacteria 1320
109 Ga0070689_100621410 3300005340 Bacteria 937
110 Ga0070691_10108256 3300005341 Bacteria 1387
111 Ga0070691_10504962 3300005341 Bacteria 699
112 Ga0070691_11075453 3300005341 Bacteria 506
113 Ga0070687_100307896 3300005343 Bacteria 1007
114 Ga0070661_100286747 3300005344 Bacteria 1279
115 Ga0070661_100396367 3300005344 Bacteria 1091
116 Ga0070661_100400261 3300005344 Bacteria 1085
117 Ga0070661_100480085 3300005344 Bacteria 992
118 Ga0070661_101177392 3300005344 Bacteria 640
119 Ga0070669_100487924 3300005353 Bacteria 1020
120 Ga0070669_100942921 3300005353 Bacteria 738
121 Ga0070669_101264428 3300005353 Bacteria 638
122 Ga0070675_100477738 3300005354 Bacteria 1121
123 Ga0070675_100607194 3300005354 Bacteria 992
124 Ga0070675_100922971 3300005354 Bacteria 800
125 Ga0070671_100140430 3300005355 Bacteria 2038
126 Ga0070671_100429876 3300005355 Bacteria 1131
127 Ga0070671_100542534 3300005355 Bacteria 1002
128 Ga0070671_100560718 3300005355 Bacteria 985
129 Ga0070671_100569289 3300005355 Bacteria 978
130 Ga0070671_101062143 3300005355 Bacteria 710
131 Ga0070671_101210867 3300005355 Bacteria 665
132 Ga0070671_101979550 3300005355 Bacteria 518
133 Ga0070673_100801867 3300005364 Bacteria 869
134 Ga0070673_101583686 3300005364 Bacteria 619
135 Ga0070673_101873841 3300005364 Bacteria 568
136 Ga0070673_102203839 3300005364 Bacteria 524
137 Ga0070688_100056044 3300005365 Bacteria 2474
138 Ga0070688_100487656 3300005365 Bacteria 927
139 Ga0070688_101049375 3300005365 Bacteria 649
140 Ga0070659_100117226 3300005366 Bacteria 2153
141 Ga0070659_100393817 3300005366 Bacteria 1168
142 Ga0070659_100556316 3300005366 Bacteria 982
143 Ga0070667_100091151 3300005367 Bacteria 2620
144 Ga0070703_10485239 3300005406 Bacteria 554
145 Ga0070709_10442692 3300005434 Bacteria 977
146 Ga0070709_11527850 3300005434 Bacteria 542
147 Ga0070709_11539730 3300005434 Bacteria 540
148 Ga0070714_100002370 3300005435 Bacteria 13866
149 Ga0070714_100059218 3300005435 Bacteria 3283
150 Ga0070714_100177677 3300005435 Bacteria 1935
151 Ga0070714_100464522 3300005435 Bacteria 1203
152 Ga0070714_100778425 3300005435 Bacteria 926
153 Ga0070714_101362958 3300005435 Bacteria 692
154 Ga0070713_100010006 3300005436 Bacteria 6833
155 Ga0070713_100054584 3300005436 Bacteria 3316
156 Ga0070713_100076595 3300005436 Bacteria 2841
157 Ga0070713_100171734 3300005436 Bacteria 1942
158 Ga0070713_100191249 3300005436 Bacteria 1844
159 Ga0070713_100199231 3300005436 Bacteria 1807
160 Ga0070713_100331543 3300005436 Bacteria 1408
161 Ga0070713_100444788 3300005436 Bacteria 1216
162 Ga0070713_101476923 3300005436 Bacteria 659
163 Ga0070713_101856706 3300005436 Bacteria 585
164 Ga0070710_10003270 3300005437 Bacteria 7682
165 Ga0070710_10005644 3300005437 Bacteria 5958
166 Ga0070710_10253649 3300005437 Bacteria 1132
167 Ga0070710_10491491 3300005437 Bacteria 839
168 Ga0070710_10631369 3300005437 Bacteria 749
169 Ga0070710_10702708 3300005437 Bacteria 714
170 Ga0070710_10723110 3300005437 Bacteria 704
171 Ga0070710_10991232 3300005437 Bacteria 612
172 Ga0070710_11150335 3300005437 Bacteria 572
173 Ga0070701_10154686 3300005438 Bacteria 1323
174 Ga0070701_10595222 3300005438 Bacteria 731
175 Ga0070711_100007497 3300005439 Bacteria 6640
176 Ga0070711_100128167 3300005439 Bacteria 1886
177 Ga0070711_100187165 3300005439 Bacteria 1588
178 Ga0070711_100195901 3300005439 Bacteria 1556
179 Ga0070711_100283035 3300005439 Bacteria 1313
180 Ga0070711_100359317 3300005439 Bacteria 1173
181 Ga0070711_100735599 3300005439 Bacteria 833
182 Ga0070711_101140627 3300005439 Bacteria 673
183 Ga0070705_100793858 3300005440 Bacteria 752
184 Ga0070700_100760037 3300005441 Bacteria 776
185 Ga0070700_101762520 3300005441 Bacteria 533
186 Ga0070700_102018498 3300005441 Bacteria 501
187 Ga0070708_100020902 3300005445 Bacteria 5527
188 Ga0070708_100035098 3300005445 Bacteria 4367
189 Ga0070708_100260674 3300005445 Bacteria 1629
190 Ga0070663_100471867 3300005455 Bacteria 1037
191 Ga0070663_100557627 3300005455 Bacteria 958
192 Ga0070663_100584355 3300005455 Bacteria 937
193 Ga0070663_100671109 3300005455 Bacteria 878
194 Ga0070663_100680923 3300005455 Bacteria 872
195 Ga0070663_100738643 3300005455 Bacteria 839
196 Ga0070663_100907063 3300005455 Bacteria 761
197 Ga0070663_102140180 3300005455 Bacteria 504
198 Ga0070678_100305948 3300005456 Bacteria 1352
199 Ga0070678_100698814 3300005456 Bacteria 913
200 Ga0070678_101285131 3300005456 Bacteria 680
201 Ga0070662_100409997 3300005457 Bacteria 1119
202 Ga0070662_100419721 3300005457 Bacteria 1106
203 Ga0070681_10018722 3300005458 Bacteria 6929
204 Ga0070681_10068789 3300005458 Bacteria 3507
205 Ga0070681_10087934 3300005458 Bacteria 3059
206 Ga0070681_10361698 3300005458 Bacteria 1361
207 Ga0070681_10450232 3300005458 Bacteria 1199
208 Ga0070681_10882727 3300005458 Bacteria 812
209 Ga0068867_100254714 3300005459 Bacteria 1429
210 Ga0068867_100499240 3300005459 Bacteria 1045
211 Ga0070685_10360932 3300005466 Bacteria 996
212 Ga0070685_10432039 3300005466 Bacteria 918
213 Ga0070698_100367619 3300005471 Bacteria 1370
214 Ga0070699_100124393 3300005518 Bacteria 2269
215 Ga0070699_100349657 3300005518 Bacteria 1331
216 Ga0070679_100092970 3300005530 Bacteria 3003
217 Ga0070679_100127967 3300005530 Bacteria 2521
218 Ga0070679_100258822 3300005530 Bacteria 1695
219 Ga0070679_100479250 3300005530 Bacteria 1188
220 Ga0070679_102098975 3300005530 Bacteria 514
221 Ga0070684_100071887 3300005535 Bacteria 3044
222 Ga0070684_100142413 3300005535 Bacteria 2168
223 Ga0070684_100257909 3300005535 Bacteria 1594
224 Ga0070684_100529633 3300005535 Bacteria 1092
225 Ga0070684_100815651 3300005535 Bacteria 872
226 Ga0070684_102321655 3300005535 Bacteria 506
227 Ga0070697_100259495 3300005536 Bacteria 1487
228 Ga0070697_100319726 3300005536 Bacteria 1336
229 Ga0068853_100030196 3300005539 Bacteria 4577
230 Ga0068853_100281887 3300005539 Bacteria 1532
231 Ga0068853_100446167 3300005539 Bacteria 1216
232 Ga0068853_100494293 3300005539 Bacteria 1154
233 Ga0068853_100626607 3300005539 Bacteria 1022
234 Ga0068853_100642638 3300005539 Bacteria 1009
235 Ga0068853_100663130 3300005539 Bacteria 993
236 Ga0068853_100723197 3300005539 Bacteria 950
237 Ga0068853_100907206 3300005539 Bacteria 846
238 Ga0068853_101160296 3300005539 Bacteria 745
239 Ga0068853_101276770 3300005539 Bacteria 709
240 Ga0068853_101364112 3300005539 Bacteria 685
241 Ga0068853_101742927 3300005539 Bacteria 604
242 Ga0068853_102331313 3300005539 Bacteria 518
243 Ga0068853_102420024 3300005539 Bacteria 508
244 Ga0070672_100198620 3300005543 Bacteria 1676
245 Ga0070672_100253577 3300005543 Bacteria 1482
246 Ga0070672_100738358 3300005543 Bacteria 863
247 Ga0070672_101259978 3300005543 Bacteria 659
248 Ga0070686_100219365 3300005544 Bacteria 1373
249 Ga0070686_100273141 3300005544 Bacteria 1244
250 Ga0070686_100903578 3300005544 Bacteria 718
251 Ga0070695_100199054 3300005545 Bacteria 1430
252 Ga0070696_100294689 3300005546 Bacteria 1240
253 Ga0070693_100144801 3300005547 Bacteria 1499
254 Ga0070693_100226999 3300005547 Bacteria 1226
255 Ga0070693_100331754 3300005547 Bacteria 1035
256 Ga0070693_101009943 3300005547 Bacteria 630
257 Ga0070693_101495343 3300005547 Bacteria 528
258 Ga0070665_100317360 3300005548 Bacteria 1562
259 Ga0070665_100431060 3300005548 Bacteria 1327
260 Ga0070665_101109745 3300005548 Bacteria 802
261 Ga0070665_101177371 3300005548 Bacteria 777
262 Ga0070665_101429523 3300005548 Bacteria 700
263 Ga0070665_101713891 3300005548 Bacteria 635
264 Ga0070665_101786382 3300005548 Bacteria 621
265 Ga0070665_101802767 3300005548 Bacteria 618
266 Ga0070665_102205889 3300005548 Bacteria 554
267 Ga0070704_100534300 3300005549 Bacteria 1022
268 Ga0070704_100831997 3300005549 Bacteria 827
269 Ga0068855_100108793 3300005563 Bacteria 3183
270 Ga0068855_100222281 3300005563 Bacteria 2117
271 Ga0068855_100305120 3300005563 Bacteria 1762
272 Ga0068855_100387119 3300005563 Bacteria 1534
273 Ga0068855_100436555 3300005563 Bacteria 1430
274 Ga0068855_100510316 3300005563 Bacteria 1305
275 Ga0068855_100638708 3300005563 Bacteria 1144
276 Ga0068855_101193755 3300005563 Bacteria 791
277 Ga0068855_102034918 3300005563 Bacteria 579
278 Ga0068855_102201225 3300005563 Bacteria 553
279 Ga0070664_100174960 3300005564 Bacteria 1905
280 Ga0070664_101279525 3300005564 Bacteria 692
281 Ga0070664_101534175 3300005564 Bacteria 631
282 Ga0070664_102332663 3300005564 Bacteria 507
283 Ga0068857_100704538 3300005577 Bacteria 959
284 Ga0068857_100801398 3300005577 Bacteria 899
285 Ga0068857_101143910 3300005577 Bacteria 752
286 Ga0068857_101632898 3300005577 Bacteria 629
287 Ga0068857_102263186 3300005577 Bacteria 534
288 Ga0068854_100299450 3300005578 Bacteria 1300
289 Ga0068854_100300930 3300005578 Bacteria 1297
290 Ga0068854_100304986 3300005578 Bacteria 1289
291 Ga0068854_100592416 3300005578 Bacteria 945
292 Ga0068854_101833771 3300005578 Bacteria 557
293 Ga0068856_100087549 3300005614 Bacteria 3096
294 Ga0068856_100137388 3300005614 Bacteria 2450
295 Ga0068856_100187446 3300005614 Bacteria 2082
296 Ga0068856_100409510 3300005614 Bacteria 1376
297 Ga0068856_100513354 3300005614 Bacteria 1219
298 Ga0068856_100597691 3300005614 Bacteria 1124
299 Ga0068856_101169568 3300005614 Bacteria 786
300 Ga0068856_101354371 3300005614 Bacteria 726
301 Ga0068856_101887296 3300005614 Bacteria 608
302 Ga0068856_102452424 3300005614 Bacteria 529
303 Ga0070702_100422526 3300005615 Bacteria 959
304 Ga0070702_100731845 3300005615 Bacteria 757
305 Ga0070702_101830838 3300005615 Bacteria 508
306 Ga0068852_100029235 3300005616 Bacteria 4524
307 Ga0068852_100322174 3300005616 Bacteria 1501
308 Ga0068852_100351494 3300005616 Bacteria 1439
309 Ga0068852_100400171 3300005616 Bacteria 1351
310 Ga0068852_100586007 3300005616 Bacteria 1118
311 Ga0068852_100687579 3300005616 Bacteria 1032
312 Ga0068852_100985166 3300005616 Bacteria 861
313 Ga0068852_101699829 3300005616 Bacteria 653
314 Ga0068859_100800085 3300005617 Bacteria 1030
315 Ga0068859_102002280 3300005617 Bacteria 639
316 Ga0068859_102491636 3300005617 Bacteria 570
317 Ga0068864_100139925 3300005618 Bacteria 2182
318 Ga0068864_100325970 3300005618 Bacteria 1443
319 Ga0068864_100798111 3300005618 Bacteria 928
320 Ga0068864_101168405 3300005618 Bacteria 767
321 Ga0068864_101664836 3300005618 Bacteria 642
322 Ga0068866_10157673 3300005718 Bacteria 1320
323 Ga0068866_10486767 3300005718 Bacteria 814
324 Ga0068861_100242539 3300005719 Bacteria 1533
325 Ga0068861_100980391 3300005719 Bacteria 805
326 Ga0068851_10016676 3300005834 Bacteria 3519
327 Ga0068851_10136707 3300005834 Bacteria 1329
328 Ga0068851_10251523 3300005834 Bacteria 1002
329 Ga0068870_10091899 3300005840 Bacteria 1698
330 Ga0068870_10151007 3300005840 Bacteria 1368
331 Ga0068863_100375088 3300005841 Bacteria 1388
332 Ga0068863_100403986 3300005841 Bacteria 1336
333 Ga0068863_100436709 3300005841 Bacteria 1283
334 Ga0068863_102046877 3300005841 Bacteria 583
335 Ga0068863_102214797 3300005841 Bacteria 560
336 Ga0068858_100658711 3300005842 Bacteria 1017
337 Ga0068858_101051585 3300005842 Bacteria 798
338 Ga0068858_101488622 3300005842 Bacteria 667
339 Ga0068858_101497011 3300005842 Bacteria 665
340 Ga0068858_101592738 3300005842 Bacteria 644
341 Ga0068858_101774827 3300005842 Bacteria 609
342 Ga0068860_100078148 3300005843 Bacteria 3147
343 Ga0068860_100138904 3300005843 Bacteria 2334
344 Ga0068860_100846023 3300005843 Bacteria 929
345 Ga0068860_101484558 3300005843 Bacteria 699
346 Ga0068860_101712020 3300005843 Bacteria 651
347 Ga0068862_101192532 3300005844 Bacteria 759
348 Ga0068862_102133648 3300005844 Bacteria 571
349 Ga0068862_102405213 3300005844 Bacteria 538
350 Ga0081455_10011724 3300005937 Bacteria 8787
351 Ga0081538_10006855 3300005981 Bacteria 9922
352 Ga0081538_10022020 3300005981 Bacteria 4630
353 Ga0081538_10066354 3300005981 Bacteria 2024
354 Ga0081538_10388299 3300005981 Bacteria 503
355 Ga0081540_1002979 3300005983 Bacteria 13570
356 Ga0081540_1014636 3300005983 Bacteria 5014
357 Ga0081540_1016986 3300005983 Bacteria 4525
358 Ga0081540_1270213 3300005983 Bacteria 589
359 Ga0081539_10000273 3300005985 Bacteria 117936
360 Ga0081539_10038639 3300005985 Bacteria 2826
361 Ga0081539_10062142 3300005985 Bacteria 2043
362 Ga0081539_10185466 3300005985 Bacteria 973
363 Ga0081539_10208965 3300005985 Bacteria 896
364 Ga0070717_10006736 3300006028 Bacteria 8475
365 Ga0070717_10023212 3300006028 Bacteria 4912
366 Ga0070717_10172141 3300006028 Bacteria 1884
367 Ga0070717_10222765 3300006028 Bacteria 1658
368 Ga0070717_10345917 3300006028 Bacteria 1328
369 Ga0070717_10472665 3300006028 Bacteria 1131
370 Ga0070717_11414596 3300006028 Bacteria 631
371 Ga0070717_11991055 3300006028 Bacteria 523
372 Ga0075365_10006087 3300006038 Bacteria 6591
373 Ga0075365_10360809 3300006038 Bacteria 1024
374 Ga0075365_11011908 3300006038 Bacteria 585
375 Ga0075365_11119029 3300006038 Bacteria 554
376 Ga0075365_11331345 3300006038 Bacteria 504
377 Ga0075368_10022925 3300006042 Bacteria 2380
378 Ga0075368_10029086 3300006042 Bacteria 2136
379 Ga0075368_10107531 3300006042 Bacteria 1148
380 Ga0075363_100021882 3300006048 Bacteria 3227
381 Ga0075363_100291656 3300006048 Bacteria 945
382 Ga0075363_100503418 3300006048 Bacteria 719
383 Ga0075363_100623375 3300006048 Bacteria 647
384 Ga0075363_100841687 3300006048 Bacteria 559
385 Ga0075363_100939607 3300006048 Bacteria 531
386 Ga0075364_10026612 3300006051 Bacteria 3690
387 Ga0075364_10881046 3300006051 Bacteria 609
388 Ga0075364_10942284 3300006051 Bacteria 587
389 Ga0075364_11211402 3300006051 Bacteria 512
390 Ga0075432_10154961 3300006058 Bacteria 883
391 Ga0070715_10001968 3300006163 Bacteria 6192
392 Ga0070715_10084494 3300006163 Bacteria 1448
393 Ga0070715_10438597 3300006163 Bacteria 735
394 Ga0070715_10540837 3300006163 Bacteria 674
395 Ga0070716_100029633 3300006173 Bacteria 2961
396 Ga0070716_100077676 3300006173 Bacteria 1971
397 Ga0070716_100083237 3300006173 Bacteria 1916
398 Ga0070716_100159662 3300006173 Bacteria 1459
399 Ga0070716_100285157 3300006173 Bacteria 1141
400 Ga0070716_101148376 3300006173 Bacteria 622
401 Ga0070712_100006185 3300006175 Bacteria 7408
402 Ga0070712_100020783 3300006175 Bacteria 4300
403 Ga0070712_100498966 3300006175 Bacteria 1020
404 Ga0070712_100533065 3300006175 Bacteria 987
405 Ga0070712_100776927 3300006175 Bacteria 821
406 Ga0070712_100944886 3300006175 Bacteria 744
407 Ga0070712_101025602 3300006175 Bacteria 714
408 Ga0070712_101156492 3300006175 Bacteria 672
409 Ga0075362_10184663 3300006177 Bacteria 1011
410 Ga0075362_10320144 3300006177 Bacteria 772
411 Ga0075362_10491980 3300006177 Bacteria 626
412 Ga0075362_10628698 3300006177 Bacteria 556
413 Ga0075362_10652851 3300006177 Bacteria 546
414 Ga0075367_10031382 3300006178 Bacteria 3051
415 Ga0075367_10130109 3300006178 Bacteria 1555
416 Ga0075367_10359294 3300006178 Bacteria 919
417 Ga0075367_10594099 3300006178 Bacteria 703
418 Ga0075369_10205008 3300006186 Bacteria 911
419 Ga0075369_10241762 3300006186 Bacteria 837
420 Ga0075369_10398581 3300006186 Bacteria 648
421 Ga0075369_10531068 3300006186 Bacteria 560
422 Ga0075369_10550483 3300006186 Bacteria 550
423 Ga0075427_10078170 3300006194 Bacteria 596
424 Ga0075366_10779444 3300006195 Bacteria 594
425 Ga0097621_100328367 3300006237 Bacteria 1356
426 Ga0097621_100697406 3300006237 Bacteria 934
427 Ga0097621_100879542 3300006237 Bacteria 833
428 Ga0097621_100957031 3300006237 Bacteria 799
429 Ga0097621_100961833 3300006237 Bacteria 797
430 Ga0097621_101203782 3300006237 Bacteria 713
431 Ga0097621_102327600 3300006237 Bacteria 513
432 Ga0075370_10472574 3300006353 Bacteria 755
433 Ga0068871_100302426 3300006358 Bacteria 1404
434 Ga0068871_100541437 3300006358 Bacteria 1053
435 Ga0068871_100596215 3300006358 Bacteria 1004
436 Ga0068871_100600994 3300006358 Bacteria 1000
437 Ga0068871_101361067 3300006358 Bacteria 668
438 Ga0068871_101411549 3300006358 Bacteria 656
439 Ga0075428_100888420 3300006844 Bacteria 945
440 Ga0075428_101611801 3300006844 Bacteria 678
441 Ga0075428_102085622 3300006844 Bacteria 587
442 Ga0075431_100905509 3300006847 Bacteria 851
443 Ga0075433_11081540 3300006852 Bacteria 698
444 Ga0075433_11190474 3300006852 Bacteria 661
445 Ga0075434_100237438 3300006871 Bacteria 1843
446 Ga0075434_100571031 3300006871 Bacteria 1150
447 Ga0075434_101273023 3300006871 Bacteria 746
448 Ga0075429_100910553 3300006880 Bacteria 770
449 Ga0068865_100153662 3300006881 Bacteria 1748
450 Ga0068865_100564506 3300006881 Bacteria 957
451 Ga0068865_100673199 3300006881 Bacteria 881
452 Ga0075436_101094712 3300006914 Bacteria 600
453 Ga0097620_100800069 3300006931 Bacteria 1030
454 Ga0097620_102002278 3300006931 Bacteria 639
455 Ga0097620_102491871 3300006931 Bacteria 570
456 Ga0099824_1024882 3300006942 Bacteria 3398
457 Ga0099824_1053160 3300006942 Bacteria 722
458 Ga0099823_1108690 3300006944 Bacteria 787
459 Ga0075435_100034111 3300007076 Bacteria 4029
460 Ga0075435_100983387 3300007076 Bacteria 737
461 Ga0099794_10160911 3300007265 Bacteria 1142
462 Ga0099794_10607784 3300007265 Bacteria 579
463 Ga0105251_10077967 3300009011 Bacteria 1535
464 Ga0105244_10126833 3300009036 Bacteria 1233
465 Ga0105244_10366205 3300009036 Bacteria 664
466 Ga0105250_10085050 3300009092 Bacteria 1284
467 Ga0105250_10090819 3300009092 Bacteria 1242
468 Ga0105250_10305041 3300009092 Bacteria 689
469 Ga0105240_10015249 3300009093 Bacteria 10455
470 Ga0105240_10211671 3300009093 Bacteria 2265
471 Ga0105240_10304374 3300009093 Bacteria 1822
472 Ga0105240_10787223 3300009093 Bacteria 1031
473 Ga0111539_11310944 3300009094 Bacteria 840
474 Ga0105245_10451094 3300009098 Bacteria 1295
475 Ga0105245_11106682 3300009098 Bacteria 838
476 Ga0105245_11654188 3300009098 Bacteria 692
477 Ga0105245_11684907 3300009098 Bacteria 686
478 Ga0105247_10069675 3300009101 Bacteria 2195
479 Ga0105247_10107897 3300009101 Bacteria 1788
480 Ga0105247_10301619 3300009101 Bacteria 1112
481 Ga0105247_10470171 3300009101 Bacteria 910
482 Ga0114129_10238310 3300009147 Bacteria 2447
483 Ga0114129_10883176 3300009147 Bacteria 1134
484 Ga0114129_10967434 3300009147 Bacteria 1074
485 Ga0105243_10457367 3300009148 Bacteria 1199
486 Ga0105243_10583022 3300009148 Bacteria 1074
487 Ga0105243_11052678 3300009148 Bacteria 819
488 Ga0105241_10237008 3300009174 Bacteria 1541
489 Ga0105241_10456731 3300009174 Bacteria 1131
490 Ga0105241_10943854 3300009174 Bacteria 804
491 Ga0105241_11561937 3300009174 Bacteria 637
492 Ga0105241_12356338 3300009174 Bacteria 531
493 Ga0105242_10481754 3300009176 Bacteria 1176
494 Ga0105242_10536426 3300009176 Bacteria 1119
495 Ga0105242_11190612 3300009176 Bacteria 781
496 Ga0105242_11268857 3300009176 Bacteria 759
497 Ga0105248_10287019 3300009177 Bacteria 1853
498 Ga0105248_10484564 3300009177 Bacteria 1394
499 Ga0105248_11213111 3300009177 Bacteria 853
500 Ga0105248_12109925 3300009177 Bacteria 641
501 Ga0105237_10235155 3300009545 Bacteria 1833
502 Ga0105237_10338060 3300009545 Bacteria 1510
503 Ga0105237_10390864 3300009545 Bacteria 1396
504 Ga0105237_10680694 3300009545 Bacteria 1035
505 Ga0105238_10251194 3300009551 Bacteria 1747
506 Ga0105238_10387575 3300009551 Bacteria 1389
507 Ga0105238_10430899 3300009551 Bacteria 1314
508 Ga0105238_10484149 3300009551 Bacteria 1237
509 Ga0105238_11118010 3300009551 Bacteria 811
510 Ga0105238_11230350 3300009551 Bacteria 774
511 Ga0105238_12077310 3300009551 Bacteria 602
512 Ga0105249_10331272 3300009553 Bacteria 1536
513 Ga0105249_10687617 3300009553 Bacteria 1082
514 Ga0105249_11093437 3300009553 Bacteria 867
515 Ga0105249_12016866 3300009553 Bacteria 650
516 Ga0105239_10374664 3300010375 Bacteria 1609
517 Ga0105239_10451209 3300010375 Bacteria 1459
518 Ga0105239_10618401 3300010375 Bacteria 1236
519 Ga0105239_10882653 3300010375 Bacteria 1026
520 Ga0105239_11110999 3300010375 Bacteria 910
521 Ga0105239_11561631 3300010375 Bacteria 763
522 Ga0105239_11749449 3300010375 Bacteria 720
523 Ga0105239_11986296 3300010375 Bacteria 675
524 Ga0105239_12746686 3300010375 Bacteria 575
525 Ga0105239_12785813 3300010375 Bacteria 571
526 Ga0105239_12993219 3300010375 Bacteria 551
527 Ga0105246_10103510 3300011119 Bacteria 2077
528 Ga0105246_10192588 3300011119 Bacteria 1579
529 Ga0105246_10920171 3300011119 Bacteria 786
530 Ga0105246_12164115 3300011119 Bacteria 540
531 Ga0105246_12446755 3300011119 Bacteria 513
532 Ga0157346_1033948 3300012480 Bacteria 510
533 Ga0157318_1001458 3300012482 Bacteria 1185
534 Ga0157335_1001532 3300012492 Bacteria 1282
535 Ga0157341_1004712 3300012494 Bacteria 997
536 Ga0157345_1005711 3300012498 Bacteria 970
537 Ga0157324_1001600 3300012506 Bacteria 1274
538 Ga0157324_1002531 3300012506 Bacteria 1122
539 Ga0157316_1008847 3300012510 Bacteria 891
540 Ga0157327_1006713 3300012512 Bacteria 979
541 Ga0157327_1066229 3300012512 Bacteria 550
542 Ga0157338_1016228 3300012515 Bacteria 820
543 Ga0157373_10431009 3300013100 Bacteria 947
544 Ga0157371_10030956 3300013102 Bacteria 3857
545 Ga0157371_10199288 3300013102 Bacteria 1435
546 Ga0157371_10659952 3300013102 Bacteria 781
547 Ga0157370_10181121 3300013104 Bacteria 1958
548 Ga0157370_10303801 3300013104 Bacteria 1473
549 Ga0157370_10411345 3300013104 Bacteria 1245
550 Ga0157370_10513595 3300013104 Bacteria 1100
551 Ga0157370_11734790 3300013104 Bacteria 560
552 Ga0157369_10066010 3300013105 Bacteria 3894
553 Ga0157369_10506634 3300013105 Bacteria 1249
554 Ga0157369_10541596 3300013105 Bacteria 1203
555 Ga0157369_10794066 3300013105 Bacteria 973
556 Ga0157369_11045214 3300013105 Bacteria 836
557 Ga0157369_11713282 3300013105 Bacteria 639
558 Ga0157369_12163267 3300013105 Bacteria 564
559 Ga0157374_10094106 3300013296 Bacteria 2863
560 Ga0157374_10169096 3300013296 Bacteria 2131
561 Ga0157374_11017345 3300013296 Bacteria 848
562 Ga0157374_11312189 3300013296 Bacteria 746
563 Ga0157374_11735515 3300013296 Bacteria 649
564 Ga0157378_10311380 3300013297 Bacteria 1527
565 Ga0157378_10978030 3300013297 Bacteria 880
566 Ga0157378_12292073 3300013297 Bacteria 591
567 Ga0163162_11109092 3300013306 Bacteria 897
568 Ga0163162_12357644 3300013306 Bacteria 612
569 Ga0157372_10802876 3300013307 Bacteria 1093
570 Ga0157375_10940741 3300013308 Bacteria 1006
571 Ga0157375_11009705 3300013308 Bacteria 971
572 Ga0157375_11028645 3300013308 Bacteria 962
573 Ga0157375_11882039 3300013308 Bacteria 710
574 Ga0157375_12904568 3300013308 Bacteria 573
575 Ga0163163_10017707 3300014325 Bacteria 6650
576 Ga0163163_10360053 3300014325 Bacteria 1511
577 Ga0163163_11078592 3300014325 Bacteria 866
578 Ga0163163_13167384 3300014325 Bacteria 513
579 Ga0157380_10808980 3300014326 Bacteria 955
580 Ga0157380_11040335 3300014326 Bacteria 854
581 Ga0157380_11459814 3300014326 Bacteria 736
582 Ga0157380_12639453 3300014326 Bacteria 569
583 Ga0182008_10293955 3300014497 Bacteria 848
584 Ga0182008_10921086 3300014497 Bacteria 516
585 Ga0157377_10141114 3300014745 Bacteria 1481
586 Ga0157377_10268647 3300014745 Bacteria 1113
587 Ga0157379_10486622 3300014968 Bacteria 1142
588 Ga0157379_10648558 3300014968 Bacteria 988
589 Ga0157379_11018876 3300014968 Bacteria 790
590 Ga0157379_12262247 3300014968 Bacteria 541
591 Ga0157376_10811586 3300014969 Bacteria 949
592 Ga0182006_1100373 3300015261 Bacteria 1028
593 Ga0182007_10011213 3300015262 Bacteria 3496
594 Ga0182005_1020757 3300015265 Bacteria 1805
595 Ga0163161_11434869 3300017792 Bacteria 604
596 Ga0197907_11128917 3300020069 Bacteria 603
597 Ga0206356_10074059 3300020070 Bacteria 574
598 Ga0206354_11719678 3300020081 Bacteria 751
599 Ga0206353_11678156 3300020082 Bacteria 858
600 Ga0154015_1142437 3300020610 Bacteria 834
601 Ga0214544_1000006 3300021320 Bacteria 380728
602 Ga0214542_1000002 3300021321 Bacteria 720798
603 Ga0214545_1000002 3300021324 Bacteria 727485
604 Ga0214543_1000017 3300021327 Bacteria 290109
605 Ga0213872_10299242 3300021361 Bacteria 668
606 Ga0213874_10209056 3300021377 Bacteria 705
607 Ga0213874_10227186 3300021377 Bacteria 680
608 Ga0213876_10002961 3300021384 Bacteria 9840
609 Ga0213876_10093668 3300021384 Bacteria 1591
610 Ga0213876_10202541 3300021384 Bacteria 1055
611 Ga0213876_10547824 3300021384 Bacteria 616
612 Ga0213875_10101062 3300021388 Bacteria 1346
613 Ga0213875_10126101 3300021388 Bacteria 1196
614 Ga0213875_10224794 3300021388 Bacteria 884
615 Ga0213871_10006446 3300021441 Bacteria 2482
616 Ga0213871_10089768 3300021441 Bacteria 889
617 Ga0213871_10170474 3300021441 Bacteria 669
618 Ga0224712_10221512 3300022467 Bacteria 866
619 Ga0224712_10311839 3300022467 Bacteria 738
620 Ga0224570_106162 3300022730 Bacteria 731
621 Ga0256744_143262 3300023309 Bacteria 1187
622 Ga0256744_145017 3300023309 Bacteria 566
623 Ga0256720_139338 3300023438 Bacteria 686
624 Ga0228600_1015241 3300024123 Bacteria 620
625 Ga0207672_1001513 3300025223 Bacteria 1730
626 Ga0207638_1006282 3300025227 Bacteria 531
627 Ga0207425_1021382 3300025245 Bacteria 1372
628 Ga0209677_100718 3300025253 Bacteria 16865
629 Ga0209677_100816 3300025253 Bacteria 15575
630 Ga0209148_1001736 3300025254 Bacteria 9496
631 Ga0209148_1046265 3300025254 Bacteria 580
632 Ga0209129_1056999 3300025258 Bacteria 584
633 Ga0209233_1006295 3300025261 Bacteria 3840
634 Ga0209233_1007083 3300025261 Bacteria 3577
635 Ga0209233_1040869 3300025261 Bacteria 1005
636 Ga0207666_1007469 3300025271 Bacteria 1440
637 Ga0209455_1002514 3300025272 Bacteria 7032
638 Ga0209130_1015211 3300025284 Bacteria 1904
639 Ga0207673_1009185 3300025290 Bacteria 1260
640 Ga0209676_1000092 3300025292 Bacteria 250453
641 Ga0209564_1047758 3300025295 Bacteria 1075
642 Ga0209758_1000216 3300025297 Bacteria 125352
643 Ga0209758_1005457 3300025297 Bacteria 9780
644 Ga0209758_1018858 3300025297 Bacteria 3359
645 Ga0209758_1044413 3300025297 Bacteria 1624
646 Ga0209758_1080478 3300025297 Bacteria 987
647 Ga0209758_1126229 3300025297 Bacteria 683
648 Ga0209050_1007859 3300025298 Bacteria 5857
649 Ga0209050_1045832 3300025298 Bacteria 1155
650 Ga0209256_1024103 3300025299 Bacteria 1798
651 Ga0209051_1029640 3300025303 Bacteria 2138
652 Ga0209257_1005510 3300025304 Bacteria 8840
653 Ga0207697_10015577 3300025315 Bacteria 3139
654 Ga0207697_10072875 3300025315 Bacteria 1441
655 Ga0207656_10210820 3300025321 Bacteria 941
656 Ga0207696_1029921 3300025711 Bacteria 1659
657 Ga0207696_1096473 3300025711 Bacteria 808
658 Ga0207713_1058988 3300025735 Bacteria 1475
659 Ga0207653_10002069 3300025885 Bacteria 6392
660 Ga0207653_10017255 3300025885 Bacteria 2271
661 Ga0207682_10076343 3300025893 Bacteria 1428
662 Ga0207692_10015101 3300025898 Bacteria 3390
663 Ga0207692_10199911 3300025898 Bacteria 1174
664 Ga0207692_10278944 3300025898 Bacteria 1011
665 Ga0207692_10720784 3300025898 Bacteria 648
666 Ga0207692_10831105 3300025898 Bacteria 605
667 Ga0207642_10121376 3300025899 Bacteria 1348
668 Ga0207710_10019030 3300025900 Bacteria 2927
669 Ga0207710_10178627 3300025900 Bacteria 1040
670 Ga0207688_10142614 3300025901 Bacteria 1411
671 Ga0207688_10545896 3300025901 Bacteria 728
672 Ga0207680_10528736 3300025903 Bacteria 841
673 Ga0207680_10576020 3300025903 Bacteria 804
674 Ga0207680_10599174 3300025903 Bacteria 788
675 Ga0207680_10975335 3300025903 Bacteria 607
676 Ga0207647_10020149 3300025904 Bacteria 4476
677 Ga0207647_10068430 3300025904 Bacteria 2149
678 Ga0207647_10112413 3300025904 Bacteria 1610
679 Ga0207647_10227696 3300025904 Bacteria 1073
680 Ga0207647_10301007 3300025904 Bacteria 913
681 Ga0207647_10707128 3300025904 Bacteria 549
682 Ga0207647_10756763 3300025904 Bacteria 525
683 Ga0207685_10016806 3300025905 Bacteria 2350
684 Ga0207685_10098307 3300025905 Bacteria 1246
685 Ga0207685_10214843 3300025905 Bacteria 911
686 Ga0207685_10280879 3300025905 Bacteria 817
687 Ga0207699_10003266 3300025906 Bacteria 7726
688 Ga0207699_10043358 3300025906 Bacteria 2612
689 Ga0207699_10143768 3300025906 Bacteria 1570
690 Ga0207699_10475049 3300025906 Bacteria 900
691 Ga0207645_10826170 3300025907 Bacteria 630
692 Ga0207643_10012061 3300025908 Bacteria 4668
693 Ga0207643_10131241 3300025908 Bacteria 1491
694 Ga0207643_10181987 3300025908 Bacteria 1272
695 Ga0207705_10010986 3300025909 Bacteria 6576
696 Ga0207705_10097389 3300025909 Bacteria 2160
697 Ga0207705_10768521 3300025909 Bacteria 748
698 Ga0207705_10988152 3300025909 Bacteria 650
699 Ga0207684_10040904 3300025910 Bacteria 3930
700 Ga0207684_11627439 3300025910 Bacteria 522
701 Ga0207654_10105637 3300025911 Bacteria 1743
702 Ga0207654_10164404 3300025911 Bacteria 1436
703 Ga0207654_11012770 3300025911 Bacteria 604
704 Ga0207707_10002337 3300025912 Bacteria 17081
705 Ga0207707_10080082 3300025912 Bacteria 2852
706 Ga0207707_10145456 3300025912 Bacteria 2072
707 Ga0207695_10000599 3300025913 Bacteria 72238
708 Ga0207695_10096164 3300025913 Bacteria 2964
709 Ga0207695_10209708 3300025913 Bacteria 1859
710 Ga0207695_10592620 3300025913 Bacteria 990
711 Ga0207695_10617376 3300025913 Bacteria 965
712 Ga0207695_10731736 3300025913 Bacteria 870
713 Ga0207671_10041691 3300025914 Bacteria 3398
714 Ga0207671_10049735 3300025914 Bacteria 3103
715 Ga0207671_10151010 3300025914 Bacteria 1795
716 Ga0207671_10164259 3300025914 Bacteria 1721
717 Ga0207671_10175689 3300025914 Bacteria 1665
718 Ga0207671_10373274 3300025914 Bacteria 1133
719 Ga0207671_10469087 3300025914 Bacteria 1003
720 Ga0207671_10477111 3300025914 Bacteria 994
721 Ga0207671_10652641 3300025914 Bacteria 838
722 Ga0207693_10001926 3300025915 Bacteria 18180
723 Ga0207693_10004694 3300025915 Bacteria 11503
724 Ga0207693_10026373 3300025915 Bacteria 4599
725 Ga0207693_10238778 3300025915 Bacteria 1427
726 Ga0207693_10884951 3300025915 Bacteria 686
727 Ga0207693_11386650 3300025915 Bacteria 522
728 Ga0207663_10000218 3300025916 Bacteria 25518
729 Ga0207663_10090962 3300025916 Bacteria 2025
730 Ga0207663_10329300 3300025916 Bacteria 1150
731 Ga0207663_10422764 3300025916 Bacteria 1023
732 Ga0207663_10679848 3300025916 Bacteria 814
733 Ga0207663_11288253 3300025916 Bacteria 589
734 Ga0207663_11570433 3300025916 Bacteria 530
735 Ga0207663_11578758 3300025916 Bacteria 528
736 Ga0207660_10001861 3300025917 Bacteria 14060
737 Ga0207660_10128616 3300025917 Bacteria 1926
738 Ga0207660_10278877 3300025917 Bacteria 1326
739 Ga0207660_10351646 3300025917 Bacteria 1181
740 Ga0207660_10520866 3300025917 Bacteria 966
741 Ga0207660_10594681 3300025917 Bacteria 901
742 Ga0207660_10655068 3300025917 Bacteria 856
743 Ga0207662_10091281 3300025918 Bacteria 1874
744 Ga0207662_11090910 3300025918 Bacteria 567
745 Ga0207657_10036025 3300025919 Bacteria 4432
746 Ga0207657_10042894 3300025919 Bacteria 3988
747 Ga0207657_10332331 3300025919 Bacteria 1200
748 Ga0207657_10853232 3300025919 Bacteria 703
749 Ga0207649_10352776 3300025920 Bacteria 1089
750 Ga0207649_10634639 3300025920 Bacteria 824
751 Ga0207649_11294752 3300025920 Bacteria 576
752 Ga0207652_10103136 3300025921 Bacteria 2522
753 Ga0207652_10139580 3300025921 Bacteria 2166
754 Ga0207652_10149458 3300025921 Bacteria 2091
755 Ga0207652_10158183 3300025921 Bacteria 2030
756 Ga0207652_10507930 3300025921 Bacteria 1085
757 Ga0207652_11013804 3300025921 Bacteria 729
758 Ga0207646_10031466 3300025922 Bacteria 4803
759 Ga0207681_11051460 3300025923 Bacteria 683
760 Ga0207681_11451831 3300025923 Bacteria 575
761 Ga0207694_10010694 3300025924 Bacteria 6927
762 Ga0207694_10100516 3300025924 Bacteria 2291
763 Ga0207694_10264619 3300025924 Bacteria 1409
764 Ga0207694_10555102 3300025924 Bacteria 964
765 Ga0207694_10562107 3300025924 Bacteria 958
766 Ga0207694_11073256 3300025924 Bacteria 681
767 Ga0207694_11154708 3300025924 Bacteria 655
768 Ga0207650_10105480 3300025925 Bacteria 2176
769 Ga0207650_10628591 3300025925 Bacteria 904
770 Ga0207659_10605679 3300025926 Bacteria 934
771 Ga0207687_10203762 3300025927 Bacteria 1548
772 Ga0207687_10495078 3300025927 Bacteria 1020
773 Ga0207687_10710286 3300025927 Bacteria 854
774 Ga0207687_10819685 3300025927 Bacteria 794
775 Ga0207700_10005204 3300025928 Bacteria 7752
776 Ga0207700_10009359 3300025928 Bacteria 6115
777 Ga0207700_10055325 3300025928 Bacteria 2982
778 Ga0207700_10348260 3300025928 Bacteria 1289
779 Ga0207700_11060374 3300025928 Bacteria 725
780 Ga0207664_10099390 3300025929 Bacteria 2401
781 Ga0207664_10499264 3300025929 Bacteria 1089
782 Ga0207664_10724428 3300025929 Bacteria 894
783 Ga0207644_10092068 3300025931 Bacteria 2261
784 Ga0207644_10842734 3300025931 Bacteria 767
785 Ga0207644_10980567 3300025931 Bacteria 709
786 Ga0207690_10149305 3300025932 Bacteria 1731
787 Ga0207690_10213247 3300025932 Bacteria 1473
788 Ga0207706_10024819 3300025933 Bacteria 5373
789 Ga0207706_10131620 3300025933 Bacteria 2200
790 Ga0207686_10204152 3300025934 Bacteria 1417
791 Ga0207686_11207648 3300025934 Bacteria 619
792 Ga0207686_11252922 3300025934 Bacteria 608
793 Ga0207709_10566505 3300025935 Bacteria 895
794 Ga0207709_10595833 3300025935 Bacteria 875
795 Ga0207709_10712839 3300025935 Bacteria 804
796 Ga0207670_10089648 3300025936 Bacteria 2171
797 Ga0207670_10816356 3300025936 Bacteria 778
798 Ga0207669_10456618 3300025937 Bacteria 1013
799 Ga0207669_11722160 3300025937 Bacteria 535
800 Ga0207704_10483901 3300025938 Bacteria 994
801 Ga0207704_11174997 3300025938 Bacteria 654
802 Ga0207665_10005572 3300025939 Bacteria 8396
803 Ga0207665_10034046 3300025939 Bacteria 3380
804 Ga0207665_10392166 3300025939 Bacteria 1056
805 Ga0207665_10431391 3300025939 Bacteria 1008
806 Ga0207665_10436966 3300025939 Bacteria 1002
807 Ga0207665_10465328 3300025939 Bacteria 972
808 Ga0207665_10941506 3300025939 Bacteria 686
809 Ga0207665_11396731 3300025939 Bacteria 557
810 Ga0207691_10436970 3300025940 Bacteria 1114
811 Ga0207691_10727220 3300025940 Bacteria 836
812 Ga0207711_10396889 3300025941 Bacteria 1281
813 Ga0207711_10520074 3300025941 Bacteria 1109
814 Ga0207711_10877760 3300025941 Bacteria 834
815 Ga0207711_11777552 3300025941 Bacteria 560
816 Ga0207689_10099958 3300025942 Bacteria 2383
817 Ga0207661_10093678 3300025944 Bacteria 2507
818 Ga0207661_10103355 3300025944 Bacteria 2397
819 Ga0207661_10189852 3300025944 Bacteria 1801
820 Ga0207661_10572769 3300025944 Bacteria 1035
821 Ga0207661_11060759 3300025944 Bacteria 746
822 Ga0207661_11723184 3300025944 Bacteria 572
823 Ga0207679_10656984 3300025945 Bacteria 949
824 Ga0207679_11311592 3300025945 Bacteria 664
825 Ga0207679_11318149 3300025945 Bacteria 662
826 Ga0207679_12004273 3300025945 Bacteria 527
827 Ga0207667_10002033 3300025949 Bacteria 25353
828 Ga0207667_10078098 3300025949 Bacteria 3432
829 Ga0207667_10230656 3300025949 Bacteria 1896
830 Ga0207667_10313159 3300025949 Bacteria 1603
831 Ga0207667_11060299 3300025949 Bacteria 795
832 Ga0207667_11624525 3300025949 Bacteria 614
833 Ga0207667_11644202 3300025949 Bacteria 610
834 Ga0207667_11936288 3300025949 Bacteria 551
835 Ga0207651_10462584 3300025960 Bacteria 1090
836 Ga0207651_10465316 3300025960 Bacteria 1087
837 Ga0207712_10036565 3300025961 Bacteria 3345
838 Ga0207712_10393717 3300025961 Bacteria 1163
839 Ga0207712_10443490 3300025961 Bacteria 1099
840 Ga0207712_11732522 3300025961 Bacteria 560
841 Ga0207668_10065864 3300025972 Bacteria 2565
842 Ga0207668_10194977 3300025972 Bacteria 1608
843 Ga0207668_11333017 3300025972 Bacteria 646
844 Ga0207640_10213722 3300025981 Bacteria 1471
845 Ga0207640_10932233 3300025981 Bacteria 760
846 Ga0207640_10997151 3300025981 Bacteria 737
847 Ga0207658_10434767 3300025986 Bacteria 1159
848 Ga0207658_11001870 3300025986 Bacteria 762
849 Ga0207658_11582888 3300025986 Bacteria 599
850 Ga0207677_10300288 3300026023 Bacteria 1326
851 Ga0207677_10569275 3300026023 Bacteria 990
852 Ga0207677_10853772 3300026023 Bacteria 818
853 Ga0207703_10124606 3300026035 Bacteria 2216
854 Ga0207703_11714577 3300026035 Bacteria 604
855 Ga0207639_10440911 3300026041 Bacteria 1181
856 Ga0207639_10876820 3300026041 Bacteria 838
857 Ga0207639_11102611 3300026041 Bacteria 744
858 Ga0207639_11198117 3300026041 Bacteria 713
859 Ga0207639_11331078 3300026041 Bacteria 674
860 Ga0207639_11371577 3300026041 Bacteria 663
861 Ga0207639_11593888 3300026041 Bacteria 612
862 Ga0207639_12183586 3300026041 Bacteria 515
863 Ga0207678_10135862 3300026067 Bacteria 2098
864 Ga0207678_10793169 3300026067 Bacteria 836
865 Ga0207678_10847445 3300026067 Bacteria 808
866 Ga0207678_11060731 3300026067 Bacteria 717
867 Ga0207678_11126406 3300026067 Bacteria 695
868 Ga0207708_10226623 3300026075 Bacteria 1499
869 Ga0207702_10000678 3300026078 Bacteria 36963
870 Ga0207702_10266620 3300026078 Bacteria 1614
871 Ga0207702_10318449 3300026078 Bacteria 1481
872 Ga0207702_10808502 3300026078 Bacteria 927
873 Ga0207641_10040588 3300026088 Bacteria 3898
874 Ga0207641_10091980 3300026088 Bacteria 2656
875 Ga0207641_10829841 3300026088 Bacteria 915
876 Ga0207641_11173038 3300026088 Bacteria 767
877 Ga0207648_10095334 3300026089 Bacteria 2603
878 Ga0207676_10105473 3300026095 Bacteria 2346
879 Ga0207676_10429026 3300026095 Bacteria 1241
880 Ga0207676_11376729 3300026095 Bacteria 701
881 Ga0207676_11730826 3300026095 Bacteria 623
882 Ga0207674_10068821 3300026116 Bacteria 3562
883 Ga0207674_10151658 3300026116 Bacteria 2275
884 Ga0207674_10344003 3300026116 Bacteria 1442
885 Ga0207674_10408733 3300026116 Bacteria 1312
886 Ga0207674_10585720 3300026116 Bacteria 1078
887 Ga0207674_11406500 3300026116 Bacteria 667
888 Ga0207675_100186246 3300026118 Bacteria 1990
889 Ga0207675_100221646 3300026118 Bacteria 1822
890 Ga0207675_100297058 3300026118 Bacteria 1572
891 Ga0207683_10131427 3300026121 Bacteria 2252
892 Ga0207683_10277976 3300026121 Bacteria 1530
893 Ga0207683_10647911 3300026121 Bacteria 978
894 Ga0207683_10917803 3300026121 Bacteria 813
895 Ga0207683_11537903 3300026121 Bacteria 614
896 Ga0207698_10254423 3300026142 Bacteria 1609
897 Ga0207698_10265499 3300026142 Bacteria 1579
898 Ga0207698_10625049 3300026142 Bacteria 1064
899 Ga0207698_11257826 3300026142 Bacteria 754
900 Ga0209389_1002002 3300027296 Bacteria 15108
901 Ga0209589_1000009 3300027357 Bacteria 252104
902 Ga0209589_1000300 3300027357 Bacteria 63625
903 Ga0209489_100010 3300027361 Bacteria 252139
904 Ga0209489_109706 3300027361 Bacteria 11675
905 Ga0209700_100017 3300027363 Bacteria 252104
906 Ga0209700_100031 3300027363 Bacteria 207349
907 Ga0209179_1016523 3300027512 Bacteria 1386
908 Ga0209588_1013306 3300027671 Bacteria 2509
909 Ga0209813_10052606 3300027866 Bacteria 1278
910 Ga0207428_10698583 3300027907 Bacteria 726
911 Ga0265357_1043259 3300028023 Bacteria 531
912 Ga0268266_10432636 3300028379 Bacteria 1248
913 Ga0268266_10516658 3300028379 Bacteria 1141
914 Ga0268266_10692132 3300028379 Bacteria 982
915 Ga0268266_10693153 3300028379 Bacteria 981
916 Ga0268266_10865756 3300028379 Bacteria 873
917 Ga0268266_10881650 3300028379 Bacteria 865
918 Ga0268266_10965476 3300028379 Bacteria 824
919 Ga0268266_11424766 3300028379 Bacteria 668
920 Ga0268265_10092241 3300028380 Bacteria 2423
921 Ga0268265_12428101 3300028380 Bacteria 530
922 Ga0268264_10000655 3300028381 Bacteria 40734
923 Ga0268264_11055124 3300028381 Bacteria 820
924 Ga0265337_1002429 3300028556 Bacteria 8569
925 Ga0265337_1172188 3300028556 Bacteria 587
926 Ga0265326_10001795 3300028558 Bacteria 7402
927 Ga0265319_1001825 3300028563 Bacteria 12143
928 Ga0265334_10000469 3300028573 Bacteria 20809
929 Ga0265334_10116721 3300028573 Bacteria 956
930 Ga0265318_10007417 3300028577 Bacteria 4956
931 Ga0265323_10001237 3300028653 Bacteria 12839
932 Ga0265322_10015443 3300028654 Bacteria 2206
933 Ga0265336_10000535 3300028666 Bacteria 21804
934 Ga0307517_10000125 3300028786 Bacteria 115466
935 Ga0307517_10420063 3300028786 Bacteria 701
936 Ga0307515_10326210 3300028794 Bacteria 1197
937 Ga0265338_10000131 3300028800 Bacteria 137627
938 Ga0265338_10468718 3300028800 Bacteria 890
939 Ga0311000_102944 3300029272 Bacteria 1513
940 Ga0311001_1018422 3300029277 Bacteria 2218
941 Ga0310982_104980 3300029283 Bacteria 1457
942 Ga0310981_1050683 3300029285 Bacteria 1109
943 Ga0265324_10001269 3300029957 Bacteria 14862
944 Ga0307511_10068859 3300030521 Bacteria 2608
945 Ga0307511_10308670 3300030521 Bacteria 708
946 Ga0307512_10152314 3300030522 Bacteria 1379
947 Ga0265761_103791 3300030889 Bacteria 754
948 Ga0265768_111923 3300030963 Bacteria 576
949 Ga0265771_1018073 3300031010 Bacteria 589
950 Ga0265773_1003180 3300031018 Bacteria 1059
951 Ga0265760_10067413 3300031090 Bacteria 1094
952 Ga0265760_10109829 3300031090 Bacteria 878
953 Ga0265330_10016493 3300031235 Bacteria 3407
954 Ga0265330_10075674 3300031235 Bacteria 1453
955 Ga0265330_10167684 3300031235 Bacteria 931
956 Ga0265332_10033161 3300031238 Bacteria 2248
957 Ga0265332_10147072 3300031238 Bacteria 986
958 Ga0265328_10028357 3300031239 Bacteria 2094
959 Ga0265328_10104084 3300031239 Bacteria 1052
960 Ga0265328_10264086 3300031239 Bacteria 660
961 Ga0265325_10067472 3300031241 Bacteria 1802
962 Ga0265325_10112600 3300031241 Bacteria 1320
963 Ga0265325_10144404 3300031241 Bacteria 1130
964 Ga0265340_10006598 3300031247 Bacteria 6374
965 Ga0265340_10036269 3300031247 Bacteria 2444
966 Ga0265340_10072056 3300031247 Bacteria 1636
967 Ga0265339_10006928 3300031249 Bacteria 7379
968 Ga0265339_10096535 3300031249 Bacteria 1542
969 Ga0265339_10304348 3300031249 Bacteria 759
970 Ga0265339_10442930 3300031249 Bacteria 603
971 Ga0265331_10149637 3300031250 Bacteria 1060
972 Ga0265331_10209681 3300031250 Bacteria 877
973 Ga0265331_10525126 3300031250 Bacteria 533
974 Ga0265316_10644101 3300031344 Bacteria 750
975 Ga0265316_10893645 3300031344 Bacteria 621
976 Ga0265316_11143741 3300031344 Bacteria 539
977 Ga0307513_10349645 3300031456 Bacteria 1226
978 Ga0307513_10405277 3300031456 Bacteria 1097
979 Ga0307509_10041031 3300031507 Bacteria 5027
980 Ga0307509_10213458 3300031507 Bacteria 1751
981 Ga0307509_10256135 3300031507 Bacteria 1529
982 Ga0307509_10690526 3300031507 Bacteria 687
983 Ga0307408_100167290 3300031548 Bacteria 1752
984 Ga0307408_101416366 3300031548 Bacteria 655
985 Ga0307408_102304792 3300031548 Bacteria 521
986 Ga0265313_10172436 3300031595 Bacteria 913
987 Ga0265313_10407388 3300031595 Bacteria 533
988 Ga0307508_10000378 3300031616 Bacteria 53801
989 Ga0307508_10136036 3300031616 Bacteria 2060
990 Ga0307508_10800598 3300031616 Bacteria 559
991 Ga0307514_10159812 3300031649 Bacteria 1494
992 Ga0265314_10002508 3300031711 Bacteria 18725
993 Ga0265314_10004990 3300031711 Bacteria 12094
994 Ga0265314_10016237 3300031711 Bacteria 5892
995 Ga0265314_10087191 3300031711 Bacteria 2041
996 Ga0265314_10242562 3300031711 Bacteria 1039
997 Ga0265342_10009360 3300031712 Bacteria 6914
998 Ga0265342_10142264 3300031712 Bacteria 1338
999 Ga0265342_10198530 3300031712 Bacteria 1091
1000 Ga0307516_10092591 3300031730 Bacteria 2849
1001 Ga0307516_10212983 3300031730 Bacteria 1645
1002 Ga0307516_10238643 3300031730 Bacteria 1517
1003 Ga0307516_10709467 3300031730 Bacteria 663
1004 Ga0307516_10721826 3300031730 Bacteria 654
1005 Ga0307405_10050000 3300031731 Bacteria 2586
1006 Ga0307405_10349799 3300031731 Bacteria 1139
1007 Ga0307405_11172692 3300031731 Bacteria 663
1008 Ga0307405_11596793 3300031731 Bacteria 575
1009 Ga0316045_122586 3300031815 Bacteria 588
1010 Ga0307413_10088897 3300031824 Bacteria 2005
1011 Ga0307413_11321041 3300031824 Bacteria 632
1012 Ga0307410_10315181 3300031852 Bacteria 1239
1013 Ga0307410_11264763 3300031852 Bacteria 644
1014 Ga0307406_10161839 3300031901 Bacteria 1610
1015 Ga0307406_10768447 3300031901 Bacteria 810
1016 Ga0307412_10450773 3300031911 Bacteria 1060
1017 Ga0307412_10463049 3300031911 Bacteria 1047
1018 Ga0307412_10567802 3300031911 Bacteria 955
1019 Ga0307412_10686179 3300031911 Bacteria 877
1020 Ga0307412_10702076 3300031911 Bacteria 868
1021 Ga0307409_100045054 3300031995 Bacteria 3327
1022 Ga0307409_100814041 3300031995 Bacteria 942
1023 Ga0307409_101540635 3300031995 Bacteria 692
1024 Ga0307409_102625180 3300031995 Bacteria 532
1025 Ga0307409_102736046 3300031995 Bacteria 521
1026 Ga0307416_100140627 3300032002 Bacteria 2193
1027 Ga0307416_100457707 3300032002 Bacteria 1330
1028 Ga0307416_100468773 3300032002 Bacteria 1316
1029 Ga0307416_102089356 3300032002 Bacteria 668
1030 Ga0307416_102527869 3300032002 Bacteria 612
1031 Ga0307414_10317675 3300032004 Bacteria 1324
1032 Ga0307411_10061926 3300032005 Bacteria 2493
1033 Ga0307411_10551428 3300032005 Bacteria 983
1034 Ga0307411_10973575 3300032005 Bacteria 758
1035 Ga0307415_100342883 3300032126 Bacteria 1254
1036 Ga0307415_100387014 3300032126 Bacteria 1189
1037 Ga0307415_101066921 3300032126 Bacteria 754
1038 Ga0307415_101444714 3300032126 Bacteria 656
1039 Ga0307415_102045526 3300032126 Bacteria 558
1040 Ga0307507_10023232 3300033179 Bacteria 6813
1041 Ga0307507_10337948 3300033179 Bacteria 894
1042 Ga0307507_10597521 3300033179 Bacteria 571
1043 Ga0307510_10019223 3300033180 Bacteria 8016
1044 Ga0307510_10123491 3300033180 Bacteria 2286
1045 Ga0307510_10124603 3300033180 Bacteria 2270
1046 Ga0307510_10140272 3300033180 Bacteria 2062
1047 Ga0307510_10321755 3300033180 Bacteria 1003
1048 Ga0307510_10650117 3300033180 Bacteria 512
1049 Ga0315911_1000009 3300033442 Bacteria 379354
1050 Ga0316214_1028574 3300033545 Bacteria 789
1051 Ga0316212_1034504 3300033547 Bacteria 713
1052 Ga0373948_0058926 3300034817 Bacteria 840
1053 Ga0373950_0013658 3300034818 Bacteria 1357
1054 Ga0373950_0033779 3300034818 Bacteria 957
1055 Ga0373958_0037304 3300034819 Bacteria 980
1056 Ga0373958_0055612 3300034819 Bacteria 845
1057 Ga0373959_0020725 3300034820 Bacteria 1257
1058 Ga0373959_0051762 3300034820 Bacteria 888
1059 Ga0373938_0026528 3300034957 Bacteria 1213
1060 Ga0373926_0025367 3300035083 Bacteria 2068
1061 Ga0373926_0131362 3300035083 Bacteria 948
1062 Ga0373926_0188086 3300035083 Bacteria 793
1063 Ga0373926_0224868 3300035083 Bacteria 725
1064 Ga0373926_0242215 3300035083 Bacteria 698
1065 Ga0373928_0038023 3300035084 Bacteria 1094
1066 Ga0373929_0078095 3300035085 Bacteria 802
1067 Ga0373934_0269350 3300035086 Bacteria 705
1068 Ga0373934_0483326 3300035086 Bacteria 520
1069 Ga0373940_0011530 3300035088 Bacteria 2100
1070 Ga0373944_0133462 3300035089 Bacteria 864
1071 Ga0373944_0185316 3300035089 Bacteria 748
1072 Ga0373944_0341438 3300035089 Bacteria 568
1073 Ga0373949_0035023 3300035090 Bacteria 1213
1074 Ga0373949_0113660 3300035090 Bacteria 754
1075 Ga0373951_0038711 3300035091 Bacteria 1144
1076 Ga0373951_0130585 3300035091 Bacteria 691
1077 Ga0373952_0074529 3300035092 Bacteria 855
1078 Ga0373952_0157212 3300035092 Bacteria 642
1079 Ga0373923_0062774 3300035111 Bacteria 1581
1080 Ga0373923_0127792 3300035111 Bacteria 1140
1081 Ga0373923_0202236 3300035111 Bacteria 918
1082 Ga0373923_0340211 3300035111 Bacteria 715
1083 Ga0373932_0158548 3300035112 Bacteria 781
1084 Ga0373932_0312753 3300035112 Bacteria 589
1085 Ga0373936_0033332 3300035113 Bacteria 2041
1086 Ga0373936_0238849 3300035113 Bacteria 809
1087 Ga0373936_0320009 3300035113 Bacteria 703
1088 Ga0373936_0433909 3300035113 Bacteria 606
1089 Ga0373936_0462778 3300035113 Bacteria 587
1090 Ga0373939_0191482 3300035114 Bacteria 768
1091 Ga0373939_0425869 3300035114 Bacteria 554
1092 Ga0373939_0452789 3300035114 Bacteria 540
1093 Ga0373941_0313728 3300035115 Bacteria 629
1094 Ga0373945_0009397 3300035116 Bacteria 3203
1095 Ga0373945_0355918 3300035116 Bacteria 635
1096 Ga0373953_0031449 3300035117 Bacteria 2064
1097 Ga0373953_0051114 3300035117 Bacteria 1670
1098 Ga0373953_0097697 3300035117 Bacteria 1233
1099 Ga0373953_0283753 3300035117 Bacteria 722
1100 Ga0373954_0012064 3300035118 Bacteria 3839
1101 Ga0373954_0075568 3300035118 Bacteria 1604
1102 Ga0373954_0249343 3300035118 Bacteria 874
1103 Ga0373954_0289386 3300035118 Bacteria 808
1104 Ga0373954_0418153 3300035118 Bacteria 663
1105 Ga0373956_0142852 3300035119 Bacteria 1124
1106 Ga0373956_0304224 3300035119 Bacteria 759
1107 Ga0373956_0586022 3300035119 Bacteria 532
1108 Ga0373957_0033631 3300035120 Bacteria 1894
1109 Ga0373957_0055160 3300035120 Bacteria 1527
1110 Ga0373957_0111375 3300035120 Bacteria 1102
1111 Ga0373957_0139175 3300035120 Bacteria 991
1112 Ga0373957_0474941 3300035120 Bacteria 543
1113 Ga0373960_0443320 3300035121 Bacteria 508
1114 Ga0373943_0003463 3300035170 Bacteria 7175
1115 Ga0373943_0006179 3300035170 Bacteria 5376
1116 Ga0373943_0013859 3300035170 Bacteria 3645
1117 Ga0373943_0146685 3300035170 Bacteria 1275
1118 Ga0373943_0266476 3300035170 Bacteria 965
1119 Ga0373943_0807434 3300035170 Bacteria 558
1120 Ga0373946_0334572 3300035171 Bacteria 754
1121 Ga0373946_0364512 3300035171 Bacteria 724
1122 Ga0373946_0637439 3300035171 Bacteria 554
1123 Ga0373946_0691778 3300035171 Bacteria 533
1124 Ga0373955_0005659 3300035172 Bacteria 5625
1125 Ga0373955_0011340 3300035172 Bacteria 4243
1126 Ga0373955_0262980 3300035172 Bacteria 1036
1127 Ga0373955_0536469 3300035172 Bacteria 715
1128 Ga0373942_0030182 3300035207 Bacteria 1427
1129 Ga0373961_0192565 3300035241 Bacteria 716
1130 Ga0373962_0006059 3300035242 Bacteria 2923
1131 Ga0373962_0131540 3300035242 Bacteria 806
1132 Ga0373924_0002732 3300035410 Bacteria 5961
1133 Ga0373924_0093590 3300035410 Bacteria 1287
1134 Ga0373924_0314712 3300035410 Bacteria 695
1135 Ga0373931_0036584 3300035691 Bacteria 2559
1136 Ga0373931_0707194 3300035691 Bacteria 666
1137 Ga0373931_0822304 3300035691 Bacteria 620
1138 Ga0373935_0006317 3300035692 Bacteria 7061
1139 Ga0373935_0010090 3300035692 Bacteria 5657
1140 Ga0373935_0301450 3300035692 Bacteria 1133
1141 Ga0373935_0331585 3300035692 Bacteria 1082
1142 Ga0373935_0398098 3300035692 Bacteria 988
1143 Ga0373935_0442809 3300035692 Bacteria 938
1144 Ga0373935_0489269 3300035692 Bacteria 892
1145 Ga0373927_0014366 3300035695 Bacteria 5243
1146 Ga0373927_0019406 3300035695 Bacteria 4458
1147 Ga0373927_0019967 3300035695 Bacteria 4394
1148 Ga0373927_0025263 3300035695 Bacteria 3882
1149 Ga0373927_0025754 3300035695 Bacteria 3845
1150 Ga0373927_0076507 3300035695 Bacteria 2167
1151 Ga0373927_0227092 3300035695 Bacteria 1226
1152 Ga0373927_0614498 3300035695 Bacteria 718
1153 Ga0373927_0688980 3300035695 Bacteria 675
1154 Ga0373927_1160560 3300035695 Bacteria 509
1155 Ga0373933_0000226 3300035724 Bacteria 37516
1156 Ga0373933_0198434 3300035724 Bacteria 1283
1157 Ga0373933_0206797 3300035724 Bacteria 1257
1158 Ga0373933_0258678 3300035724 Bacteria 1122
1159 Ga0373933_0275621 3300035724 Bacteria 1086
1160 Ga0373933_0562146 3300035724 Bacteria 748
1161 Ga0373933_0666971 3300035724 Bacteria 684
1162 Ga0373947_0005298 3300035725 Bacteria 7541
1163 Ga0373947_0015233 3300035725 Bacteria 4414
1164 Ga0373947_0034609 3300035725 Bacteria 2988
1165 Ga0373947_0373337 3300035725 Bacteria 959
1166 Ga0373947_0436425 3300035725 Bacteria 886
1167 Ga0373947_0481192 3300035725 Bacteria 842
1168 Ga0310104_00079 3300036242 Bacteria 4049
1169 Ga0373937_0025879 3300036401 Bacteria 5299
1170 Ga0373937_0080661 3300036401 Bacteria 3009
1171 Ga0373937_0166265 3300036401 Bacteria 2068
1172 Ga0373937_0480261 3300036401 Bacteria 1180
1173 Ga0373937_0778963 3300036401 Bacteria 904
1174 Ga0372808_022249 3300036459 Bacteria 911
1175 Ga0316582_0038913 3300036647 Bacteria 2959
1176 Ga0373925_0005636 3300037068 Bacteria 9315
1177 Ga0373925_0008352 3300037068 Bacteria 7539
1178 Ga0373925_0052935 3300037068 Bacteria 3033
1179 Ga0373925_0102737 3300037068 Bacteria 2199
1180 Ga0373925_0197582 3300037068 Bacteria 1598
1181 Ga0373925_0457697 3300037068 Bacteria 1045
1182 Ga0373925_0561488 3300037068 Bacteria 939
1183 Ga0373925_0568937 3300037068 Bacteria 932
1184 Ga0373925_0827427 3300037068 Bacteria 763
1185 Ga0373925_0896368 3300037068 Bacteria 731
1186 Ga0373925_1141730 3300037068 Bacteria 641
1187 Ga0373925_1670787 3300037068 Bacteria 520
1188 Ga0395899_0013235 3300037312 Bacteria 6312
1189 Ga0395899_0116869 3300037312 Bacteria 1913
1190 Ga0395899_0226664 3300037312 Bacteria 1292
1191 Ga0395899_0377375 3300037312 Bacteria 943
1192 Ga0395899_0600117 3300037312 Bacteria 701
1193 Ga0395899_0601856 3300037312 Bacteria 700
1194 Ga0395899_0719359 3300037312 Bacteria 624
1195 Ga0395900_0010887 3300037418 Bacteria 9299
1196 Ga0395900_0049338 3300037418 Bacteria 4336
1197 Ga0395900_0050005 3300037418 Bacteria 4306
1198 Ga0395900_0165040 3300037418 Bacteria 2257
1199 Ga0395900_0240896 3300037418 Bacteria 1814
1200 Ga0395900_0692111 3300037418 Bacteria 953
1201 Ga0395900_0938774 3300037418 Bacteria 787
1202 Ga0395898_0021940 3300037466 Bacteria 6467
1203 Ga0395898_0036410 3300037466 Bacteria 4886
1204 Ga0395898_0104107 3300037466 Bacteria 2722
1205 Ga0395898_0122269 3300037466 Bacteria 2494
1206 Ga0395898_0581519 3300037466 Bacteria 1062
1207 Ga0395898_1173143 3300037466 Bacteria 700
1208 Ga0395898_1694179 3300037466 Bacteria 555
1209 Ga0395905_0143635 3300037471 Bacteria 2245
1210 Ga0395905_0237250 3300037471 Bacteria 1704
1211 Ga0395905_0621052 3300037471 Bacteria 983
1212 Ga0395905_0977794 3300037471 Bacteria 749
1213 Ga0436364_0117848 3300037853 Bacteria 628
1214 Ga0436364_0195688 3300037853 Bacteria 1266
1215 Ga0436364_0426550 3300037853 Bacteria 1962
1216 Ga0436364_0998563 3300037853 Bacteria 1403
1217 Ga0436364_1277527 3300037853 Bacteria 552
1218 Ga0436364_1512680 3300037853 Bacteria 1230
1219 Ga0395901_0052028 3300038443 Bacteria 4257
1220 Ga0395901_0116293 3300038443 Bacteria 2809
1221 Ga0395901_0157923 3300038443 Bacteria 2381
1222 Ga0395901_0170305 3300038443 Bacteria 2285
1223 Ga0395901_0326517 3300038443 Bacteria 1587
1224 Ga0395901_0511506 3300038443 Bacteria 1221
1225 Ga0395901_0911102 3300038443 Bacteria 860
1226 Ga0395901_0943368 3300038443 Bacteria 842
1227 Ga0395901_1440507 3300038443 Bacteria 646
1228 Ga0436365_0092954 3300039437 Bacteria 806
1229 Ga0436365_0132418 3300039437 Bacteria 785
1230 Ga0436365_0167353 3300039437 Bacteria 5874
1231 Ga0436365_0182717 3300039437 Bacteria 698
1232 Ga0436365_0553612 3300039437 Bacteria 646
1233 Ga0436365_0976640 3300039437 Bacteria 544
1234 Ga0436365_1780618 3300039437 Bacteria 537
1235 Ga0436360_0327078 3300039438 Bacteria 1456
1236 Ga0436360_0389769 3300039438 Bacteria 670
1237 Ga0436360_0498192 3300039438 Bacteria 548
1238 Ga0436360_0901853 3300039438 Bacteria 518
1239 Ga0436360_1015481 3300039438 Bacteria 2367
1240 Ga0436360_1328820 3300039438 Bacteria 881
1241 Ga0436361_0164147 3300039447 Bacteria 581
1242 Ga0436361_0345432 3300039447 Bacteria 2327
1243 Ga0436361_0503536 3300039447 Bacteria 1357
1244 Ga0436361_0820316 3300039447 Bacteria 870
1245 Ga0436363_0301621 3300039450 Bacteria 597
1246 Ga0436363_0524521 3300039450 Bacteria 1898
1247 Ga0436363_0686660 3300039450 Bacteria 1352
1248 Ga0436363_0734107 3300039450 Bacteria 1044
1249 Ga0436363_1073607 3300039450 Bacteria 670
1250 Ga0436363_1416214 3300039450 Bacteria 3509
1251 Ga0436362_0123421 3300039453 Bacteria 2593
1252 Ga0436362_0501210 3300039453 Bacteria 2187
1253 Ga0436362_1023268 3300039453 Bacteria 1775
1254 Ga0436362_1193219 3300039453 Bacteria 1151
1255 Ga0436362_1268291 3300039453 Bacteria 582
1256 Ga0439447_042355 3300041407 Bacteria 1106
1257 Ga0439465_0223731 3300041413 Bacteria 690
1258 Ga0439465_0358462 3300041413 Bacteria 551
1259 Ga0451789_0024405 3300041443 Bacteria 696
1260 Ga0451789_0484245 3300041443 Bacteria 765
1261 Ga0451791_1641340 3300041451 Bacteria 845
1262 Ga0451791_1844086 3300041451 Bacteria 798
1263 Ga0451795_0835681 3300041456 Bacteria 663
1264 Ga0451795_1431950 3300041456 Bacteria 667
1265 Ga0451800_1529223 3300041459 Bacteria 1008
1266 Ga0451802_0016898 3300041460 Bacteria 945
1267 Ga0451802_0629483 3300041460 Bacteria 882
1268 Ga0451804_0034360 3300041463 Bacteria 565
1269 Ga0451804_0746900 3300041463 Bacteria 790
1270 Ga0451807_1574599 3300041486 Bacteria 525
1271 Ga0451833_0765327 3300041491 Bacteria 1108
1272 Ga0451833_1094826 3300041491 Bacteria 686
1273 Ga0451837_0578265 3300041494 Bacteria 566
1274 Ga0451837_0651182 3300041494 Bacteria 674
1275 Ga0451845_0309105 3300041501 Bacteria 689
1276 Ga0451847_0055320 3300041503 Bacteria 987
1277 Ga0451843_1721461 3300041509 Bacteria 566
1278 Ga0451853_1476642 3300041512 Bacteria 712
1279 Ga0451853_3163796 3300041512 Bacteria 1014
1280 Ga0439431_0062179 3300041997 Bacteria 984
1281 Ga0439437_042268 3300042000 Bacteria 593
1282 Ga0439448_0016636 3300042005 Bacteria 2240
1283 Ga0439448_0072517 3300042005 Bacteria 1148
1284 Ga0439432_036353 3300042006 Bacteria 1576
1285 Ga0439450_040515 3300042008 Bacteria 1080
1286 Ga0439455_0114242 3300042012 Bacteria 753
1287 Ga0439456_086970 3300042013 Bacteria 701
1288 Ga0439456_090080 3300042013 Bacteria 689
1289 Ga0439463_057865 3300042016 Bacteria 991
1290 Ga0450898_062453 3300042134 Bacteria 735
1291 Ga0450900_022131 3300042136 Bacteria 892
1292 Ga0439446_0089603 3300042156 Bacteria 962
1293 Ga0439458_0119246 3300042157 Bacteria 694
1294 Ga0439458_0159421 3300042157 Bacteria 607
1295 Ga0450908_014907 3300042184 Bacteria 1394
1296 Ga0439444_0203115 3300042437 Bacteria 501
1297 Ga0439459_0086897 3300042438 Bacteria 746
1298 Ga0439464_0193745 3300042439 Bacteria 647
1299 Ga0439460_0191261 3300042461 Bacteria 695
1300 Ga0450918_016269 3300042531 Bacteria 1292
1301 Ga0466969_0027298 3300044656 Bacteria 2924
1302 Ga0466969_0098661 3300044656 Bacteria 1377
1303 Ga0466969_0137022 3300044656 Bacteria 1133
1304 Ga0466972_0022437 3300044658 Bacteria 3144
1305 Ga0466966_0002417 3300044684 Bacteria 12201
1306 Ga0466966_0115184 3300044684 Bacteria 1655
1307 Ga0466966_0470870 3300044684 Bacteria 755
1308 Ga0466966_0796277 3300044684 Bacteria 570
1309 Ga0466966_1012913 3300044684 Bacteria 501
1310 Ga0466961_0030631 3300044693 Bacteria 3457
1311 Ga0466961_0782575 3300044693 Bacteria 570
1312 Ga0466963_0375815 3300044694 Bacteria 1001
1313 Ga0466963_0495538 3300044694 Bacteria 862
1314 Ga0466964_0081593 3300044706 Bacteria 1389
1315 Ga0466964_0089440 3300044706 Bacteria 1337
1316 Ga0466964_0163437 3300044706 Bacteria 1042
1317 Ga0466964_0236849 3300044706 Bacteria 893
1318 Ga0466971_0118155 3300044719 Bacteria 1226
1319 Ga0466968_0142512 3300044735 Bacteria 1097
1320 Ga0466968_0197788 3300044735 Bacteria 940
1321 Ga0466970_0043671 3300044765 Bacteria 2386
1322 Ga0466970_0160238 3300044765 Bacteria 1244
1323 Ga0466970_0350843 3300044765 Bacteria 837
1324 Ga0466957_0208706 3300044842 Bacteria 1285
1325 Ga0466957_0414385 3300044842 Bacteria 923
1326 Ga0466957_0512903 3300044842 Bacteria 832
1327 Ga0466957_0861205 3300044842 Bacteria 646
1328 Ga0466957_1051109 3300044842 Bacteria 586
1329 Ga0466960_0304803 3300044901 Bacteria 898
1330 Ga0466960_0457595 3300044901 Bacteria 742
1331 Ga0466959_0283135 3300045049 Bacteria 1137
1332 Ga0466959_0334672 3300045049 Bacteria 1033
1333 Ga0466959_0401754 3300045049 Bacteria 931
1334 Ga0466959_0475958 3300045049 Bacteria 845
1335 Ga0466958_0144968 3300045836 Bacteria 1496
1336 Ga0466958_0655205 3300045836 Bacteria 684
1337 Ga0466967_0139430 3300045976 Bacteria 2257
1338 Ga0466967_0247618 3300045976 Bacteria 1701
1339 Ga0466967_0525201 3300045976 Bacteria 1163
1340 Ga0466967_1082361 3300045976 Bacteria 799
1341 Ga0495617_095130 3300046452 Bacteria 970
1342 Ga0495592_0076879 3300046454 Bacteria 2421
1343 Ga0495592_0092701 3300046454 Bacteria 2164
1344 Ga0495592_0444417 3300046454 Bacteria 813
1345 Ga0495592_0515080 3300046454 Bacteria 740
1346 Ga0495592_0539767 3300046454 Bacteria 718
1347 Ga0495603_0007442 3300046455 Bacteria 6584
1348 Ga0495603_0265066 3300046455 Bacteria 988
1349 Ga0495603_0311961 3300046455 Bacteria 903
1350 Ga0495603_0436955 3300046455 Bacteria 749
1351 Ga0495603_0485421 3300046455 Bacteria 708
1352 Ga0495603_0754671 3300046455 Bacteria 556
1353 Ga0495603_0832193 3300046455 Bacteria 526
1354 Ga0495590_0037009 3300046457 Bacteria 1702
1355 Ga0495590_0039028 3300046457 Bacteria 1656
1356 Ga0495591_043556 3300046458 Bacteria 1262
1357 Ga0495629_0016778 3300046459 Bacteria 5255
1358 Ga0495629_0020113 3300046459 Bacteria 4766
1359 Ga0495629_0117136 3300046459 Bacteria 1856
1360 Ga0495629_0337324 3300046459 Bacteria 1029
1361 Ga0495629_0406275 3300046459 Bacteria 925
1362 Ga0495638_0015537 3300046460 Bacteria 5111
1363 Ga0495638_0107230 3300046460 Bacteria 1663
1364 Ga0495638_0179152 3300046460 Bacteria 1210
1365 Ga0495638_0351446 3300046460 Bacteria 778
1366 Ga0495641_0012494 3300046461 Bacteria 4745
1367 Ga0495641_0201691 3300046461 Bacteria 891
1368 Ga0495651_0031637 3300046462 Bacteria 4126
1369 Ga0495651_0081674 3300046462 Bacteria 2439
1370 Ga0495651_0329017 3300046462 Bacteria 1016
1371 Ga0495651_0364071 3300046462 Bacteria 952
1372 Ga0495651_0521367 3300046462 Bacteria 758
1373 Ga0495653_0109906 3300046463 Bacteria 1983
1374 Ga0495653_0168278 3300046463 Bacteria 1515
1375 Ga0495653_0381709 3300046463 Bacteria 900
1376 Ga0495653_0528451 3300046463 Bacteria 732
1377 Ga0495650_0073954 3300046471 Bacteria 1330
1378 Ga0495650_0217243 3300046471 Bacteria 659
1379 Ga0495650_0315623 3300046471 Bacteria 521
1380 Ga0495580_0022295 3300046472 Bacteria 4661
1381 Ga0495580_0061284 3300046472 Bacteria 2641
1382 Ga0495580_0285341 3300046472 Bacteria 1126
1383 Ga0495582_0000163 3300046473 Bacteria 35979
1384 Ga0495582_0015152 3300046473 Bacteria 4241
1385 Ga0495582_0520877 3300046473 Bacteria 687
1386 Ga0495605_0111712 3300046474 Bacteria 1246
1387 Ga0495605_0216357 3300046474 Bacteria 829
1388 Ga0495605_0356834 3300046474 Bacteria 612
1389 Ga0495605_0360073 3300046474 Bacteria 609
1390 Ga0495639_0000873 3300046475 Bacteria 13634
1391 Ga0495639_0028168 3300046475 Bacteria 2488
1392 Ga0495639_0034344 3300046475 Bacteria 2268
1393 Ga0495639_0069963 3300046475 Bacteria 1619
1394 Ga0495639_0135444 3300046475 Bacteria 1181
1395 Ga0495639_0141345 3300046475 Bacteria 1157
1396 Ga0495639_0171560 3300046475 Bacteria 1053
1397 Ga0495639_0625852 3300046475 Bacteria 554
1398 Ga0495662_0000285 3300046476 Bacteria 21823
1399 Ga0495662_0137623 3300046476 Bacteria 1201
1400 Ga0495662_0166807 3300046476 Bacteria 1085
1401 Ga0495662_0191890 3300046476 Bacteria 1007
1402 Ga0495662_0477642 3300046476 Bacteria 611
1403 Ga0495662_0586414 3300046476 Bacteria 545
1404 Ga0495662_0642642 3300046476 Bacteria 518
1405 Ga0495664_0005138 3300046477 Bacteria 7181
1406 Ga0495664_0070233 3300046477 Bacteria 2091
1407 Ga0495664_0089417 3300046477 Bacteria 1851
1408 Ga0495664_0177397 3300046477 Bacteria 1292
1409 Ga0495664_0441662 3300046477 Bacteria 779
1410 Ga0495664_0455832 3300046477 Bacteria 766
1411 Ga0495664_0768018 3300046477 Bacteria 567
1412 Ga0495664_0886614 3300046477 Bacteria 522
1413 Ga0495584_0095937 3300046491 Bacteria 1497
1414 Ga0495584_0138043 3300046491 Bacteria 1237
1415 Ga0495584_0180168 3300046491 Bacteria 1074
1416 Ga0495584_0230493 3300046491 Bacteria 941
1417 Ga0495585_0101859 3300046492 Bacteria 1535
1418 Ga0495585_0117755 3300046492 Bacteria 1407
1419 Ga0495585_0261406 3300046492 Bacteria 861
1420 Ga0495585_0341282 3300046492 Bacteria 729
1421 Ga0495594_0002164 3300046499 Bacteria 10224
1422 Ga0495594_0041814 3300046499 Bacteria 2509
1423 Ga0495594_0095331 3300046499 Bacteria 1671
1424 Ga0495594_0284446 3300046499 Bacteria 942
1425 Ga0495594_0401944 3300046499 Bacteria 779
1426 Ga0495594_0419227 3300046499 Bacteria 761
1427 Ga0495594_0511962 3300046499 Bacteria 681
1428 Ga0495607_0099047 3300046501 Bacteria 1564
1429 Ga0495583_0201925 3300046506 Bacteria 807
1430 Ga0495583_0272505 3300046506 Bacteria 675
1431 Ga0495583_0372361 3300046506 Bacteria 562
1432 Ga0495606_0004034 3300046507 Bacteria 14975
1433 Ga0495606_0153846 3300046507 Bacteria 1347
1434 Ga0495606_0170990 3300046507 Bacteria 1260
1435 Ga0495606_0200472 3300046507 Bacteria 1137
1436 Ga0495606_0229401 3300046507 Bacteria 1041
1437 Ga0495606_0245829 3300046507 Bacteria 995
1438 Ga0495606_0426438 3300046507 Bacteria 684
1439 Ga0495608_0043139 3300046511 Bacteria 3014
1440 Ga0495608_0197269 3300046511 Bacteria 1269
1441 Ga0495608_0499438 3300046511 Bacteria 737
1442 Ga0495610_0101933 3300046512 Bacteria 1284
1443 Ga0495610_0297951 3300046512 Bacteria 622
1444 Ga0495616_0052334 3300046513 Bacteria 2033
1445 Ga0495616_0064295 3300046513 Bacteria 1790
1446 Ga0495616_0384265 3300046513 Bacteria 579
1447 Ga0495618_0010748 3300046514 Bacteria 5541
1448 Ga0495618_0135199 3300046514 Bacteria 1577
1449 Ga0495618_0207307 3300046514 Bacteria 1239
1450 Ga0495618_0477597 3300046514 Bacteria 754
1451 Ga0495620_0131819 3300046515 Bacteria 980
1452 Ga0495620_0201908 3300046515 Bacteria 764
1453 Ga0495628_0053224 3300046516 Bacteria 3195
1454 Ga0495628_0444358 3300046516 Bacteria 942
1455 Ga0495628_0515124 3300046516 Bacteria 862
1456 Ga0495628_0613999 3300046516 Bacteria 776
1457 Ga0495628_0658116 3300046516 Bacteria 743
1458 Ga0495628_0891223 3300046516 Bacteria 618
1459 Ga0495630_0142413 3300046517 Bacteria 1823
1460 Ga0495630_0839996 3300046517 Bacteria 700
1461 Ga0495630_1387024 3300046517 Bacteria 529
1462 Ga0495631_0279853 3300046518 Bacteria 710
1463 Ga0495631_0504875 3300046518 Bacteria 515
1464 Ga0495632_0127779 3300046519 Bacteria 1184
1465 Ga0495632_0280483 3300046519 Bacteria 742
1466 Ga0495637_0059040 3300046520 Bacteria 1579
1467 Ga0495643_0043237 3300046522 Bacteria 2452
1468 Ga0495643_0511217 3300046522 Bacteria 515
1469 Ga0495644_0055348 3300046523 Bacteria 1490
1470 Ga0495644_0248776 3300046523 Bacteria 690
1471 Ga0495644_0255921 3300046523 Bacteria 680
1472 Ga0495648_0001935 3300046524 Bacteria 19722
1473 Ga0495648_0109352 3300046524 Bacteria 1507
1474 Ga0495648_0125390 3300046524 Bacteria 1373
1475 Ga0495648_0170800 3300046524 Bacteria 1114
1476 Ga0495663_0368741 3300046525 Bacteria 525
1477 Ga0495666_0103277 3300046526 Bacteria 1342
1478 Ga0495666_0125161 3300046526 Bacteria 1202
1479 Ga0495666_0170559 3300046526 Bacteria 1006
1480 Ga0495666_0385263 3300046526 Bacteria 630
1481 Ga0495642_0110216 3300046528 Bacteria 1176
1482 Ga0495642_0469862 3300046528 Bacteria 556
1483 Ga0495652_0091173 3300046529 Bacteria 2492
1484 Ga0495652_0095349 3300046529 Bacteria 2424
1485 Ga0495652_0276179 3300046529 Bacteria 1232
1486 Ga0495652_0570558 3300046529 Bacteria 775
1487 Ga0495652_1150276 3300046529 Bacteria 502
1488 Ga0495654_0205185 3300046530 Bacteria 841
1489 Ga0495654_0328003 3300046530 Bacteria 619
1490 Ga0495665_0004495 3300046531 Bacteria 7527
1491 Ga0495665_0194085 3300046531 Bacteria 1053
1492 Ga0495640_0017722 3300046533 Bacteria 5299
1493 Ga0495640_0129210 3300046533 Bacteria 1636
1494 Ga0495640_0257670 3300046533 Bacteria 1090
1495 Ga0495640_0395035 3300046533 Bacteria 850
1496 Ga0495640_0395892 3300046533 Bacteria 848
1497 Ga0495586_0030573 3300046535 Bacteria 2882
1498 Ga0495586_0091344 3300046535 Bacteria 1682
1499 Ga0495586_0439754 3300046535 Bacteria 752
1500 Ga0495586_0655875 3300046535 Bacteria 606
1501 Ga0495587_0079772 3300046536 Bacteria 1897
1502 Ga0495587_0085463 3300046536 Bacteria 1826
1503 Ga0495587_0217454 3300046536 Bacteria 1078
1504 Ga0495598_0008482 3300046537 Bacteria 2395
1505 Ga0495598_0037702 3300046537 Bacteria 1396
1506 Ga0495609_0249875 3300046538 Bacteria 730
1507 Ga0495609_0270793 3300046538 Bacteria 696
1508 Ga0495597_0034451 3300046542 Bacteria 2288
1509 Ga0495597_0198838 3300046542 Bacteria 803
1510 Ga0495597_0308726 3300046542 Bacteria 613
1511 Ga0495645_0012032 3300046543 Bacteria 6098
1512 Ga0495645_0040592 3300046543 Bacteria 3394
1513 Ga0495645_0053051 3300046543 Bacteria 2948
1514 Ga0495622_0008764 3300046557 Bacteria 4684
1515 Ga0495622_0127586 3300046557 Bacteria 1159
1516 Ga0495622_0195630 3300046557 Bacteria 902
1517 Ga0495622_0258032 3300046557 Bacteria 765
1518 Ga0495622_0291305 3300046557 Bacteria 712
1519 Ga0495633_0178205 3300046558 Bacteria 978
1520 Ga0495667_0042519 3300046559 Bacteria 3013
1521 Ga0495667_0155723 3300046559 Bacteria 1470
1522 Ga0495667_0304533 3300046559 Bacteria 1009
1523 Ga0495667_0388614 3300046559 Bacteria 879
1524 Ga0495656_0098490 3300046615 Bacteria 1348
1525 Ga0495656_0653277 3300046615 Bacteria 564
1526 Ga0495656_0731037 3300046615 Bacteria 533
1527 Ga0495668_0111225 3300046616 Bacteria 1498
1528 Ga0495668_0233854 3300046616 Bacteria 1006
1529 Ga0495668_0636142 3300046616 Bacteria 589
1530 Ga0495668_0705322 3300046616 Bacteria 558
1531 Ga0495634_0017993 3300046642 Bacteria 5035
1532 Ga0495634_0044824 3300046642 Bacteria 2991
1533 Ga0495634_0053212 3300046642 Bacteria 2712
1534 Ga0495634_0134675 3300046642 Bacteria 1572
1535 Ga0495634_0436994 3300046642 Bacteria 773
1536 Ga0495611_0027142 3300046648 Bacteria 2501
1537 Ga0495611_0581225 3300046648 Bacteria 506
1538 Ga0495625_0086245 3300046660 Bacteria 2178
1539 Ga0495625_0200240 3300046660 Bacteria 1318
1540 Ga0495635_0016474 3300046663 Bacteria 5162
1541 Ga0495635_0036862 3300046663 Bacteria 3386
1542 Ga0495635_0052878 3300046663 Bacteria 2797
1543 Ga0495635_0164552 3300046663 Bacteria 1509
1544 Ga0495635_0228928 3300046663 Bacteria 1256
1545 Ga0495635_0618328 3300046663 Bacteria 706
1546 Ga0495659_0016349 3300046664 Bacteria 2446
1547 Ga0495659_0057451 3300046664 Bacteria 1429
1548 Ga0495661_0130544 3300046665 Bacteria 1377
1549 Ga0495661_0604183 3300046665 Bacteria 515
1550 Ga0495588_0025858 3300046674 Bacteria 2928
1551 Ga0495588_0064604 3300046674 Bacteria 1898
1552 Ga0495588_0070929 3300046674 Bacteria 1811
1553 Ga0495588_0158872 3300046674 Bacteria 1195
1554 Ga0495588_0649852 3300046674 Bacteria 552
1555 Ga0495588_0678106 3300046674 Bacteria 539
1556 Ga0495657_0029899 3300046675 Bacteria 3818
1557 Ga0495657_0235737 3300046675 Bacteria 1105
1558 Ga0495657_0383562 3300046675 Bacteria 829
1559 Ga0495657_0487566 3300046675 Bacteria 719
1560 Ga0495657_0510056 3300046675 Bacteria 701
1561 Ga0495599_0090841 3300046678 Bacteria 1905
1562 Ga0495599_0328607 3300046678 Bacteria 919
1563 Ga0495599_0400762 3300046678 Bacteria 817
1564 Ga0495599_0415673 3300046678 Bacteria 799
1565 Ga0495623_0049308 3300046679 Bacteria 2668
1566 Ga0495623_0066734 3300046679 Bacteria 2247
1567 Ga0495623_0302002 3300046679 Bacteria 884
1568 Ga0495646_0009353 3300046680 Bacteria 6217
1569 Ga0495646_0078131 3300046680 Bacteria 1934
1570 Ga0495646_0086060 3300046680 Bacteria 1823
1571 Ga0495646_0276317 3300046680 Bacteria 893
1572 Ga0495647_0006072 3300046681 Bacteria 3982
1573 Ga0495647_0052540 3300046681 Bacteria 1587
1574 Ga0495647_0084742 3300046681 Bacteria 1290
1575 Ga0495647_0219425 3300046681 Bacteria 839
1576 Ga0495658_0001480 3300046683 Bacteria 12346
1577 Ga0495658_0155047 3300046683 Bacteria 1409
1578 Ga0495658_0394310 3300046683 Bacteria 882
1579 Ga0495658_0629352 3300046683 Bacteria 687
1580 Ga0495669_0160017 3300046684 Bacteria 1068
1581 Ga0495669_0290611 3300046684 Bacteria 787
1582 Ga0495669_0312118 3300046684 Bacteria 758
1583 Ga0495669_0314871 3300046684 Bacteria 755
1584 Ga0495669_0338924 3300046684 Bacteria 726
1585 Ga0495669_0375930 3300046684 Bacteria 687
1586 Ga0495613_0064217 3300046689 Bacteria 2685
1587 Ga0495613_0118769 3300046689 Bacteria 1900
1588 Ga0495613_0202690 3300046689 Bacteria 1398
1589 Ga0495613_0298152 3300046689 Bacteria 1116
1590 Ga0495613_0474520 3300046689 Bacteria 845
1591 Ga0495613_0559840 3300046689 Bacteria 764
1592 Ga0495624_0004478 3300046690 Bacteria 10223
1593 Ga0495624_0019695 3300046690 Bacteria 4498
1594 Ga0495624_0036661 3300046690 Bacteria 3159
1595 Ga0495624_0283306 3300046690 Bacteria 1000
1596 Ga0495670_0055606 3300046691 Bacteria 1984
1597 Ga0495670_0330089 3300046691 Bacteria 819
1598 Ga0495670_0801292 3300046691 Bacteria 514
1599 Ga0495671_0111586 3300046692 Bacteria 1335
1600 Ga0495671_0361782 3300046692 Bacteria 695
1601 Ga0495671_0375260 3300046692 Bacteria 682
1602 Ga0495649_0190494 3300046694 Bacteria 1068
1603 Ga0495649_0309190 3300046694 Bacteria 803
1604 Ga0495649_0424727 3300046694 Bacteria 665
1605 Ga0495649_0524010 3300046694 Bacteria 588
1606 Ga0495589_0117142 3300046794 Bacteria 1283
1607 Ga0495589_0530006 3300046794 Bacteria 537
1608 Ga0495589_0549580 3300046794 Bacteria 526
1609 Ga0495600_0009515 3300046809 Bacteria 6007
1610 Ga0495600_0048205 3300046809 Bacteria 2779
1611 Ga0495600_0798386 3300046809 Bacteria 562
1612 Ga0495660_0095619 3300046810 Bacteria 1536
1613 Ga0495660_0448085 3300046810 Bacteria 558
1614 Ga0495581_0007052 3300047315 Bacteria 6513
1615 Ga0495581_0068636 3300047315 Bacteria 2049
1616 Ga0495581_0266151 3300047315 Bacteria 1002
1617 Ga0495581_0347659 3300047315 Bacteria 865
1618 Ga0495581_0353108 3300047315 Bacteria 858
1619 Ga0495581_0568676 3300047315 Bacteria 657
1620 Ga0495604_0116426 3300047317 Bacteria 1940
1621 Ga0495604_0240854 3300047317 Bacteria 1237
1622 Ga0495604_0398690 3300047317 Bacteria 906
1623 Ga0495604_0458805 3300047317 Bacteria 831
1624 Ga0495604_0490288 3300047317 Bacteria 798
1625 Ga0495636_0050467 3300047318 Bacteria 1741
1626 Ga0495636_0592365 3300047318 Bacteria 542
1627 Ga0495674_0010137 3300047319 Bacteria 8927
1628 Ga0495674_0081704 3300047319 Bacteria 2771
1629 Ga0495674_0134702 3300047319 Bacteria 2080
1630 Ga0495674_0438617 3300047319 Bacteria 1050
1631 Ga0495674_0813268 3300047319 Bacteria 726
1632 Ga0495674_1254458 3300047319 Bacteria 558
1633 Ga0495672_0044069 3300047320 Bacteria 2678
1634 Ga0495672_0130496 3300047320 Bacteria 1323
1635 Ga0495672_0139169 3300047320 Bacteria 1269
1636 Ga0495672_0180371 3300047320 Bacteria 1070
1637 Ga0495672_0288614 3300047320 Bacteria 781
1638 Ga0495672_0454984 3300047320 Bacteria 576
1639 Ga0495676_0029937 3300047321 Bacteria 4628
1640 Ga0495676_0036685 3300047321 Bacteria 4090
1641 Ga0495676_0055671 3300047321 Bacteria 3134
1642 Ga0495676_0301829 3300047321 Bacteria 1080
1643 Ga0495676_0519544 3300047321 Bacteria 780
1644 Ga0495680_0027673 3300047322 Bacteria 4653
1645 Ga0495680_0194616 3300047322 Bacteria 1457
1646 Ga0495680_0389865 3300047322 Bacteria 963
1647 Ga0495683_0199044 3300047323 Bacteria 904
1648 Ga0495683_0250738 3300047323 Bacteria 777
1649 Ga0495683_0283360 3300047323 Bacteria 716
1650 Ga0495687_016394 3300047443 Bacteria 3727
1651 Ga0495687_070399 3300047443 Bacteria 1405
1652 Ga0495675_0009679 3300047444 Bacteria 6007
1653 Ga0495675_0012730 3300047444 Bacteria 5297
1654 Ga0495675_0197399 3300047444 Bacteria 1226
1655 Ga0495675_0548639 3300047444 Bacteria 659
1656 Ga0495675_0549429 3300047444 Bacteria 659
1657 Ga0495677_0080230 3300047445 Bacteria 1222
1658 Ga0495679_037610 3300047446 Bacteria 1521
1659 Ga0495685_103339 3300047447 Bacteria 940
1660 Ga0495673_0099562 3300047469 Bacteria 1177
1661 Ga0495673_0265327 3300047469 Bacteria 623
1662 Ga0495681_0052920 3300047470 Bacteria 1902
1663 Ga0495684_0021540 3300047471 Bacteria 4962
1664 Ga0495684_0063489 3300047471 Bacteria 2807
1665 Ga0495684_0343071 3300047471 Bacteria 1062
1666 Ga0495684_0644112 3300047471 Bacteria 709
1667 Ga0495684_1032330 3300047471 Bacteria 520
1668 Ga0495686_0088051 3300047472 Bacteria 1888
1669 Ga0495686_0225237 3300047472 Bacteria 1064
1670 Ga0495686_0312070 3300047472 Bacteria 864
1671 Ga0495686_0542913 3300047472 Bacteria 608
1672 Ga0495686_0551847 3300047472 Bacteria 601
1673 Ga0495593_0003980 3300047673 Bacteria 8815
1674 Ga0495593_0025559 3300047673 Bacteria 3268
1675 Ga0495593_0135566 3300047673 Bacteria 1248
1676 Ga0495593_0140453 3300047673 Bacteria 1223
1677 Ga0495593_0178909 3300047673 Bacteria 1068
1678 Ga0495602_0038966 3300048088 Bacteria 4383
1679 Ga0495602_0107504 3300048088 Bacteria 2273
1680 Ga0495602_0272719 3300048088 Bacteria 1250
1681 Ga0495602_0342057 3300048088 Bacteria 1082
1682 Ga0495614_0052494 3300048089 Bacteria 1747
1683 Ga0495614_0285635 3300048089 Bacteria 760
1684 Ga0495614_0465810 3300048089 Bacteria 599
1685 Ga0495615_0047031 3300048090 Bacteria 1098
1686 Ga0495615_0123619 3300048090 Bacteria 750
1687 Ga0495615_0222431 3300048090 Bacteria 589
1688 Ga0495626_0062838 3300048091 Bacteria 1685
1689 Ga0496100_0039043 3300048903 Bacteria 3012
1690 Ga0496100_0068969 3300048903 Bacteria 2353
1691 Ga0496100_0084662 3300048903 Bacteria 2150
1692 Ga0496100_0197052 3300048903 Bacteria 1465
1693 Ga0496100_0519007 3300048903 Bacteria 919
1694 Ga0496100_0695206 3300048903 Bacteria 793
1695 Ga0496100_0921441 3300048903 Bacteria 686
1696 Ga0496100_1114542 3300048903 Bacteria 622
1697 Ga0496101_0297083 3300048904 Bacteria 1264
1698 Ga0496101_0331031 3300048904 Bacteria 1195
1699 Ga0496101_0566373 3300048904 Bacteria 898
1700 Ga0496101_0667136 3300048904 Bacteria 821
1701 Ga0496101_0842777 3300048904 Bacteria 722
1702 Ga0496101_0862026 3300048904 Bacteria 713
1703 Ga0496101_1064781 3300048904 Bacteria 635
1704 Ga0496101_1211317 3300048904 Bacteria 591
1705 Ga0496101_1414080 3300048904 Bacteria 542
1706 Ga0496101_1442181 3300048904 Bacteria 536
1707 Ga0496102_0023539 3300048905 Bacteria 5472
1708 Ga0496102_0027963 3300048905 Bacteria 5039
1709 Ga0496102_0242470 3300048905 Bacteria 1699
1710 Ga0496102_0530729 3300048905 Bacteria 1099
1711 Ga0496102_0619264 3300048905 Bacteria 1005
1712 Ga0496102_0775278 3300048905 Bacteria 881
1713 Ga0496102_1197395 3300048905 Bacteria 679
1714 Ga0496102_1217366 3300048905 Bacteria 672
1715 Ga0496102_1351646 3300048905 Bacteria 631
1716 Ga0496102_1460747 3300048905 Bacteria 602
1717 Ga0496102_1575497 3300048905 Bacteria 575
1718 Ga0496103_0181069 3300048906 Bacteria 1354
1719 Ga0496103_0595638 3300048906 Bacteria 704
1720 Ga0496103_0649065 3300048906 Bacteria 670
1721 Ga0496103_0840913 3300048906 Bacteria 577
1722 Ga0496104_0000877 3300048907 Bacteria 25894
1723 Ga0496104_0023640 3300048907 Bacteria 5651
1724 Ga0496104_0072619 3300048907 Bacteria 3272
1725 Ga0496104_0130045 3300048907 Bacteria 2418
1726 Ga0496104_0175960 3300048907 Bacteria 2050
1727 Ga0496104_0328076 3300048907 Bacteria 1443
1728 Ga0496104_0464284 3300048907 Bacteria 1177
1729 Ga0496104_0676183 3300048907 Bacteria 940
1730 Ga0496104_0737221 3300048907 Bacteria 892
1731 Ga0496104_0929348 3300048907 Bacteria 774
1732 Ga0496105_0005725 3300048908 Bacteria 9460
1733 Ga0496105_0051572 3300048908 Bacteria 3399
1734 Ga0496105_0088669 3300048908 Bacteria 2555
1735 Ga0496105_0100695 3300048908 Bacteria 2386
1736 Ga0496105_0106208 3300048908 Bacteria 2318
1737 Ga0496105_0147653 3300048908 Bacteria 1933
1738 Ga0496105_0366967 3300048908 Bacteria 1147
1739 Ga0496105_1122603 3300048908 Bacteria 582
1740 Ga0496105_1281524 3300048908 Bacteria 536
1741 Ga0496105_1283258 3300048908 Bacteria 535
1742 Ga0496106_0012368 3300048909 Bacteria 6300
1743 Ga0496106_0032905 3300048909 Bacteria 3867
1744 Ga0496106_0107991 3300048909 Bacteria 2164
1745 Ga0496106_0148888 3300048909 Bacteria 1845
1746 Ga0496106_0333211 3300048909 Bacteria 1218
1747 Ga0496106_0352298 3300048909 Bacteria 1182
1748 Ga0496106_0358817 3300048909 Bacteria 1171
1749 Ga0496106_0679584 3300048909 Bacteria 821
1750 Ga0496106_0694049 3300048909 Bacteria 811
1751 Ga0496106_1082734 3300048909 Bacteria 628
1752 Ga0496107_0005639 3300048910 Bacteria 8575
1753 Ga0496107_0051127 3300048910 Bacteria 2980
1754 Ga0496107_0074113 3300048910 Bacteria 2476
1755 Ga0496107_0101173 3300048910 Bacteria 2113
1756 Ga0496107_0146748 3300048910 Bacteria 1745
1757 Ga0496107_0151158 3300048910 Bacteria 1717
1758 Ga0496107_0244747 3300048910 Bacteria 1334
1759 Ga0496107_0343706 3300048910 Bacteria 1110
1760 Ga0496107_0397932 3300048910 Bacteria 1024
1761 Ga0496107_1203465 3300048910 Bacteria 544
1762 Ga0496108_0002766 3300048911 Bacteria 14044
1763 Ga0496108_0021472 3300048911 Bacteria 5307
1764 Ga0496108_0051723 3300048911 Bacteria 3441
1765 Ga0496108_0093770 3300048911 Bacteria 2554
1766 Ga0496108_0165215 3300048911 Bacteria 1913
1767 Ga0496108_0281941 3300048911 Bacteria 1446
1768 Ga0496108_0402883 3300048911 Bacteria 1195
1769 Ga0496108_0819446 3300048911 Bacteria 802
1770 Ga0496108_0900180 3300048911 Bacteria 759
1771 Ga0496109_0000518 3300048912 Bacteria 32691
1772 Ga0496109_0046305 3300048912 Bacteria 3950
1773 Ga0496109_0124240 3300048912 Bacteria 2405
1774 Ga0496109_0219596 3300048912 Bacteria 1787
1775 Ga0496109_0493832 3300048912 Bacteria 1155
1776 Ga0496109_0700132 3300048912 Bacteria 950
1777 Ga0496109_1208619 3300048912 Bacteria 692
1778 Ga0496110_0008327 3300048913 Bacteria 8342
1779 Ga0496110_0038155 3300048913 Bacteria 4178
1780 Ga0496110_0047078 3300048913 Bacteria 3774
1781 Ga0496110_0055961 3300048913 Bacteria 3471
1782 Ga0496110_0069967 3300048913 Bacteria 3108
1783 Ga0496110_0292978 3300048913 Bacteria 1482
1784 Ga0496110_0530555 3300048913 Bacteria 1070
1785 Ga0496110_0560529 3300048913 Bacteria 1038
1786 Ga0496110_0614356 3300048913 Bacteria 986
1787 Ga0496110_0919130 3300048913 Bacteria 781
1788 Ga0496111_0065502 3300048914 Bacteria 2637
1789 Ga0496111_0077925 3300048914 Bacteria 2416
1790 Ga0496111_0165286 3300048914 Bacteria 1643
1791 Ga0496111_0273704 3300048914 Bacteria 1252
1792 Ga0496111_0437438 3300048914 Bacteria 965
1793 Ga0496112_0000021 3300048915 Bacteria 156561
1794 Ga0496112_0049260 3300048915 Bacteria 4129
1795 Ga0496112_0049696 3300048915 Bacteria 4110
1796 Ga0496112_0055107 3300048915 Bacteria 3908
1797 Ga0496112_0114417 3300048915 Bacteria 2668
1798 Ga0496112_0126745 3300048915 Bacteria 2523
1799 Ga0496112_0183263 3300048915 Bacteria 2057
1800 Ga0496112_0490475 3300048915 Bacteria 1164
1801 Ga0496112_0493299 3300048915 Bacteria 1160
1802 Ga0496112_0553001 3300048915 Bacteria 1085
1803 Ga0496112_0625591 3300048915 Bacteria 1007
1804 Ga0496112_1606466 3300048915 Bacteria 563
1805 Ga0496113_0062546 3300048916 Bacteria 2811
1806 Ga0496113_0073033 3300048916 Bacteria 2612
1807 Ga0496113_0082457 3300048916 Bacteria 2466
1808 Ga0496113_0082707 3300048916 Bacteria 2462
1809 Ga0496113_0151705 3300048916 Bacteria 1828
1810 Ga0496113_0405610 3300048916 Bacteria 1094
1811 Ga0496113_0421286 3300048916 Bacteria 1072
1812 Ga0496113_0616776 3300048916 Bacteria 868
1813 Ga0496113_0648266 3300048916 Bacteria 844
1814 Ga0496113_0835767 3300048916 Bacteria 730
1815 Ga0496114_0095538 3300048917 Bacteria 2529
1816 Ga0496114_0156258 3300048917 Bacteria 1980
1817 Ga0496114_0199460 3300048917 Bacteria 1752
1818 Ga0496114_0619389 3300048917 Bacteria 953
1819 Ga0496114_0621935 3300048917 Bacteria 951
1820 Ga0496114_0874604 3300048917 Bacteria 779
1821 Ga0496114_0992873 3300048917 Bacteria 722
1822 Ga0496114_1086462 3300048917 Bacteria 685
1823 Ga0496115_0004922 3300048918 Bacteria 9702
1824 Ga0496115_0028688 3300048918 Bacteria 4364
1825 Ga0496115_0031262 3300048918 Bacteria 4193
1826 Ga0496115_0090300 3300048918 Bacteria 2502
1827 Ga0496115_0129152 3300048918 Bacteria 2082
1828 Ga0496115_0166941 3300048918 Bacteria 1820
1829 Ga0496115_0431587 3300048918 Bacteria 1066
1830 Ga0496115_0492973 3300048918 Bacteria 985
1831 Ga0496115_0505356 3300048918 Bacteria 971
1832 Ga0496115_0590189 3300048918 Bacteria 884
1833 Ga0496115_0843172 3300048918 Bacteria 710
1834 Ga0496115_0891278 3300048918 Bacteria 686
1835 Ga0496115_0938486 3300048918 Bacteria 665
1836 Ga0496116_0050868 3300048919 Bacteria 2757
1837 Ga0496116_0181295 3300048919 Bacteria 1127
1838 Ga0496116_0349606 3300048919 Bacteria 677
1839 Ga0496116_0455360 3300048919 Bacteria 546
1840 Ga0496117_0152534 3300048920 Bacteria 1365
1841 Ga0496117_0165645 3300048920 Bacteria 1289
1842 Ga0496117_0190283 3300048920 Bacteria 1169
1843 Ga0496118_0010277 3300048921 Bacteria 9286
1844 Ga0496118_0038146 3300048921 Bacteria 3855
1845 Ga0496118_0057391 3300048921 Bacteria 2918
1846 Ga0496118_0112374 3300048921 Bacteria 1803
1847 Ga0496118_0188917 3300048921 Bacteria 1234
1848 Ga0496118_0206949 3300048921 Bacteria 1155
1849 Ga0496118_0448751 3300048921 Bacteria 655
1850 Ga0496119_0061766 3300048922 Bacteria 2235
1851 Ga0496119_0099346 3300048922 Bacteria 1637
1852 Ga0496119_0163200 3300048922 Bacteria 1182
1853 Ga0496119_0166467 3300048922 Bacteria 1167
1854 Ga0496119_0303497 3300048922 Bacteria 786
1855 Ga0496120_0028214 3300048923 Bacteria 3441
1856 Ga0496120_0106077 3300048923 Bacteria 1476
1857 Ga0496120_0193413 3300048923 Bacteria 990
1858 Ga0496120_0259725 3300048923 Bacteria 811
1859 Ga0496120_0332694 3300048923 Bacteria 687
1860 Ga0496120_0494569 3300048923 Bacteria 526
1861 Ga0496121_0002196 3300048924 Bacteria 30506
1862 Ga0496121_0012437 3300048924 Bacteria 9278
1863 Ga0496121_0018239 3300048924 Bacteria 7093
1864 Ga0496121_0062541 3300048924 Bacteria 3048
1865 Ga0496121_0126270 3300048924 Bacteria 1922
1866 Ga0496121_0175710 3300048924 Bacteria 1550
1867 Ga0496121_0291074 3300048924 Bacteria 1112
1868 Ga0496121_0351140 3300048924 Bacteria 982
1869 Ga0496121_0370802 3300048924 Bacteria 947
1870 Ga0496121_0495791 3300048924 Bacteria 776
1871 Ga0496121_0568624 3300048924 Bacteria 706
1872 Ga0496121_0603752 3300048924 Bacteria 676
1873 Ga0496121_0672680 3300048924 Bacteria 627
1874 Ga0496121_0732233 3300048924 Bacteria 590
1875 Ga0496122_0081132 3300048925 Bacteria 2259
1876 Ga0496122_0146403 3300048925 Bacteria 1467
1877 Ga0496122_0511361 3300048925 Bacteria 581
1878 Ga0496122_0546897 3300048925 Bacteria 552
1879 Ga0496123_0210393 3300048926 Bacteria 989
1880 Ga0496123_0333751 3300048926 Bacteria 711
1881 Ga0496124_0004199 3300048927 Bacteria 16960
1882 Ga0496124_0046215 3300048927 Bacteria 3729
1883 Ga0496124_0166989 3300048927 Bacteria 1709
1884 Ga0496124_0323031 3300048927 Bacteria 1104
1885 Ga0496124_0723865 3300048927 Bacteria 627
1886 Ga0496124_0730369 3300048927 Bacteria 623
1887 Ga0496124_0754444 3300048927 Bacteria 609
1888 Ga0496125_0023890 3300048928 Bacteria 5632
1889 Ga0496125_0069688 3300048928 Bacteria 2757
1890 Ga0496125_0164790 3300048928 Bacteria 1499
1891 Ga0496125_0246146 3300048928 Bacteria 1131
1892 Ga0496125_0518865 3300048928 Bacteria 666
1893 Ga0496125_0520035 3300048928 Bacteria 665
1894 Ga0496125_0683156 3300048928 Bacteria 547
1895 Ga0496125_0694689 3300048928 Bacteria 541
1896 Ga0496126_0052986 3300048929 Bacteria 3683
1897 Ga0496126_0055514 3300048929 Bacteria 3583
1898 Ga0496126_0056669 3300048929 Bacteria 3541
1899 Ga0496126_0087077 3300048929 Bacteria 2752
1900 Ga0496126_0135399 3300048929 Bacteria 2125
1901 Ga0496126_0138430 3300048929 Bacteria 2097
1902 Ga0496126_0168420 3300048929 Bacteria 1868
1903 Ga0496126_0257980 3300048929 Bacteria 1450
1904 Ga0496126_0329911 3300048929 Bacteria 1252
1905 Ga0496126_0470654 3300048929 Bacteria 1008
1906 Ga0496126_0636095 3300048929 Bacteria 836
1907 Ga0496126_0675163 3300048929 Bacteria 805
1908 Ga0496126_0692963 3300048929 Bacteria 792
1909 Ga0496126_0871056 3300048929 Bacteria 685
1910 Ga0496126_1380950 3300048929 Bacteria 509
1911 Ga0501306_040697 3300049127 Bacteria 720
1912 Ga0501308_010973 3300049128 Bacteria 1014
1913 Ga0501305_002606 3300049161 Bacteria 1963
1914 Ga0501307_001064 3300049162 Bacteria 2181
1915 Ga0495678_193166 3300049459 Bacteria 631
1916 Ga0495682_0007189 3300049460 Bacteria 4447
1917 Ga0495682_0216548 3300049460 Bacteria 678
1918 Ga0495682_0225706 3300049460 Bacteria 663
1919 Ga0501313_000478 3300049529 Bacteria 2757
1920 Ga0501314_001624 3300049530 Bacteria 1648
1921 Ga0501315_001006 3300049531 Bacteria 2240
1922 Ga0501316_008607 3300049532 Bacteria 1130
1923 Ga0501317_003139 3300049533 Bacteria 1620
1924 Ga0501317_053939 3300049533 Bacteria 645
1925 Ga0501318_000289 3300049534 Bacteria 2926
1926 Ga0501318_042471 3300049534 Bacteria 654
1927 Ga0501320_006660 3300049536 Bacteria 1090
1928 Ga0501321_003608 3300049537 Bacteria 1429
1929 Ga0501324_013372 3300049540 Bacteria 777
1930 Ga0501325_001022 3300049541 Bacteria 1598
1931 Ga0501325_027194 3300049541 Bacteria 637
1932 Ga0501335_004292 3300049551 Bacteria 1240
1933 Ga0501031_0032969 3300049568 Bacteria 3377
1934 Ga0501031_0043134 3300049568 Bacteria 2944
1935 Ga0501031_0106279 3300049568 Bacteria 1832
1936 Ga0501031_0106490 3300049568 Bacteria 1830
1937 Ga0501031_0293338 3300049568 Bacteria 1054
1938 Ga0501032_0008814 3300049569 Bacteria 7337
1939 Ga0501032_0012346 3300049569 Bacteria 6106
1940 Ga0501032_0080615 3300049569 Bacteria 2165
1941 Ga0501032_0480145 3300049569 Bacteria 795
1942 Ga0501032_0527601 3300049569 Bacteria 753
1943 Ga0501032_0646720 3300049569 Bacteria 671
1944 Ga0501033_0000094 3300049570 Bacteria 84669
1945 Ga0501033_0003899 3300049570 Bacteria 12129
1946 Ga0501033_0058637 3300049570 Bacteria 2843
1947 Ga0501033_0062277 3300049570 Bacteria 2747
1948 Ga0501033_0070423 3300049570 Bacteria 2569
1949 Ga0501033_0549454 3300049570 Bacteria 796
1950 Ga0501034_0000021 3300049571 Bacteria 266023
1951 Ga0501034_0058496 3300049571 Bacteria 3874
1952 Ga0501034_0064071 3300049571 Bacteria 3689
1953 Ga0501034_0150472 3300049571 Bacteria 2303
1954 Ga0501034_0341828 3300049571 Bacteria 1426
1955 Ga0501034_0490261 3300049571 Bacteria 1143
1956 Ga0501036_0001704 3300049572 Bacteria 17077
1957 Ga0501036_0025460 3300049572 Bacteria 4991
1958 Ga0501036_0103003 3300049572 Bacteria 2414
1959 Ga0501036_0127385 3300049572 Bacteria 2150
1960 Ga0501036_0341053 3300049572 Bacteria 1251
1961 Ga0501036_1227589 3300049572 Bacteria 610
1962 Ga0501037_0000450 3300049573 Bacteria 33712
1963 Ga0501037_0043209 3300049573 Bacteria 3312
1964 Ga0501037_0055533 3300049573 Bacteria 2895
1965 Ga0501037_0181614 3300049573 Bacteria 1492
1966 Ga0501037_0280298 3300049573 Bacteria 1161
1967 Ga0501037_0372250 3300049573 Bacteria 983
1968 Ga0501037_0758159 3300049573 Bacteria 643
1969 Ga0501038_0000052 3300049574 Bacteria 94841
1970 Ga0501038_0002105 3300049574 Bacteria 18455
1971 Ga0501038_0012441 3300049574 Bacteria 7775
1972 Ga0501038_0193104 3300049574 Bacteria 1637
1973 Ga0501038_0217309 3300049574 Bacteria 1527
1974 Ga0501038_0226561 3300049574 Bacteria 1489
1975 Ga0501038_0715359 3300049574 Bacteria 749
1976 Ga0501039_0000549 3300049575 Bacteria 27168
1977 Ga0501039_0054081 3300049575 Bacteria 3107
1978 Ga0501039_0059666 3300049575 Bacteria 2954
1979 Ga0501039_0268213 3300049575 Bacteria 1342
1980 Ga0501039_0730827 3300049575 Bacteria 773
1981 Ga0501039_0911450 3300049575 Bacteria 684
1982 Ga0501040_0147552 3300049576 Bacteria 1658
1983 Ga0501040_0476983 3300049576 Bacteria 899
1984 Ga0501040_0649790 3300049576 Bacteria 762
1985 Ga0501042_0024330 3300049578 Bacteria 4247
1986 Ga0501042_0115203 3300049578 Bacteria 1935
1987 Ga0501042_0493838 3300049578 Bacteria 889
1988 Ga0501042_0963573 3300049578 Bacteria 622
1989 Ga0501042_1300388 3300049578 Bacteria 530
1990 Ga0501043_0005051 3300049579 Bacteria 10670
1991 Ga0501043_0019357 3300049579 Bacteria 5344
1992 Ga0501043_0053373 3300049579 Bacteria 3174
1993 Ga0501043_0054560 3300049579 Bacteria 3139
1994 Ga0501043_0073700 3300049579 Bacteria 2681
1995 Ga0501043_0700772 3300049579 Bacteria 740
1996 Ga0501046_0002237 3300049580 Bacteria 18256
1997 Ga0501046_0031427 3300049580 Bacteria 4303
1998 Ga0501046_0041545 3300049580 Bacteria 3669
1999 Ga0501046_0099560 3300049580 Bacteria 2231
2000 Ga0501046_0314356 3300049580 Bacteria 1142
2001 Ga0501046_0682521 3300049580 Bacteria 724
2002 Ga0501047_0005487 3300049581 Bacteria 11930
2003 Ga0501047_0015758 3300049581 Bacteria 7204
2004 Ga0501047_0017348 3300049581 Bacteria 6894
2005 Ga0501047_0096357 3300049581 Bacteria 2837
2006 Ga0501047_0321371 3300049581 Bacteria 1387
2007 Ga0501047_0833261 3300049581 Bacteria 736
2008 Ga0501047_1140588 3300049581 Bacteria 593
2009 Ga0501048_0001862 3300049582 Bacteria 16006
2010 Ga0501048_0014555 3300049582 Bacteria 5821
2011 Ga0501048_0038901 3300049582 Bacteria 3413
2012 Ga0501048_0068927 3300049582 Bacteria 2498
2013 Ga0501048_0210552 3300049582 Bacteria 1379
2014 Ga0501048_0308921 3300049582 Bacteria 1126
2015 Ga0501048_0575224 3300049582 Bacteria 808
2016 Ga0501048_1220341 3300049582 Bacteria 541
2017 Ga0501067_0001840 3300049583 Bacteria 11669
2018 Ga0501067_0006170 3300049583 Bacteria 6642
2019 Ga0501067_0159624 3300049583 Bacteria 1256
2020 Ga0501067_0416611 3300049583 Bacteria 749
2021 Ga0501067_0546877 3300049583 Bacteria 648
2022 Ga0501068_0001049 3300049584 Bacteria 14641
2023 Ga0501068_0005350 3300049584 Bacteria 7016
2024 Ga0501068_0068839 3300049584 Bacteria 2157
2025 Ga0501068_0625969 3300049584 Bacteria 702
2026 Ga0501068_1130676 3300049584 Bacteria 518
2027 Ga0501069_0092719 3300049585 Bacteria 1708
2028 Ga0501069_0102505 3300049585 Bacteria 1625
2029 Ga0501069_0123493 3300049585 Bacteria 1480
2030 Ga0501069_0174624 3300049585 Bacteria 1241
2031 Ga0501069_0299063 3300049585 Bacteria 943
2032 Ga0501069_0505109 3300049585 Bacteria 721
2033 Ga0501069_0755810 3300049585 Bacteria 588
2034 Ga0501070_0025506 3300049586 Bacteria 4958
2035 Ga0501070_0049842 3300049586 Bacteria 3476
2036 Ga0501070_0073534 3300049586 Bacteria 2828
2037 Ga0501070_0158650 3300049586 Bacteria 1865
2038 Ga0501070_0166019 3300049586 Bacteria 1819
2039 Ga0501070_0265466 3300049586 Bacteria 1402
2040 Ga0501070_0417253 3300049586 Bacteria 1084
2041 Ga0501070_0686722 3300049586 Bacteria 810
2042 Ga0501070_0975956 3300049586 Bacteria 658
2043 Ga0501071_0014068 3300049587 Bacteria 5468
2044 Ga0501071_0093574 3300049587 Bacteria 2210
2045 Ga0501071_0441898 3300049587 Bacteria 995
2046 Ga0501071_0602468 3300049587 Bacteria 845
2047 Ga0501071_0741637 3300049587 Bacteria 757
2048 Ga0501071_0905424 3300049587 Bacteria 681
2049 Ga0501072_0002634 3300049588 Bacteria 13457
2050 Ga0501072_0325324 3300049588 Bacteria 1222
2051 Ga0501072_0506713 3300049588 Bacteria 954
2052 Ga0501072_0627657 3300049588 Bacteria 846
2053 Ga0501073_0000597 3300049589 Bacteria 25445
2054 Ga0501073_0258545 3300049589 Bacteria 1201
2055 Ga0501073_0333901 3300049589 Bacteria 1046
2056 Ga0501073_0484297 3300049589 Bacteria 855
2057 Ga0501073_1070015 3300049589 Bacteria 554
2058 Ga0501074_0000285 3300049590 Bacteria 29182
2059 Ga0501074_0015922 3300049590 Bacteria 5469
2060 Ga0501074_0097677 3300049590 Bacteria 2102
2061 Ga0501074_0472800 3300049590 Bacteria 888
2062 Ga0501074_0505575 3300049590 Bacteria 856
2063 Ga0501074_0554274 3300049590 Bacteria 814
2064 Ga0501075_0070033 3300049591 Bacteria 2651
2065 Ga0501075_0122155 3300049591 Bacteria 1982
2066 Ga0501075_1260807 3300049591 Bacteria 560
2067 Ga0501076_0037512 3300049592 Bacteria 3801
2068 Ga0501076_0095532 3300049592 Bacteria 2394
2069 Ga0501076_0121604 3300049592 Bacteria 2114
2070 Ga0501076_0253917 3300049592 Bacteria 1439
2071 Ga0501076_0396316 3300049592 Bacteria 1135
2072 Ga0501076_0485098 3300049592 Bacteria 1018
2073 Ga0501076_1346489 3300049592 Bacteria 587
2074 Ga0501076_1406787 3300049592 Bacteria 573
2075 Ga0501077_0068650 3300049593 Bacteria 2247
2076 Ga0501077_0227628 3300049593 Bacteria 1185
2077 Ga0501077_0911074 3300049593 Bacteria 566
2078 Ga0501079_0008121 3300049741 Bacteria 7953
2079 Ga0501079_0553001 3300049741 Bacteria 905
2080 Ga0501079_0990745 3300049741 Bacteria 662
2081 Ga0501079_1264662 3300049741 Bacteria 581
2082 Ga0501080_0001080 3300049742 Bacteria 22459
2083 Ga0501080_0015400 3300049742 Bacteria 7048
2084 Ga0501080_0049974 3300049742 Bacteria 3892
2085 Ga0501080_1193622 3300049742 Bacteria 654
2086 Ga0501081_0374207 3300049743 Bacteria 1052
2087 Ga0501081_0994447 3300049743 Bacteria 634
2088 Ga0501083_0005133 3300049744 Bacteria 9268
2089 Ga0501083_0022769 3300049744 Bacteria 4347
2090 Ga0501083_0652007 3300049744 Bacteria 685
2091 Ga0501035_0000255 3300049822 Bacteria 63841
2092 Ga0501035_0061225 3300049822 Bacteria 3350
2093 Ga0501035_0075525 3300049822 Bacteria 2980
2094 Ga0501035_0078226 3300049822 Bacteria 2922
2095 Ga0501035_0160311 3300049822 Bacteria 1947
2096 Ga0501035_0205176 3300049822 Bacteria 1689
2097 Ga0501035_0287039 3300049822 Bacteria 1389
2098 Ga0501035_0298622 3300049822 Bacteria 1357
2099 Ga0501044_0014028 3300049823 Bacteria 8651
2100 Ga0501044_0018525 3300049823 Bacteria 7459
2101 Ga0501044_0023029 3300049823 Bacteria 6629
2102 Ga0501044_0047177 3300049823 Bacteria 4456
2103 Ga0501044_0161220 3300049823 Bacteria 2219
2104 Ga0501044_0191585 3300049823 Bacteria 2007
2105 Ga0501044_1498897 3300049823 Bacteria 539
2106 Ga0501045_0008019 3300049824 Bacteria 7353
2107 Ga0501045_0020723 3300049824 Bacteria 4697
2108 Ga0501045_0559802 3300049824 Bacteria 848
2109 nmdc:mga03683_366557_c1 3300050489 Bacteria 684
2110 nmdc:mga03683_410752_c1 3300050489 Bacteria 647
2111 nmdc:mga03683_421287_c1 3300050489 Bacteria 640
2112 nmdc:mga03683_433762_c1 3300050489 Bacteria 631
2113 nmdc:mga03n38_261423_c1 3300050490 Bacteria 918
2114 nmdc:mga03n38_267638_c1 3300050490 Bacteria 908
2115 nmdc:mga03n38_26871_c1 3300050490 Bacteria 1965
2116 nmdc:mga03n38_51087_c1 3300050490 Bacteria 1845
2117 nmdc:mga03n38_56258_c1 3300050490 Bacteria 1775
2118 nmdc:mga03n38_816947_c1 3300050490 Bacteria 544
2119 nmdc:mga03n38_837349_c1 3300050490 Bacteria 537
2120 nmdc:mga00v17_404813_c1 3300050491 Bacteria 887
2121 nmdc:mga00v17_46530_c1 3300050491 Bacteria 2625
2122 nmdc:mga00v17_515394_c1 3300050491 Bacteria 775
2123 nmdc:mga00v17_721988_c1 3300050491 Bacteria 638
2124 nmdc:mga00v17_769614_c1 3300050491 Bacteria 615
2125 nmdc:mga0yw44_11167_c1 3300050492 Bacteria 4621
2126 nmdc:mga0yw44_1184017_c1 3300050492 Bacteria 516
2127 nmdc:mga0yw44_132659_c1 3300050492 Bacteria 1614
2128 nmdc:mga0yw44_171528_c1 3300050492 Bacteria 1425
2129 nmdc:mga0yw44_240608_c1 3300050492 Bacteria 1203
2130 nmdc:mga0yw44_42038_c1 3300050492 Bacteria 2724
2131 nmdc:mga0yw44_931554_c1 3300050492 Bacteria 589
2132 nmdc:mga0k408_13277_c1 3300050493 Bacteria 4513
2133 nmdc:mga06z11_133429_c1 3300050494 Bacteria 1397
2134 nmdc:mga06z11_198329_c1 3300050494 Bacteria 1165
2135 nmdc:mga06z11_252445_c1 3300050494 Bacteria 1039
2136 nmdc:mga06z11_357011_c1 3300050494 Bacteria 876
2137 nmdc:mga06z11_70162_c1 3300050494 Bacteria 1852
2138 nmdc:mga04h51_52340_c1 3300050495 Bacteria 1375
2139 nmdc:mga07m45_103592_c1 3300050496 Bacteria 1636
2140 nmdc:mga07m45_279190_c1 3300050496 Bacteria 972
2141 nmdc:mga07m45_87295_c1 3300050496 Bacteria 1785
2142 nmdc:mga05p37_1622265_c1 3300050507 Bacteria 636
2143 nmdc:mga05p37_587380_c1 3300050507 Bacteria 1260
2144 nmdc:mga09592_1272861_c1 3300050508 Bacteria 605
2145 nmdc:mga09592_325495_c1 3300050508 Bacteria 1331
2146 nmdc:mga0qj67_120438_c1 3300050509 Bacteria 2122
2147 nmdc:mga0qj67_806880_c1 3300050509 Bacteria 743
2148 nmdc:mga08y16_318412_c1 3300050511 Bacteria 1602
2149 nmdc:mga08y16_836254_c1 3300050511 Bacteria 911
2150 nmdc:mga0n895_47595_c1 3300050512 Bacteria 4193
2151 nmdc:mga0n895_769032_c1 3300050512 Bacteria 955
2152 nmdc:mga0n895_859294_c1 3300050512 Bacteria 895
2153 nmdc:mga0rr50_125060_c1 3300050513 Bacteria 2052
2154 nmdc:mga0rr50_1684057_c1 3300050513 Bacteria 535
2155 nmdc:mga08x19_310329_c1 3300050514 Bacteria 1096
2156 nmdc:mga08x19_382513_c1 3300050514 Bacteria 986
2157 nmdc:mga08x19_724037_c1 3300050514 Bacteria 706
2158 nmdc:mga0a205_49921_c1 3300050515 Bacteria 4039
2159 nmdc:mga0sz30_107389_c1 3300050516 Bacteria 1222
2160 nmdc:mga0sz30_198108_c1 3300050516 Bacteria 892
2161 nmdc:mga0sz30_2465_c1 3300050516 Bacteria 6587
2162 nmdc:mga0sz30_553866_c1 3300050516 Bacteria 519
2163 Ga0495601_0063163 3300053077 Bacteria 2353
2164 Ga0495601_0246127 3300053077 Bacteria 1167
2165 Ga0495601_0521101 3300053077 Bacteria 766
2166 Ga0495601_0559693 3300053077 Bacteria 735
2167 Ga0495601_0572043 3300053077 Bacteria 726
2168 Ga0495601_0589847 3300053077 Bacteria 714
2169 Ga0495601_0748475 3300053077 Bacteria 622
2170 Ga0495612_0006325 3300053078 Bacteria 4882
2171 Ga0495612_0121140 3300053078 Bacteria 1125
2172 Ga0495612_0171101 3300053078 Bacteria 951
2173 Ga0500610_0118000 3300053079 Bacteria 1359
2174 Ga0500610_0243054 3300053079 Bacteria 836
2175 Ga0500610_0399878 3300053079 Bacteria 559
2176 Ga0500635_0071313 3300053080 Bacteria 1232
2177 Ga0500635_0077879 3300053080 Bacteria 1186
2178 Ga0500635_0166509 3300053080 Bacteria 847
2179 Ga0495655_0050060 3300053083 Bacteria 1102
2180 Ga0495655_0118124 3300053083 Bacteria 804
2181 Ga0495655_0223139 3300053083 Bacteria 624
2182 Ga0495595_0018184 3300053084 Bacteria 3034
2183 Ga0495595_0164004 3300053084 Bacteria 1098
2184 Ga0495595_0220100 3300053084 Bacteria 947
2185 Ga0495595_0383718 3300053084 Bacteria 711
2186 Ga0495619_0078427 3300053085 Bacteria 2220
2187 Ga0495619_0156778 3300053085 Bacteria 1571
2188 Ga0495619_0446083 3300053085 Bacteria 892
2189 Ga0495619_0572988 3300053085 Bacteria 773
2190 Ga0495619_1103225 3300053085 Bacteria 528
2191 Ga0500578_0177891 3300053086 Bacteria 1312
2192 Ga0500578_0274812 3300053086 Bacteria 1007
2193 Ga0500578_0357348 3300053086 Bacteria 852
2194 Ga0500578_0648709 3300053086 Bacteria 574
2195 Ga0500578_0713275 3300053086 Bacteria 538
2196 Ga0500643_000227 3300053087 Bacteria 52101
2197 Ga0500643_117885 3300053087 Bacteria 715
2198 Ga0500644_0001281 3300053088 Bacteria 6847
2199 Ga0500644_0024693 3300053088 Bacteria 1840
2200 Ga0500644_0482900 3300053088 Bacteria 544
2201 Ga0500581_335258 3300053089 Bacteria 581
2202 Ga0500646_0101356 3300053090 Bacteria 904
2203 Ga0500646_0256632 3300053090 Bacteria 617
2204 Ga0500646_0375883 3300053090 Bacteria 521
2205 Ga0500646_0401282 3300053090 Bacteria 506
2206 Ga0500647_0136794 3300053091 Bacteria 1152
2207 Ga0500647_0137515 3300053091 Bacteria 1148
2208 Ga0500647_0152221 3300053091 Bacteria 1078
2209 Ga0500583_0261089 3300053092 Bacteria 853
2210 Ga0500583_0339445 3300053092 Bacteria 729
2211 Ga0500583_0423092 3300053092 Bacteria 636
2212 Ga0500651_0055530 3300053093 Bacteria 2480
2213 Ga0500651_0066405 3300053093 Bacteria 2246
2214 Ga0500651_0397211 3300053093 Bacteria 775
2215 Ga0500566_0000320 3300053094 Bacteria 25974
2216 Ga0500566_0023602 3300053094 Bacteria 3611
2217 Ga0500566_0034994 3300053094 Bacteria 2919
2218 Ga0500640_039267 3300053095 Bacteria 2079
2219 Ga0500640_112994 3300053095 Bacteria 1101
2220 Ga0500640_136720 3300053095 Bacteria 958
2221 Ga0500641_0007663 3300053096 Bacteria 3847
2222 Ga0500641_0073123 3300053096 Bacteria 1446
2223 Ga0500648_162224 3300053097 Bacteria 1174
2224 Ga0500648_204380 3300053097 Bacteria 988
2225 Ga0500650_0212642 3300053098 Bacteria 877
2226 Ga0500650_0352269 3300053098 Bacteria 643
2227 Ga0500654_202039 3300053099 Bacteria 597
2228 Ga0500553_177805 3300053101 Bacteria 769
2229 Ga0500554_051832 3300053102 Bacteria 1293
2230 Ga0500554_260419 3300053102 Bacteria 569
2231 Ga0500555_003043 3300053103 Bacteria 4793
2232 Ga0500555_041936 3300053103 Bacteria 1272
2233 Ga0500556_0002980 3300053104 Bacteria 5108
2234 Ga0500556_0279495 3300053104 Bacteria 655
2235 Ga0500557_000010 3300053105 Bacteria 118251
2236 Ga0500558_269592 3300053106 Bacteria 548
2237 Ga0500562_009272 3300053108 Bacteria 2488
2238 Ga0500562_081749 3300053108 Bacteria 874
2239 Ga0500562_114258 3300053108 Bacteria 735
2240 Ga0500569_087992 3300053109 Bacteria 1002
2241 Ga0500569_088882 3300053109 Bacteria 998
2242 Ga0500572_001453 3300053111 Bacteria 6482
2243 Ga0500572_006785 3300053111 Bacteria 2630
2244 Ga0500572_157486 3300053111 Bacteria 743
2245 Ga0500592_060904 3300053116 Bacteria 617
2246 Ga0500594_0012613 3300053118 Bacteria 1995
2247 Ga0500594_0027857 3300053118 Bacteria 1465
2248 Ga0500594_0338029 3300053118 Bacteria 506
2249 Ga0500595_004583 3300053119 Bacteria 6165
2250 Ga0500595_024963 3300053119 Bacteria 2079
2251 Ga0500595_036059 3300053119 Bacteria 1623
2252 Ga0500595_093416 3300053119 Bacteria 868
2253 Ga0500595_097613 3300053119 Bacteria 844
2254 Ga0500597_283378 3300053120 Bacteria 667
2255 Ga0500597_370098 3300053120 Bacteria 552
2256 Ga0500597_373040 3300053120 Bacteria 549
2257 Ga0500607_011275 3300053121 Bacteria 5290
2258 Ga0500608_014127 3300053122 Bacteria 3557
2259 Ga0500608_100139 3300053122 Bacteria 1343
2260 Ga0500608_261250 3300053122 Bacteria 668
2261 Ga0500614_016190 3300053123 Bacteria 1670
2262 Ga0500614_021690 3300053123 Bacteria 1492
2263 Ga0500628_129025 3300053129 Bacteria 693
2264 Ga0500642_0001144 3300053130 Bacteria 7603
2265 Ga0500642_0041999 3300053130 Bacteria 1980
2266 Ga0500642_0215378 3300053130 Bacteria 891
2267 Ga0500642_0320311 3300053130 Bacteria 695
2268 Ga0500642_0379285 3300053130 Bacteria 621
2269 Ga0500652_001803 3300053131 Bacteria 6489
2270 Ga0500652_113707 3300053131 Bacteria 1131
2271 Ga0500652_216662 3300053131 Bacteria 771
2272 Ga0500652_329213 3300053131 Bacteria 583
2273 Ga0500655_010692 3300053133 Bacteria 1658
2274 Ga0500655_043326 3300053133 Bacteria 886
2275 Ga0500658_0048461 3300053134 Bacteria 1727
2276 Ga0500658_0332199 3300053134 Bacteria 698
2277 Ga0500658_0453696 3300053134 Bacteria 583
2278 Ga0500559_0002803 3300053136 Bacteria 8808
2279 Ga0500559_0030835 3300053136 Bacteria 2299
2280 Ga0500559_0051014 3300053136 Bacteria 1826
2281 Ga0500559_0217333 3300053136 Bacteria 901
2282 Ga0500559_0218187 3300053136 Bacteria 899
2283 Ga0500559_0363413 3300053136 Bacteria 676
2284 Ga0500561_0091190 3300053137 Bacteria 901
2285 Ga0500564_004201 3300053138 Bacteria 5729
2286 Ga0500568_0071897 3300053139 Bacteria 1323
2287 Ga0500568_0134928 3300053139 Bacteria 916
2288 Ga0500568_0137510 3300053139 Bacteria 906
2289 Ga0500568_0163012 3300053139 Bacteria 822
2290 Ga0500568_0232682 3300053139 Bacteria 672
2291 Ga0500568_0339642 3300053139 Bacteria 544
2292 Ga0500573_0006745 3300053140 Bacteria 6228
2293 Ga0500577_0111488 3300053142 Bacteria 1129
2294 Ga0500577_0265746 3300053142 Bacteria 746
2295 Ga0500577_0289027 3300053142 Bacteria 715
2296 Ga0500577_0456365 3300053142 Bacteria 558
2297 Ga0500577_0514029 3300053142 Bacteria 523
2298 Ga0500579_190643 3300053143 Bacteria 782
2299 Ga0500585_204860 3300053144 Bacteria 655
2300 Ga0500588_0258953 3300053146 Bacteria 654
2301 Ga0500588_0357131 3300053146 Bacteria 555
2302 Ga0500590_033008 3300053148 Bacteria 2684
2303 Ga0500590_115369 3300053148 Bacteria 1267
2304 Ga0500590_246961 3300053148 Bacteria 713
2305 Ga0500603_003307 3300053150 Bacteria 3463
2306 Ga0500603_009515 3300053150 Bacteria 2176
2307 Ga0500603_207848 3300053150 Bacteria 622
2308 Ga0500604_0011626 3300053151 Bacteria 2367
2309 Ga0500604_0115134 3300053151 Bacteria 895
2310 Ga0500604_0327889 3300053151 Bacteria 531
2311 Ga0500606_098712 3300053152 Bacteria 986
2312 Ga0500616_0000006 3300053153 Bacteria 944738
2313 Ga0500616_0000085 3300053153 Bacteria 193192
2314 Ga0500616_0013161 3300053153 Bacteria 4816
2315 Ga0500616_0043747 3300053153 Bacteria 2392
2316 Ga0500616_0192251 3300053153 Bacteria 910
2317 Ga0500616_0304119 3300053153 Bacteria 661
2318 Ga0500619_000847 3300053154 Bacteria 5225
2319 Ga0500620_061973 3300053155 Bacteria 1274
2320 Ga0500620_105335 3300053155 Bacteria 987
2321 Ga0500622_0004758 3300053156 Bacteria 8356
2322 Ga0500622_0077284 3300053156 Bacteria 1672
2323 Ga0500622_0208299 3300053156 Bacteria 884
2324 Ga0500627_0016063 3300053158 Bacteria 2911
2325 Ga0500627_0083588 3300053158 Bacteria 1424
2326 Ga0500627_0163322 3300053158 Bacteria 1004
2327 Ga0500634_0314854 3300053161 Bacteria 613
2328 Ga0500638_002268 3300053162 Bacteria 6590
2329 Ga0500638_006089 3300053162 Bacteria 4895
2330 Ga0500638_024655 3300053162 Bacteria 2870
2331 Ga0500638_099763 3300053162 Bacteria 1356
2332 Ga0500638_119650 3300053162 Bacteria 1206
2333 Ga0500639_002134 3300053163 Bacteria 9896
2334 Ga0500639_049846 3300053163 Bacteria 2183
2335 Ga0500639_051651 3300053163 Bacteria 2140
2336 Ga0500639_125227 3300053163 Bacteria 1227
2337 Ga0500639_149104 3300053163 Bacteria 1081
2338 Ga0500636_0143963 3300053177 Bacteria 1316
2339 Ga0500636_0296018 3300053177 Bacteria 799
2340 Ga0500636_0329793 3300053177 Bacteria 737
2341 Ga0500636_0415374 3300053177 Bacteria 619
2342 Ga0500637_0003070 3300053178 Bacteria 7605
2343 Ga0500637_0051628 3300053178 Bacteria 2343
2344 Ga0500637_0164946 3300053178 Bacteria 1275
2345 Ga0500637_0373379 3300053178 Bacteria 750
2346 Ga0500637_0398617 3300053178 Bacteria 715
2347 Ga0500637_0414925 3300053178 Bacteria 694
2348 Ga0500649_133007 3300053722 Bacteria 927
2349 Ga0500567_147073 3300053723 Bacteria 890
2350 Ga0500576_180875 3300053725 Bacteria 744
2351 Ga0500576_238910 3300053725 Bacteria 577
2352 Ga0500611_067759 3300053727 Bacteria 862
2353 Ga0500625_072266 3300053729 Bacteria 1531
2354 Ga0500645_001772 3300053730 Bacteria 10420
2355 Ga0500645_007545 3300053730 Bacteria 3777
2356 Ga0500609_011977 3300053731 Bacteria 1173
2357 Ga0500609_039471 3300053731 Bacteria 652
2358 Ga0500609_047325 3300053731 Bacteria 596
2359 Ga0500552_040942 3300053733 Bacteria 754
2360 Ga0500596_008894 3300053735 Bacteria 1585
2361 Ga0500596_012417 3300053735 Bacteria 1292
2362 Ga0500599_004657 3300053736 Bacteria 1701
2363 Ga0500601_000921 3300053737 Bacteria 3489
2364 Ga0500601_014472 3300053737 Bacteria 896
2365 Ga0500587_060328 3300053739 Bacteria 579
2366 Ga0501084_0017420 3300054114 Bacteria 5972
2367 Ga0501084_0041111 3300054114 Bacteria 3867
2368 Ga0501084_0875914 3300054114 Bacteria 755
2369 Ga0501084_1383372 3300054114 Bacteria 589
2370 Ga0500661_006436 3300055283 Bacteria 2184
2371 Ga0500661_018639 3300055283 Bacteria 1236
2372 Ga0500661_052346 3300055283 Bacteria 730
2373 Ga0587066_017034 3300059490 Bacteria 1153
2374 Ga0587070_007170 3300059491 Bacteria 1535
2375 Ga0587073_0079436 3300059492 Bacteria 811
2376 Ga0587080_077005 3300059503 Bacteria 677
2377 Ga0587082_004176 3300059504 Bacteria 1789
2378 Ga0587083_0109414 3300059505 Bacteria 700
2379 Ga0587085_001166 3300059506 Bacteria 2334
2380 Ga0587088_139516 3300059508 Bacteria 577
2381 Ga0587091_041345 3300059511 Bacteria 910
2382 Ga0587098_006153 3300059604 Bacteria 1206
2383 Ga0587106_069324 3300059605 Bacteria 665
2384 Ga0587128_116576 3300059630 Bacteria 577
2385 Ga0587062_069322 3300059639 Bacteria 635
2386 Ga0587072_044665 3300059643 Bacteria 871
2387 Ga0587107_004105 3300059652 Bacteria 1458
2388 Ga0587111_0007618 3300060346 Bacteria 1765
2389 Ga0501082_0004728 3300060353 Bacteria 11876
2390 Ga0501082_0059046 3300060353 Bacteria 3305
2391 Ga0501082_0384089 3300060353 Bacteria 1225
2392 Ga0501082_0740726 3300060353 Bacteria 860
2393 Ga0501082_0821083 3300060353 Bacteria 813
2394 Ga0501082_0888288 3300060353 Bacteria 780
2395 Ga0530510_0056862 3300061734 Bacteria 2827
2396 Ga0530510_0568966 3300061734 Bacteria 861

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8016557553 8016561266 88
2 iso_pu_bacteria 8019608314 8019616214 88
3 3300006048 Ga0075363_100939607 Ga0075363_1009396072 90
4 3300014968 Ga0157379_11018876 Ga0157379_110188761 90
5 3300025903 Ga0207680_10576020 Ga0207680_105760202 90
6 3300025920 Ga0207649_11294752 Ga0207649_112947522 90
7 3300050489 nmdc:mga03683_410752_c1 nmdc:mga03683_410752_c1_162_470 90
8 3300050490 nmdc:mga03n38_837349_c1 nmdc:mga03n38_837349_c1_152_460 90
9 3300053153 Ga0500616_0000085 Ga0500616_0000085_135939_136247 90
10 2010549000 RicEn_C5874 RicEn_104160 92
11 3300000532 CNAas_1005690 CNAas_10056902 92
12 3300000549 LJQas_1018455 LJQas_10184552 92
13 3300001904 JGI24736J21556_1073790 JGI24736J21556_10737902 92
14 3300001915 JGI24741J21665_1027565 JGI24741J21665_10275652 92
15 3300001915 JGI24741J21665_1057490 JGI24741J21665_10574901 92
16 3300001977 JGI24746J21847_1026022 JGI24746J21847_10260222 92
17 3300001978 JGI24747J21853_1015344 JGI24747J21853_10153441 92
18 3300001979 JGI24740J21852_10083972 JGI24740J21852_100839722 92
19 3300001979 JGI24740J21852_10093120 JGI24740J21852_100931202 92
20 3300001979 JGI24740J21852_10110192 JGI24740J21852_101101921 92
21 3300001989 JGI24739J22299_10021424 JGI24739J22299_100214245 92
22 3300001989 JGI24739J22299_10034294 JGI24739J22299_100342945 92
23 3300001989 JGI24739J22299_10048104 JGI24739J22299_100481041 92
24 3300001989 JGI24739J22299_10145934 JGI24739J22299_101459341 92
25 3300001989 JGI24739J22299_10189131 JGI24739J22299_101891312 92
26 3300001990 JGI24737J22298_10008861 JGI24737J22298_100088612 92
27 3300001990 JGI24737J22298_10132603 JGI24737J22298_101326032 92
28 3300002067 JGI24735J21928_10014623 JGI24735J21928_100146235 92
29 3300002067 JGI24735J21928_10124774 JGI24735J21928_101247742 92
30 3300002070 JGI24750J21931_1008775 JGI24750J21931_10087753 92
31 3300002073 JGI24745J21846_1044293 JGI24745J21846_10442932 92
32 3300002074 JGI24748J21848_1020628 JGI24748J21848_10206282 92
33 3300002075 JGI24738J21930_10006734 JGI24738J21930_100067343 92
34 3300002075 JGI24738J21930_10110199 JGI24738J21930_101101992 92
35 3300002076 JGI24749J21850_1062373 JGI24749J21850_10623732 92
36 3300002077 JGI24744J21845_10033365 JGI24744J21845_100333652 92
37 3300002155 JGI24033J26618_1015106 JGI24033J26618_10151063 92
38 3300002155 JGI24033J26618_1041773 JGI24033J26618_10417731 92
39 3300002155 JGI24033J26618_1063387 JGI24033J26618_10633872 92
40 3300002239 JGI24034J26672_10017113 JGI24034J26672_100171133 92
41 3300002239 JGI24034J26672_10019005 JGI24034J26672_100190052 92
42 3300002244 JGI24742J22300_10013172 JGI24742J22300_100131723 92
43 3300003203 JGI25406J46586_10000078 JGI25406J46586_100000782 92
44 3300003203 JGI25406J46586_10040734 JGI25406J46586_100407342 92
45 3300003203 JGI25406J46586_10108005 JGI25406J46586_101080052 92
46 3300003214 JGI25165J46597_1006932 JGI25165J46597_10069322 92
47 3300003214 JGI25165J46597_1020572 JGI25165J46597_10205722 92
48 3300003215 JGI25153J46596_10001601 JGI25153J46596_1000160114 92
49 3300003308 Ga0006777J48905_1054038 Ga0006777J48905_10540383 92
50 3300003574 Ga0007410J51695_1028777 Ga0007410J51695_10287772 92
51 3300003575 Ga0007409J51694_1030207 Ga0007409J51694_10302072 92
52 3300003659 JGI25404J52841_10013637 JGI25404J52841_100136372 92
53 3300003659 JGI25404J52841_10096617 JGI25404J52841_100966172 92
54 3300003693 Ga0032354_1106446 Ga0032354_11064462 92
55 3300003735 Ga0006780_1016914 Ga0006780_10169143 92
56 3300003752 Ga0055539_1002237 Ga0055539_10022372 92
57 3300003752 Ga0055539_1002356 Ga0055539_10023564 92
58 3300003762 Ga0055542_1003192 Ga0055542_10031925 92
59 3300003763 Ga0055529_1005440 Ga0055529_10054404 92
60 3300003771 Ga0055526_1040086 Ga0055526_10400861 92
61 3300003775 Ga0055524_1022189 Ga0055524_10221893 92
62 3300003781 Ga0055536_1016913 Ga0055536_10169134 92
63 3300003794 Ga0055531_10005825 Ga0055531_1000582512 92
64 3300003794 Ga0055531_10028999 Ga0055531_100289994 92
65 3300003911 JGI25405J52794_10079350 JGI25405J52794_100793501 92
66 3300004625 Ga0055543_1065234 Ga0055543_10652341 92
67 3300004799 Ga0058863_11733669 Ga0058863_117336691 92
68 3300004800 Ga0058861_12073627 Ga0058861_120736272 92
69 3300004801 Ga0058860_12214667 Ga0058860_122146671 92
70 3300004803 Ga0058862_12847737 Ga0058862_128477373 92
71 3300005290 Ga0065712_10595092 Ga0065712_105950921 92
72 3300005295 Ga0065707_10024721 Ga0065707_100247213 92
73 3300005327 Ga0070658_10178129 Ga0070658_101781292 92
74 3300005327 Ga0070658_10729550 Ga0070658_107295502 92
75 3300005327 Ga0070658_11180486 Ga0070658_111804861 92
76 3300005327 Ga0070658_11431767 Ga0070658_114317671 92
77 3300005328 Ga0070676_10636849 Ga0070676_106368492 92
78 3300005328 Ga0070676_11503215 Ga0070676_115032151 92
79 3300005328 Ga0070676_11528723 Ga0070676_115287232 92
80 3300005329 Ga0070683_100017855 Ga0070683_1000178551 92
81 3300005329 Ga0070683_100038770 Ga0070683_1000387702 92
82 3300005329 Ga0070683_100132890 Ga0070683_1001328903 92
83 3300005329 Ga0070683_100479650 Ga0070683_1004796503 92
84 3300005329 Ga0070683_102029653 Ga0070683_1020296532 92
85 3300005330 Ga0070690_100835458 Ga0070690_1008354581 92
86 3300005330 Ga0070690_101245664 Ga0070690_1012456641 92
87 3300005331 Ga0070670_100258867 Ga0070670_1002588674 92
88 3300005333 Ga0070677_10466040 Ga0070677_104660401 92
89 3300005334 Ga0068869_101943267 Ga0068869_1019432671 92
90 3300005334 Ga0068869_101965520 Ga0068869_1019655202 92
91 3300005335 Ga0070666_10320043 Ga0070666_103200432 92
92 3300005335 Ga0070666_10710114 Ga0070666_107101141 92
93 3300005335 Ga0070666_11426162 Ga0070666_114261622 92
94 3300005336 Ga0070680_100097692 Ga0070680_1000976922 92
95 3300005336 Ga0070680_100098152 Ga0070680_1000981523 92
96 3300005336 Ga0070680_100128267 Ga0070680_1001282675 92
97 3300005336 Ga0070680_100174605 Ga0070680_1001746053 92
98 3300005336 Ga0070680_100291776 Ga0070680_1002917763 92
99 3300005336 Ga0070680_100399538 Ga0070680_1003995382 92
100 3300005336 Ga0070680_100552917 Ga0070680_1005529172 92
101 3300005336 Ga0070680_100946105 Ga0070680_1009461052 92
102 3300005337 Ga0070682_100295472 Ga0070682_1002954723 92
103 3300005337 Ga0070682_100316068 Ga0070682_1003160683 92
104 3300005337 Ga0070682_100517447 Ga0070682_1005174472 92
105 3300005337 Ga0070682_100644439 Ga0070682_1006444392 92
106 3300005337 Ga0070682_100942182 Ga0070682_1009421822 92
107 3300005338 Ga0068868_100320964 Ga0068868_1003209642 92
108 3300005338 Ga0068868_100345413 Ga0068868_1003454132 92
109 3300005338 Ga0068868_100561056 Ga0068868_1005610562 92
110 3300005338 Ga0068868_101267718 Ga0068868_1012677182 92
111 3300005339 Ga0070660_100242109 Ga0070660_1002421093 92
112 3300005339 Ga0070660_100362134 Ga0070660_1003621342 92
113 3300005339 Ga0070660_100414849 Ga0070660_1004148492 92
114 3300005339 Ga0070660_100700018 Ga0070660_1007000182 92
115 3300005340 Ga0070689_100175086 Ga0070689_1001750863 92
116 3300005340 Ga0070689_100269008 Ga0070689_1002690082 92
117 3300005340 Ga0070689_100307743 Ga0070689_1003077433 92
118 3300005340 Ga0070689_100621410 Ga0070689_1006214102 92
119 3300005341 Ga0070691_10108256 Ga0070691_101082563 92
120 3300005341 Ga0070691_10504962 Ga0070691_105049622 92
121 3300005341 Ga0070691_11075453 Ga0070691_110754532 92
122 3300005343 Ga0070687_100307896 Ga0070687_1003078962 92
123 3300005344 Ga0070661_100286747 Ga0070661_1002867473 92
124 3300005344 Ga0070661_100396367 Ga0070661_1003963672 92
125 3300005344 Ga0070661_100400261 Ga0070661_1004002611 92
126 3300005344 Ga0070661_100480085 Ga0070661_1004800851 92
127 3300005344 Ga0070661_101177392 Ga0070661_1011773921 92
128 3300005353 Ga0070669_100487924 Ga0070669_1004879242 92
129 3300005353 Ga0070669_100942921 Ga0070669_1009429212 92
130 3300005353 Ga0070669_101264428 Ga0070669_1012644281 92
131 3300005354 Ga0070675_100477738 Ga0070675_1004777382 92
132 3300005354 Ga0070675_100607194 Ga0070675_1006071942 92
133 3300005354 Ga0070675_100922971 Ga0070675_1009229712 92
134 3300005355 Ga0070671_100140430 Ga0070671_1001404303 92
135 3300005355 Ga0070671_100429876 Ga0070671_1004298762 92
136 3300005355 Ga0070671_100542534 Ga0070671_1005425341 92
137 3300005355 Ga0070671_100560718 Ga0070671_1005607181 92
138 3300005355 Ga0070671_100569289 Ga0070671_1005692891 92
139 3300005355 Ga0070671_101062143 Ga0070671_1010621432 92
140 3300005355 Ga0070671_101210867 Ga0070671_1012108672 92
141 3300005355 Ga0070671_101979550 Ga0070671_1019795501 92
142 3300005364 Ga0070673_100801867 Ga0070673_1008018672 92
143 3300005364 Ga0070673_101583686 Ga0070673_1015836862 92
144 3300005364 Ga0070673_101873841 Ga0070673_1018738411 92
145 3300005364 Ga0070673_102203839 Ga0070673_1022038392 92
146 3300005365 Ga0070688_100056044 Ga0070688_1000560442 92
147 3300005365 Ga0070688_100487656 Ga0070688_1004876562 92
148 3300005365 Ga0070688_101049375 Ga0070688_1010493752 92
149 3300005366 Ga0070659_100117226 Ga0070659_1001172264 92
150 3300005366 Ga0070659_100393817 Ga0070659_1003938172 92
151 3300005366 Ga0070659_100556316 Ga0070659_1005563162 92
152 3300005367 Ga0070667_100091151 Ga0070667_1000911514 92
153 3300005406 Ga0070703_10485239 Ga0070703_104852391 92
154 3300005434 Ga0070709_10442692 Ga0070709_104426922 92
155 3300005434 Ga0070709_11527850 Ga0070709_115278501 92
156 3300005434 Ga0070709_11539730 Ga0070709_115397302 92
157 3300005435 Ga0070714_100002370 Ga0070714_10000237020 92
158 3300005435 Ga0070714_100059218 Ga0070714_1000592182 92
159 3300005435 Ga0070714_100177677 Ga0070714_1001776776 92
160 3300005435 Ga0070714_100464522 Ga0070714_1004645222 92
161 3300005435 Ga0070714_100778425 Ga0070714_1007784251 92
162 3300005435 Ga0070714_101362958 Ga0070714_1013629581 92
163 3300005436 Ga0070713_100010006 Ga0070713_10001000614 92
164 3300005436 Ga0070713_100054584 Ga0070713_1000545844 92
165 3300005436 Ga0070713_100076595 Ga0070713_1000765951 92
166 3300005436 Ga0070713_100171734 Ga0070713_1001717344 92
167 3300005436 Ga0070713_100191249 Ga0070713_1001912494 92
168 3300005436 Ga0070713_100199231 Ga0070713_1001992315 92
169 3300005436 Ga0070713_100331543 Ga0070713_1003315431 92
170 3300005436 Ga0070713_100444788 Ga0070713_1004447883 92
171 3300005436 Ga0070713_101476923 Ga0070713_1014769231 92
172 3300005436 Ga0070713_101856706 Ga0070713_1018567062 92
173 3300005437 Ga0070710_10003270 Ga0070710_1000327010 92
174 3300005437 Ga0070710_10005644 Ga0070710_1000564413 92
175 3300005437 Ga0070710_10253649 Ga0070710_102536492 92
176 3300005437 Ga0070710_10491491 Ga0070710_104914912 92
177 3300005437 Ga0070710_10631369 Ga0070710_106313691 92
178 3300005437 Ga0070710_10702708 Ga0070710_107027082 92
179 3300005437 Ga0070710_10723110 Ga0070710_107231102 92
180 3300005437 Ga0070710_10991232 Ga0070710_109912321 92
181 3300005437 Ga0070710_11150335 Ga0070710_111503352 92
182 3300005438 Ga0070701_10154686 Ga0070701_101546862 92
183 3300005438 Ga0070701_10595222 Ga0070701_105952222 92
184 3300005439 Ga0070711_100007497 Ga0070711_1000074979 92
185 3300005439 Ga0070711_100128167 Ga0070711_1001281675 92
186 3300005439 Ga0070711_100187165 Ga0070711_1001871653 92
187 3300005439 Ga0070711_100195901 Ga0070711_1001959012 92
188 3300005439 Ga0070711_100283035 Ga0070711_1002830352 92
189 3300005439 Ga0070711_100359317 Ga0070711_1003593172 92
190 3300005439 Ga0070711_100735599 Ga0070711_1007355992 92
191 3300005439 Ga0070711_101140627 Ga0070711_1011406272 92
192 3300005440 Ga0070705_100793858 Ga0070705_1007938582 92
193 3300005441 Ga0070700_100760037 Ga0070700_1007600372 92
194 3300005441 Ga0070700_101762520 Ga0070700_1017625202 92
195 3300005441 Ga0070700_102018498 Ga0070700_1020184982 92
196 3300005445 Ga0070708_100020902 Ga0070708_1000209027 92
197 3300005445 Ga0070708_100035098 Ga0070708_1000350985 92
198 3300005445 Ga0070708_100260674 Ga0070708_1002606744 92
199 3300005455 Ga0070663_100471867 Ga0070663_1004718672 92
200 3300005455 Ga0070663_100557627 Ga0070663_1005576272 92
201 3300005455 Ga0070663_100584355 Ga0070663_1005843551 92
202 3300005455 Ga0070663_100671109 Ga0070663_1006711092 92
203 3300005455 Ga0070663_100680923 Ga0070663_1006809232 92
204 3300005455 Ga0070663_100738643 Ga0070663_1007386432 92
205 3300005455 Ga0070663_100907063 Ga0070663_1009070632 92
206 3300005455 Ga0070663_102140180 Ga0070663_1021401802 92
207 3300005456 Ga0070678_100305948 Ga0070678_1003059481 92
208 3300005456 Ga0070678_100698814 Ga0070678_1006988142 92
209 3300005456 Ga0070678_101285131 Ga0070678_1012851312 92
210 3300005457 Ga0070662_100409997 Ga0070662_1004099972 92
211 3300005457 Ga0070662_100419721 Ga0070662_1004197212 92
212 3300005458 Ga0070681_10018722 Ga0070681_1001872212 92
213 3300005458 Ga0070681_10068789 Ga0070681_100687893 92
214 3300005458 Ga0070681_10087934 Ga0070681_100879342 92
215 3300005458 Ga0070681_10361698 Ga0070681_103616981 92
216 3300005458 Ga0070681_10450232 Ga0070681_104502322 92
217 3300005458 Ga0070681_10882727 Ga0070681_108827271 92
218 3300005459 Ga0068867_100254714 Ga0068867_1002547144 92
219 3300005459 Ga0068867_100499240 Ga0068867_1004992402 92
220 3300005466 Ga0070685_10360932 Ga0070685_103609322 92
221 3300005466 Ga0070685_10432039 Ga0070685_104320392 92
222 3300005471 Ga0070698_100367619 Ga0070698_1003676192 92
223 3300005518 Ga0070699_100124393 Ga0070699_1001243932 92
224 3300005518 Ga0070699_100349657 Ga0070699_1003496572 92
225 3300005530 Ga0070679_100092970 Ga0070679_1000929706 92
226 3300005530 Ga0070679_100127967 Ga0070679_1001279676 92
227 3300005530 Ga0070679_100258822 Ga0070679_1002588223 92
228 3300005530 Ga0070679_100479250 Ga0070679_1004792502 92
229 3300005530 Ga0070679_102098975 Ga0070679_1020989752 92
230 3300005535 Ga0070684_100071887 Ga0070684_1000718873 92
231 3300005535 Ga0070684_100142413 Ga0070684_1001424133 92
232 3300005535 Ga0070684_100257909 Ga0070684_1002579092 92
233 3300005535 Ga0070684_100529633 Ga0070684_1005296332 92
234 3300005535 Ga0070684_100815651 Ga0070684_1008156512 92
235 3300005535 Ga0070684_102321655 Ga0070684_1023216551 92
236 3300005536 Ga0070697_100259495 Ga0070697_1002594951 92
237 3300005536 Ga0070697_100319726 Ga0070697_1003197261 92
238 3300005539 Ga0068853_100030196 Ga0068853_1000301963 92
239 3300005539 Ga0068853_100281887 Ga0068853_1002818874 92
240 3300005539 Ga0068853_100446167 Ga0068853_1004461672 92
241 3300005539 Ga0068853_100494293 Ga0068853_1004942932 92
242 3300005539 Ga0068853_100626607 Ga0068853_1006266072 92
243 3300005539 Ga0068853_100642638 Ga0068853_1006426381 92
244 3300005539 Ga0068853_100663130 Ga0068853_1006631302 92
245 3300005539 Ga0068853_100723197 Ga0068853_1007231972 92
246 3300005539 Ga0068853_100907206 Ga0068853_1009072062 92
247 3300005539 Ga0068853_101160296 Ga0068853_1011602961 92
248 3300005539 Ga0068853_101276770 Ga0068853_1012767702 92
249 3300005539 Ga0068853_101364112 Ga0068853_1013641122 92
250 3300005539 Ga0068853_101742927 Ga0068853_1017429272 92
251 3300005539 Ga0068853_102331313 Ga0068853_1023313131 92
252 3300005539 Ga0068853_102420024 Ga0068853_1024200241 92
253 3300005543 Ga0070672_100198620 Ga0070672_1001986204 92
254 3300005543 Ga0070672_100253577 Ga0070672_1002535772 92
255 3300005543 Ga0070672_100738358 Ga0070672_1007383582 92
256 3300005543 Ga0070672_101259978 Ga0070672_1012599782 92
257 3300005544 Ga0070686_100219365 Ga0070686_1002193652 92
258 3300005544 Ga0070686_100273141 Ga0070686_1002731412 92
259 3300005544 Ga0070686_100903578 Ga0070686_1009035782 92
260 3300005545 Ga0070695_100199054 Ga0070695_1001990543 92
261 3300005546 Ga0070696_100294689 Ga0070696_1002946891 92
262 3300005547 Ga0070693_100144801 Ga0070693_1001448011 92
263 3300005547 Ga0070693_100226999 Ga0070693_1002269991 92
264 3300005547 Ga0070693_100331754 Ga0070693_1003317542 92
265 3300005547 Ga0070693_101009943 Ga0070693_1010099431 92
266 3300005547 Ga0070693_101495343 Ga0070693_1014953432 92
267 3300005548 Ga0070665_100317360 Ga0070665_1003173602 92
268 3300005548 Ga0070665_100431060 Ga0070665_1004310601 92
269 3300005548 Ga0070665_101109745 Ga0070665_1011097452 92
270 3300005548 Ga0070665_101177371 Ga0070665_1011773712 92
271 3300005548 Ga0070665_101429523 Ga0070665_1014295232 92
272 3300005548 Ga0070665_101713891 Ga0070665_1017138912 92
273 3300005548 Ga0070665_101786382 Ga0070665_1017863822 92
274 3300005548 Ga0070665_101802767 Ga0070665_1018027671 92
275 3300005548 Ga0070665_102205889 Ga0070665_1022058892 92
276 3300005549 Ga0070704_100534300 Ga0070704_1005343001 92
277 3300005549 Ga0070704_100831997 Ga0070704_1008319972 92
278 3300005563 Ga0068855_100108793 Ga0068855_1001087934 92
279 3300005563 Ga0068855_100222281 Ga0068855_1002222814 92
280 3300005563 Ga0068855_100305120 Ga0068855_1003051203 92
281 3300005563 Ga0068855_100387119 Ga0068855_1003871193 92
282 3300005563 Ga0068855_100436555 Ga0068855_1004365553 92
283 3300005563 Ga0068855_100510316 Ga0068855_1005103162 92
284 3300005563 Ga0068855_100638708 Ga0068855_1006387082 92
285 3300005563 Ga0068855_101193755 Ga0068855_1011937552 92
286 3300005563 Ga0068855_102034918 Ga0068855_1020349181 92
287 3300005563 Ga0068855_102201225 Ga0068855_1022012252 92
288 3300005564 Ga0070664_100174960 Ga0070664_1001749603 92
289 3300005564 Ga0070664_101279525 Ga0070664_1012795251 92
290 3300005564 Ga0070664_101534175 Ga0070664_1015341752 92
291 3300005564 Ga0070664_102332663 Ga0070664_1023326632 92
292 3300005577 Ga0068857_100704538 Ga0068857_1007045382 92
293 3300005577 Ga0068857_100801398 Ga0068857_1008013982 92
294 3300005577 Ga0068857_101143910 Ga0068857_1011439101 92
295 3300005577 Ga0068857_101632898 Ga0068857_1016328982 92
296 3300005577 Ga0068857_102263186 Ga0068857_1022631862 92
297 3300005578 Ga0068854_100299450 Ga0068854_1002994503 92
298 3300005578 Ga0068854_100300930 Ga0068854_1003009304 92
299 3300005578 Ga0068854_100304986 Ga0068854_1003049862 92
300 3300005578 Ga0068854_100592416 Ga0068854_1005924162 92
301 3300005578 Ga0068854_101833771 Ga0068854_1018337711 92
302 3300005614 Ga0068856_100087549 Ga0068856_1000875497 92
303 3300005614 Ga0068856_100137388 Ga0068856_1001373882 92
304 3300005614 Ga0068856_100187446 Ga0068856_1001874462 92
305 3300005614 Ga0068856_100409510 Ga0068856_1004095102 92
306 3300005614 Ga0068856_100513354 Ga0068856_1005133543 92
307 3300005614 Ga0068856_100597691 Ga0068856_1005976912 92
308 3300005614 Ga0068856_101169568 Ga0068856_1011695682 92
309 3300005614 Ga0068856_101354371 Ga0068856_1013543712 92
310 3300005614 Ga0068856_101887296 Ga0068856_1018872962 92
311 3300005614 Ga0068856_102452424 Ga0068856_1024524242 92
312 3300005615 Ga0070702_100422526 Ga0070702_1004225262 92
313 3300005615 Ga0070702_100731845 Ga0070702_1007318452 92
314 3300005615 Ga0070702_101830838 Ga0070702_1018308381 92
315 3300005616 Ga0068852_100029235 Ga0068852_1000292352 92
316 3300005616 Ga0068852_100322174 Ga0068852_1003221742 92
317 3300005616 Ga0068852_100351494 Ga0068852_1003514942 92
318 3300005616 Ga0068852_100400171 Ga0068852_1004001713 92
319 3300005616 Ga0068852_100586007 Ga0068852_1005860072 92
320 3300005616 Ga0068852_100687579 Ga0068852_1006875792 92
321 3300005616 Ga0068852_100985166 Ga0068852_1009851662 92
322 3300005616 Ga0068852_101699829 Ga0068852_1016998291 92
323 3300005617 Ga0068859_100800085 Ga0068859_1008000852 92
324 3300005617 Ga0068859_102002280 Ga0068859_1020022802 92
325 3300005617 Ga0068859_102491636 Ga0068859_1024916361 92
326 3300005618 Ga0068864_100139925 Ga0068864_1001399252 92
327 3300005618 Ga0068864_100325970 Ga0068864_1003259703 92
328 3300005618 Ga0068864_100798111 Ga0068864_1007981112 92
329 3300005618 Ga0068864_101168405 Ga0068864_1011684051 92
330 3300005618 Ga0068864_101664836 Ga0068864_1016648362 92
331 3300005718 Ga0068866_10157673 Ga0068866_101576732 92
332 3300005718 Ga0068866_10486767 Ga0068866_104867672 92
333 3300005719 Ga0068861_100242539 Ga0068861_1002425395 92
334 3300005719 Ga0068861_100980391 Ga0068861_1009803912 92
335 3300005834 Ga0068851_10016676 Ga0068851_100166767 92
336 3300005834 Ga0068851_10136707 Ga0068851_101367072 92
337 3300005834 Ga0068851_10251523 Ga0068851_102515232 92
338 3300005840 Ga0068870_10091899 Ga0068870_100918992 92
339 3300005840 Ga0068870_10151007 Ga0068870_101510073 92
340 3300005841 Ga0068863_100375088 Ga0068863_1003750883 92
341 3300005841 Ga0068863_100403986 Ga0068863_1004039862 92
342 3300005841 Ga0068863_100436709 Ga0068863_1004367093 92
343 3300005841 Ga0068863_102046877 Ga0068863_1020468772 92
344 3300005841 Ga0068863_102214797 Ga0068863_1022147971 92
345 3300005842 Ga0068858_100658711 Ga0068858_1006587112 92
346 3300005842 Ga0068858_101051585 Ga0068858_1010515852 92
347 3300005842 Ga0068858_101488622 Ga0068858_1014886222 92
348 3300005842 Ga0068858_101497011 Ga0068858_1014970112 92
349 3300005842 Ga0068858_101592738 Ga0068858_1015927382 92
350 3300005842 Ga0068858_101774827 Ga0068858_1017748272 92
351 3300005843 Ga0068860_100078148 Ga0068860_1000781482 92
352 3300005843 Ga0068860_100138904 Ga0068860_1001389042 92
353 3300005843 Ga0068860_100846023 Ga0068860_1008460232 92
354 3300005843 Ga0068860_101484558 Ga0068860_1014845581 92
355 3300005843 Ga0068860_101712020 Ga0068860_1017120202 92
356 3300005844 Ga0068862_101192532 Ga0068862_1011925322 92
357 3300005844 Ga0068862_102133648 Ga0068862_1021336482 92
358 3300005844 Ga0068862_102405213 Ga0068862_1024052132 92
359 3300005937 Ga0081455_10011724 Ga0081455_1001172410 92
360 3300005981 Ga0081538_10006855 Ga0081538_1000685511 92
361 3300005981 Ga0081538_10022020 Ga0081538_1002202011 92
362 3300005981 Ga0081538_10066354 Ga0081538_100663545 92
363 3300005981 Ga0081538_10388299 Ga0081538_103882992 92
364 3300005983 Ga0081540_1002979 Ga0081540_100297910 92
365 3300005983 Ga0081540_1014636 Ga0081540_10146363 92
366 3300005983 Ga0081540_1016986 Ga0081540_10169867 92
367 3300005983 Ga0081540_1270213 Ga0081540_12702131 92
368 3300005985 Ga0081539_10000273 Ga0081539_1000027314 92
369 3300005985 Ga0081539_10038639 Ga0081539_100386391 92
370 3300005985 Ga0081539_10062142 Ga0081539_100621422 92
371 3300005985 Ga0081539_10185466 Ga0081539_101854661 92
372 3300005985 Ga0081539_10208965 Ga0081539_102089652 92
373 3300006028 Ga0070717_10006736 Ga0070717_1000673612 92
374 3300006028 Ga0070717_10023212 Ga0070717_100232124 92
375 3300006028 Ga0070717_10172141 Ga0070717_101721412 92
376 3300006028 Ga0070717_10222765 Ga0070717_102227652 92
377 3300006028 Ga0070717_10345917 Ga0070717_103459173 92
378 3300006028 Ga0070717_10472665 Ga0070717_104726652 92
379 3300006028 Ga0070717_11414596 Ga0070717_114145962 92
380 3300006028 Ga0070717_11991055 Ga0070717_119910552 92
381 3300006038 Ga0075365_10006087 Ga0075365_100060878 92
382 3300006038 Ga0075365_10360809 Ga0075365_103608092 92
383 3300006038 Ga0075365_11011908 Ga0075365_110119081 92
384 3300006038 Ga0075365_11119029 Ga0075365_111190291 92
385 3300006038 Ga0075365_11331345 Ga0075365_113313452 92
386 3300006042 Ga0075368_10022925 Ga0075368_100229254 92
387 3300006042 Ga0075368_10029086 Ga0075368_100290863 92
388 3300006042 Ga0075368_10107531 Ga0075368_101075312 92
389 3300006048 Ga0075363_100021882 Ga0075363_1000218825 92
390 3300006048 Ga0075363_100291656 Ga0075363_1002916562 92
391 3300006048 Ga0075363_100503418 Ga0075363_1005034182 92
392 3300006048 Ga0075363_100623375 Ga0075363_1006233752 92
393 3300006048 Ga0075363_100841687 Ga0075363_1008416872 92
394 3300006051 Ga0075364_10026612 Ga0075364_100266122 92
395 3300006051 Ga0075364_10881046 Ga0075364_108810461 92
396 3300006051 Ga0075364_10942284 Ga0075364_109422842 92
397 3300006051 Ga0075364_11211402 Ga0075364_112114021 92
398 3300006058 Ga0075432_10154961 Ga0075432_101549611 92
399 3300006163 Ga0070715_10001968 Ga0070715_100019688 92
400 3300006163 Ga0070715_10084494 Ga0070715_100844943 92
401 3300006163 Ga0070715_10438597 Ga0070715_104385971 92
402 3300006163 Ga0070715_10540837 Ga0070715_105408372 92
403 3300006173 Ga0070716_100029633 Ga0070716_1000296335 92
404 3300006173 Ga0070716_100077676 Ga0070716_1000776764 92
405 3300006173 Ga0070716_100083237 Ga0070716_1000832375 92
406 3300006173 Ga0070716_100159662 Ga0070716_1001596625 92
407 3300006173 Ga0070716_100285157 Ga0070716_1002851572 92
408 3300006173 Ga0070716_101148376 Ga0070716_1011483761 92
409 3300006175 Ga0070712_100006185 Ga0070712_1000061856 92
410 3300006175 Ga0070712_100020783 Ga0070712_1000207836 92
411 3300006175 Ga0070712_100498966 Ga0070712_1004989662 92
412 3300006175 Ga0070712_100533065 Ga0070712_1005330651 92
413 3300006175 Ga0070712_100776927 Ga0070712_1007769272 92
414 3300006175 Ga0070712_100944886 Ga0070712_1009448861 92
415 3300006175 Ga0070712_101025602 Ga0070712_1010256022 92
416 3300006175 Ga0070712_101156492 Ga0070712_1011564921 92
417 3300006177 Ga0075362_10184663 Ga0075362_101846632 92
418 3300006177 Ga0075362_10320144 Ga0075362_103201442 92
419 3300006177 Ga0075362_10491980 Ga0075362_104919802 92
420 3300006177 Ga0075362_10628698 Ga0075362_106286982 92
421 3300006177 Ga0075362_10652851 Ga0075362_106528512 92
422 3300006178 Ga0075367_10031382 Ga0075367_100313827 92
423 3300006178 Ga0075367_10130109 Ga0075367_101301093 92
424 3300006178 Ga0075367_10359294 Ga0075367_103592942 92
425 3300006178 Ga0075367_10594099 Ga0075367_105940991 92
426 3300006186 Ga0075369_10205008 Ga0075369_102050081 92
427 3300006186 Ga0075369_10241762 Ga0075369_102417622 92
428 3300006186 Ga0075369_10398581 Ga0075369_103985812 92
429 3300006186 Ga0075369_10531068 Ga0075369_105310682 92
430 3300006186 Ga0075369_10550483 Ga0075369_105504832 92
431 3300006194 Ga0075427_10078170 Ga0075427_100781702 92
432 3300006195 Ga0075366_10779444 Ga0075366_107794442 92
433 3300006237 Ga0097621_100328367 Ga0097621_1003283674 92
434 3300006237 Ga0097621_100697406 Ga0097621_1006974062 92
435 3300006237 Ga0097621_100879542 Ga0097621_1008795422 92
436 3300006237 Ga0097621_100957031 Ga0097621_1009570312 92
437 3300006237 Ga0097621_100961833 Ga0097621_1009618332 92
438 3300006237 Ga0097621_101203782 Ga0097621_1012037822 92
439 3300006237 Ga0097621_102327600 Ga0097621_1023276002 92
440 3300006353 Ga0075370_10472574 Ga0075370_104725742 92
441 3300006358 Ga0068871_100302426 Ga0068871_1003024264 92
442 3300006358 Ga0068871_100541437 Ga0068871_1005414373 92
443 3300006358 Ga0068871_100596215 Ga0068871_1005962152 92
444 3300006358 Ga0068871_100600994 Ga0068871_1006009942 92
445 3300006358 Ga0068871_101361067 Ga0068871_1013610672 92
446 3300006358 Ga0068871_101411549 Ga0068871_1014115492 92
447 3300006844 Ga0075428_100888420 Ga0075428_1008884202 92
448 3300006844 Ga0075428_101611801 Ga0075428_1016118012 92
449 3300006844 Ga0075428_102085622 Ga0075428_1020856222 92
450 3300006847 Ga0075431_100905509 Ga0075431_1009055091 92
451 3300006852 Ga0075433_11081540 Ga0075433_110815402 92
452 3300006852 Ga0075433_11190474 Ga0075433_111904742 92
453 3300006871 Ga0075434_100237438 Ga0075434_1002374385 92
454 3300006871 Ga0075434_100571031 Ga0075434_1005710312 92
455 3300006871 Ga0075434_101273023 Ga0075434_1012730232 92
456 3300006880 Ga0075429_100910553 Ga0075429_1009105532 92
457 3300006881 Ga0068865_100153662 Ga0068865_1001536622 92
458 3300006881 Ga0068865_100564506 Ga0068865_1005645062 92
459 3300006881 Ga0068865_100673199 Ga0068865_1006731992 92
460 3300006914 Ga0075436_101094712 Ga0075436_1010947122 92
461 3300006931 Ga0097620_100800069 Ga0097620_1008000692 92
462 3300006931 Ga0097620_102002278 Ga0097620_1020022782 92
463 3300006931 Ga0097620_102491871 Ga0097620_1024918711 92
464 3300006942 Ga0099824_1024882 Ga0099824_10248828 92
465 3300006942 Ga0099824_1053160 Ga0099824_10531602 92
466 3300006944 Ga0099823_1108690 Ga0099823_11086902 92
467 3300007076 Ga0075435_100034111 Ga0075435_1000341118 92
468 3300007076 Ga0075435_100983387 Ga0075435_1009833872 92
469 3300007265 Ga0099794_10160911 Ga0099794_101609112 92
470 3300007265 Ga0099794_10607784 Ga0099794_106077842 92
471 3300009011 Ga0105251_10077967 Ga0105251_100779675 92
472 3300009036 Ga0105244_10126833 Ga0105244_101268331 92
473 3300009036 Ga0105244_10366205 Ga0105244_103662052 92
474 3300009092 Ga0105250_10085050 Ga0105250_100850503 92
475 3300009092 Ga0105250_10090819 Ga0105250_100908192 92
476 3300009092 Ga0105250_10305041 Ga0105250_103050412 92
477 3300009093 Ga0105240_10015249 Ga0105240_100152496 92
478 3300009093 Ga0105240_10211671 Ga0105240_102116714 92
479 3300009093 Ga0105240_10304374 Ga0105240_103043745 92
480 3300009093 Ga0105240_10787223 Ga0105240_107872233 92
481 3300009094 Ga0111539_11310944 Ga0111539_113109442 92
482 3300009098 Ga0105245_10451094 Ga0105245_104510943 92
483 3300009098 Ga0105245_11106682 Ga0105245_111066822 92
484 3300009098 Ga0105245_11654188 Ga0105245_116541882 92
485 3300009098 Ga0105245_11684907 Ga0105245_116849071 92
486 3300009101 Ga0105247_10069675 Ga0105247_100696755 92
487 3300009101 Ga0105247_10107897 Ga0105247_101078975 92
488 3300009101 Ga0105247_10301619 Ga0105247_103016192 92
489 3300009101 Ga0105247_10470171 Ga0105247_104701712 92
490 3300009147 Ga0114129_10238310 Ga0114129_102383103 92
491 3300009147 Ga0114129_10883176 Ga0114129_108831762 92
492 3300009147 Ga0114129_10967434 Ga0114129_109674342 92
493 3300009148 Ga0105243_10457367 Ga0105243_104573672 92
494 3300009148 Ga0105243_10583022 Ga0105243_105830222 92
495 3300009148 Ga0105243_11052678 Ga0105243_110526782 92
496 3300009174 Ga0105241_10237008 Ga0105241_102370084 92
497 3300009174 Ga0105241_10456731 Ga0105241_104567312 92
498 3300009174 Ga0105241_10943854 Ga0105241_109438542 92
499 3300009174 Ga0105241_11561937 Ga0105241_115619372 92
500 3300009174 Ga0105241_12356338 Ga0105241_123563381 92
501 3300009176 Ga0105242_10481754 Ga0105242_104817542 92
502 3300009176 Ga0105242_10536426 Ga0105242_105364263 92
503 3300009176 Ga0105242_11190612 Ga0105242_111906122 92
504 3300009176 Ga0105242_11268857 Ga0105242_112688572 92
505 3300009177 Ga0105248_10287019 Ga0105248_102870191 92
506 3300009177 Ga0105248_10484564 Ga0105248_104845642 92
507 3300009177 Ga0105248_11213111 Ga0105248_112131112 92
508 3300009177 Ga0105248_12109925 Ga0105248_121099252 92
509 3300009545 Ga0105237_10235155 Ga0105237_102351552 92
510 3300009545 Ga0105237_10338060 Ga0105237_103380603 92
511 3300009545 Ga0105237_10390864 Ga0105237_103908643 92
512 3300009545 Ga0105237_10680694 Ga0105237_106806942 92
513 3300009551 Ga0105238_10251194 Ga0105238_102511942 92
514 3300009551 Ga0105238_10387575 Ga0105238_103875754 92
515 3300009551 Ga0105238_10430899 Ga0105238_104308993 92
516 3300009551 Ga0105238_10484149 Ga0105238_104841493 92
517 3300009551 Ga0105238_11118010 Ga0105238_111180102 92
518 3300009551 Ga0105238_11230350 Ga0105238_112303502 92
519 3300009551 Ga0105238_12077310 Ga0105238_120773102 92
520 3300009553 Ga0105249_10331272 Ga0105249_103312723 92
521 3300009553 Ga0105249_10687617 Ga0105249_106876172 92
522 3300009553 Ga0105249_11093437 Ga0105249_110934372 92
523 3300009553 Ga0105249_12016866 Ga0105249_120168662 92
524 3300010375 Ga0105239_10374664 Ga0105239_103746643 92
525 3300010375 Ga0105239_10451209 Ga0105239_104512093 92
526 3300010375 Ga0105239_10618401 Ga0105239_106184012 92
527 3300010375 Ga0105239_10882653 Ga0105239_108826532 92
528 3300010375 Ga0105239_11110999 Ga0105239_111109992 92
529 3300010375 Ga0105239_11561631 Ga0105239_115616312 92
530 3300010375 Ga0105239_11749449 Ga0105239_117494492 92
531 3300010375 Ga0105239_11986296 Ga0105239_119862962 92
532 3300010375 Ga0105239_12746686 Ga0105239_127466862 92
533 3300010375 Ga0105239_12785813 Ga0105239_127858132 92
534 3300010375 Ga0105239_12993219 Ga0105239_129932191 92
535 3300011119 Ga0105246_10103510 Ga0105246_101035106 92
536 3300011119 Ga0105246_10192588 Ga0105246_101925884 92
537 3300011119 Ga0105246_10920171 Ga0105246_109201712 92
538 3300011119 Ga0105246_12164115 Ga0105246_121641151 92
539 3300011119 Ga0105246_12446755 Ga0105246_124467552 92
540 3300012480 Ga0157346_1033948 Ga0157346_10339482 92
541 3300012482 Ga0157318_1001458 Ga0157318_10014582 92
542 3300012492 Ga0157335_1001532 Ga0157335_10015323 92
543 3300012494 Ga0157341_1004712 Ga0157341_10047122 92
544 3300012498 Ga0157345_1005711 Ga0157345_10057112 92
545 3300012506 Ga0157324_1001600 Ga0157324_10016002 92
546 3300012506 Ga0157324_1002531 Ga0157324_10025312 92
547 3300012510 Ga0157316_1008847 Ga0157316_10088472 92
548 3300012512 Ga0157327_1006713 Ga0157327_10067132 92
549 3300012512 Ga0157327_1066229 Ga0157327_10662291 92
550 3300012515 Ga0157338_1016228 Ga0157338_10162283 92
551 3300013100 Ga0157373_10431009 Ga0157373_104310092 92
552 3300013102 Ga0157371_10030956 Ga0157371_100309565 92
553 3300013102 Ga0157371_10199288 Ga0157371_101992882 92
554 3300013102 Ga0157371_10659952 Ga0157371_106599522 92
555 3300013104 Ga0157370_10181121 Ga0157370_101811212 92
556 3300013104 Ga0157370_10303801 Ga0157370_103038012 92
557 3300013104 Ga0157370_10411345 Ga0157370_104113452 92
558 3300013104 Ga0157370_10513595 Ga0157370_105135953 92
559 3300013104 Ga0157370_11734790 Ga0157370_117347902 92
560 3300013105 Ga0157369_10066010 Ga0157369_100660102 92
561 3300013105 Ga0157369_10506634 Ga0157369_105066342 92
562 3300013105 Ga0157369_10541596 Ga0157369_105415962 92
563 3300013105 Ga0157369_10794066 Ga0157369_107940662 92
564 3300013105 Ga0157369_11045214 Ga0157369_110452142 92
565 3300013105 Ga0157369_11713282 Ga0157369_117132822 92
566 3300013105 Ga0157369_12163267 Ga0157369_121632672 92
567 3300013296 Ga0157374_10094106 Ga0157374_100941067 92
568 3300013296 Ga0157374_10169096 Ga0157374_101690962 92
569 3300013296 Ga0157374_11017345 Ga0157374_110173452 92
570 3300013296 Ga0157374_11312189 Ga0157374_113121892 92
571 3300013296 Ga0157374_11735515 Ga0157374_117355152 92
572 3300013297 Ga0157378_10311380 Ga0157378_103113802 92
573 3300013297 Ga0157378_10978030 Ga0157378_109780302 92
574 3300013297 Ga0157378_12292073 Ga0157378_122920732 92
575 3300013306 Ga0163162_11109092 Ga0163162_111090922 92
576 3300013306 Ga0163162_12357644 Ga0163162_123576442 92
577 3300013307 Ga0157372_10802876 Ga0157372_108028762 92
578 3300013308 Ga0157375_10940741 Ga0157375_109407412 92
579 3300013308 Ga0157375_11009705 Ga0157375_110097052 92
580 3300013308 Ga0157375_11028645 Ga0157375_110286451 92
581 3300013308 Ga0157375_11882039 Ga0157375_118820392 92
582 3300013308 Ga0157375_12904568 Ga0157375_129045682 92
583 3300014325 Ga0163163_10017707 Ga0163163_100177076 92
584 3300014325 Ga0163163_10360053 Ga0163163_103600533 92
585 3300014325 Ga0163163_11078592 Ga0163163_110785922 92
586 3300014325 Ga0163163_13167384 Ga0163163_131673842 92
587 3300014326 Ga0157380_10808980 Ga0157380_108089802 92
588 3300014326 Ga0157380_11040335 Ga0157380_110403351 92
589 3300014326 Ga0157380_11459814 Ga0157380_114598142 92
590 3300014326 Ga0157380_12639453 Ga0157380_126394532 92
591 3300014497 Ga0182008_10293955 Ga0182008_102939552 92
592 3300014497 Ga0182008_10921086 Ga0182008_109210862 92
593 3300014745 Ga0157377_10141114 Ga0157377_101411143 92
594 3300014745 Ga0157377_10268647 Ga0157377_102686473 92
595 3300014968 Ga0157379_10486622 Ga0157379_104866222 92
596 3300014968 Ga0157379_10648558 Ga0157379_106485582 92
597 3300014968 Ga0157379_12262247 Ga0157379_122622472 92
598 3300014969 Ga0157376_10811586 Ga0157376_108115862 92
599 3300015261 Ga0182006_1100373 Ga0182006_11003732 92
600 3300015262 Ga0182007_10011213 Ga0182007_100112135 92
601 3300015265 Ga0182005_1020757 Ga0182005_10207572 92
602 3300017792 Ga0163161_11434869 Ga0163161_114348692 92
603 3300020069 Ga0197907_11128917 Ga0197907_111289172 92
604 3300020070 Ga0206356_10074059 Ga0206356_100740592 92
605 3300020081 Ga0206354_11719678 Ga0206354_117196782 92
606 3300020082 Ga0206353_11678156 Ga0206353_116781562 92
607 3300020610 Ga0154015_1142437 Ga0154015_11424371 92
608 3300021320 Ga0214544_1000006 Ga0214544_1000006174 92
609 3300021321 Ga0214542_1000002 Ga0214542_1000002201 92
610 3300021324 Ga0214545_1000002 Ga0214545_1000002518 92
611 3300021327 Ga0214543_1000017 Ga0214543_1000017122 92
612 3300021361 Ga0213872_10299242 Ga0213872_102992422 92
613 3300021377 Ga0213874_10209056 Ga0213874_102090562 92
614 3300021377 Ga0213874_10227186 Ga0213874_102271862 92
615 3300021384 Ga0213876_10002961 Ga0213876_1000296115 92
616 3300021384 Ga0213876_10093668 Ga0213876_100936682 92
617 3300021384 Ga0213876_10202541 Ga0213876_102025412 92
618 3300021384 Ga0213876_10547824 Ga0213876_105478241 92
619 3300021388 Ga0213875_10101062 Ga0213875_101010623 92
620 3300021388 Ga0213875_10126101 Ga0213875_101261013 92
621 3300021388 Ga0213875_10224794 Ga0213875_102247942 92
622 3300021441 Ga0213871_10006446 Ga0213871_100064462 92
623 3300021441 Ga0213871_10089768 Ga0213871_100897682 92
624 3300021441 Ga0213871_10170474 Ga0213871_101704742 92
625 3300022467 Ga0224712_10221512 Ga0224712_102215122 92
626 3300022467 Ga0224712_10311839 Ga0224712_103118392 92
627 3300022730 Ga0224570_106162 Ga0224570_1061622 92
628 3300023309 Ga0256744_143262 Ga0256744_1432624 92
629 3300023309 Ga0256744_145017 Ga0256744_1450172 92
630 3300023438 Ga0256720_139338 Ga0256720_1393381 92
631 3300024123 Ga0228600_1015241 Ga0228600_10152412 92
632 3300025223 Ga0207672_1001513 Ga0207672_10015133 92
633 3300025227 Ga0207638_1006282 Ga0207638_10062822 92
634 3300025245 Ga0207425_1021382 Ga0207425_10213822 92
635 3300025253 Ga0209677_100718 Ga0209677_10071814 92
636 3300025253 Ga0209677_100816 Ga0209677_10081612 92
637 3300025254 Ga0209148_1001736 Ga0209148_100173612 92
638 3300025254 Ga0209148_1046265 Ga0209148_10462652 92
639 3300025258 Ga0209129_1056999 Ga0209129_10569991 92
640 3300025261 Ga0209233_1006295 Ga0209233_10062956 92
641 3300025261 Ga0209233_1007083 Ga0209233_10070838 92
642 3300025261 Ga0209233_1040869 Ga0209233_10408692 92
643 3300025271 Ga0207666_1007469 Ga0207666_10074695 92
644 3300025272 Ga0209455_1002514 Ga0209455_10025145 92
645 3300025284 Ga0209130_1015211 Ga0209130_10152112 92
646 3300025290 Ga0207673_1009185 Ga0207673_10091852 92
647 3300025292 Ga0209676_1000092 Ga0209676_100009214 92
648 3300025295 Ga0209564_1047758 Ga0209564_10477582 92
649 3300025297 Ga0209758_1000216 Ga0209758_1000216137 92
650 3300025297 Ga0209758_1005457 Ga0209758_100545716 92
651 3300025297 Ga0209758_1018858 Ga0209758_10188582 92
652 3300025297 Ga0209758_1044413 Ga0209758_10444132 92
653 3300025297 Ga0209758_1080478 Ga0209758_10804782 92
654 3300025297 Ga0209758_1126229 Ga0209758_11262292 92
655 3300025298 Ga0209050_1007859 Ga0209050_10078599 92
656 3300025298 Ga0209050_1045832 Ga0209050_10458322 92
657 3300025299 Ga0209256_1024103 Ga0209256_10241032 92
658 3300025303 Ga0209051_1029640 Ga0209051_10296405 92
659 3300025304 Ga0209257_1005510 Ga0209257_100551013 92
660 3300025315 Ga0207697_10015577 Ga0207697_100155775 92
661 3300025315 Ga0207697_10072875 Ga0207697_100728754 92
662 3300025321 Ga0207656_10210820 Ga0207656_102108202 92
663 3300025711 Ga0207696_1029921 Ga0207696_10299214 92
664 3300025711 Ga0207696_1096473 Ga0207696_10964732 92
665 3300025735 Ga0207713_1058988 Ga0207713_10589882 92
666 3300025885 Ga0207653_10002069 Ga0207653_100020699 92
667 3300025885 Ga0207653_10017255 Ga0207653_100172551 92
668 3300025893 Ga0207682_10076343 Ga0207682_100763432 92
669 3300025898 Ga0207692_10015101 Ga0207692_100151016 92
670 3300025898 Ga0207692_10199911 Ga0207692_101999112 92
671 3300025898 Ga0207692_10278944 Ga0207692_102789442 92
672 3300025898 Ga0207692_10720784 Ga0207692_107207842 92
673 3300025898 Ga0207692_10831105 Ga0207692_108311051 92
674 3300025899 Ga0207642_10121376 Ga0207642_101213762 92
675 3300025900 Ga0207710_10019030 Ga0207710_100190306 92
676 3300025900 Ga0207710_10178627 Ga0207710_101786271 92
677 3300025901 Ga0207688_10142614 Ga0207688_101426142 92
678 3300025901 Ga0207688_10545896 Ga0207688_105458962 92
679 3300025903 Ga0207680_10528736 Ga0207680_105287362 92
680 3300025903 Ga0207680_10599174 Ga0207680_105991742 92
681 3300025903 Ga0207680_10975335 Ga0207680_109753351 92
682 3300025904 Ga0207647_10020149 Ga0207647_100201499 92
683 3300025904 Ga0207647_10068430 Ga0207647_100684305 92
684 3300025904 Ga0207647_10112413 Ga0207647_101124132 92
685 3300025904 Ga0207647_10227696 Ga0207647_102276963 92
686 3300025904 Ga0207647_10301007 Ga0207647_103010072 92
687 3300025904 Ga0207647_10707128 Ga0207647_107071282 92
688 3300025904 Ga0207647_10756763 Ga0207647_107567631 92
689 3300025905 Ga0207685_10016806 Ga0207685_100168064 92
690 3300025905 Ga0207685_10098307 Ga0207685_100983072 92
691 3300025905 Ga0207685_10214843 Ga0207685_102148432 92
692 3300025905 Ga0207685_10280879 Ga0207685_102808792 92
693 3300025906 Ga0207699_10003266 Ga0207699_1000326613 92
694 3300025906 Ga0207699_10043358 Ga0207699_100433585 92
695 3300025906 Ga0207699_10143768 Ga0207699_101437682 92
696 3300025906 Ga0207699_10475049 Ga0207699_104750492 92
697 3300025907 Ga0207645_10826170 Ga0207645_108261702 92
698 3300025908 Ga0207643_10012061 Ga0207643_100120617 92
699 3300025908 Ga0207643_10131241 Ga0207643_101312413 92
700 3300025908 Ga0207643_10181987 Ga0207643_101819871 92
701 3300025909 Ga0207705_10010986 Ga0207705_1001098610 92
702 3300025909 Ga0207705_10097389 Ga0207705_100973894 92
703 3300025909 Ga0207705_10768521 Ga0207705_107685212 92
704 3300025909 Ga0207705_10988152 Ga0207705_109881522 92
705 3300025910 Ga0207684_10040904 Ga0207684_100409046 92
706 3300025910 Ga0207684_11627439 Ga0207684_116274392 92
707 3300025911 Ga0207654_10105637 Ga0207654_101056372 92
708 3300025911 Ga0207654_10164404 Ga0207654_101644042 92
709 3300025911 Ga0207654_11012770 Ga0207654_110127701 92
710 3300025912 Ga0207707_10002337 Ga0207707_1000233715 92
711 3300025912 Ga0207707_10080082 Ga0207707_100800826 92
712 3300025912 Ga0207707_10145456 Ga0207707_101454565 92
713 3300025913 Ga0207695_10000599 Ga0207695_1000059981 92
714 3300025913 Ga0207695_10096164 Ga0207695_100961643 92
715 3300025913 Ga0207695_10209708 Ga0207695_102097084 92
716 3300025913 Ga0207695_10592620 Ga0207695_105926201 92
717 3300025913 Ga0207695_10617376 Ga0207695_106173762 92
718 3300025913 Ga0207695_10731736 Ga0207695_107317362 92
719 3300025914 Ga0207671_10041691 Ga0207671_100416917 92
720 3300025914 Ga0207671_10049735 Ga0207671_100497354 92
721 3300025914 Ga0207671_10151010 Ga0207671_101510102 92
722 3300025914 Ga0207671_10164259 Ga0207671_101642592 92
723 3300025914 Ga0207671_10175689 Ga0207671_101756893 92
724 3300025914 Ga0207671_10373274 Ga0207671_103732742 92
725 3300025914 Ga0207671_10469087 Ga0207671_104690871 92
726 3300025914 Ga0207671_10477111 Ga0207671_104771112 92
727 3300025914 Ga0207671_10652641 Ga0207671_106526411 92
728 3300025915 Ga0207693_10001926 Ga0207693_1000192615 92
729 3300025915 Ga0207693_10004694 Ga0207693_100046949 92
730 3300025915 Ga0207693_10026373 Ga0207693_100263737 92
731 3300025915 Ga0207693_10238778 Ga0207693_102387783 92
732 3300025915 Ga0207693_10884951 Ga0207693_108849511 92
733 3300025915 Ga0207693_11386650 Ga0207693_113866502 92
734 3300025916 Ga0207663_10000218 Ga0207663_1000021818 92
735 3300025916 Ga0207663_10090962 Ga0207663_100909624 92
736 3300025916 Ga0207663_10329300 Ga0207663_103293002 92
737 3300025916 Ga0207663_10422764 Ga0207663_104227642 92
738 3300025916 Ga0207663_10679848 Ga0207663_106798482 92
739 3300025916 Ga0207663_11288253 Ga0207663_112882532 92
740 3300025916 Ga0207663_11570433 Ga0207663_115704332 92
741 3300025916 Ga0207663_11578758 Ga0207663_115787581 92
742 3300025917 Ga0207660_10001861 Ga0207660_1000186115 92
743 3300025917 Ga0207660_10128616 Ga0207660_101286162 92
744 3300025917 Ga0207660_10278877 Ga0207660_102788773 92
745 3300025917 Ga0207660_10351646 Ga0207660_103516463 92
746 3300025917 Ga0207660_10520866 Ga0207660_105208663 92
747 3300025917 Ga0207660_10594681 Ga0207660_105946812 92
748 3300025917 Ga0207660_10655068 Ga0207660_106550682 92
749 3300025918 Ga0207662_10091281 Ga0207662_100912812 92
750 3300025918 Ga0207662_11090910 Ga0207662_110909102 92
751 3300025919 Ga0207657_10036025 Ga0207657_100360252 92
752 3300025919 Ga0207657_10042894 Ga0207657_100428946 92
753 3300025919 Ga0207657_10332331 Ga0207657_103323312 92
754 3300025919 Ga0207657_10853232 Ga0207657_108532322 92
755 3300025920 Ga0207649_10352776 Ga0207649_103527763 92
756 3300025920 Ga0207649_10634639 Ga0207649_106346391 92
757 3300025921 Ga0207652_10103136 Ga0207652_101031366 92
758 3300025921 Ga0207652_10139580 Ga0207652_101395803 92
759 3300025921 Ga0207652_10149458 Ga0207652_101494583 92
760 3300025921 Ga0207652_10158183 Ga0207652_101581832 92
761 3300025921 Ga0207652_10507930 Ga0207652_105079302 92
762 3300025921 Ga0207652_11013804 Ga0207652_110138042 92
763 3300025922 Ga0207646_10031466 Ga0207646_100314669 92
764 3300025923 Ga0207681_11051460 Ga0207681_110514602 92
765 3300025923 Ga0207681_11451831 Ga0207681_114518312 92
766 3300025924 Ga0207694_10010694 Ga0207694_1001069411 92
767 3300025924 Ga0207694_10100516 Ga0207694_101005164 92
768 3300025924 Ga0207694_10264619 Ga0207694_102646192 92
769 3300025924 Ga0207694_10555102 Ga0207694_105551022 92
770 3300025924 Ga0207694_10562107 Ga0207694_105621072 92
771 3300025924 Ga0207694_11073256 Ga0207694_110732562 92
772 3300025924 Ga0207694_11154708 Ga0207694_111547082 92
773 3300025925 Ga0207650_10105480 Ga0207650_101054804 92
774 3300025925 Ga0207650_10628591 Ga0207650_106285912 92
775 3300025926 Ga0207659_10605679 Ga0207659_106056792 92
776 3300025927 Ga0207687_10203762 Ga0207687_102037623 92
777 3300025927 Ga0207687_10495078 Ga0207687_104950782 92
778 3300025927 Ga0207687_10710286 Ga0207687_107102861 92
779 3300025927 Ga0207687_10819685 Ga0207687_108196852 92
780 3300025928 Ga0207700_10005204 Ga0207700_100052042 92
781 3300025928 Ga0207700_10009359 Ga0207700_1000935910 92
782 3300025928 Ga0207700_10055325 Ga0207700_100553253 92
783 3300025928 Ga0207700_10348260 Ga0207700_103482603 92
784 3300025928 Ga0207700_11060374 Ga0207700_110603742 92
785 3300025929 Ga0207664_10099390 Ga0207664_100993905 92
786 3300025929 Ga0207664_10499264 Ga0207664_104992643 92
787 3300025929 Ga0207664_10724428 Ga0207664_107244282 92
788 3300025931 Ga0207644_10092068 Ga0207644_100920686 92
789 3300025931 Ga0207644_10842734 Ga0207644_108427342 92
790 3300025931 Ga0207644_10980567 Ga0207644_109805672 92
791 3300025932 Ga0207690_10149305 Ga0207690_101493052 92
792 3300025932 Ga0207690_10213247 Ga0207690_102132471 92
793 3300025933 Ga0207706_10024819 Ga0207706_100248199 92
794 3300025933 Ga0207706_10131620 Ga0207706_101316206 92
795 3300025934 Ga0207686_10204152 Ga0207686_102041522 92
796 3300025934 Ga0207686_11207648 Ga0207686_112076481 92
797 3300025934 Ga0207686_11252922 Ga0207686_112529222 92
798 3300025935 Ga0207709_10566505 Ga0207709_105665051 92
799 3300025935 Ga0207709_10595833 Ga0207709_105958332 92
800 3300025935 Ga0207709_10712839 Ga0207709_107128392 92
801 3300025936 Ga0207670_10089648 Ga0207670_100896484 92
802 3300025936 Ga0207670_10816356 Ga0207670_108163561 92
803 3300025937 Ga0207669_10456618 Ga0207669_104566182 92
804 3300025937 Ga0207669_11722160 Ga0207669_117221602 92
805 3300025938 Ga0207704_10483901 Ga0207704_104839012 92
806 3300025938 Ga0207704_11174997 Ga0207704_111749972 92
807 3300025939 Ga0207665_10005572 Ga0207665_100055722 92
808 3300025939 Ga0207665_10034046 Ga0207665_100340466 92
809 3300025939 Ga0207665_10392166 Ga0207665_103921662 92
810 3300025939 Ga0207665_10431391 Ga0207665_104313912 92
811 3300025939 Ga0207665_10436966 Ga0207665_104369662 92
812 3300025939 Ga0207665_10465328 Ga0207665_104653282 92
813 3300025939 Ga0207665_10941506 Ga0207665_109415062 92
814 3300025939 Ga0207665_11396731 Ga0207665_113967311 92
815 3300025940 Ga0207691_10436970 Ga0207691_104369702 92
816 3300025940 Ga0207691_10727220 Ga0207691_107272202 92
817 3300025941 Ga0207711_10396889 Ga0207711_103968892 92
818 3300025941 Ga0207711_10520074 Ga0207711_105200742 92
819 3300025941 Ga0207711_10877760 Ga0207711_108777602 92
820 3300025941 Ga0207711_11777552 Ga0207711_117775521 92
821 3300025942 Ga0207689_10099958 Ga0207689_100999585 92
822 3300025944 Ga0207661_10093678 Ga0207661_100936784 92
823 3300025944 Ga0207661_10103355 Ga0207661_101033555 92
824 3300025944 Ga0207661_10189852 Ga0207661_101898525 92
825 3300025944 Ga0207661_10572769 Ga0207661_105727692 92
826 3300025944 Ga0207661_11060759 Ga0207661_110607592 92
827 3300025944 Ga0207661_11723184 Ga0207661_117231841 92
828 3300025945 Ga0207679_10656984 Ga0207679_106569842 92
829 3300025945 Ga0207679_11311592 Ga0207679_113115922 92
830 3300025945 Ga0207679_11318149 Ga0207679_113181492 92
831 3300025945 Ga0207679_12004273 Ga0207679_120042731 92
832 3300025949 Ga0207667_10002033 Ga0207667_1000203314 92
833 3300025949 Ga0207667_10078098 Ga0207667_100780985 92
834 3300025949 Ga0207667_10230656 Ga0207667_102306563 92
835 3300025949 Ga0207667_10313159 Ga0207667_103131592 92
836 3300025949 Ga0207667_11060299 Ga0207667_110602992 92
837 3300025949 Ga0207667_11624525 Ga0207667_116245251 92
838 3300025949 Ga0207667_11644202 Ga0207667_116442022 92
839 3300025949 Ga0207667_11936288 Ga0207667_119362881 92
840 3300025960 Ga0207651_10462584 Ga0207651_104625842 92
841 3300025960 Ga0207651_10465316 Ga0207651_104653162 92
842 3300025961 Ga0207712_10036565 Ga0207712_100365656 92
843 3300025961 Ga0207712_10393717 Ga0207712_103937172 92
844 3300025961 Ga0207712_10443490 Ga0207712_104434903 92
845 3300025961 Ga0207712_11732522 Ga0207712_117325221 92
846 3300025972 Ga0207668_10065864 Ga0207668_100658646 92
847 3300025972 Ga0207668_10194977 Ga0207668_101949771 92
848 3300025972 Ga0207668_11333017 Ga0207668_113330172 92
849 3300025981 Ga0207640_10213722 Ga0207640_102137223 92
850 3300025981 Ga0207640_10932233 Ga0207640_109322332 92
851 3300025981 Ga0207640_10997151 Ga0207640_109971511 92
852 3300025986 Ga0207658_10434767 Ga0207658_104347673 92
853 3300025986 Ga0207658_11001870 Ga0207658_110018702 92
854 3300025986 Ga0207658_11582888 Ga0207658_115828881 92
855 3300026023 Ga0207677_10300288 Ga0207677_103002882 92
856 3300026023 Ga0207677_10569275 Ga0207677_105692752 92
857 3300026023 Ga0207677_10853772 Ga0207677_108537722 92
858 3300026035 Ga0207703_10124606 Ga0207703_101246063 92
859 3300026035 Ga0207703_11714577 Ga0207703_117145772 92
860 3300026041 Ga0207639_10440911 Ga0207639_104409112 92
861 3300026041 Ga0207639_10876820 Ga0207639_108768202 92
862 3300026041 Ga0207639_11102611 Ga0207639_111026112 92
863 3300026041 Ga0207639_11198117 Ga0207639_111981172 92
864 3300026041 Ga0207639_11331078 Ga0207639_113310782 92
865 3300026041 Ga0207639_11371577 Ga0207639_113715772 92
866 3300026041 Ga0207639_11593888 Ga0207639_115938882 92
867 3300026041 Ga0207639_12183586 Ga0207639_121835862 92
868 3300026067 Ga0207678_10135862 Ga0207678_101358625 92
869 3300026067 Ga0207678_10793169 Ga0207678_107931692 92
870 3300026067 Ga0207678_10847445 Ga0207678_108474452 92
871 3300026067 Ga0207678_11060731 Ga0207678_110607311 92
872 3300026067 Ga0207678_11126406 Ga0207678_111264062 92
873 3300026075 Ga0207708_10226623 Ga0207708_102266234 92
874 3300026078 Ga0207702_10000678 Ga0207702_1000067821 92
875 3300026078 Ga0207702_10266620 Ga0207702_102666202 92
876 3300026078 Ga0207702_10318449 Ga0207702_103184494 92
877 3300026078 Ga0207702_10808502 Ga0207702_108085022 92
878 3300026088 Ga0207641_10040588 Ga0207641_100405889 92
879 3300026088 Ga0207641_10091980 Ga0207641_100919802 92
880 3300026088 Ga0207641_10829841 Ga0207641_108298412 92
881 3300026088 Ga0207641_11173038 Ga0207641_111730381 92
882 3300026089 Ga0207648_10095334 Ga0207648_100953342 92
883 3300026095 Ga0207676_10105473 Ga0207676_101054735 92
884 3300026095 Ga0207676_10429026 Ga0207676_104290262 92
885 3300026095 Ga0207676_11376729 Ga0207676_113767292 92
886 3300026095 Ga0207676_11730826 Ga0207676_117308262 92
887 3300026116 Ga0207674_10068821 Ga0207674_100688218 92
888 3300026116 Ga0207674_10151658 Ga0207674_101516585 92
889 3300026116 Ga0207674_10344003 Ga0207674_103440034 92
890 3300026116 Ga0207674_10408733 Ga0207674_104087332 92
891 3300026116 Ga0207674_10585720 Ga0207674_105857202 92
892 3300026116 Ga0207674_11406500 Ga0207674_114065002 92
893 3300026118 Ga0207675_100186246 Ga0207675_1001862465 92
894 3300026118 Ga0207675_100221646 Ga0207675_1002216465 92
895 3300026118 Ga0207675_100297058 Ga0207675_1002970585 92
896 3300026121 Ga0207683_10131427 Ga0207683_101314275 92
897 3300026121 Ga0207683_10277976 Ga0207683_102779764 92
898 3300026121 Ga0207683_10647911 Ga0207683_106479111 92
899 3300026121 Ga0207683_10917803 Ga0207683_109178032 92
900 3300026121 Ga0207683_11537903 Ga0207683_115379031 92
901 3300026142 Ga0207698_10254423 Ga0207698_102544231 92
902 3300026142 Ga0207698_10265499 Ga0207698_102654992 92
903 3300026142 Ga0207698_10625049 Ga0207698_106250492 92
904 3300026142 Ga0207698_11257826 Ga0207698_112578262 92
905 3300027296 Ga0209389_1002002 Ga0209389_100200214 92
906 3300027357 Ga0209589_1000009 Ga0209589_100000926 92
907 3300027357 Ga0209589_1000300 Ga0209589_100030030 92
908 3300027361 Ga0209489_100010 Ga0209489_100010245 92
909 3300027361 Ga0209489_109706 Ga0209489_1097069 92
910 3300027363 Ga0209700_100017 Ga0209700_100017245 92
911 3300027363 Ga0209700_100031 Ga0209700_100031175 92
912 3300027512 Ga0209179_1016523 Ga0209179_10165232 92
913 3300027671 Ga0209588_1013306 Ga0209588_10133066 92
914 3300027866 Ga0209813_10052606 Ga0209813_100526064 92
915 3300027907 Ga0207428_10698583 Ga0207428_106985832 92
916 3300028023 Ga0265357_1043259 Ga0265357_10432592 92
917 3300028379 Ga0268266_10432636 Ga0268266_104326362 92
918 3300028379 Ga0268266_10516658 Ga0268266_105166582 92
919 3300028379 Ga0268266_10692132 Ga0268266_106921322 92
920 3300028379 Ga0268266_10693153 Ga0268266_106931531 92
921 3300028379 Ga0268266_10865756 Ga0268266_108657562 92
922 3300028379 Ga0268266_10881650 Ga0268266_108816501 92
923 3300028379 Ga0268266_10965476 Ga0268266_109654762 92
924 3300028379 Ga0268266_11424766 Ga0268266_114247662 92
925 3300028380 Ga0268265_10092241 Ga0268265_100922413 92
926 3300028380 Ga0268265_12428101 Ga0268265_124281012 92
927 3300028381 Ga0268264_10000655 Ga0268264_100006556 92
928 3300028381 Ga0268264_11055124 Ga0268264_110551242 92
929 3300028556 Ga0265337_1002429 Ga0265337_10024299 92
930 3300028556 Ga0265337_1172188 Ga0265337_11721882 92
931 3300028558 Ga0265326_10001795 Ga0265326_100017958 92
932 3300028563 Ga0265319_1001825 Ga0265319_100182514 92
933 3300028573 Ga0265334_10000469 Ga0265334_1000046911 92
934 3300028573 Ga0265334_10116721 Ga0265334_101167212 92
935 3300028577 Ga0265318_10007417 Ga0265318_100074173 92
936 3300028653 Ga0265323_10001237 Ga0265323_1000123715 92
937 3300028654 Ga0265322_10015443 Ga0265322_100154432 92
938 3300028666 Ga0265336_10000535 Ga0265336_1000053516 92
939 3300028786 Ga0307517_10000125 Ga0307517_100001258 92
940 3300028786 Ga0307517_10420063 Ga0307517_104200632 92
941 3300028794 Ga0307515_10326210 Ga0307515_103262103 92
942 3300028800 Ga0265338_10000131 Ga0265338_10000131102 92
943 3300028800 Ga0265338_10468718 Ga0265338_104687182 92
944 3300029272 Ga0311000_102944 Ga0311000_1029441 92
945 3300029277 Ga0311001_1018422 Ga0311001_10184226 92
946 3300029283 Ga0310982_104980 Ga0310982_1049802 92
947 3300029285 Ga0310981_1050683 Ga0310981_10506832 92
948 3300029957 Ga0265324_10001269 Ga0265324_1000126918 92
949 3300030521 Ga0307511_10068859 Ga0307511_100688593 92
950 3300030521 Ga0307511_10308670 Ga0307511_103086702 92
951 3300030522 Ga0307512_10152314 Ga0307512_101523142 92
952 3300030889 Ga0265761_103791 Ga0265761_1037912 92
953 3300030963 Ga0265768_111923 Ga0265768_1119232 92
954 3300031010 Ga0265771_1018073 Ga0265771_10180732 92
955 3300031018 Ga0265773_1003180 Ga0265773_10031803 92
956 3300031090 Ga0265760_10067413 Ga0265760_100674133 92
957 3300031090 Ga0265760_10109829 Ga0265760_101098292 92
958 3300031235 Ga0265330_10016493 Ga0265330_100164938 92
959 3300031235 Ga0265330_10075674 Ga0265330_100756743 92
960 3300031235 Ga0265330_10167684 Ga0265330_101676841 92
961 3300031238 Ga0265332_10033161 Ga0265332_100331614 92
962 3300031238 Ga0265332_10147072 Ga0265332_101470722 92
963 3300031239 Ga0265328_10028357 Ga0265328_100283575 92
964 3300031239 Ga0265328_10104084 Ga0265328_101040843 92
965 3300031239 Ga0265328_10264086 Ga0265328_102640862 92
966 3300031241 Ga0265325_10067472 Ga0265325_100674725 92
967 3300031241 Ga0265325_10112600 Ga0265325_101126003 92
968 3300031241 Ga0265325_10144404 Ga0265325_101444041 92
969 3300031247 Ga0265340_10006598 Ga0265340_100065984 92
970 3300031247 Ga0265340_10036269 Ga0265340_100362695 92
971 3300031247 Ga0265340_10072056 Ga0265340_100720562 92
972 3300031249 Ga0265339_10006928 Ga0265339_1000692811 92
973 3300031249 Ga0265339_10096535 Ga0265339_100965351 92
974 3300031249 Ga0265339_10304348 Ga0265339_103043482 92
975 3300031249 Ga0265339_10442930 Ga0265339_104429301 92
976 3300031250 Ga0265331_10149637 Ga0265331_101496371 92
977 3300031250 Ga0265331_10209681 Ga0265331_102096812 92
978 3300031250 Ga0265331_10525126 Ga0265331_105251262 92
979 3300031344 Ga0265316_10644101 Ga0265316_106441011 92
980 3300031344 Ga0265316_10893645 Ga0265316_108936452 92
981 3300031344 Ga0265316_11143741 Ga0265316_111437412 92
982 3300031456 Ga0307513_10349645 Ga0307513_103496453 92
983 3300031456 Ga0307513_10405277 Ga0307513_104052772 92
984 3300031507 Ga0307509_10041031 Ga0307509_1004103110 92
985 3300031507 Ga0307509_10213458 Ga0307509_102134584 92
986 3300031507 Ga0307509_10256135 Ga0307509_102561352 92
987 3300031507 Ga0307509_10690526 Ga0307509_106905262 92
988 3300031548 Ga0307408_100167290 Ga0307408_1001672903 92
989 3300031548 Ga0307408_101416366 Ga0307408_1014163662 92
990 3300031548 Ga0307408_102304792 Ga0307408_1023047922 92
991 3300031595 Ga0265313_10172436 Ga0265313_101724362 92
992 3300031595 Ga0265313_10407388 Ga0265313_104073882 92
993 3300031616 Ga0307508_10000378 Ga0307508_1000037838 92
994 3300031616 Ga0307508_10136036 Ga0307508_101360366 92
995 3300031616 Ga0307508_10800598 Ga0307508_108005982 92
996 3300031649 Ga0307514_10159812 Ga0307514_101598122 92
997 3300031711 Ga0265314_10002508 Ga0265314_100025085 92
998 3300031711 Ga0265314_10004990 Ga0265314_100049906 92
999 3300031711 Ga0265314_10016237 Ga0265314_1001623711 92
1000 3300031711 Ga0265314_10087191 Ga0265314_100871915 92
1001 3300031711 Ga0265314_10242562 Ga0265314_102425622 92
1002 3300031712 Ga0265342_10009360 Ga0265342_100093608 92
1003 3300031712 Ga0265342_10142264 Ga0265342_101422644 92
1004 3300031712 Ga0265342_10198530 Ga0265342_101985302 92
1005 3300031730 Ga0307516_10092591 Ga0307516_100925916 92
1006 3300031730 Ga0307516_10212983 Ga0307516_102129834 92
1007 3300031730 Ga0307516_10238643 Ga0307516_102386432 92
1008 3300031730 Ga0307516_10709467 Ga0307516_107094672 92
1009 3300031730 Ga0307516_10721826 Ga0307516_107218262 92
1010 3300031731 Ga0307405_10050000 Ga0307405_100500006 92
1011 3300031731 Ga0307405_10349799 Ga0307405_103497992 92
1012 3300031731 Ga0307405_11172692 Ga0307405_111726922 92
1013 3300031731 Ga0307405_11596793 Ga0307405_115967932 92
1014 3300031815 Ga0316045_122586 Ga0316045_1225862 92
1015 3300031824 Ga0307413_10088897 Ga0307413_100888975 92
1016 3300031824 Ga0307413_11321041 Ga0307413_113210412 92
1017 3300031852 Ga0307410_10315181 Ga0307410_103151813 92
1018 3300031852 Ga0307410_11264763 Ga0307410_112647632 92
1019 3300031901 Ga0307406_10161839 Ga0307406_101618394 92
1020 3300031901 Ga0307406_10768447 Ga0307406_107684472 92
1021 3300031911 Ga0307412_10450773 Ga0307412_104507732 92
1022 3300031911 Ga0307412_10463049 Ga0307412_104630492 92
1023 3300031911 Ga0307412_10567802 Ga0307412_105678022 92
1024 3300031911 Ga0307412_10686179 Ga0307412_106861792 92
1025 3300031911 Ga0307412_10702076 Ga0307412_107020762 92
1026 3300031995 Ga0307409_100045054 Ga0307409_1000450547 92
1027 3300031995 Ga0307409_100814041 Ga0307409_1008140413 92
1028 3300031995 Ga0307409_101540635 Ga0307409_1015406352 92
1029 3300031995 Ga0307409_102625180 Ga0307409_1026251802 92
1030 3300031995 Ga0307409_102736046 Ga0307409_1027360462 92
1031 3300032002 Ga0307416_100140627 Ga0307416_1001406275 92
1032 3300032002 Ga0307416_100457707 Ga0307416_1004577074 92
1033 3300032002 Ga0307416_100468773 Ga0307416_1004687732 92
1034 3300032002 Ga0307416_102089356 Ga0307416_1020893562 92
1035 3300032002 Ga0307416_102527869 Ga0307416_1025278692 92
1036 3300032004 Ga0307414_10317675 Ga0307414_103176751 92
1037 3300032005 Ga0307411_10061926 Ga0307411_100619264 92
1038 3300032005 Ga0307411_10551428 Ga0307411_105514282 92
1039 3300032005 Ga0307411_10973575 Ga0307411_109735752 92
1040 3300032126 Ga0307415_100342883 Ga0307415_1003428832 92
1041 3300032126 Ga0307415_100387014 Ga0307415_1003870142 92
1042 3300032126 Ga0307415_101066921 Ga0307415_1010669212 92
1043 3300032126 Ga0307415_101444714 Ga0307415_1014447142 92
1044 3300032126 Ga0307415_102045526 Ga0307415_1020455262 92
1045 3300033179 Ga0307507_10023232 Ga0307507_1002323210 92
1046 3300033179 Ga0307507_10337948 Ga0307507_103379482 92
1047 3300033179 Ga0307507_10597521 Ga0307507_105975211 92
1048 3300033180 Ga0307510_10019223 Ga0307510_1001922311 92
1049 3300033180 Ga0307510_10123491 Ga0307510_101234912 92
1050 3300033180 Ga0307510_10124603 Ga0307510_101246035 92
1051 3300033180 Ga0307510_10140272 Ga0307510_101402726 92
1052 3300033180 Ga0307510_10321755 Ga0307510_103217552 92
1053 3300033180 Ga0307510_10650117 Ga0307510_106501171 92
1054 3300033442 Ga0315911_1000009 Ga0315911_100000991 92
1055 3300033545 Ga0316214_1028574 Ga0316214_10285742 92
1056 3300033547 Ga0316212_1034504 Ga0316212_10345041 92
1057 3300034817 Ga0373948_0058926 Ga0373948_0058926_391_705 92
1058 3300034818 Ga0373950_0013658 Ga0373950_0013658_641_955 92
1059 3300034818 Ga0373950_0033779 Ga0373950_0033779_531_845 92
1060 3300034819 Ga0373958_0037304 Ga0373958_0037304_210_524 92
1061 3300034819 Ga0373958_0055612 Ga0373958_0055612_417_731 92
1062 3300034820 Ga0373959_0020725 Ga0373959_0020725_676_990 92
1063 3300034820 Ga0373959_0051762 Ga0373959_0051762_397_711 92
1064 3300034957 Ga0373938_0026528 Ga0373938_0026528_379_693 92
1065 3300035083 Ga0373926_0025367 Ga0373926_0025367_376_690 92
1066 3300035083 Ga0373926_0131362 Ga0373926_0131362_613_927 92
1067 3300035083 Ga0373926_0188086 Ga0373926_0188086_454_768 92
1068 3300035083 Ga0373926_0224868 Ga0373926_0224868_146_460 92
1069 3300035083 Ga0373926_0242215 Ga0373926_0242215_323_637 92
1070 3300035084 Ga0373928_0038023 Ga0373928_0038023_460_774 92
1071 3300035085 Ga0373929_0078095 Ga0373929_0078095_321_635 92
1072 3300035086 Ga0373934_0269350 Ga0373934_0269350_47_373 92
1073 3300035086 Ga0373934_0483326 Ga0373934_0483326_147_461 92
1074 3300035088 Ga0373940_0011530 Ga0373940_0011530_1463_1777 92
1075 3300035089 Ga0373944_0133462 Ga0373944_0133462_149_463 92
1076 3300035089 Ga0373944_0185316 Ga0373944_0185316_412_726 92
1077 3300035089 Ga0373944_0341438 Ga0373944_0341438_107_421 92
1078 3300035090 Ga0373949_0035023 Ga0373949_0035023_863_1180 92
1079 3300035090 Ga0373949_0113660 Ga0373949_0113660_181_495 92
1080 3300035091 Ga0373951_0038711 Ga0373951_0038711_208_522 92
1081 3300035091 Ga0373951_0130585 Ga0373951_0130585_358_672 92
1082 3300035092 Ga0373952_0074529 Ga0373952_0074529_89_403 92
1083 3300035092 Ga0373952_0157212 Ga0373952_0157212_68_382 92
1084 3300035111 Ga0373923_0062774 Ga0373923_0062774_855_1169 92
1085 3300035111 Ga0373923_0127792 Ga0373923_0127792_456_770 92
1086 3300035111 Ga0373923_0202236 Ga0373923_0202236_114_428 92
1087 3300035111 Ga0373923_0340211 Ga0373923_0340211_10_336 92
1088 3300035112 Ga0373932_0158548 Ga0373932_0158548_277_591 92
1089 3300035112 Ga0373932_0312753 Ga0373932_0312753_74_388 92
1090 3300035113 Ga0373936_0033332 Ga0373936_0033332_1131_1445 92
1091 3300035113 Ga0373936_0238849 Ga0373936_0238849_353_667 92
1092 3300035113 Ga0373936_0320009 Ga0373936_0320009_108_422 92
1093 3300035113 Ga0373936_0433909 Ga0373936_0433909_257_571 92
1094 3300035113 Ga0373936_0462778 Ga0373936_0462778_141_467 92
1095 3300035114 Ga0373939_0191482 Ga0373939_0191482_166_480 92
1096 3300035114 Ga0373939_0425869 Ga0373939_0425869_29_343 92
1097 3300035114 Ga0373939_0452789 Ga0373939_0452789_155_469 92
1098 3300035115 Ga0373941_0313728 Ga0373941_0313728_194_508 92
1099 3300035116 Ga0373945_0009397 Ga0373945_0009397_2655_2969 92
1100 3300035116 Ga0373945_0355918 Ga0373945_0355918_25_339 92
1101 3300035117 Ga0373953_0031449 Ga0373953_0031449_184_498 92
1102 3300035117 Ga0373953_0051114 Ga0373953_0051114_1346_1660 92
1103 3300035117 Ga0373953_0097697 Ga0373953_0097697_687_1001 92
1104 3300035117 Ga0373953_0283753 Ga0373953_0283753_258_572 92
1105 3300035118 Ga0373954_0012064 Ga0373954_0012064_2522_2836 92
1106 3300035118 Ga0373954_0075568 Ga0373954_0075568_444_758 92
1107 3300035118 Ga0373954_0249343 Ga0373954_0249343_43_357 92
1108 3300035118 Ga0373954_0289386 Ga0373954_0289386_385_699 92
1109 3300035118 Ga0373954_0418153 Ga0373954_0418153_289_603 92
1110 3300035119 Ga0373956_0142852 Ga0373956_0142852_420_734 92
1111 3300035119 Ga0373956_0304224 Ga0373956_0304224_162_476 92
1112 3300035119 Ga0373956_0586022 Ga0373956_0586022_28_342 92
1113 3300035120 Ga0373957_0033631 Ga0373957_0033631_1426_1740 92
1114 3300035120 Ga0373957_0055160 Ga0373957_0055160_343_657 92
1115 3300035120 Ga0373957_0111375 Ga0373957_0111375_299_613 92
1116 3300035120 Ga0373957_0139175 Ga0373957_0139175_58_372 92
1117 3300035120 Ga0373957_0474941 Ga0373957_0474941_19_333 92
1118 3300035121 Ga0373960_0443320 Ga0373960_0443320_116_430 92
1119 3300035170 Ga0373943_0003463 Ga0373943_0003463_2761_3075 92
1120 3300035170 Ga0373943_0006179 Ga0373943_0006179_422_736 92
1121 3300035170 Ga0373943_0013859 Ga0373943_0013859_376_690 92
1122 3300035170 Ga0373943_0146685 Ga0373943_0146685_551_877 92
1123 3300035170 Ga0373943_0266476 Ga0373943_0266476_367_681 92
1124 3300035170 Ga0373943_0807434 Ga0373943_0807434_206_520 92
1125 3300035171 Ga0373946_0334572 Ga0373946_0334572_317_631 92
1126 3300035171 Ga0373946_0364512 Ga0373946_0364512_177_491 92
1127 3300035171 Ga0373946_0637439 Ga0373946_0637439_96_410 92
1128 3300035171 Ga0373946_0691778 Ga0373946_0691778_34_348 92
1129 3300035172 Ga0373955_0005659 Ga0373955_0005659_3253_3567 92
1130 3300035172 Ga0373955_0011340 Ga0373955_0011340_3533_3847 92
1131 3300035172 Ga0373955_0262980 Ga0373955_0262980_318_632 92
1132 3300035172 Ga0373955_0536469 Ga0373955_0536469_57_371 92
1133 3300035207 Ga0373942_0030182 Ga0373942_0030182_385_699 92
1134 3300035241 Ga0373961_0192565 Ga0373961_0192565_299_613 92
1135 3300035242 Ga0373962_0006059 Ga0373962_0006059_2412_2729 92
1136 3300035242 Ga0373962_0131540 Ga0373962_0131540_69_383 92
1137 3300035410 Ga0373924_0002732 Ga0373924_0002732_1966_2280 92
1138 3300035410 Ga0373924_0093590 Ga0373924_0093590_355_669 92
1139 3300035410 Ga0373924_0314712 Ga0373924_0314712_122_436 92
1140 3300035691 Ga0373931_0036584 Ga0373931_0036584_2116_2430 92
1141 3300035691 Ga0373931_0707194 Ga0373931_0707194_236_562 92
1142 3300035691 Ga0373931_0822304 Ga0373931_0822304_257_571 92
1143 3300035692 Ga0373935_0006317 Ga0373935_0006317_2673_2987 92
1144 3300035692 Ga0373935_0010090 Ga0373935_0010090_1127_1441 92
1145 3300035692 Ga0373935_0301450 Ga0373935_0301450_378_692 92
1146 3300035692 Ga0373935_0331585 Ga0373935_0331585_192_506 92
1147 3300035692 Ga0373935_0398098 Ga0373935_0398098_20_334 92
1148 3300035692 Ga0373935_0442809 Ga0373935_0442809_554_868 92
1149 3300035692 Ga0373935_0489269 Ga0373935_0489269_491_805 92
1150 3300035695 Ga0373927_0014366 Ga0373927_0014366_1932_2246 92
1151 3300035695 Ga0373927_0019406 Ga0373927_0019406_2814_3128 92
1152 3300035695 Ga0373927_0019967 Ga0373927_0019967_236_550 92
1153 3300035695 Ga0373927_0025263 Ga0373927_0025263_3392_3706 92
1154 3300035695 Ga0373927_0025754 Ga0373927_0025754_431_745 92
1155 3300035695 Ga0373927_0076507 Ga0373927_0076507_174_488 92
1156 3300035695 Ga0373927_0227092 Ga0373927_0227092_720_1034 92
1157 3300035695 Ga0373927_0614498 Ga0373927_0614498_192_506 92
1158 3300035695 Ga0373927_0688980 Ga0373927_0688980_311_625 92
1159 3300035695 Ga0373927_1160560 Ga0373927_1160560_62_376 92
1160 3300035724 Ga0373933_0000226 Ga0373933_0000226_2189_2503 92
1161 3300035724 Ga0373933_0198434 Ga0373933_0198434_376_690 92
1162 3300035724 Ga0373933_0206797 Ga0373933_0206797_153_467 92
1163 3300035724 Ga0373933_0258678 Ga0373933_0258678_781_1098 92
1164 3300035724 Ga0373933_0275621 Ga0373933_0275621_504_818 92
1165 3300035724 Ga0373933_0562146 Ga0373933_0562146_369_683 92
1166 3300035724 Ga0373933_0666971 Ga0373933_0666971_320_634 92
1167 3300035725 Ga0373947_0005298 Ga0373947_0005298_3304_3618 92
1168 3300035725 Ga0373947_0015233 Ga0373947_0015233_2176_2490 92
1169 3300035725 Ga0373947_0034609 Ga0373947_0034609_685_999 92
1170 3300035725 Ga0373947_0373337 Ga0373947_0373337_668_946 92
1171 3300035725 Ga0373947_0436425 Ga0373947_0436425_216_542 92
1172 3300035725 Ga0373947_0481192 Ga0373947_0481192_311_625 92
1173 3300036242 Ga0310104_00079 Ga0310104_00079_2526_2840 92
1174 3300036401 Ga0373937_0025879 Ga0373937_0025879_899_1213 92
1175 3300036401 Ga0373937_0080661 Ga0373937_0080661_2246_2560 92
1176 3300036401 Ga0373937_0166265 Ga0373937_0166265_1319_1633 92
1177 3300036401 Ga0373937_0480261 Ga0373937_0480261_356_670 92
1178 3300036401 Ga0373937_0778963 Ga0373937_0778963_36_350 92
1179 3300036459 Ga0372808_022249 Ga0372808_022249_273_587 92
1180 3300036647 Ga0316582_0038913 Ga0316582_0038913_645_971 92
1181 3300037068 Ga0373925_0005636 Ga0373925_0005636_8760_9074 92
1182 3300037068 Ga0373925_0008352 Ga0373925_0008352_853_1167 92
1183 3300037068 Ga0373925_0052935 Ga0373925_0052935_845_1159 92
1184 3300037068 Ga0373925_0102737 Ga0373925_0102737_558_872 92
1185 3300037068 Ga0373925_0197582 Ga0373925_0197582_924_1238 92
1186 3300037068 Ga0373925_0457697 Ga0373925_0457697_479_793 92
1187 3300037068 Ga0373925_0561488 Ga0373925_0561488_190_516 92
1188 3300037068 Ga0373925_0568937 Ga0373925_0568937_198_512 92
1189 3300037068 Ga0373925_0827427 Ga0373925_0827427_434_748 92
1190 3300037068 Ga0373925_0896368 Ga0373925_0896368_372_686 92
1191 3300037068 Ga0373925_1141730 Ga0373925_1141730_290_604 92
1192 3300037068 Ga0373925_1670787 Ga0373925_1670787_17_331 92
1193 3300037312 Ga0395899_0013235 Ga0395899_0013235_3277_3591 92
1194 3300037312 Ga0395899_0116869 Ga0395899_0116869_1364_1678 92
1195 3300037312 Ga0395899_0226664 Ga0395899_0226664_714_1028 92
1196 3300037312 Ga0395899_0377375 Ga0395899_0377375_209_523 92
1197 3300037312 Ga0395899_0600117 Ga0395899_0600117_137_451 92
1198 3300037312 Ga0395899_0601856 Ga0395899_0601856_284_598 92
1199 3300037312 Ga0395899_0719359 Ga0395899_0719359_17_331 92
1200 3300037418 Ga0395900_0010887 Ga0395900_0010887_859_1173 92
1201 3300037418 Ga0395900_0049338 Ga0395900_0049338_109_423 92
1202 3300037418 Ga0395900_0050005 Ga0395900_0050005_1970_2284 92
1203 3300037418 Ga0395900_0165040 Ga0395900_0165040_1847_2161 92
1204 3300037418 Ga0395900_0240896 Ga0395900_0240896_266_580 92
1205 3300037418 Ga0395900_0692111 Ga0395900_0692111_440_754 92
1206 3300037418 Ga0395900_0938774 Ga0395900_0938774_329_643 92
1207 3300037466 Ga0395898_0021940 Ga0395898_0021940_232_546 92
1208 3300037466 Ga0395898_0036410 Ga0395898_0036410_633_947 92
1209 3300037466 Ga0395898_0104107 Ga0395898_0104107_185_499 92
1210 3300037466 Ga0395898_0122269 Ga0395898_0122269_1979_2293 92
1211 3300037466 Ga0395898_0581519 Ga0395898_0581519_426_740 92
1212 3300037466 Ga0395898_1173143 Ga0395898_1173143_233_547 92
1213 3300037466 Ga0395898_1694179 Ga0395898_1694179_115_429 92
1214 3300037471 Ga0395905_0143635 Ga0395905_0143635_691_1005 92
1215 3300037471 Ga0395905_0237250 Ga0395905_0237250_383_697 92
1216 3300037471 Ga0395905_0621052 Ga0395905_0621052_19_342 92
1217 3300037471 Ga0395905_0977794 Ga0395905_0977794_211_525 92
1218 3300037853 Ga0436364_0117848 Ga0436364_0117848_292_606 92
1219 3300037853 Ga0436364_0195688 Ga0436364_0195688_549_863 92
1220 3300037853 Ga0436364_0426550 Ga0436364_0426550_1077_1391 92
1221 3300037853 Ga0436364_0998563 Ga0436364_0998563_357_671 92
1222 3300037853 Ga0436364_1277527 Ga0436364_1277527_135_461 92
1223 3300037853 Ga0436364_1512680 Ga0436364_1512680_593_907 92
1224 3300038443 Ga0395901_0052028 Ga0395901_0052028_792_1106 92
1225 3300038443 Ga0395901_0116293 Ga0395901_0116293_233_547 92
1226 3300038443 Ga0395901_0157923 Ga0395901_0157923_1738_2052 92
1227 3300038443 Ga0395901_0170305 Ga0395901_0170305_761_1075 92
1228 3300038443 Ga0395901_0326517 Ga0395901_0326517_1157_1471 92
1229 3300038443 Ga0395901_0511506 Ga0395901_0511506_787_1101 92
1230 3300038443 Ga0395901_0911102 Ga0395901_0911102_385_699 92
1231 3300038443 Ga0395901_0943368 Ga0395901_0943368_400_714 92
1232 3300038443 Ga0395901_1440507 Ga0395901_1440507_64_378 92
1233 3300039437 Ga0436365_0092954 Ga0436365_0092954_257_571 92
1234 3300039437 Ga0436365_0132418 Ga0436365_0132418_438_752 92
1235 3300039437 Ga0436365_0167353 Ga0436365_0167353_1503_1817 92
1236 3300039437 Ga0436365_0182717 Ga0436365_0182717_321_635 92
1237 3300039437 Ga0436365_0553612 Ga0436365_0553612_297_611 92
1238 3300039437 Ga0436365_0976640 Ga0436365_0976640_83_397 92
1239 3300039437 Ga0436365_1780618 Ga0436365_1780618_142_456 92
1240 3300039438 Ga0436360_0327078 Ga0436360_0327078_553_876 92
1241 3300039438 Ga0436360_0389769 Ga0436360_0389769_28_351 92
1242 3300039438 Ga0436360_0498192 Ga0436360_0498192_112_426 92
1243 3300039438 Ga0436360_0901853 Ga0436360_0901853_33_347 92
1244 3300039438 Ga0436360_1015481 Ga0436360_1015481_932_1246 92
1245 3300039438 Ga0436360_1328820 Ga0436360_1328820_42_356 92
1246 3300039447 Ga0436361_0164147 Ga0436361_0164147_217_531 92
1247 3300039447 Ga0436361_0345432 Ga0436361_0345432_1966_2280 92
1248 3300039447 Ga0436361_0503536 Ga0436361_0503536_521_835 92
1249 3300039447 Ga0436361_0820316 Ga0436361_0820316_481_795 92
1250 3300039450 Ga0436363_0301621 Ga0436363_0301621_185_499 92
1251 3300039450 Ga0436363_0524521 Ga0436363_0524521_626_940 92
1252 3300039450 Ga0436363_0686660 Ga0436363_0686660_155_469 92
1253 3300039450 Ga0436363_0734107 Ga0436363_0734107_277_591 92
1254 3300039450 Ga0436363_1073607 Ga0436363_1073607_122_436 92
1255 3300039450 Ga0436363_1416214 Ga0436363_1416214_2745_3059 92
1256 3300039453 Ga0436362_0123421 Ga0436362_0123421_1718_2032 92
1257 3300039453 Ga0436362_0501210 Ga0436362_0501210_329_643 92
1258 3300039453 Ga0436362_1023268 Ga0436362_1023268_1264_1578 92
1259 3300039453 Ga0436362_1193219 Ga0436362_1193219_664_978 92
1260 3300039453 Ga0436362_1268291 Ga0436362_1268291_219_539 92
1261 3300041407 Ga0439447_042355 Ga0439447_042355_671_985 92
1262 3300041413 Ga0439465_0223731 Ga0439465_0223731_253_567 92
1263 3300041413 Ga0439465_0358462 Ga0439465_0358462_90_404 92
1264 3300041443 Ga0451789_0024405 Ga0451789_0024405_294_608 92
1265 3300041443 Ga0451789_0484245 Ga0451789_0484245_39_353 92
1266 3300041451 Ga0451791_1641340 Ga0451791_1641340_509_823 92
1267 3300041451 Ga0451791_1844086 Ga0451791_1844086_466_780 92
1268 3300041456 Ga0451795_0835681 Ga0451795_0835681_101_415 92
1269 3300041456 Ga0451795_1431950 Ga0451795_1431950_299_613 92
1270 3300041459 Ga0451800_1529223 Ga0451800_1529223_84_398 92
1271 3300041460 Ga0451802_0016898 Ga0451802_0016898_478_792 92
1272 3300041460 Ga0451802_0629483 Ga0451802_0629483_114_428 92
1273 3300041463 Ga0451804_0034360 Ga0451804_0034360_54_368 92
1274 3300041463 Ga0451804_0746900 Ga0451804_0746900_187_501 92
1275 3300041486 Ga0451807_1574599 Ga0451807_1574599_73_387 92
1276 3300041491 Ga0451833_0765327 Ga0451833_0765327_243_557 92
1277 3300041491 Ga0451833_1094826 Ga0451833_1094826_228_542 92
1278 3300041494 Ga0451837_0578265 Ga0451837_0578265_112_429 92
1279 3300041494 Ga0451837_0651182 Ga0451837_0651182_48_362 92
1280 3300041501 Ga0451845_0309105 Ga0451845_0309105_58_372 92
1281 3300041503 Ga0451847_0055320 Ga0451847_0055320_494_808 92
1282 3300041509 Ga0451843_1721461 Ga0451843_1721461_62_376 92
1283 3300041512 Ga0451853_1476642 Ga0451853_1476642_40_354 92
1284 3300041512 Ga0451853_3163796 Ga0451853_3163796_399_713 92
1285 3300041997 Ga0439431_0062179 Ga0439431_0062179_518_832 92
1286 3300042000 Ga0439437_042268 Ga0439437_042268_156_470 92
1287 3300042005 Ga0439448_0016636 Ga0439448_0016636_1411_1725 92
1288 3300042005 Ga0439448_0072517 Ga0439448_0072517_622_936 92
1289 3300042006 Ga0439432_036353 Ga0439432_036353_880_1194 92
1290 3300042008 Ga0439450_040515 Ga0439450_040515_268_582 92
1291 3300042012 Ga0439455_0114242 Ga0439455_0114242_94_408 92
1292 3300042013 Ga0439456_086970 Ga0439456_086970_103_429 92
1293 3300042013 Ga0439456_090080 Ga0439456_090080_340_654 92
1294 3300042016 Ga0439463_057865 Ga0439463_057865_145_459 92
1295 3300042134 Ga0450898_062453 Ga0450898_062453_240_554 92
1296 3300042136 Ga0450900_022131 Ga0450900_022131_496_810 92
1297 3300042156 Ga0439446_0089603 Ga0439446_0089603_617_931 92
1298 3300042157 Ga0439458_0119246 Ga0439458_0119246_331_645 92
1299 3300042157 Ga0439458_0159421 Ga0439458_0159421_36_350 92
1300 3300042184 Ga0450908_014907 Ga0450908_014907_385_705 92
1301 3300042437 Ga0439444_0203115 Ga0439444_0203115_137_451 92
1302 3300042438 Ga0439459_0086897 Ga0439459_0086897_13_327 92
1303 3300042439 Ga0439464_0193745 Ga0439464_0193745_110_424 92
1304 3300042461 Ga0439460_0191261 Ga0439460_0191261_14_328 92
1305 3300042531 Ga0450918_016269 Ga0450918_016269_54_374 92
1306 3300044656 Ga0466969_0027298 Ga0466969_0027298_474_788 92
1307 3300044656 Ga0466969_0098661 Ga0466969_0098661_154_468 92
1308 3300044656 Ga0466969_0137022 Ga0466969_0137022_515_829 92
1309 3300044658 Ga0466972_0022437 Ga0466972_0022437_1553_1867 92
1310 3300044684 Ga0466966_0002417 Ga0466966_0002417_8993_9307 92
1311 3300044684 Ga0466966_0115184 Ga0466966_0115184_1107_1421 92
1312 3300044684 Ga0466966_0470870 Ga0466966_0470870_364_678 92
1313 3300044684 Ga0466966_0796277 Ga0466966_0796277_46_360 92
1314 3300044684 Ga0466966_1012913 Ga0466966_1012913_137_451 92
1315 3300044693 Ga0466961_0030631 Ga0466961_0030631_2498_2812 92
1316 3300044693 Ga0466961_0782575 Ga0466961_0782575_170_484 92
1317 3300044694 Ga0466963_0375815 Ga0466963_0375815_186_500 92
1318 3300044694 Ga0466963_0495538 Ga0466963_0495538_26_340 92
1319 3300044706 Ga0466964_0081593 Ga0466964_0081593_289_603 92
1320 3300044706 Ga0466964_0089440 Ga0466964_0089440_735_1049 92
1321 3300044706 Ga0466964_0163437 Ga0466964_0163437_259_573 92
1322 3300044706 Ga0466964_0236849 Ga0466964_0236849_20_334 92
1323 3300044719 Ga0466971_0118155 Ga0466971_0118155_352_666 92
1324 3300044735 Ga0466968_0142512 Ga0466968_0142512_373_687 92
1325 3300044735 Ga0466968_0197788 Ga0466968_0197788_506_820 92
1326 3300044765 Ga0466970_0043671 Ga0466970_0043671_360_674 92
1327 3300044765 Ga0466970_0160238 Ga0466970_0160238_372_686 92
1328 3300044765 Ga0466970_0350843 Ga0466970_0350843_294_608 92
1329 3300044842 Ga0466957_0208706 Ga0466957_0208706_689_1003 92
1330 3300044842 Ga0466957_0414385 Ga0466957_0414385_261_575 92
1331 3300044842 Ga0466957_0512903 Ga0466957_0512903_356_670 92
1332 3300044842 Ga0466957_0861205 Ga0466957_0861205_65_379 92
1333 3300044842 Ga0466957_1051109 Ga0466957_1051109_258_572 92
1334 3300044901 Ga0466960_0304803 Ga0466960_0304803_61_375 92
1335 3300044901 Ga0466960_0457595 Ga0466960_0457595_272_586 92
1336 3300045049 Ga0466959_0283135 Ga0466959_0283135_242_556 92
1337 3300045049 Ga0466959_0334672 Ga0466959_0334672_264_578 92
1338 3300045049 Ga0466959_0401754 Ga0466959_0401754_265_579 92
1339 3300045049 Ga0466959_0475958 Ga0466959_0475958_82_396 92
1340 3300045836 Ga0466958_0144968 Ga0466958_0144968_491_805 92
1341 3300045836 Ga0466958_0655205 Ga0466958_0655205_161_475 92
1342 3300045976 Ga0466967_0139430 Ga0466967_0139430_1611_1925 92
1343 3300045976 Ga0466967_0247618 Ga0466967_0247618_1133_1447 92
1344 3300045976 Ga0466967_0525201 Ga0466967_0525201_418_732 92
1345 3300045976 Ga0466967_1082361 Ga0466967_1082361_119_433 92
1346 3300046452 Ga0495617_095130 Ga0495617_095130_644_958 92
1347 3300046454 Ga0495592_0076879 Ga0495592_0076879_1918_2232 92
1348 3300046454 Ga0495592_0092701 Ga0495592_0092701_1647_1961 92
1349 3300046454 Ga0495592_0444417 Ga0495592_0444417_416_730 92
1350 3300046454 Ga0495592_0515080 Ga0495592_0515080_135_449 92
1351 3300046454 Ga0495592_0539767 Ga0495592_0539767_314_628 92
1352 3300046455 Ga0495603_0007442 Ga0495603_0007442_421_735 92
1353 3300046455 Ga0495603_0265066 Ga0495603_0265066_209_523 92
1354 3300046455 Ga0495603_0311961 Ga0495603_0311961_460_774 92
1355 3300046455 Ga0495603_0436955 Ga0495603_0436955_332_646 92
1356 3300046455 Ga0495603_0485421 Ga0495603_0485421_278_592 92
1357 3300046455 Ga0495603_0754671 Ga0495603_0754671_49_375 92
1358 3300046455 Ga0495603_0832193 Ga0495603_0832193_110_424 92
1359 3300046457 Ga0495590_0037009 Ga0495590_0037009_280_606 92
1360 3300046457 Ga0495590_0039028 Ga0495590_0039028_379_693 92
1361 3300046458 Ga0495591_043556 Ga0495591_043556_584_898 92
1362 3300046459 Ga0495629_0016778 Ga0495629_0016778_2754_3068 92
1363 3300046459 Ga0495629_0020113 Ga0495629_0020113_2538_2852 92
1364 3300046459 Ga0495629_0117136 Ga0495629_0117136_582_896 92
1365 3300046459 Ga0495629_0337324 Ga0495629_0337324_257_571 92
1366 3300046459 Ga0495629_0406275 Ga0495629_0406275_442_756 92
1367 3300046460 Ga0495638_0015537 Ga0495638_0015537_503_817 92
1368 3300046460 Ga0495638_0107230 Ga0495638_0107230_740_1054 92
1369 3300046460 Ga0495638_0179152 Ga0495638_0179152_438_752 92
1370 3300046460 Ga0495638_0351446 Ga0495638_0351446_357_671 92
1371 3300046461 Ga0495641_0012494 Ga0495641_0012494_428_742 92
1372 3300046461 Ga0495641_0201691 Ga0495641_0201691_193_507 92
1373 3300046462 Ga0495651_0031637 Ga0495651_0031637_1551_1865 92
1374 3300046462 Ga0495651_0081674 Ga0495651_0081674_451_765 92
1375 3300046462 Ga0495651_0329017 Ga0495651_0329017_531_845 92
1376 3300046462 Ga0495651_0364071 Ga0495651_0364071_572_886 92
1377 3300046462 Ga0495651_0521367 Ga0495651_0521367_266_580 92
1378 3300046463 Ga0495653_0109906 Ga0495653_0109906_1282_1596 92
1379 3300046463 Ga0495653_0168278 Ga0495653_0168278_380_694 92
1380 3300046463 Ga0495653_0381709 Ga0495653_0381709_373_687 92
1381 3300046463 Ga0495653_0528451 Ga0495653_0528451_118_432 92
1382 3300046471 Ga0495650_0073954 Ga0495650_0073954_761_1075 92
1383 3300046471 Ga0495650_0217243 Ga0495650_0217243_185_499 92
1384 3300046471 Ga0495650_0315623 Ga0495650_0315623_14_328 92
1385 3300046472 Ga0495580_0022295 Ga0495580_0022295_2712_3026 92
1386 3300046472 Ga0495580_0061284 Ga0495580_0061284_1779_2093 92
1387 3300046472 Ga0495580_0285341 Ga0495580_0285341_648_962 92
1388 3300046473 Ga0495582_0000163 Ga0495582_0000163_587_901 92
1389 3300046473 Ga0495582_0015152 Ga0495582_0015152_1986_2300 92
1390 3300046473 Ga0495582_0520877 Ga0495582_0520877_276_590 92
1391 3300046474 Ga0495605_0111712 Ga0495605_0111712_458_772 92
1392 3300046474 Ga0495605_0216357 Ga0495605_0216357_225_539 92
1393 3300046474 Ga0495605_0356834 Ga0495605_0356834_134_448 92
1394 3300046474 Ga0495605_0360073 Ga0495605_0360073_22_336 92
1395 3300046475 Ga0495639_0000873 Ga0495639_0000873_9442_9756 92
1396 3300046475 Ga0495639_0028168 Ga0495639_0028168_350_664 92
1397 3300046475 Ga0495639_0034344 Ga0495639_0034344_1257_1571 92
1398 3300046475 Ga0495639_0069963 Ga0495639_0069963_852_1166 92
1399 3300046475 Ga0495639_0135444 Ga0495639_0135444_445_759 92
1400 3300046475 Ga0495639_0141345 Ga0495639_0141345_365_679 92
1401 3300046475 Ga0495639_0171560 Ga0495639_0171560_350_664 92
1402 3300046475 Ga0495639_0625852 Ga0495639_0625852_220_534 92
1403 3300046476 Ga0495662_0000285 Ga0495662_0000285_4356_4670 92
1404 3300046476 Ga0495662_0137623 Ga0495662_0137623_458_772 92
1405 3300046476 Ga0495662_0166807 Ga0495662_0166807_13_327 92
1406 3300046476 Ga0495662_0191890 Ga0495662_0191890_316_630 92
1407 3300046476 Ga0495662_0477642 Ga0495662_0477642_205_519 92
1408 3300046476 Ga0495662_0586414 Ga0495662_0586414_180_494 92
1409 3300046476 Ga0495662_0642642 Ga0495662_0642642_175_489 92
1410 3300046477 Ga0495664_0005138 Ga0495664_0005138_5071_5385 92
1411 3300046477 Ga0495664_0070233 Ga0495664_0070233_1701_2015 92
1412 3300046477 Ga0495664_0089417 Ga0495664_0089417_1280_1594 92
1413 3300046477 Ga0495664_0177397 Ga0495664_0177397_364_678 92
1414 3300046477 Ga0495664_0441662 Ga0495664_0441662_405_719 92
1415 3300046477 Ga0495664_0455832 Ga0495664_0455832_413_727 92
1416 3300046477 Ga0495664_0768018 Ga0495664_0768018_205_519 92
1417 3300046477 Ga0495664_0886614 Ga0495664_0886614_189_503 92
1418 3300046491 Ga0495584_0095937 Ga0495584_0095937_1039_1353 92
1419 3300046491 Ga0495584_0138043 Ga0495584_0138043_735_1049 92
1420 3300046491 Ga0495584_0180168 Ga0495584_0180168_475_789 92
1421 3300046491 Ga0495584_0230493 Ga0495584_0230493_427_741 92
1422 3300046492 Ga0495585_0101859 Ga0495585_0101859_16_330 92
1423 3300046492 Ga0495585_0117755 Ga0495585_0117755_621_935 92
1424 3300046492 Ga0495585_0261406 Ga0495585_0261406_476_790 92
1425 3300046492 Ga0495585_0341282 Ga0495585_0341282_363_677 92
1426 3300046499 Ga0495594_0002164 Ga0495594_0002164_569_883 92
1427 3300046499 Ga0495594_0041814 Ga0495594_0041814_156_470 92
1428 3300046499 Ga0495594_0095331 Ga0495594_0095331_464_778 92
1429 3300046499 Ga0495594_0284446 Ga0495594_0284446_506_820 92
1430 3300046499 Ga0495594_0401944 Ga0495594_0401944_35_349 92
1431 3300046499 Ga0495594_0419227 Ga0495594_0419227_257_571 92
1432 3300046499 Ga0495594_0511962 Ga0495594_0511962_353_667 92
1433 3300046501 Ga0495607_0099047 Ga0495607_0099047_940_1254 92
1434 3300046506 Ga0495583_0201925 Ga0495583_0201925_441_755 92
1435 3300046506 Ga0495583_0272505 Ga0495583_0272505_15_329 92
1436 3300046506 Ga0495583_0372361 Ga0495583_0372361_118_432 92
1437 3300046507 Ga0495606_0004034 Ga0495606_0004034_5410_5724 92
1438 3300046507 Ga0495606_0153846 Ga0495606_0153846_380_694 92
1439 3300046507 Ga0495606_0170990 Ga0495606_0170990_113_427 92
1440 3300046507 Ga0495606_0200472 Ga0495606_0200472_61_375 92
1441 3300046507 Ga0495606_0229401 Ga0495606_0229401_571_885 92
1442 3300046507 Ga0495606_0245829 Ga0495606_0245829_625_939 92
1443 3300046507 Ga0495606_0426438 Ga0495606_0426438_141_455 92
1444 3300046511 Ga0495608_0043139 Ga0495608_0043139_455_769 92
1445 3300046511 Ga0495608_0197269 Ga0495608_0197269_869_1183 92
1446 3300046511 Ga0495608_0499438 Ga0495608_0499438_317_631 92
1447 3300046512 Ga0495610_0101933 Ga0495610_0101933_588_902 92
1448 3300046512 Ga0495610_0297951 Ga0495610_0297951_67_381 92
1449 3300046513 Ga0495616_0052334 Ga0495616_0052334_1423_1737 92
1450 3300046513 Ga0495616_0064295 Ga0495616_0064295_53_367 92
1451 3300046513 Ga0495616_0384265 Ga0495616_0384265_189_503 92
1452 3300046514 Ga0495618_0010748 Ga0495618_0010748_4905_5219 92
1453 3300046514 Ga0495618_0135199 Ga0495618_0135199_1185_1499 92
1454 3300046514 Ga0495618_0207307 Ga0495618_0207307_571_885 92
1455 3300046514 Ga0495618_0477597 Ga0495618_0477597_340_654 92
1456 3300046515 Ga0495620_0131819 Ga0495620_0131819_223_537 92
1457 3300046515 Ga0495620_0201908 Ga0495620_0201908_391_705 92
1458 3300046516 Ga0495628_0053224 Ga0495628_0053224_2029_2343 92
1459 3300046516 Ga0495628_0444358 Ga0495628_0444358_353_667 92
1460 3300046516 Ga0495628_0515124 Ga0495628_0515124_394_708 92
1461 3300046516 Ga0495628_0613999 Ga0495628_0613999_379_693 92
1462 3300046516 Ga0495628_0658116 Ga0495628_0658116_380_694 92
1463 3300046516 Ga0495628_0891223 Ga0495628_0891223_148_462 92
1464 3300046517 Ga0495630_0142413 Ga0495630_0142413_539_853 92
1465 3300046517 Ga0495630_0839996 Ga0495630_0839996_241_555 92
1466 3300046517 Ga0495630_1387024 Ga0495630_1387024_14_328 92
1467 3300046518 Ga0495631_0279853 Ga0495631_0279853_53_367 92
1468 3300046518 Ga0495631_0504875 Ga0495631_0504875_65_379 92
1469 3300046519 Ga0495632_0127779 Ga0495632_0127779_302_616 92
1470 3300046519 Ga0495632_0280483 Ga0495632_0280483_180_494 92
1471 3300046520 Ga0495637_0059040 Ga0495637_0059040_938_1252 92
1472 3300046522 Ga0495643_0043237 Ga0495643_0043237_1887_2201 92
1473 3300046522 Ga0495643_0511217 Ga0495643_0511217_169_483 92
1474 3300046523 Ga0495644_0055348 Ga0495644_0055348_389_703 92
1475 3300046523 Ga0495644_0248776 Ga0495644_0248776_41_355 92
1476 3300046523 Ga0495644_0255921 Ga0495644_0255921_353_667 92
1477 3300046524 Ga0495648_0001935 Ga0495648_0001935_16244_16558 92
1478 3300046524 Ga0495648_0109352 Ga0495648_0109352_1174_1488 92
1479 3300046524 Ga0495648_0125390 Ga0495648_0125390_782_1096 92
1480 3300046524 Ga0495648_0170800 Ga0495648_0170800_641_955 92
1481 3300046525 Ga0495663_0368741 Ga0495663_0368741_19_333 92
1482 3300046526 Ga0495666_0103277 Ga0495666_0103277_444_758 92
1483 3300046526 Ga0495666_0125161 Ga0495666_0125161_487_801 92
1484 3300046526 Ga0495666_0170559 Ga0495666_0170559_358_672 92
1485 3300046526 Ga0495666_0385263 Ga0495666_0385263_113_427 92
1486 3300046528 Ga0495642_0110216 Ga0495642_0110216_29_343 92
1487 3300046528 Ga0495642_0469862 Ga0495642_0469862_186_512 92
1488 3300046529 Ga0495652_0091173 Ga0495652_0091173_2124_2438 92
1489 3300046529 Ga0495652_0095349 Ga0495652_0095349_235_549 92
1490 3300046529 Ga0495652_0276179 Ga0495652_0276179_416_730 92
1491 3300046529 Ga0495652_0570558 Ga0495652_0570558_416_730 92
1492 3300046529 Ga0495652_1150276 Ga0495652_1150276_87_401 92
1493 3300046530 Ga0495654_0205185 Ga0495654_0205185_358_672 92
1494 3300046530 Ga0495654_0328003 Ga0495654_0328003_241_555 92
1495 3300046531 Ga0495665_0004495 Ga0495665_0004495_2701_3015 92
1496 3300046531 Ga0495665_0194085 Ga0495665_0194085_376_690 92
1497 3300046533 Ga0495640_0017722 Ga0495640_0017722_4667_4981 92
1498 3300046533 Ga0495640_0129210 Ga0495640_0129210_370_684 92
1499 3300046533 Ga0495640_0257670 Ga0495640_0257670_600_914 92
1500 3300046533 Ga0495640_0395035 Ga0495640_0395035_521_835 92
1501 3300046533 Ga0495640_0395892 Ga0495640_0395892_361_675 92
1502 3300046535 Ga0495586_0030573 Ga0495586_0030573_2206_2520 92
1503 3300046535 Ga0495586_0091344 Ga0495586_0091344_1209_1523 92
1504 3300046535 Ga0495586_0439754 Ga0495586_0439754_242_556 92
1505 3300046535 Ga0495586_0655875 Ga0495586_0655875_213_527 92
1506 3300046536 Ga0495587_0079772 Ga0495587_0079772_950_1264 92
1507 3300046536 Ga0495587_0085463 Ga0495587_0085463_1081_1395 92
1508 3300046536 Ga0495587_0217454 Ga0495587_0217454_601_915 92
1509 3300046537 Ga0495598_0008482 Ga0495598_0008482_747_1061 92
1510 3300046537 Ga0495598_0037702 Ga0495598_0037702_901_1215 92
1511 3300046538 Ga0495609_0249875 Ga0495609_0249875_273_587 92
1512 3300046538 Ga0495609_0270793 Ga0495609_0270793_326_640 92
1513 3300046542 Ga0495597_0034451 Ga0495597_0034451_338_652 92
1514 3300046542 Ga0495597_0198838 Ga0495597_0198838_189_503 92
1515 3300046542 Ga0495597_0308726 Ga0495597_0308726_173_487 92
1516 3300046543 Ga0495645_0012032 Ga0495645_0012032_1676_1990 92
1517 3300046543 Ga0495645_0040592 Ga0495645_0040592_232_546 92
1518 3300046543 Ga0495645_0053051 Ga0495645_0053051_1313_1627 92
1519 3300046557 Ga0495622_0008764 Ga0495622_0008764_4066_4380 92
1520 3300046557 Ga0495622_0127586 Ga0495622_0127586_801_1115 92
1521 3300046557 Ga0495622_0195630 Ga0495622_0195630_351_665 92
1522 3300046557 Ga0495622_0258032 Ga0495622_0258032_56_370 92
1523 3300046557 Ga0495622_0291305 Ga0495622_0291305_48_362 92
1524 3300046558 Ga0495633_0178205 Ga0495633_0178205_507_821 92
1525 3300046559 Ga0495667_0042519 Ga0495667_0042519_277_591 92
1526 3300046559 Ga0495667_0155723 Ga0495667_0155723_885_1199 92
1527 3300046559 Ga0495667_0304533 Ga0495667_0304533_132_446 92
1528 3300046559 Ga0495667_0388614 Ga0495667_0388614_263_577 92
1529 3300046615 Ga0495656_0098490 Ga0495656_0098490_435_749 92
1530 3300046615 Ga0495656_0653277 Ga0495656_0653277_67_381 92
1531 3300046615 Ga0495656_0731037 Ga0495656_0731037_165_479 92
1532 3300046616 Ga0495668_0111225 Ga0495668_0111225_649_963 92
1533 3300046616 Ga0495668_0233854 Ga0495668_0233854_427_741 92
1534 3300046616 Ga0495668_0636142 Ga0495668_0636142_242_556 92
1535 3300046616 Ga0495668_0705322 Ga0495668_0705322_12_326 92
1536 3300046642 Ga0495634_0017993 Ga0495634_0017993_1850_2164 92
1537 3300046642 Ga0495634_0044824 Ga0495634_0044824_2302_2616 92
1538 3300046642 Ga0495634_0053212 Ga0495634_0053212_1119_1433 92
1539 3300046642 Ga0495634_0134675 Ga0495634_0134675_412_726 92
1540 3300046642 Ga0495634_0436994 Ga0495634_0436994_398_712 92
1541 3300046648 Ga0495611_0027142 Ga0495611_0027142_345_659 92
1542 3300046648 Ga0495611_0581225 Ga0495611_0581225_13_327 92
1543 3300046660 Ga0495625_0086245 Ga0495625_0086245_39_353 92
1544 3300046660 Ga0495625_0200240 Ga0495625_0200240_825_1139 92
1545 3300046663 Ga0495635_0016474 Ga0495635_0016474_614_928 92
1546 3300046663 Ga0495635_0036862 Ga0495635_0036862_356_670 92
1547 3300046663 Ga0495635_0052878 Ga0495635_0052878_2382_2696 92
1548 3300046663 Ga0495635_0164552 Ga0495635_0164552_65_379 92
1549 3300046663 Ga0495635_0228928 Ga0495635_0228928_737_1051 92
1550 3300046663 Ga0495635_0618328 Ga0495635_0618328_102_416 92
1551 3300046664 Ga0495659_0016349 Ga0495659_0016349_137_451 92
1552 3300046664 Ga0495659_0057451 Ga0495659_0057451_493_807 92
1553 3300046665 Ga0495661_0130544 Ga0495661_0130544_740_1054 92
1554 3300046665 Ga0495661_0604183 Ga0495661_0604183_61_375 92
1555 3300046674 Ga0495588_0025858 Ga0495588_0025858_2597_2911 92
1556 3300046674 Ga0495588_0064604 Ga0495588_0064604_1456_1770 92
1557 3300046674 Ga0495588_0070929 Ga0495588_0070929_96_410 92
1558 3300046674 Ga0495588_0158872 Ga0495588_0158872_467_781 92
1559 3300046674 Ga0495588_0649852 Ga0495588_0649852_94_408 92
1560 3300046674 Ga0495588_0678106 Ga0495588_0678106_188_502 92
1561 3300046675 Ga0495657_0029899 Ga0495657_0029899_1497_1811 92
1562 3300046675 Ga0495657_0235737 Ga0495657_0235737_416_730 92
1563 3300046675 Ga0495657_0383562 Ga0495657_0383562_51_365 92
1564 3300046675 Ga0495657_0487566 Ga0495657_0487566_342_656 92
1565 3300046675 Ga0495657_0510056 Ga0495657_0510056_36_350 92
1566 3300046678 Ga0495599_0090841 Ga0495599_0090841_395_709 92
1567 3300046678 Ga0495599_0328607 Ga0495599_0328607_123_437 92
1568 3300046678 Ga0495599_0400762 Ga0495599_0400762_138_452 92
1569 3300046678 Ga0495599_0415673 Ga0495599_0415673_272_586 92
1570 3300046679 Ga0495623_0049308 Ga0495623_0049308_1519_1833 92
1571 3300046679 Ga0495623_0066734 Ga0495623_0066734_362_676 92
1572 3300046679 Ga0495623_0302002 Ga0495623_0302002_228_542 92
1573 3300046680 Ga0495646_0009353 Ga0495646_0009353_3260_3574 92
1574 3300046680 Ga0495646_0078131 Ga0495646_0078131_49_363 92
1575 3300046680 Ga0495646_0086060 Ga0495646_0086060_624_938 92
1576 3300046680 Ga0495646_0276317 Ga0495646_0276317_291_605 92
1577 3300046681 Ga0495647_0006072 Ga0495647_0006072_417_731 92
1578 3300046681 Ga0495647_0052540 Ga0495647_0052540_944_1258 92
1579 3300046681 Ga0495647_0084742 Ga0495647_0084742_384_698 92
1580 3300046681 Ga0495647_0219425 Ga0495647_0219425_399_713 92
1581 3300046683 Ga0495658_0001480 Ga0495658_0001480_6938_7252 92
1582 3300046683 Ga0495658_0155047 Ga0495658_0155047_165_479 92
1583 3300046683 Ga0495658_0394310 Ga0495658_0394310_292_606 92
1584 3300046683 Ga0495658_0629352 Ga0495658_0629352_16_330 92
1585 3300046684 Ga0495669_0160017 Ga0495669_0160017_341_655 92
1586 3300046684 Ga0495669_0290611 Ga0495669_0290611_427_741 92
1587 3300046684 Ga0495669_0312118 Ga0495669_0312118_137_451 92
1588 3300046684 Ga0495669_0314871 Ga0495669_0314871_353_667 92
1589 3300046684 Ga0495669_0338924 Ga0495669_0338924_152_466 92
1590 3300046684 Ga0495669_0375930 Ga0495669_0375930_147_461 92
1591 3300046689 Ga0495613_0064217 Ga0495613_0064217_1161_1475 92
1592 3300046689 Ga0495613_0118769 Ga0495613_0118769_113_427 92
1593 3300046689 Ga0495613_0202690 Ga0495613_0202690_195_509 92
1594 3300046689 Ga0495613_0298152 Ga0495613_0298152_606_920 92
1595 3300046689 Ga0495613_0474520 Ga0495613_0474520_416_730 92
1596 3300046689 Ga0495613_0559840 Ga0495613_0559840_39_353 92
1597 3300046690 Ga0495624_0004478 Ga0495624_0004478_4568_4882 92
1598 3300046690 Ga0495624_0019695 Ga0495624_0019695_625_939 92
1599 3300046690 Ga0495624_0036661 Ga0495624_0036661_2487_2801 92
1600 3300046690 Ga0495624_0283306 Ga0495624_0283306_398_712 92
1601 3300046691 Ga0495670_0055606 Ga0495670_0055606_770_1084 92
1602 3300046691 Ga0495670_0330089 Ga0495670_0330089_430_744 92
1603 3300046691 Ga0495670_0801292 Ga0495670_0801292_145_459 92
1604 3300046692 Ga0495671_0111586 Ga0495671_0111586_973_1287 92
1605 3300046692 Ga0495671_0361782 Ga0495671_0361782_157_471 92
1606 3300046692 Ga0495671_0375260 Ga0495671_0375260_355_669 92
1607 3300046694 Ga0495649_0190494 Ga0495649_0190494_447_761 92
1608 3300046694 Ga0495649_0309190 Ga0495649_0309190_52_366 92
1609 3300046694 Ga0495649_0424727 Ga0495649_0424727_84_398 92
1610 3300046694 Ga0495649_0524010 Ga0495649_0524010_162_476 92
1611 3300046794 Ga0495589_0117142 Ga0495589_0117142_621_935 92
1612 3300046794 Ga0495589_0530006 Ga0495589_0530006_54_368 92
1613 3300046794 Ga0495589_0549580 Ga0495589_0549580_14_328 92
1614 3300046809 Ga0495600_0009515 Ga0495600_0009515_4925_5239 92
1615 3300046809 Ga0495600_0048205 Ga0495600_0048205_372_686 92
1616 3300046809 Ga0495600_0798386 Ga0495600_0798386_81_395 92
1617 3300046810 Ga0495660_0095619 Ga0495660_0095619_1197_1511 92
1618 3300046810 Ga0495660_0448085 Ga0495660_0448085_140_454 92
1619 3300047315 Ga0495581_0007052 Ga0495581_0007052_5559_5873 92
1620 3300047315 Ga0495581_0068636 Ga0495581_0068636_1155_1469 92
1621 3300047315 Ga0495581_0266151 Ga0495581_0266151_46_360 92
1622 3300047315 Ga0495581_0347659 Ga0495581_0347659_338_652 92
1623 3300047315 Ga0495581_0353108 Ga0495581_0353108_407_721 92
1624 3300047315 Ga0495581_0568676 Ga0495581_0568676_259_573 92
1625 3300047317 Ga0495604_0116426 Ga0495604_0116426_1465_1779 92
1626 3300047317 Ga0495604_0240854 Ga0495604_0240854_727_1041 92
1627 3300047317 Ga0495604_0398690 Ga0495604_0398690_416_730 92
1628 3300047317 Ga0495604_0458805 Ga0495604_0458805_416_730 92
1629 3300047317 Ga0495604_0490288 Ga0495604_0490288_203_517 92
1630 3300047318 Ga0495636_0050467 Ga0495636_0050467_770_1084 92
1631 3300047318 Ga0495636_0592365 Ga0495636_0592365_192_506 92
1632 3300047319 Ga0495674_0010137 Ga0495674_0010137_1070_1384 92
1633 3300047319 Ga0495674_0081704 Ga0495674_0081704_2239_2553 92
1634 3300047319 Ga0495674_0134702 Ga0495674_0134702_895_1209 92
1635 3300047319 Ga0495674_0438617 Ga0495674_0438617_579_893 92
1636 3300047319 Ga0495674_0813268 Ga0495674_0813268_230_544 92
1637 3300047319 Ga0495674_1254458 Ga0495674_1254458_161_475 92
1638 3300047320 Ga0495672_0044069 Ga0495672_0044069_1050_1364 92
1639 3300047320 Ga0495672_0130496 Ga0495672_0130496_237_551 92
1640 3300047320 Ga0495672_0139169 Ga0495672_0139169_373_687 92
1641 3300047320 Ga0495672_0180371 Ga0495672_0180371_263_577 92
1642 3300047320 Ga0495672_0288614 Ga0495672_0288614_140_454 92
1643 3300047320 Ga0495672_0454984 Ga0495672_0454984_102_416 92
1644 3300047321 Ga0495676_0029937 Ga0495676_0029937_2729_3043 92
1645 3300047321 Ga0495676_0036685 Ga0495676_0036685_3028_3342 92
1646 3300047321 Ga0495676_0055671 Ga0495676_0055671_992_1306 92
1647 3300047321 Ga0495676_0301829 Ga0495676_0301829_601_915 92
1648 3300047321 Ga0495676_0519544 Ga0495676_0519544_308_622 92
1649 3300047322 Ga0495680_0027673 Ga0495680_0027673_1577_1891 92
1650 3300047322 Ga0495680_0194616 Ga0495680_0194616_123_437 92
1651 3300047322 Ga0495680_0389865 Ga0495680_0389865_156_470 92
1652 3300047323 Ga0495683_0199044 Ga0495683_0199044_485_799 92
1653 3300047323 Ga0495683_0250738 Ga0495683_0250738_48_362 92
1654 3300047323 Ga0495683_0283360 Ga0495683_0283360_266_580 92
1655 3300047443 Ga0495687_016394 Ga0495687_016394_294_608 92
1656 3300047443 Ga0495687_070399 Ga0495687_070399_78_392 92
1657 3300047444 Ga0495675_0009679 Ga0495675_0009679_2487_2801 92
1658 3300047444 Ga0495675_0012730 Ga0495675_0012730_233_547 92
1659 3300047444 Ga0495675_0197399 Ga0495675_0197399_348_662 92
1660 3300047444 Ga0495675_0548639 Ga0495675_0548639_214_528 92
1661 3300047444 Ga0495675_0549429 Ga0495675_0549429_132_446 92
1662 3300047445 Ga0495677_0080230 Ga0495677_0080230_126_440 92
1663 3300047446 Ga0495679_037610 Ga0495679_037610_121_435 92
1664 3300047447 Ga0495685_103339 Ga0495685_103339_353_667 92
1665 3300047469 Ga0495673_0099562 Ga0495673_0099562_450_764 92
1666 3300047469 Ga0495673_0265327 Ga0495673_0265327_299_613 92
1667 3300047470 Ga0495681_0052920 Ga0495681_0052920_615_929 92
1668 3300047471 Ga0495684_0021540 Ga0495684_0021540_2857_3171 92
1669 3300047471 Ga0495684_0063489 Ga0495684_0063489_2180_2494 92
1670 3300047471 Ga0495684_0343071 Ga0495684_0343071_291_605 92
1671 3300047471 Ga0495684_0644112 Ga0495684_0644112_141_455 92
1672 3300047471 Ga0495684_1032330 Ga0495684_1032330_86_400 92
1673 3300047472 Ga0495686_0088051 Ga0495686_0088051_1054_1368 92
1674 3300047472 Ga0495686_0225237 Ga0495686_0225237_692_1006 92
1675 3300047472 Ga0495686_0312070 Ga0495686_0312070_267_581 92
1676 3300047472 Ga0495686_0542913 Ga0495686_0542913_198_512 92
1677 3300047472 Ga0495686_0551847 Ga0495686_0551847_190_504 92
1678 3300047673 Ga0495593_0003980 Ga0495593_0003980_888_1202 92
1679 3300047673 Ga0495593_0025559 Ga0495593_0025559_252_566 92
1680 3300047673 Ga0495593_0135566 Ga0495593_0135566_382_696 92
1681 3300047673 Ga0495593_0140453 Ga0495593_0140453_296_610 92
1682 3300047673 Ga0495593_0178909 Ga0495593_0178909_383_697 92
1683 3300048088 Ga0495602_0038966 Ga0495602_0038966_3462_3776 92
1684 3300048088 Ga0495602_0107504 Ga0495602_0107504_1095_1409 92
1685 3300048088 Ga0495602_0272719 Ga0495602_0272719_421_747 92
1686 3300048088 Ga0495602_0342057 Ga0495602_0342057_72_386 92
1687 3300048089 Ga0495614_0052494 Ga0495614_0052494_980_1294 92
1688 3300048089 Ga0495614_0285635 Ga0495614_0285635_125_439 92
1689 3300048089 Ga0495614_0465810 Ga0495614_0465810_188_502 92
1690 3300048090 Ga0495615_0047031 Ga0495615_0047031_384_698 92
1691 3300048090 Ga0495615_0123619 Ga0495615_0123619_305_619 92
1692 3300048090 Ga0495615_0222431 Ga0495615_0222431_73_387 92
1693 3300048091 Ga0495626_0062838 Ga0495626_0062838_433_747 92
1694 3300048903 Ga0496100_0039043 Ga0496100_0039043_816_1130 92
1695 3300048903 Ga0496100_0068969 Ga0496100_0068969_758_1072 92
1696 3300048903 Ga0496100_0084662 Ga0496100_0084662_193_519 92
1697 3300048903 Ga0496100_0197052 Ga0496100_0197052_358_672 92
1698 3300048903 Ga0496100_0519007 Ga0496100_0519007_273_587 92
1699 3300048903 Ga0496100_0695206 Ga0496100_0695206_357_671 92
1700 3300048903 Ga0496100_0921441 Ga0496100_0921441_307_621 92
1701 3300048903 Ga0496100_1114542 Ga0496100_1114542_110_424 92
1702 3300048904 Ga0496101_0297083 Ga0496101_0297083_881_1195 92
1703 3300048904 Ga0496101_0331031 Ga0496101_0331031_550_864 92
1704 3300048904 Ga0496101_0566373 Ga0496101_0566373_33_359 92
1705 3300048904 Ga0496101_0667136 Ga0496101_0667136_340_654 92
1706 3300048904 Ga0496101_0842777 Ga0496101_0842777_168_482 92
1707 3300048904 Ga0496101_0862026 Ga0496101_0862026_344_658 92
1708 3300048904 Ga0496101_1064781 Ga0496101_1064781_150_464 92
1709 3300048904 Ga0496101_1211317 Ga0496101_1211317_242_556 92
1710 3300048904 Ga0496101_1414080 Ga0496101_1414080_177_491 92
1711 3300048904 Ga0496101_1442181 Ga0496101_1442181_48_362 92
1712 3300048905 Ga0496102_0023539 Ga0496102_0023539_3245_3559 92
1713 3300048905 Ga0496102_0027963 Ga0496102_0027963_1565_1879 92
1714 3300048905 Ga0496102_0242470 Ga0496102_0242470_547_861 92
1715 3300048905 Ga0496102_0530729 Ga0496102_0530729_372_686 92
1716 3300048905 Ga0496102_0619264 Ga0496102_0619264_13_327 92
1717 3300048905 Ga0496102_0775278 Ga0496102_0775278_422_736 92
1718 3300048905 Ga0496102_1197395 Ga0496102_1197395_217_531 92
1719 3300048905 Ga0496102_1217366 Ga0496102_1217366_56_370 92
1720 3300048905 Ga0496102_1351646 Ga0496102_1351646_250_564 92
1721 3300048905 Ga0496102_1460747 Ga0496102_1460747_253_567 92
1722 3300048905 Ga0496102_1575497 Ga0496102_1575497_29_343 92
1723 3300048906 Ga0496103_0181069 Ga0496103_0181069_120_434 92
1724 3300048906 Ga0496103_0595638 Ga0496103_0595638_271_585 92
1725 3300048906 Ga0496103_0649065 Ga0496103_0649065_83_397 92
1726 3300048906 Ga0496103_0840913 Ga0496103_0840913_241_555 92
1727 3300048907 Ga0496104_0000877 Ga0496104_0000877_15661_15987 92
1728 3300048907 Ga0496104_0023640 Ga0496104_0023640_140_454 92
1729 3300048907 Ga0496104_0072619 Ga0496104_0072619_2831_3145 92
1730 3300048907 Ga0496104_0130045 Ga0496104_0130045_1837_2151 92
1731 3300048907 Ga0496104_0175960 Ga0496104_0175960_1318_1632 92
1732 3300048907 Ga0496104_0328076 Ga0496104_0328076_243_557 92
1733 3300048907 Ga0496104_0464284 Ga0496104_0464284_66_380 92
1734 3300048907 Ga0496104_0676183 Ga0496104_0676183_423_737 92
1735 3300048907 Ga0496104_0737221 Ga0496104_0737221_232_546 92
1736 3300048907 Ga0496104_0929348 Ga0496104_0929348_224_538 92
1737 3300048908 Ga0496105_0005725 Ga0496105_0005725_7601_7915 92
1738 3300048908 Ga0496105_0051572 Ga0496105_0051572_1901_2215 92
1739 3300048908 Ga0496105_0088669 Ga0496105_0088669_266_580 92
1740 3300048908 Ga0496105_0100695 Ga0496105_0100695_1854_2168 92
1741 3300048908 Ga0496105_0106208 Ga0496105_0106208_1479_1805 92
1742 3300048908 Ga0496105_0147653 Ga0496105_0147653_1239_1553 92
1743 3300048908 Ga0496105_0366967 Ga0496105_0366967_607_921 92
1744 3300048908 Ga0496105_1122603 Ga0496105_1122603_57_371 92
1745 3300048908 Ga0496105_1281524 Ga0496105_1281524_212_526 92
1746 3300048908 Ga0496105_1283258 Ga0496105_1283258_181_495 92
1747 3300048909 Ga0496106_0012368 Ga0496106_0012368_2014_2328 92
1748 3300048909 Ga0496106_0032905 Ga0496106_0032905_1356_1670 92
1749 3300048909 Ga0496106_0107991 Ga0496106_0107991_58_372 92
1750 3300048909 Ga0496106_0148888 Ga0496106_0148888_1472_1786 92
1751 3300048909 Ga0496106_0333211 Ga0496106_0333211_233_547 92
1752 3300048909 Ga0496106_0352298 Ga0496106_0352298_767_1081 92
1753 3300048909 Ga0496106_0358817 Ga0496106_0358817_408_722 92
1754 3300048909 Ga0496106_0679584 Ga0496106_0679584_49_375 92
1755 3300048909 Ga0496106_0694049 Ga0496106_0694049_90_404 92
1756 3300048909 Ga0496106_1082734 Ga0496106_1082734_260_574 92
1757 3300048910 Ga0496107_0005639 Ga0496107_0005639_374_688 92
1758 3300048910 Ga0496107_0051127 Ga0496107_0051127_1772_2086 92
1759 3300048910 Ga0496107_0074113 Ga0496107_0074113_544_858 92
1760 3300048910 Ga0496107_0101173 Ga0496107_0101173_466_780 92
1761 3300048910 Ga0496107_0146748 Ga0496107_0146748_267_581 92
1762 3300048910 Ga0496107_0151158 Ga0496107_0151158_155_469 92
1763 3300048910 Ga0496107_0244747 Ga0496107_0244747_44_358 92
1764 3300048910 Ga0496107_0343706 Ga0496107_0343706_14_328 92
1765 3300048910 Ga0496107_0397932 Ga0496107_0397932_268_582 92
1766 3300048910 Ga0496107_1203465 Ga0496107_1203465_42_356 92
1767 3300048911 Ga0496108_0002766 Ga0496108_0002766_5884_6198 92
1768 3300048911 Ga0496108_0021472 Ga0496108_0021472_2548_2862 92
1769 3300048911 Ga0496108_0051723 Ga0496108_0051723_3062_3376 92
1770 3300048911 Ga0496108_0093770 Ga0496108_0093770_187_501 92
1771 3300048911 Ga0496108_0165215 Ga0496108_0165215_1145_1459 92
1772 3300048911 Ga0496108_0281941 Ga0496108_0281941_667_981 92
1773 3300048911 Ga0496108_0402883 Ga0496108_0402883_293_619 92
1774 3300048911 Ga0496108_0819446 Ga0496108_0819446_197_511 92
1775 3300048911 Ga0496108_0900180 Ga0496108_0900180_229_543 92
1776 3300048912 Ga0496109_0000518 Ga0496109_0000518_18559_18873 92
1777 3300048912 Ga0496109_0046305 Ga0496109_0046305_3598_3912 92
1778 3300048912 Ga0496109_0124240 Ga0496109_0124240_324_638 92
1779 3300048912 Ga0496109_0219596 Ga0496109_0219596_24_338 92
1780 3300048912 Ga0496109_0493832 Ga0496109_0493832_77_403 92
1781 3300048912 Ga0496109_0700132 Ga0496109_0700132_270_584 92
1782 3300048912 Ga0496109_1208619 Ga0496109_1208619_160_474 92
1783 3300048913 Ga0496110_0008327 Ga0496110_0008327_3489_3815 92
1784 3300048913 Ga0496110_0038155 Ga0496110_0038155_1526_1840 92
1785 3300048913 Ga0496110_0047078 Ga0496110_0047078_3063_3377 92
1786 3300048913 Ga0496110_0055961 Ga0496110_0055961_2698_3012 92
1787 3300048913 Ga0496110_0069967 Ga0496110_0069967_1825_2139 92
1788 3300048913 Ga0496110_0292978 Ga0496110_0292978_886_1200 92
1789 3300048913 Ga0496110_0530555 Ga0496110_0530555_66_380 92
1790 3300048913 Ga0496110_0560529 Ga0496110_0560529_112_438 92
1791 3300048913 Ga0496110_0614356 Ga0496110_0614356_190_504 92
1792 3300048913 Ga0496110_0919130 Ga0496110_0919130_31_345 92
1793 3300048914 Ga0496111_0065502 Ga0496111_0065502_422_736 92
1794 3300048914 Ga0496111_0077925 Ga0496111_0077925_1352_1666 92
1795 3300048914 Ga0496111_0165286 Ga0496111_0165286_21_335 92
1796 3300048914 Ga0496111_0273704 Ga0496111_0273704_449_763 92
1797 3300048914 Ga0496111_0437438 Ga0496111_0437438_289_603 92
1798 3300048915 Ga0496112_0000021 Ga0496112_0000021_5878_6192 92
1799 3300048915 Ga0496112_0049260 Ga0496112_0049260_1897_2211 92
1800 3300048915 Ga0496112_0049696 Ga0496112_0049696_2349_2663 92
1801 3300048915 Ga0496112_0055107 Ga0496112_0055107_3288_3602 92
1802 3300048915 Ga0496112_0114417 Ga0496112_0114417_1689_2003 92
1803 3300048915 Ga0496112_0126745 Ga0496112_0126745_2043_2357 92
1804 3300048915 Ga0496112_0183263 Ga0496112_0183263_392_706 92
1805 3300048915 Ga0496112_0490475 Ga0496112_0490475_224_538 92
1806 3300048915 Ga0496112_0493299 Ga0496112_0493299_242_556 92
1807 3300048915 Ga0496112_0553001 Ga0496112_0553001_615_929 92
1808 3300048915 Ga0496112_0625591 Ga0496112_0625591_443_769 92
1809 3300048915 Ga0496112_1606466 Ga0496112_1606466_192_518 92
1810 3300048916 Ga0496113_0062546 Ga0496113_0062546_752_1066 92
1811 3300048916 Ga0496113_0073033 Ga0496113_0073033_913_1227 92
1812 3300048916 Ga0496113_0082457 Ga0496113_0082457_1705_2019 92
1813 3300048916 Ga0496113_0082707 Ga0496113_0082707_1654_1968 92
1814 3300048916 Ga0496113_0151705 Ga0496113_0151705_1291_1605 92
1815 3300048916 Ga0496113_0405610 Ga0496113_0405610_293_607 92
1816 3300048916 Ga0496113_0421286 Ga0496113_0421286_411_725 92
1817 3300048916 Ga0496113_0616776 Ga0496113_0616776_245_571 92
1818 3300048916 Ga0496113_0648266 Ga0496113_0648266_159_473 92
1819 3300048916 Ga0496113_0835767 Ga0496113_0835767_18_332 92
1820 3300048917 Ga0496114_0095538 Ga0496114_0095538_1795_2109 92
1821 3300048917 Ga0496114_0156258 Ga0496114_0156258_258_572 92
1822 3300048917 Ga0496114_0199460 Ga0496114_0199460_1125_1439 92
1823 3300048917 Ga0496114_0619389 Ga0496114_0619389_418_732 92
1824 3300048917 Ga0496114_0621935 Ga0496114_0621935_168_482 92
1825 3300048917 Ga0496114_0874604 Ga0496114_0874604_100_414 92
1826 3300048917 Ga0496114_0992873 Ga0496114_0992873_193_507 92
1827 3300048917 Ga0496114_1086462 Ga0496114_1086462_129_443 92
1828 3300048918 Ga0496115_0004922 Ga0496115_0004922_1459_1773 92
1829 3300048918 Ga0496115_0028688 Ga0496115_0028688_2243_2557 92
1830 3300048918 Ga0496115_0031262 Ga0496115_0031262_2495_2809 92
1831 3300048918 Ga0496115_0090300 Ga0496115_0090300_768_1082 92
1832 3300048918 Ga0496115_0129152 Ga0496115_0129152_1562_1876 92
1833 3300048918 Ga0496115_0166941 Ga0496115_0166941_994_1308 92
1834 3300048918 Ga0496115_0431587 Ga0496115_0431587_620_934 92
1835 3300048918 Ga0496115_0492973 Ga0496115_0492973_510_836 92
1836 3300048918 Ga0496115_0505356 Ga0496115_0505356_221_535 92
1837 3300048918 Ga0496115_0590189 Ga0496115_0590189_437_751 92
1838 3300048918 Ga0496115_0843172 Ga0496115_0843172_41_355 92
1839 3300048918 Ga0496115_0891278 Ga0496115_0891278_40_354 92
1840 3300048918 Ga0496115_0938486 Ga0496115_0938486_75_389 92
1841 3300048919 Ga0496116_0050868 Ga0496116_0050868_880_1194 92
1842 3300048919 Ga0496116_0181295 Ga0496116_0181295_384_698 92
1843 3300048919 Ga0496116_0349606 Ga0496116_0349606_229_543 92
1844 3300048919 Ga0496116_0455360 Ga0496116_0455360_106_420 92
1845 3300048920 Ga0496117_0152534 Ga0496117_0152534_544_858 92
1846 3300048920 Ga0496117_0165645 Ga0496117_0165645_917_1231 92
1847 3300048920 Ga0496117_0190283 Ga0496117_0190283_352_666 92
1848 3300048921 Ga0496118_0010277 Ga0496118_0010277_8196_8510 92
1849 3300048921 Ga0496118_0038146 Ga0496118_0038146_1888_2202 92
1850 3300048921 Ga0496118_0057391 Ga0496118_0057391_1801_2115 92
1851 3300048921 Ga0496118_0112374 Ga0496118_0112374_536_850 92
1852 3300048921 Ga0496118_0188917 Ga0496118_0188917_747_1061 92
1853 3300048921 Ga0496118_0206949 Ga0496118_0206949_423_737 92
1854 3300048921 Ga0496118_0448751 Ga0496118_0448751_15_329 92
1855 3300048922 Ga0496119_0061766 Ga0496119_0061766_1170_1484 92
1856 3300048922 Ga0496119_0099346 Ga0496119_0099346_916_1230 92
1857 3300048922 Ga0496119_0163200 Ga0496119_0163200_262_576 92
1858 3300048922 Ga0496119_0166467 Ga0496119_0166467_266_580 92
1859 3300048922 Ga0496119_0303497 Ga0496119_0303497_328_642 92
1860 3300048923 Ga0496120_0028214 Ga0496120_0028214_2075_2389 92
1861 3300048923 Ga0496120_0106077 Ga0496120_0106077_719_1033 92
1862 3300048923 Ga0496120_0193413 Ga0496120_0193413_242_556 92
1863 3300048923 Ga0496120_0259725 Ga0496120_0259725_206_520 92
1864 3300048923 Ga0496120_0332694 Ga0496120_0332694_330_644 92
1865 3300048923 Ga0496120_0494569 Ga0496120_0494569_56_370 92
1866 3300048924 Ga0496121_0002196 Ga0496121_0002196_16324_16638 92
1867 3300048924 Ga0496121_0012437 Ga0496121_0012437_8102_8416 92
1868 3300048924 Ga0496121_0018239 Ga0496121_0018239_5502_5816 92
1869 3300048924 Ga0496121_0062541 Ga0496121_0062541_135_449 92
1870 3300048924 Ga0496121_0126270 Ga0496121_0126270_1496_1810 92
1871 3300048924 Ga0496121_0175710 Ga0496121_0175710_272_586 92
1872 3300048924 Ga0496121_0291074 Ga0496121_0291074_376_690 92
1873 3300048924 Ga0496121_0351140 Ga0496121_0351140_67_381 92
1874 3300048924 Ga0496121_0370802 Ga0496121_0370802_217_531 92
1875 3300048924 Ga0496121_0495791 Ga0496121_0495791_147_461 92
1876 3300048924 Ga0496121_0568624 Ga0496121_0568624_331_645 92
1877 3300048924 Ga0496121_0603752 Ga0496121_0603752_352_666 92
1878 3300048924 Ga0496121_0672680 Ga0496121_0672680_260_574 92
1879 3300048924 Ga0496121_0732233 Ga0496121_0732233_11_325 92
1880 3300048925 Ga0496122_0081132 Ga0496122_0081132_416_730 92
1881 3300048925 Ga0496122_0146403 Ga0496122_0146403_16_330 92
1882 3300048925 Ga0496122_0511361 Ga0496122_0511361_68_382 92
1883 3300048925 Ga0496122_0546897 Ga0496122_0546897_26_340 92
1884 3300048926 Ga0496123_0210393 Ga0496123_0210393_424_738 92
1885 3300048926 Ga0496123_0333751 Ga0496123_0333751_163_477 92
1886 3300048927 Ga0496124_0004199 Ga0496124_0004199_373_687 92
1887 3300048927 Ga0496124_0046215 Ga0496124_0046215_202_516 92
1888 3300048927 Ga0496124_0166989 Ga0496124_0166989_853_1167 92
1889 3300048927 Ga0496124_0323031 Ga0496124_0323031_651_965 92
1890 3300048927 Ga0496124_0723865 Ga0496124_0723865_15_329 92
1891 3300048927 Ga0496124_0730369 Ga0496124_0730369_250_564 92
1892 3300048927 Ga0496124_0754444 Ga0496124_0754444_40_354 92
1893 3300048928 Ga0496125_0023890 Ga0496125_0023890_1145_1459 92
1894 3300048928 Ga0496125_0069688 Ga0496125_0069688_1604_1918 92
1895 3300048928 Ga0496125_0164790 Ga0496125_0164790_53_367 92
1896 3300048928 Ga0496125_0246146 Ga0496125_0246146_404_718 92
1897 3300048928 Ga0496125_0518865 Ga0496125_0518865_53_367 92
1898 3300048928 Ga0496125_0520035 Ga0496125_0520035_154_468 92
1899 3300048928 Ga0496125_0683156 Ga0496125_0683156_13_327 92
1900 3300048928 Ga0496125_0694689 Ga0496125_0694689_123_437 92
1901 3300048929 Ga0496126_0052986 Ga0496126_0052986_1819_2133 92
1902 3300048929 Ga0496126_0055514 Ga0496126_0055514_686_1000 92
1903 3300048929 Ga0496126_0056669 Ga0496126_0056669_1554_1868 92
1904 3300048929 Ga0496126_0087077 Ga0496126_0087077_173_487 92
1905 3300048929 Ga0496126_0135399 Ga0496126_0135399_1118_1432 92
1906 3300048929 Ga0496126_0138430 Ga0496126_0138430_1667_1981 92
1907 3300048929 Ga0496126_0168420 Ga0496126_0168420_796_1110 92
1908 3300048929 Ga0496126_0257980 Ga0496126_0257980_1111_1425 92
1909 3300048929 Ga0496126_0329911 Ga0496126_0329911_774_1088 92
1910 3300048929 Ga0496126_0470654 Ga0496126_0470654_280_594 92
1911 3300048929 Ga0496126_0636095 Ga0496126_0636095_395_709 92
1912 3300048929 Ga0496126_0675163 Ga0496126_0675163_11_325 92
1913 3300048929 Ga0496126_0692963 Ga0496126_0692963_56_370 92
1914 3300048929 Ga0496126_0871056 Ga0496126_0871056_297_611 92
1915 3300048929 Ga0496126_1380950 Ga0496126_1380950_139_453 92
1916 3300049127 Ga0501306_040697 Ga0501306_040697_353_673 92
1917 3300049128 Ga0501308_010973 Ga0501308_010973_25_345 92
1918 3300049161 Ga0501305_002606 Ga0501305_002606_1448_1768 92
1919 3300049162 Ga0501307_001064 Ga0501307_001064_1072_1392 92
1920 3300049459 Ga0495678_193166 Ga0495678_193166_286_600 92
1921 3300049460 Ga0495682_0007189 Ga0495682_0007189_844_1158 92
1922 3300049460 Ga0495682_0216548 Ga0495682_0216548_202_516 92
1923 3300049460 Ga0495682_0225706 Ga0495682_0225706_337_651 92
1924 3300049529 Ga0501313_000478 Ga0501313_000478_1449_1769 92
1925 3300049530 Ga0501314_001624 Ga0501314_001624_1140_1460 92
1926 3300049531 Ga0501315_001006 Ga0501315_001006_236_556 92
1927 3300049532 Ga0501316_008607 Ga0501316_008607_25_345 92
1928 3300049533 Ga0501317_003139 Ga0501317_003139_596_916 92
1929 3300049533 Ga0501317_053939 Ga0501317_053939_87_407 92
1930 3300049534 Ga0501318_000289 Ga0501318_000289_330_650 92
1931 3300049534 Ga0501318_042471 Ga0501318_042471_185_505 92
1932 3300049536 Ga0501320_006660 Ga0501320_006660_32_352 92
1933 3300049537 Ga0501321_003608 Ga0501321_003608_930_1250 92
1934 3300049540 Ga0501324_013372 Ga0501324_013372_406_726 92
1935 3300049541 Ga0501325_001022 Ga0501325_001022_891_1211 92
1936 3300049541 Ga0501325_027194 Ga0501325_027194_272_592 92
1937 3300049551 Ga0501335_004292 Ga0501335_004292_181_501 92
1938 3300049568 Ga0501031_0032969 Ga0501031_0032969_2798_3112 92
1939 3300049568 Ga0501031_0043134 Ga0501031_0043134_2097_2411 92
1940 3300049568 Ga0501031_0106279 Ga0501031_0106279_400_714 92
1941 3300049568 Ga0501031_0106490 Ga0501031_0106490_355_669 92
1942 3300049568 Ga0501031_0293338 Ga0501031_0293338_386_700 92
1943 3300049569 Ga0501032_0008814 Ga0501032_0008814_1138_1452 92
1944 3300049569 Ga0501032_0012346 Ga0501032_0012346_3646_3960 92
1945 3300049569 Ga0501032_0080615 Ga0501032_0080615_1318_1632 92
1946 3300049569 Ga0501032_0480145 Ga0501032_0480145_160_486 92
1947 3300049569 Ga0501032_0527601 Ga0501032_0527601_56_370 92
1948 3300049569 Ga0501032_0646720 Ga0501032_0646720_74_388 92
1949 3300049570 Ga0501033_0000094 Ga0501033_0000094_78600_78914 92
1950 3300049570 Ga0501033_0003899 Ga0501033_0003899_1478_1792 92
1951 3300049570 Ga0501033_0058637 Ga0501033_0058637_78_392 92
1952 3300049570 Ga0501033_0062277 Ga0501033_0062277_1678_2004 92
1953 3300049570 Ga0501033_0070423 Ga0501033_0070423_1768_2082 92
1954 3300049570 Ga0501033_0549454 Ga0501033_0549454_247_561 92
1955 3300049571 Ga0501034_0000021 Ga0501034_0000021_5873_6187 92
1956 3300049571 Ga0501034_0058496 Ga0501034_0058496_3476_3790 92
1957 3300049571 Ga0501034_0064071 Ga0501034_0064071_2917_3231 92
1958 3300049571 Ga0501034_0150472 Ga0501034_0150472_672_986 92
1959 3300049571 Ga0501034_0341828 Ga0501034_0341828_23_337 92
1960 3300049571 Ga0501034_0490261 Ga0501034_0490261_560_874 92
1961 3300049572 Ga0501036_0001704 Ga0501036_0001704_10947_11261 92
1962 3300049572 Ga0501036_0025460 Ga0501036_0025460_4383_4697 92
1963 3300049572 Ga0501036_0103003 Ga0501036_0103003_400_714 92
1964 3300049572 Ga0501036_0127385 Ga0501036_0127385_1199_1525 92
1965 3300049572 Ga0501036_0341053 Ga0501036_0341053_266_580 92
1966 3300049572 Ga0501036_1227589 Ga0501036_1227589_57_371 92
1967 3300049573 Ga0501037_0000450 Ga0501037_0000450_26518_26832 92
1968 3300049573 Ga0501037_0043209 Ga0501037_0043209_253_567 92
1969 3300049573 Ga0501037_0055533 Ga0501037_0055533_2388_2702 92
1970 3300049573 Ga0501037_0181614 Ga0501037_0181614_645_959 92
1971 3300049573 Ga0501037_0280298 Ga0501037_0280298_543_857 92
1972 3300049573 Ga0501037_0372250 Ga0501037_0372250_614_928 92
1973 3300049573 Ga0501037_0758159 Ga0501037_0758159_224_550 92
1974 3300049574 Ga0501038_0000052 Ga0501038_0000052_5886_6200 92
1975 3300049574 Ga0501038_0002105 Ga0501038_0002105_17798_18112 92
1976 3300049574 Ga0501038_0012441 Ga0501038_0012441_4455_4769 92
1977 3300049574 Ga0501038_0193104 Ga0501038_0193104_408_722 92
1978 3300049574 Ga0501038_0217309 Ga0501038_0217309_1119_1445 92
1979 3300049574 Ga0501038_0226561 Ga0501038_0226561_573_887 92
1980 3300049574 Ga0501038_0715359 Ga0501038_0715359_421_735 92
1981 3300049575 Ga0501039_0000549 Ga0501039_0000549_5758_6072 92
1982 3300049575 Ga0501039_0054081 Ga0501039_0054081_2484_2798 92
1983 3300049575 Ga0501039_0059666 Ga0501039_0059666_396_710 92
1984 3300049575 Ga0501039_0268213 Ga0501039_0268213_978_1292 92
1985 3300049575 Ga0501039_0730827 Ga0501039_0730827_403_717 92
1986 3300049575 Ga0501039_0911450 Ga0501039_0911450_162_488 92
1987 3300049576 Ga0501040_0147552 Ga0501040_0147552_812_1126 92
1988 3300049576 Ga0501040_0476983 Ga0501040_0476983_547_861 92
1989 3300049576 Ga0501040_0649790 Ga0501040_0649790_322_636 92
1990 3300049578 Ga0501042_0024330 Ga0501042_0024330_2456_2770 92
1991 3300049578 Ga0501042_0115203 Ga0501042_0115203_461_775 92
1992 3300049578 Ga0501042_0493838 Ga0501042_0493838_280_594 92
1993 3300049578 Ga0501042_0963573 Ga0501042_0963573_40_366 92
1994 3300049578 Ga0501042_1300388 Ga0501042_1300388_109_423 92
1995 3300049579 Ga0501043_0005051 Ga0501043_0005051_4512_4826 92
1996 3300049579 Ga0501043_0019357 Ga0501043_0019357_3805_4119 92
1997 3300049579 Ga0501043_0053373 Ga0501043_0053373_2410_2736 92
1998 3300049579 Ga0501043_0054560 Ga0501043_0054560_1895_2209 92
1999 3300049579 Ga0501043_0073700 Ga0501043_0073700_75_389 92
2000 3300049579 Ga0501043_0700772 Ga0501043_0700772_179_505 92
2001 3300049580 Ga0501046_0002237 Ga0501046_0002237_5886_6200 92
2002 3300049580 Ga0501046_0031427 Ga0501046_0031427_575_889 92
2003 3300049580 Ga0501046_0041545 Ga0501046_0041545_685_999 92
2004 3300049580 Ga0501046_0099560 Ga0501046_0099560_440_754 92
2005 3300049580 Ga0501046_0314356 Ga0501046_0314356_150_476 92
2006 3300049580 Ga0501046_0682521 Ga0501046_0682521_148_462 92
2007 3300049581 Ga0501047_0005487 Ga0501047_0005487_4152_4466 92
2008 3300049581 Ga0501047_0015758 Ga0501047_0015758_1012_1326 92
2009 3300049581 Ga0501047_0017348 Ga0501047_0017348_5886_6200 92
2010 3300049581 Ga0501047_0096357 Ga0501047_0096357_1483_1809 92
2011 3300049581 Ga0501047_0321371 Ga0501047_0321371_23_337 92
2012 3300049581 Ga0501047_0833261 Ga0501047_0833261_359_673 92
2013 3300049581 Ga0501047_1140588 Ga0501047_1140588_82_396 92
2014 3300049582 Ga0501048_0001862 Ga0501048_0001862_9807_10121 92
2015 3300049582 Ga0501048_0014555 Ga0501048_0014555_2556_2870 92
2016 3300049582 Ga0501048_0038901 Ga0501048_0038901_378_692 92
2017 3300049582 Ga0501048_0068927 Ga0501048_0068927_188_502 92
2018 3300049582 Ga0501048_0210552 Ga0501048_0210552_665_991 92
2019 3300049582 Ga0501048_0308921 Ga0501048_0308921_687_1013 92
2020 3300049582 Ga0501048_0575224 Ga0501048_0575224_321_635 92
2021 3300049582 Ga0501048_1220341 Ga0501048_1220341_203_517 92
2022 3300049583 Ga0501067_0001840 Ga0501067_0001840_5263_5577 92
2023 3300049583 Ga0501067_0006170 Ga0501067_0006170_562_876 92
2024 3300049583 Ga0501067_0159624 Ga0501067_0159624_900_1214 92
2025 3300049583 Ga0501067_0416611 Ga0501067_0416611_382_696 92
2026 3300049583 Ga0501067_0546877 Ga0501067_0546877_174_488 92
2027 3300049584 Ga0501068_0001049 Ga0501068_0001049_6355_6669 92
2028 3300049584 Ga0501068_0005350 Ga0501068_0005350_6439_6753 92
2029 3300049584 Ga0501068_0068839 Ga0501068_0068839_123_437 92
2030 3300049584 Ga0501068_0625969 Ga0501068_0625969_205_528 92
2031 3300049584 Ga0501068_1130676 Ga0501068_1130676_147_461 92
2032 3300049585 Ga0501069_0092719 Ga0501069_0092719_1039_1353 92
2033 3300049585 Ga0501069_0102505 Ga0501069_0102505_1057_1371 92
2034 3300049585 Ga0501069_0123493 Ga0501069_0123493_1108_1422 92
2035 3300049585 Ga0501069_0174624 Ga0501069_0174624_784_1098 92
2036 3300049585 Ga0501069_0299063 Ga0501069_0299063_432_746 92
2037 3300049585 Ga0501069_0505109 Ga0501069_0505109_72_398 92
2038 3300049585 Ga0501069_0755810 Ga0501069_0755810_168_482 92
2039 3300049586 Ga0501070_0025506 Ga0501070_0025506_4059_4373 92
2040 3300049586 Ga0501070_0049842 Ga0501070_0049842_1094_1408 92
2041 3300049586 Ga0501070_0073534 Ga0501070_0073534_401_715 92
2042 3300049586 Ga0501070_0158650 Ga0501070_0158650_623_949 92
2043 3300049586 Ga0501070_0166019 Ga0501070_0166019_1094_1408 92
2044 3300049586 Ga0501070_0265466 Ga0501070_0265466_687_1001 92
2045 3300049586 Ga0501070_0417253 Ga0501070_0417253_702_1016 92
2046 3300049586 Ga0501070_0686722 Ga0501070_0686722_406_720 92
2047 3300049586 Ga0501070_0975956 Ga0501070_0975956_139_465 92
2048 3300049587 Ga0501071_0014068 Ga0501071_0014068_787_1101 92
2049 3300049587 Ga0501071_0093574 Ga0501071_0093574_254_580 92
2050 3300049587 Ga0501071_0441898 Ga0501071_0441898_609_923 92
2051 3300049587 Ga0501071_0602468 Ga0501071_0602468_284_610 92
2052 3300049587 Ga0501071_0741637 Ga0501071_0741637_87_410 92
2053 3300049587 Ga0501071_0905424 Ga0501071_0905424_193_507 92
2054 3300049588 Ga0501072_0002634 Ga0501072_0002634_2853_3167 92
2055 3300049588 Ga0501072_0325324 Ga0501072_0325324_530_856 92
2056 3300049588 Ga0501072_0506713 Ga0501072_0506713_376_690 92
2057 3300049588 Ga0501072_0627657 Ga0501072_0627657_357_671 92
2058 3300049589 Ga0501073_0000597 Ga0501073_0000597_19246_19560 92
2059 3300049589 Ga0501073_0258545 Ga0501073_0258545_76_390 92
2060 3300049589 Ga0501073_0333901 Ga0501073_0333901_349_663 92
2061 3300049589 Ga0501073_0484297 Ga0501073_0484297_148_462 92
2062 3300049589 Ga0501073_1070015 Ga0501073_1070015_229_543 92
2063 3300049590 Ga0501074_0000285 Ga0501074_0000285_4428_4742 92
2064 3300049590 Ga0501074_0015922 Ga0501074_0015922_957_1271 92
2065 3300049590 Ga0501074_0097677 Ga0501074_0097677_203_517 92
2066 3300049590 Ga0501074_0472800 Ga0501074_0472800_265_579 92
2067 3300049590 Ga0501074_0505575 Ga0501074_0505575_383_697 92
2068 3300049590 Ga0501074_0554274 Ga0501074_0554274_402_716 92
2069 3300049591 Ga0501075_0070033 Ga0501075_0070033_2155_2481 92
2070 3300049591 Ga0501075_0122155 Ga0501075_0122155_441_767 92
2071 3300049591 Ga0501075_1260807 Ga0501075_1260807_136_450 92
2072 3300049592 Ga0501076_0037512 Ga0501076_0037512_3322_3648 92
2073 3300049592 Ga0501076_0095532 Ga0501076_0095532_241_567 92
2074 3300049592 Ga0501076_0121604 Ga0501076_0121604_407_721 92
2075 3300049592 Ga0501076_0253917 Ga0501076_0253917_931_1257 92
2076 3300049592 Ga0501076_0396316 Ga0501076_0396316_146_472 92
2077 3300049592 Ga0501076_0485098 Ga0501076_0485098_280_594 92
2078 3300049592 Ga0501076_1346489 Ga0501076_1346489_92_406 92
2079 3300049592 Ga0501076_1406787 Ga0501076_1406787_147_461 92
2080 3300049593 Ga0501077_0068650 Ga0501077_0068650_1325_1651 92
2081 3300049593 Ga0501077_0227628 Ga0501077_0227628_681_1007 92
2082 3300049593 Ga0501077_0911074 Ga0501077_0911074_62_376 92
2083 3300049741 Ga0501079_0008121 Ga0501079_0008121_4300_4614 92
2084 3300049741 Ga0501079_0553001 Ga0501079_0553001_550_876 92
2085 3300049741 Ga0501079_0990745 Ga0501079_0990745_125_439 92
2086 3300049741 Ga0501079_1264662 Ga0501079_1264662_181_507 92
2087 3300049742 Ga0501080_0001080 Ga0501080_0001080_1985_2299 92
2088 3300049742 Ga0501080_0015400 Ga0501080_0015400_4482_4796 92
2089 3300049742 Ga0501080_0049974 Ga0501080_0049974_176_490 92
2090 3300049742 Ga0501080_1193622 Ga0501080_1193622_149_463 92
2091 3300049743 Ga0501081_0374207 Ga0501081_0374207_360_674 92
2092 3300049743 Ga0501081_0994447 Ga0501081_0994447_188_514 92
2093 3300049744 Ga0501083_0005133 Ga0501083_0005133_2732_3046 92
2094 3300049744 Ga0501083_0022769 Ga0501083_0022769_3539_3853 92
2095 3300049744 Ga0501083_0652007 Ga0501083_0652007_12_338 92
2096 3300049822 Ga0501035_0000255 Ga0501035_0000255_6881_7195 92
2097 3300049822 Ga0501035_0061225 Ga0501035_0061225_2771_3085 92
2098 3300049822 Ga0501035_0075525 Ga0501035_0075525_2357_2671 92
2099 3300049822 Ga0501035_0078226 Ga0501035_0078226_1025_1351 92
2100 3300049822 Ga0501035_0160311 Ga0501035_0160311_64_378 92
2101 3300049822 Ga0501035_0205176 Ga0501035_0205176_139_465 92
2102 3300049822 Ga0501035_0287039 Ga0501035_0287039_341_655 92
2103 3300049822 Ga0501035_0298622 Ga0501035_0298622_321_635 92
2104 3300049823 Ga0501044_0014028 Ga0501044_0014028_5886_6200 92
2105 3300049823 Ga0501044_0018525 Ga0501044_0018525_3329_3643 92
2106 3300049823 Ga0501044_0023029 Ga0501044_0023029_4909_5223 92
2107 3300049823 Ga0501044_0047177 Ga0501044_0047177_4067_4381 92
2108 3300049823 Ga0501044_0161220 Ga0501044_0161220_1580_1906 92
2109 3300049823 Ga0501044_0191585 Ga0501044_0191585_937_1251 92
2110 3300049823 Ga0501044_1498897 Ga0501044_1498897_64_378 92
2111 3300049824 Ga0501045_0008019 Ga0501045_0008019_3437_3751 92
2112 3300049824 Ga0501045_0020723 Ga0501045_0020723_3802_4116 92
2113 3300049824 Ga0501045_0559802 Ga0501045_0559802_205_519 92
2114 3300050489 nmdc:mga03683_366557_c1 nmdc:mga03683_366557_c1_305_619 92
2115 3300050489 nmdc:mga03683_421287_c1 nmdc:mga03683_421287_c1_299_613 92
2116 3300050489 nmdc:mga03683_433762_c1 nmdc:mga03683_433762_c1_12_326 92
2117 3300050490 nmdc:mga03n38_261423_c1 nmdc:mga03n38_261423_c1_456_770 92
2118 3300050490 nmdc:mga03n38_267638_c1 nmdc:mga03n38_267638_c1_277_591 92
2119 3300050490 nmdc:mga03n38_26871_c1 nmdc:mga03n38_26871_c1_650_964 92
2120 3300050490 nmdc:mga03n38_51087_c1 nmdc:mga03n38_51087_c1_328_642 92
2121 3300050490 nmdc:mga03n38_56258_c1 nmdc:mga03n38_56258_c1_36_350 92
2122 3300050490 nmdc:mga03n38_816947_c1 nmdc:mga03n38_816947_c1_24_338 92
2123 3300050491 nmdc:mga00v17_404813_c1 nmdc:mga00v17_404813_c1_494_808 92
2124 3300050491 nmdc:mga00v17_46530_c1 nmdc:mga00v17_46530_c1_693_1007 92
2125 3300050491 nmdc:mga00v17_515394_c1 nmdc:mga00v17_515394_c1_212_526 92
2126 3300050491 nmdc:mga00v17_721988_c1 nmdc:mga00v17_721988_c1_156_470 92
2127 3300050491 nmdc:mga00v17_769614_c1 nmdc:mga00v17_769614_c1_289_603 92
2128 3300050492 nmdc:mga0yw44_11167_c1 nmdc:mga0yw44_11167_c1_3889_4215 92
2129 3300050492 nmdc:mga0yw44_1184017_c1 nmdc:mga0yw44_1184017_c1_107_421 92
2130 3300050492 nmdc:mga0yw44_132659_c1 nmdc:mga0yw44_132659_c1_956_1270 92
2131 3300050492 nmdc:mga0yw44_171528_c1 nmdc:mga0yw44_171528_c1_532_846 92
2132 3300050492 nmdc:mga0yw44_240608_c1 nmdc:mga0yw44_240608_c1_396_710 92
2133 3300050492 nmdc:mga0yw44_42038_c1 nmdc:mga0yw44_42038_c1_1448_1762 92
2134 3300050492 nmdc:mga0yw44_931554_c1 nmdc:mga0yw44_931554_c1_84_398 92
2135 3300050493 nmdc:mga0k408_13277_c1 nmdc:mga0k408_13277_c1_3740_4054 92
2136 3300050494 nmdc:mga06z11_133429_c1 nmdc:mga06z11_133429_c1_593_907 92
2137 3300050494 nmdc:mga06z11_198329_c1 nmdc:mga06z11_198329_c1_237_551 92
2138 3300050494 nmdc:mga06z11_252445_c1 nmdc:mga06z11_252445_c1_263_577 92
2139 3300050494 nmdc:mga06z11_357011_c1 nmdc:mga06z11_357011_c1_303_617 92
2140 3300050494 nmdc:mga06z11_70162_c1 nmdc:mga06z11_70162_c1_256_570 92
2141 3300050495 nmdc:mga04h51_52340_c1 nmdc:mga04h51_52340_c1_682_996 92
2142 3300050496 nmdc:mga07m45_103592_c1 nmdc:mga07m45_103592_c1_913_1227 92
2143 3300050496 nmdc:mga07m45_279190_c1 nmdc:mga07m45_279190_c1_531_845 92
2144 3300050496 nmdc:mga07m45_87295_c1 nmdc:mga07m45_87295_c1_1186_1500 92
2145 3300050507 nmdc:mga05p37_1622265_c1 nmdc:mga05p37_1622265_c1_83_409 92
2146 3300050507 nmdc:mga05p37_587380_c1 nmdc:mga05p37_587380_c1_13_339 92
2147 3300050508 nmdc:mga09592_1272861_c1 nmdc:mga09592_1272861_c1_15_329 92
2148 3300050508 nmdc:mga09592_325495_c1 nmdc:mga09592_325495_c1_443_757 92
2149 3300050509 nmdc:mga0qj67_120438_c1 nmdc:mga0qj67_120438_c1_1417_1743 92
2150 3300050509 nmdc:mga0qj67_806880_c1 nmdc:mga0qj67_806880_c1_217_537 92
2151 3300050511 nmdc:mga08y16_318412_c1 nmdc:mga08y16_318412_c1_689_1003 92
2152 3300050511 nmdc:mga08y16_836254_c1 nmdc:mga08y16_836254_c1_161_475 92
2153 3300050512 nmdc:mga0n895_47595_c1 nmdc:mga0n895_47595_c1_1427_1744 92
2154 3300050512 nmdc:mga0n895_769032_c1 nmdc:mga0n895_769032_c1_27_344 92
2155 3300050512 nmdc:mga0n895_859294_c1 nmdc:mga0n895_859294_c1_358_672 92
2156 3300050513 nmdc:mga0rr50_125060_c1 nmdc:mga0rr50_125060_c1_1562_1888 92
2157 3300050513 nmdc:mga0rr50_1684057_c1 nmdc:mga0rr50_1684057_c1_83_397 92
2158 3300050514 nmdc:mga08x19_310329_c1 nmdc:mga08x19_310329_c1_107_433 92
2159 3300050514 nmdc:mga08x19_382513_c1 nmdc:mga08x19_382513_c1_16_330 92
2160 3300050514 nmdc:mga08x19_724037_c1 nmdc:mga08x19_724037_c1_54_380 92
2161 3300050515 nmdc:mga0a205_49921_c1 nmdc:mga0a205_49921_c1_1237_1563 92
2162 3300050516 nmdc:mga0sz30_107389_c1 nmdc:mga0sz30_107389_c1_504_818 92
2163 3300050516 nmdc:mga0sz30_198108_c1 nmdc:mga0sz30_198108_c1_85_399 92
2164 3300050516 nmdc:mga0sz30_2465_c1 nmdc:mga0sz30_2465_c1_4281_4595 92
2165 3300050516 nmdc:mga0sz30_553866_c1 nmdc:mga0sz30_553866_c1_74_388 92
2166 3300053077 Ga0495601_0063163 Ga0495601_0063163_1036_1350 92
2167 3300053077 Ga0495601_0246127 Ga0495601_0246127_778_1092 92
2168 3300053077 Ga0495601_0521101 Ga0495601_0521101_127_441 92
2169 3300053077 Ga0495601_0559693 Ga0495601_0559693_266_580 92
2170 3300053077 Ga0495601_0572043 Ga0495601_0572043_288_602 92
2171 3300053077 Ga0495601_0589847 Ga0495601_0589847_268_582 92
2172 3300053077 Ga0495601_0748475 Ga0495601_0748475_266_580 92
2173 3300053078 Ga0495612_0006325 Ga0495612_0006325_394_708 92
2174 3300053078 Ga0495612_0121140 Ga0495612_0121140_719_1033 92
2175 3300053078 Ga0495612_0171101 Ga0495612_0171101_222_536 92
2176 3300053079 Ga0500610_0118000 Ga0500610_0118000_356_670 92
2177 3300053079 Ga0500610_0243054 Ga0500610_0243054_144_458 92
2178 3300053079 Ga0500610_0399878 Ga0500610_0399878_139_453 92
2179 3300053080 Ga0500635_0071313 Ga0500635_0071313_62_376 92
2180 3300053080 Ga0500635_0077879 Ga0500635_0077879_735_1049 92
2181 3300053080 Ga0500635_0166509 Ga0500635_0166509_215_529 92
2182 3300053083 Ga0495655_0050060 Ga0495655_0050060_704_1018 92
2183 3300053083 Ga0495655_0118124 Ga0495655_0118124_404_718 92
2184 3300053083 Ga0495655_0223139 Ga0495655_0223139_38_352 92
2185 3300053084 Ga0495595_0018184 Ga0495595_0018184_247_561 92
2186 3300053084 Ga0495595_0164004 Ga0495595_0164004_393_707 92
2187 3300053084 Ga0495595_0220100 Ga0495595_0220100_384_698 92
2188 3300053084 Ga0495595_0383718 Ga0495595_0383718_176_490 92
2189 3300053085 Ga0495619_0078427 Ga0495619_0078427_536_850 92
2190 3300053085 Ga0495619_0156778 Ga0495619_0156778_348_662 92
2191 3300053085 Ga0495619_0446083 Ga0495619_0446083_345_671 92
2192 3300053085 Ga0495619_0572988 Ga0495619_0572988_351_665 92
2193 3300053085 Ga0495619_1103225 Ga0495619_1103225_139_453 92
2194 3300053086 Ga0500578_0177891 Ga0500578_0177891_213_527 92
2195 3300053086 Ga0500578_0274812 Ga0500578_0274812_346_672 92
2196 3300053086 Ga0500578_0357348 Ga0500578_0357348_450_776 92
2197 3300053086 Ga0500578_0648709 Ga0500578_0648709_241_555 92
2198 3300053086 Ga0500578_0713275 Ga0500578_0713275_107_421 92
2199 3300053087 Ga0500643_000227 Ga0500643_000227_37790_38104 92
2200 3300053087 Ga0500643_117885 Ga0500643_117885_14_328 92
2201 3300053088 Ga0500644_0001281 Ga0500644_0001281_2961_3287 92
2202 3300053088 Ga0500644_0024693 Ga0500644_0024693_1004_1318 92
2203 3300053088 Ga0500644_0482900 Ga0500644_0482900_216_530 92
2204 3300053089 Ga0500581_335258 Ga0500581_335258_197_511 92
2205 3300053090 Ga0500646_0101356 Ga0500646_0101356_432_758 92
2206 3300053090 Ga0500646_0256632 Ga0500646_0256632_15_341 92
2207 3300053090 Ga0500646_0375883 Ga0500646_0375883_43_357 92
2208 3300053090 Ga0500646_0401282 Ga0500646_0401282_153_467 92
2209 3300053091 Ga0500647_0136794 Ga0500647_0136794_750_1064 92
2210 3300053091 Ga0500647_0137515 Ga0500647_0137515_642_956 92
2211 3300053091 Ga0500647_0152221 Ga0500647_0152221_370_684 92
2212 3300053092 Ga0500583_0261089 Ga0500583_0261089_28_342 92
2213 3300053092 Ga0500583_0339445 Ga0500583_0339445_201_515 92
2214 3300053092 Ga0500583_0423092 Ga0500583_0423092_282_596 92
2215 3300053093 Ga0500651_0055530 Ga0500651_0055530_1883_2197 92
2216 3300053093 Ga0500651_0066405 Ga0500651_0066405_934_1260 92
2217 3300053093 Ga0500651_0397211 Ga0500651_0397211_276_590 92
2218 3300053094 Ga0500566_0000320 Ga0500566_0000320_19488_19802 92
2219 3300053094 Ga0500566_0023602 Ga0500566_0023602_2696_3010 92
2220 3300053094 Ga0500566_0034994 Ga0500566_0034994_189_503 92
2221 3300053095 Ga0500640_039267 Ga0500640_039267_845_1159 92
2222 3300053095 Ga0500640_112994 Ga0500640_112994_597_911 92
2223 3300053095 Ga0500640_136720 Ga0500640_136720_100_414 92
2224 3300053096 Ga0500641_0007663 Ga0500641_0007663_66_392 92
2225 3300053096 Ga0500641_0073123 Ga0500641_0073123_272_586 92
2226 3300053097 Ga0500648_162224 Ga0500648_162224_474_788 92
2227 3300053097 Ga0500648_204380 Ga0500648_204380_418_732 92
2228 3300053098 Ga0500650_0212642 Ga0500650_0212642_422_736 92
2229 3300053098 Ga0500650_0352269 Ga0500650_0352269_49_363 92
2230 3300053099 Ga0500654_202039 Ga0500654_202039_227_541 92
2231 3300053101 Ga0500553_177805 Ga0500553_177805_241_555 92
2232 3300053102 Ga0500554_051832 Ga0500554_051832_891_1205 92
2233 3300053102 Ga0500554_260419 Ga0500554_260419_111_425 92
2234 3300053103 Ga0500555_003043 Ga0500555_003043_532_846 92
2235 3300053103 Ga0500555_041936 Ga0500555_041936_672_986 92
2236 3300053104 Ga0500556_0002980 Ga0500556_0002980_1056_1370 92
2237 3300053104 Ga0500556_0279495 Ga0500556_0279495_246_560 92
2238 3300053105 Ga0500557_000010 Ga0500557_000010_51993_52307 92
2239 3300053106 Ga0500558_269592 Ga0500558_269592_128_442 92
2240 3300053108 Ga0500562_009272 Ga0500562_009272_2008_2322 92
2241 3300053108 Ga0500562_081749 Ga0500562_081749_90_425 92
2242 3300053108 Ga0500562_114258 Ga0500562_114258_385_699 92
2243 3300053109 Ga0500569_087992 Ga0500569_087992_475_789 92
2244 3300053109 Ga0500569_088882 Ga0500569_088882_166_480 92
2245 3300053111 Ga0500572_001453 Ga0500572_001453_2475_2789 92
2246 3300053111 Ga0500572_006785 Ga0500572_006785_940_1254 92
2247 3300053111 Ga0500572_157486 Ga0500572_157486_122_436 92
2248 3300053116 Ga0500592_060904 Ga0500592_060904_58_372 92
2249 3300053118 Ga0500594_0012613 Ga0500594_0012613_83_397 92
2250 3300053118 Ga0500594_0027857 Ga0500594_0027857_724_1038 92
2251 3300053118 Ga0500594_0338029 Ga0500594_0338029_66_380 92
2252 3300053119 Ga0500595_004583 Ga0500595_004583_3967_4281 92
2253 3300053119 Ga0500595_024963 Ga0500595_024963_538_852 92
2254 3300053119 Ga0500595_036059 Ga0500595_036059_1231_1545 92
2255 3300053119 Ga0500595_093416 Ga0500595_093416_80_394 92
2256 3300053119 Ga0500595_097613 Ga0500595_097613_28_342 92
2257 3300053120 Ga0500597_283378 Ga0500597_283378_124_438 92
2258 3300053120 Ga0500597_370098 Ga0500597_370098_190_504 92
2259 3300053120 Ga0500597_373040 Ga0500597_373040_160_474 92
2260 3300053121 Ga0500607_011275 Ga0500607_011275_1460_1774 92
2261 3300053122 Ga0500608_014127 Ga0500608_014127_2020_2334 92
2262 3300053122 Ga0500608_100139 Ga0500608_100139_641_955 92
2263 3300053122 Ga0500608_261250 Ga0500608_261250_80_394 92
2264 3300053123 Ga0500614_016190 Ga0500614_016190_821_1135 92
2265 3300053123 Ga0500614_021690 Ga0500614_021690_258_572 92
2266 3300053129 Ga0500628_129025 Ga0500628_129025_269_583 92
2267 3300053130 Ga0500642_0001144 Ga0500642_0001144_2583_2897 92
2268 3300053130 Ga0500642_0041999 Ga0500642_0041999_427_753 92
2269 3300053130 Ga0500642_0215378 Ga0500642_0215378_537_863 92
2270 3300053130 Ga0500642_0320311 Ga0500642_0320311_141_455 92
2271 3300053130 Ga0500642_0379285 Ga0500642_0379285_275_589 92
2272 3300053131 Ga0500652_001803 Ga0500652_001803_5563_5889 92
2273 3300053131 Ga0500652_113707 Ga0500652_113707_740_1054 92
2274 3300053131 Ga0500652_216662 Ga0500652_216662_183_497 92
2275 3300053131 Ga0500652_329213 Ga0500652_329213_80_406 92
2276 3300053133 Ga0500655_010692 Ga0500655_010692_166_480 92
2277 3300053133 Ga0500655_043326 Ga0500655_043326_246_560 92
2278 3300053134 Ga0500658_0048461 Ga0500658_0048461_1242_1556 92
2279 3300053134 Ga0500658_0332199 Ga0500658_0332199_264_578 92
2280 3300053134 Ga0500658_0453696 Ga0500658_0453696_15_329 92
2281 3300053136 Ga0500559_0002803 Ga0500559_0002803_790_1104 92
2282 3300053136 Ga0500559_0030835 Ga0500559_0030835_1512_1826 92
2283 3300053136 Ga0500559_0051014 Ga0500559_0051014_792_1106 92
2284 3300053136 Ga0500559_0217333 Ga0500559_0217333_510_824 92
2285 3300053136 Ga0500559_0218187 Ga0500559_0218187_112_426 92
2286 3300053136 Ga0500559_0363413 Ga0500559_0363413_28_351 92
2287 3300053137 Ga0500561_0091190 Ga0500561_0091190_139_453 92
2288 3300053138 Ga0500564_004201 Ga0500564_004201_4613_4927 92
2289 3300053139 Ga0500568_0071897 Ga0500568_0071897_380_694 92
2290 3300053139 Ga0500568_0134928 Ga0500568_0134928_84_398 92
2291 3300053139 Ga0500568_0137510 Ga0500568_0137510_472_786 92
2292 3300053139 Ga0500568_0163012 Ga0500568_0163012_112_426 92
2293 3300053139 Ga0500568_0232682 Ga0500568_0232682_154_480 92
2294 3300053139 Ga0500568_0339642 Ga0500568_0339642_15_329 92
2295 3300053140 Ga0500573_0006745 Ga0500573_0006745_5179_5493 92
2296 3300053142 Ga0500577_0111488 Ga0500577_0111488_519_833 92
2297 3300053142 Ga0500577_0265746 Ga0500577_0265746_418_732 92
2298 3300053142 Ga0500577_0289027 Ga0500577_0289027_121_447 92
2299 3300053142 Ga0500577_0456365 Ga0500577_0456365_111_425 92
2300 3300053142 Ga0500577_0514029 Ga0500577_0514029_43_369 92
2301 3300053143 Ga0500579_190643 Ga0500579_190643_301_615 92
2302 3300053144 Ga0500585_204860 Ga0500585_204860_256_570 92
2303 3300053146 Ga0500588_0258953 Ga0500588_0258953_14_328 92
2304 3300053146 Ga0500588_0357131 Ga0500588_0357131_83_397 92
2305 3300053148 Ga0500590_033008 Ga0500590_033008_2260_2574 92
2306 3300053148 Ga0500590_115369 Ga0500590_115369_246_560 92
2307 3300053148 Ga0500590_246961 Ga0500590_246961_45_359 92
2308 3300053150 Ga0500603_003307 Ga0500603_003307_915_1229 92
2309 3300053150 Ga0500603_009515 Ga0500603_009515_748_1062 92
2310 3300053150 Ga0500603_207848 Ga0500603_207848_198_512 92
2311 3300053151 Ga0500604_0011626 Ga0500604_0011626_13_327 92
2312 3300053151 Ga0500604_0115134 Ga0500604_0115134_263_577 92
2313 3300053151 Ga0500604_0327889 Ga0500604_0327889_62_376 92
2314 3300053152 Ga0500606_098712 Ga0500606_098712_545_859 92
2315 3300053153 Ga0500616_0000006 Ga0500616_0000006_569310_569636 92
2316 3300053153 Ga0500616_0013161 Ga0500616_0013161_3280_3606 92
2317 3300053153 Ga0500616_0043747 Ga0500616_0043747_1864_2178 92
2318 3300053153 Ga0500616_0192251 Ga0500616_0192251_120_443 92
2319 3300053153 Ga0500616_0304119 Ga0500616_0304119_307_621 92
2320 3300053154 Ga0500619_000847 Ga0500619_000847_2952_3266 92
2321 3300053155 Ga0500620_061973 Ga0500620_061973_137_451 92
2322 3300053155 Ga0500620_105335 Ga0500620_105335_384_698 92
2323 3300053156 Ga0500622_0004758 Ga0500622_0004758_5671_5985 92
2324 3300053156 Ga0500622_0077284 Ga0500622_0077284_307_621 92
2325 3300053156 Ga0500622_0208299 Ga0500622_0208299_484_798 92
2326 3300053158 Ga0500627_0016063 Ga0500627_0016063_799_1113 92
2327 3300053158 Ga0500627_0083588 Ga0500627_0083588_802_1116 92
2328 3300053158 Ga0500627_0163322 Ga0500627_0163322_599_913 92
2329 3300053161 Ga0500634_0314854 Ga0500634_0314854_56_370 92
2330 3300053162 Ga0500638_002268 Ga0500638_002268_2822_3136 92
2331 3300053162 Ga0500638_006089 Ga0500638_006089_3385_3699 92
2332 3300053162 Ga0500638_024655 Ga0500638_024655_936_1250 92
2333 3300053162 Ga0500638_099763 Ga0500638_099763_715_1029 92
2334 3300053162 Ga0500638_119650 Ga0500638_119650_443_757 92
2335 3300053163 Ga0500639_002134 Ga0500639_002134_2210_2524 92
2336 3300053163 Ga0500639_049846 Ga0500639_049846_245_559 92
2337 3300053163 Ga0500639_051651 Ga0500639_051651_284_598 92
2338 3300053163 Ga0500639_125227 Ga0500639_125227_602_916 92
2339 3300053163 Ga0500639_149104 Ga0500639_149104_111_425 92
2340 3300053177 Ga0500636_0143963 Ga0500636_0143963_79_393 92
2341 3300053177 Ga0500636_0296018 Ga0500636_0296018_471_785 92
2342 3300053177 Ga0500636_0329793 Ga0500636_0329793_334_648 92
2343 3300053177 Ga0500636_0415374 Ga0500636_0415374_151_465 92
2344 3300053178 Ga0500637_0003070 Ga0500637_0003070_1821_2135 92
2345 3300053178 Ga0500637_0051628 Ga0500637_0051628_1840_2154 92
2346 3300053178 Ga0500637_0164946 Ga0500637_0164946_199_513 92
2347 3300053178 Ga0500637_0373379 Ga0500637_0373379_299_613 92
2348 3300053178 Ga0500637_0398617 Ga0500637_0398617_326_640 92
2349 3300053178 Ga0500637_0414925 Ga0500637_0414925_296_610 92
2350 3300053722 Ga0500649_133007 Ga0500649_133007_117_431 92
2351 3300053723 Ga0500567_147073 Ga0500567_147073_159_473 92
2352 3300053725 Ga0500576_180875 Ga0500576_180875_177_491 92
2353 3300053725 Ga0500576_238910 Ga0500576_238910_133_447 92
2354 3300053727 Ga0500611_067759 Ga0500611_067759_237_551 92
2355 3300053729 Ga0500625_072266 Ga0500625_072266_940_1254 92
2356 3300053730 Ga0500645_001772 Ga0500645_001772_4612_4938 92
2357 3300053730 Ga0500645_007545 Ga0500645_007545_1693_2007 92
2358 3300053731 Ga0500609_011977 Ga0500609_011977_741_1055 92
2359 3300053731 Ga0500609_039471 Ga0500609_039471_166_492 92
2360 3300053731 Ga0500609_047325 Ga0500609_047325_80_394 92
2361 3300053733 Ga0500552_040942 Ga0500552_040942_242_556 92
2362 3300053735 Ga0500596_008894 Ga0500596_008894_1166_1480 92
2363 3300053735 Ga0500596_012417 Ga0500596_012417_521_835 92
2364 3300053736 Ga0500599_004657 Ga0500599_004657_391_705 92
2365 3300053737 Ga0500601_000921 Ga0500601_000921_2534_2848 92
2366 3300053737 Ga0500601_014472 Ga0500601_014472_76_390 92
2367 3300053739 Ga0500587_060328 Ga0500587_060328_193_507 92
2368 3300054114 Ga0501084_0017420 Ga0501084_0017420_4547_4861 92
2369 3300054114 Ga0501084_0041111 Ga0501084_0041111_1262_1576 92
2370 3300054114 Ga0501084_0875914 Ga0501084_0875914_137_451 92
2371 3300054114 Ga0501084_1383372 Ga0501084_1383372_243_557 92
2372 3300055283 Ga0500661_006436 Ga0500661_006436_304_618 92
2373 3300055283 Ga0500661_018639 Ga0500661_018639_382_696 92
2374 3300055283 Ga0500661_052346 Ga0500661_052346_290_604 92
2375 3300059490 Ga0587066_017034 Ga0587066_017034_694_1008 92
2376 3300059491 Ga0587070_007170 Ga0587070_007170_961_1275 92
2377 3300059492 Ga0587073_0079436 Ga0587073_0079436_206_520 92
2378 3300059503 Ga0587080_077005 Ga0587080_077005_130_444 92
2379 3300059504 Ga0587082_004176 Ga0587082_004176_560_874 92
2380 3300059505 Ga0587083_0109414 Ga0587083_0109414_149_463 92
2381 3300059506 Ga0587085_001166 Ga0587085_001166_2008_2322 92
2382 3300059508 Ga0587088_139516 Ga0587088_139516_190_504 92
2383 3300059511 Ga0587091_041345 Ga0587091_041345_226_540 92
2384 3300059604 Ga0587098_006153 Ga0587098_006153_317_631 92
2385 3300059605 Ga0587106_069324 Ga0587106_069324_59_373 92
2386 3300059630 Ga0587128_116576 Ga0587128_116576_155_469 92
2387 3300059639 Ga0587062_069322 Ga0587062_069322_136_450 92
2388 3300059643 Ga0587072_044665 Ga0587072_044665_545_859 92
2389 3300059652 Ga0587107_004105 Ga0587107_004105_606_920 92
2390 3300060346 Ga0587111_0007618 Ga0587111_0007618_1242_1556 92
2391 3300060353 Ga0501082_0004728 Ga0501082_0004728_7192_7506 92
2392 3300060353 Ga0501082_0059046 Ga0501082_0059046_2458_2772 92
2393 3300060353 Ga0501082_0384089 Ga0501082_0384089_713_1027 92
2394 3300060353 Ga0501082_0740726 Ga0501082_0740726_59_385 92
2395 3300060353 Ga0501082_0821083 Ga0501082_0821083_309_635 92
2396 3300060353 Ga0501082_0888288 Ga0501082_0888288_329_655 92
2397 3300061734 Ga0530510_0056862 Ga0530510_0056862_239_553 92
2398 3300061734 Ga0530510_0568966 Ga0530510_0568966_440_754 92
2399 iso_pu_bacteria 2507262055 2507509771 92
2400 iso_pu_bacteria 2508501009 2508543787 92
2401 iso_pu_bacteria 2508501042 2508698425 92
2402 iso_pu_bacteria 2508501128 2509149623 92
2403 iso_pu_bacteria 2511231028 2511396971 92
2404 iso_pu_bacteria 2513237092 2513625279 92
2405 iso_pu_bacteria 2513237094 2513644596 92
2406 iso_pu_bacteria 2513237095 2513646163 92
2407 iso_pu_bacteria 2513237096 2513658399 92
2408 iso_pu_bacteria 2513237098 2513678608 92
2409 iso_pu_bacteria 2513237101 2513695930 92
2410 iso_pu_bacteria 2513237102 2513701042 92
2411 iso_pu_bacteria 2513237104 2513715009 92
2412 iso_pu_bacteria 2513237137 2513857525 92
2413 iso_pu_bacteria 2513237139 2513875849 92
2414 iso_pu_bacteria 2513237141 2513894238 92
2415 iso_pu_bacteria 2513237145 2513920109 92
2416 iso_pu_bacteria 2513237161 2514011484 92
2417 iso_pu_bacteria 2515154112 2515630017 92
2418 iso_pu_bacteria 2517093001 2517103529 92
2419 iso_pu_bacteria 2517572143 2517893478 92
2420 iso_pu_bacteria 2524023205 2524441038 92
2421 iso_pu_bacteria 2524023210 2524469980 92
2422 iso_pu_bacteria 2524023228 2524537983 92
2423 iso_pu_bacteria 2528768022 2528856454 92
2424 iso_pu_bacteria 2617270735 2617349295 92
2425 iso_pu_bacteria 2617270741 2617378182 92
2426 iso_pu_bacteria 2667528175 2671118116 92
2427 iso_pu_bacteria 2721755755 2723846162 92
2428 iso_pu_bacteria 2728368998 2728747759 92
2429 iso_pu_bacteria 2744054633 2745082439 92
2430 iso_pu_bacteria 2791355196 2793060255 92
2431 iso_pu_bacteria 2791355197 2793071765 92
2432 iso_pu_bacteria 2791355199 2793076668 92
2433 iso_pu_bacteria 2802429603 2805917621 92
2434 iso_pu_bacteria 2816332527 2818241498 92
2435 iso_pu_bacteria 2824600985 2824602124 92
2436 iso_pu_bacteria 2824609381 2824610112 92
2437 iso_pu_bacteria 2824617872 2824620080 92
2438 iso_pu_bacteria 2824626560 2824627709 92
2439 iso_pu_bacteria 2824635225 2824636722 92
2440 iso_pu_bacteria 2824644064 2824645015 92
2441 iso_pu_bacteria 2824653114 2824654968 92
2442 iso_pu_bacteria 2824661429 2824662366 92
2443 iso_pu_bacteria 2824671348 2824672615 92
2444 iso_pu_bacteria 2824679649 2824680835 92
2445 iso_pu_bacteria 2824687955 2824689052 92
2446 iso_pu_bacteria 2824696289 2824697419 92
2447 iso_pu_bacteria 2824704595 2824706683 92
2448 iso_pu_bacteria 2824714736 2824715423 92
2449 iso_pu_bacteria 2824723954 2824724722 92
2450 iso_pu_bacteria 2824732956 2824733550 92
2451 iso_pu_bacteria 2824746037 2824746925 92
2452 iso_pu_bacteria 2824753945 2824759425 92
2453 iso_pu_bacteria 2824763712 2824769661 92
2454 iso_pu_bacteria 2824773399 2824774028 92
2455 iso_pu_bacteria 2838122688 2838130077 92
2456 iso_pu_bacteria 2841941048 2841941234 92
2457 iso_pu_bacteria 2841949485 2841952739 92
2458 iso_pu_bacteria 2841957949 2841962252 92
2459 iso_pu_bacteria 2841966195 2841967389 92
2460 iso_pu_bacteria 2841974524 2841979213 92
2461 iso_pu_bacteria 2841983080 2841990789 92
2462 iso_pu_bacteria 2842038055 2842038629 92
2463 iso_pu_bacteria 2842045827 2842048426 92
2464 iso_pu_bacteria 2842333319 2842335156 92
2465 iso_pu_bacteria 2844315083 2844318027 92
2466 iso_pu_bacteria 2847930680 2847934838 92
2467 iso_pu_bacteria 2847939898 2847945403 92
2468 iso_pu_bacteria 2849076700 2849080409 92
2469 iso_pu_bacteria 2857509624 2857510238 92
2470 iso_pu_bacteria 2874590934 2874595120 92
2471 iso_pu_bacteria 2874604998 2874610928 92
2472 iso_pu_bacteria 2874612657 2874615647 92
2473 iso_pu_bacteria 2874620515 2874621670 92
2474 iso_pu_bacteria 2874628541 2874632696 92
2475 iso_pu_bacteria 2874645413 2874650981 92
2476 iso_pu_bacteria 2876761206 2876765735 92
2477 iso_pu_bacteria 2876771140 2876775056 92
2478 iso_pu_bacteria 2876808645 2876810442 92
2479 iso_pu_bacteria 2876818435 2876823871 92
2480 iso_pu_bacteria 2879074833 2879080499 92
2481 iso_pu_bacteria 2879083081 2879089285 92
2482 iso_pu_bacteria 2879099564 2879109347 92
2483 iso_pu_bacteria 2879110137 2879110541 92
2484 iso_pu_bacteria 2879127579 2879134895 92
2485 iso_pu_bacteria 2879142872 2879149206 92
2486 iso_pu_bacteria 2881364244 2881366232 92
2487 iso_pu_bacteria 2881665667 2881671573 92
2488 iso_pu_bacteria 2885366525 2885372825 92
2489 iso_pu_bacteria 2885374607 2885380939 92
2490 iso_pu_bacteria 2885383462 2885384436 92
2491 iso_pu_bacteria 2885409591 2885413052 92
2492 iso_pu_bacteria 2888378607 2888382824 92
2493 iso_pu_bacteria 2888388044 2888394976 92
2494 iso_pu_bacteria 2888419890 2888423303 92
2495 iso_pu_bacteria 2889033259 2889041111 92
2496 iso_pu_bacteria 2903727486 2903729664 92
2497 iso_pu_bacteria 2903748898 2903758256 92
2498 iso_pu_bacteria 2903768456 2903770853 92
2499 iso_pu_bacteria 2904666416 2904668613 92
2500 iso_pu_bacteria 2904690495 2904696902 92
2501 iso_pu_bacteria 2904699407 2904701665 92
2502 iso_pu_bacteria 2904711408 2904716665 92
2503 iso_pu_bacteria 2906602504 2906605812 92
2504 iso_pu_bacteria 2906610324 2906610363 92
2505 iso_pu_bacteria 2906626472 2906628262 92
2506 iso_pu_bacteria 2906635258 2906642778 92
2507 iso_pu_bacteria 2906643746 2906644205 92
2508 iso_pu_bacteria 2906660503 2906665913 92
2509 iso_pu_bacteria 2908739725 2908743884 92
2510 iso_pu_bacteria 2908756301 2908761478 92
2511 iso_pu_bacteria 2908775508 2908778946 92
2512 iso_pu_bacteria 2922361189 2922361958 92
2513 iso_pu_bacteria 2922368715 2922375216 92
2514 iso_pu_bacteria 2922386360 2922392036 92
2515 iso_pu_bacteria 2922393267 2922395232 92
2516 iso_pu_bacteria 2922425934 2922428998 92
2517 iso_pu_bacteria 2929615660 2929615904 92
2518 iso_pu_bacteria 2929624759 2929630517 92
2519 iso_pu_bacteria 2932784394 2932792458 92
2520 iso_pu_bacteria 2932794094 2932800396 92
2521 iso_pu_bacteria 2932801729 2932804569 92
2522 iso_pu_bacteria 2932809354 2932813957 92
2523 iso_pu_bacteria 2932818245 2932819531 92
2524 iso_pu_bacteria 2932828146 2932833763 92
2525 iso_pu_bacteria 2933577622 2933578810 92
2526 iso_pu_bacteria 2935608549 2935611370 92
2527 iso_pu_bacteria 2935616580 2935618733 92
2528 iso_pu_bacteria 2935630451 2935637739 92
2529 iso_pu_bacteria 2935638405 2935644427 92
2530 iso_pu_bacteria 2935648319 2935648754 92
2531 iso_pu_bacteria 2935656913 2935657163 92
2532 iso_pu_bacteria 2935665750 2935674165 92
2533 iso_pu_bacteria 2935675223 2935678553 92
2534 iso_pu_bacteria 2935684952 2935687950 92
2535 iso_pu_bacteria 2935694250 2935701438 92
2536 iso_pu_bacteria 2935703347 2935708284 92
2537 iso_pu_bacteria 2935713505 2935714970 92
2538 iso_pu_bacteria 2935722832 2935726465 92
2539 iso_pu_bacteria 2935732158 2935733788 92
2540 iso_pu_bacteria 2935741537 2935743167 92
2541 iso_pu_bacteria 2935750917 2935754794 92
2542 iso_pu_bacteria 2935760218 2935765502 92
2543 iso_pu_bacteria 2935769743 2935775255 92
2544 iso_pu_bacteria 2935777560 2935779545 92
2545 iso_pu_bacteria 2935785616 2935791547 92
2546 iso_pu_bacteria 2935793552 2935799859 92
2547 iso_pu_bacteria 2935801545 2935805455 92
2548 iso_pu_bacteria 2935810662 2935816749 92
2549 iso_pu_bacteria 2935819856 2935820847 92
2550 iso_pu_bacteria 2935827899 2935833824 92
2551 iso_pu_bacteria 2935837841 2935839491 92
2552 iso_pu_bacteria 2935847175 2935850893 92
2553 iso_pu_bacteria 2935855204 2935857098 92
2554 iso_pu_bacteria 2935864058 2935864642 92
2555 iso_pu_bacteria 2935873716 2935876420 92
2556 iso_pu_bacteria 2935883170 2935889763 92
2557 iso_pu_bacteria 2935908558 2935913740 92
2558 iso_pu_bacteria 2935916978 2935920270 92
2559 iso_pu_bacteria 2935926038 2935930609 92
2560 iso_pu_bacteria 2935934488 2935939418 92
2561 iso_pu_bacteria 2935942939 2935946367 92
2562 iso_pu_bacteria 2935951376 2935955794 92
2563 iso_pu_bacteria 2935959822 2935966950 92
2564 iso_pu_bacteria 2935967501 2935972496 92
2565 iso_pu_bacteria 2935975950 2935981673 92
2566 iso_pu_bacteria 2935984226 2935991048 92
2567 iso_pu_bacteria 2935992306 2935997611 92
2568 iso_pu_bacteria 2936002035 2936007129 92
2569 iso_pu_bacteria 2936011229 2936011664 92
2570 iso_pu_bacteria 2936019824 2936020259 92
2571 iso_pu_bacteria 2936028420 2936028954 92
2572 iso_pu_bacteria 2936037263 2936042989 92
2573 iso_pu_bacteria 2936046547 2936046982 92
2574 iso_pu_bacteria 2936055302 2936058138 92
2575 iso_pu_bacteria 2940556831 2940559829 92
2576 iso_pu_bacteria 2941507105 2941514412 92
2577 iso_pu_bacteria 2941515067 2941522308 92
2578 iso_pu_bacteria 2941523033 2941530173 92
2579 iso_pu_bacteria 2941531003 2941536081 92
2580 iso_pu_bacteria 2941538514 2941540180 92
2581 iso_pu_bacteria 3005474847 3005479143 92
2582 iso_pu_bacteria 3005483717 3005488152 92
2583 iso_pu_bacteria 3005506211 3005512700 92
2584 iso_pu_bacteria 3005587118 3005590466 92
2585 iso_pu_bacteria 3005594810 3005598077 92
2586 iso_pu_bacteria 3005710791 3005713756 92
2587 iso_pu_bacteria 3005718088 3005721267 92
2588 iso_pu_bacteria 8006926726 8006930388 92
2589 iso_pu_bacteria 8006933436 8006942205 92
2590 iso_pu_bacteria 8006964411 8006964516 92
2591 iso_pu_bacteria 8006973647 8006981939 92
2592 iso_pu_bacteria 8006984368 8006986865 92
2593 iso_pu_bacteria 8006994254 8006996084 92
2594 iso_pu_bacteria 8016511872 8016514674 92
2595 iso_pu_bacteria 8016539877 8016540343 92
2596 iso_pu_bacteria 8016548790 8016552887 92
2597 iso_pu_bacteria 8016566248 8016574410 92
2598 iso_pu_bacteria 8016575299 8016578508 92
2599 iso_pu_bacteria 8016583857 8016591252 92
2600 iso_pu_bacteria 8016595262 8016599123 92
2601 iso_pu_bacteria 8016603502 8016611925 92
2602 iso_pu_bacteria 8016613128 8016621879 92
2603 iso_pu_bacteria 8016622563 8016627975 92
2604 iso_pu_bacteria 8016630954 8016632298 92
2605 iso_pu_bacteria 8017057580 8017061760 92
2606 iso_pu_bacteria 8019538911 8019543689 92
2607 iso_pu_bacteria 8019547302 8019555083 92
2608 iso_pu_bacteria 8019555841 8019557926 92
2609 iso_pu_bacteria 8019565922 8019567359 92
2610 iso_pu_bacteria 8019576017 8019581260 92
2611 iso_pu_bacteria 8019586578 8019588887 92
2612 iso_pu_bacteria 8019597564 8019602347 92
2613 iso_pu_bacteria 8019619141 8019626834 92
2614 iso_pu_bacteria 8019629233 8019635678 92
2615 iso_pu_bacteria 8019638758 8019644007 92
2616 iso_pu_bacteria 8019648815 8019657004 92
2617 iso_pu_bacteria 8019659431 8019663475 92
2618 iso_pu_bacteria 8019668869 8019673088 92
2619 iso_pu_bacteria 8019678201 8019683051 92
2620 iso_pu_bacteria 8019687851 8019688749 92
2621 iso_pu_bacteria 8055742211 8055747551 92
2622 iso_pu_bacteria 8056673599 8056680474 92
2623 iso_pu_bacteria 8056681323 8056684529 92
2624 iso_pu_bacteria 8056689827 8056691239 92
2625 iso_pu_bacteria 8056967851 8056972373 92

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00467

KOW

KOW motif

7

38

0.94

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

40

106

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgk-assembly1.cif.gz_t lincomycin and avilamycin bound to the 50s subunit 0.8669 1 90
7jil-assembly1.cif.gz_U 70s ribosome flavobacterium johnsoniae 0.8661 1 87
6z1p-assembly1.cif.gz_Ay structure of the mitochondrial ribosome from tetrahymena thermophila 0.866 1 92
8cgd-assembly1.cif.gz_t clindamycin bound to the 50s subunit 0.8647 1 90
6wru-assembly1.cif.gz_G structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid 0.8615 1 90
ID Description Score Start End Superfamily
af_Q8I5H8_47_152_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8799 1 88 2.30.30.30
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8749 1 88 2.30.30.30
af_Q96A35_47_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8491 1 88 2.30.30.30
af_Q653V9_69_173_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8486 1 88 2.30.30.30
af_C6SX56_4_111_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8453 1 88 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A7X3XRY9-F1-model_v4 Large ribosomal subunit protein uL24 0.9852 1 56 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2A2YG35-F1-model_v4 Large ribosomal subunit protein uL24 0.9676 1 56 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2G4F8M0-F1-model_v4 Large ribosomal subunit protein uL24 0.9644 1 56 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A3D1TDX0-F1-model_v4 Large ribosomal subunit protein uL24 0.9591 1 56 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-G2LHH3-F1-model_v4 Large ribosomal subunit protein uL24 (50S ribosomal protein L24) 0.9509 2 56 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
89.36 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map