metagRoot

F496909

General Info

Members	Datasets	Scaffolds	Average Seq Length
2551	877	5102	187

Family's Representative Sequence

Representative Sequence	3300039437\|Ga0436365_0619963\|Ga0436365_0619963_3920_4540
Length	192
Sequence	LAAILGNRPSVARSEIEGIVATTADFKNGLVLAIDGQLWQIVEFQHVKPGKGPAFVRTKLKNILSGKVVDKTYNAGVKVETATVDRRDTTYLYEQHHLPDTLVGDAARFLQEGLPVQVAFHNGSPLYIELPVSVELEVSHTEPGLQGDRSSAGTKPATLETGAEIQVPLFINTGDKLKVDTRDGSYLGRVNA

Samples

	Sample ID	Description	Type	Environment
1	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
2	3300000549	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled	Metagenome	Rhizosphere
3	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
4	3300001978	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6	Metagenome	Rhizosphere
5	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
6	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
7	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
8	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
9	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
10	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
11	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
12	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
13	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
14	3300003285	Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
15	3300003300	Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
16	3300003308	Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
17	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
18	3300003693	Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
19	3300003735	Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
20	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
21	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
22	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
23	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
24	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
25	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
26	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
27	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
28	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
29	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
30	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
31	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
32	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
33	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
34	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
35	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
36	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
37	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
38	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
39	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
40	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
41	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
42	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
43	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
44	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
45	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
46	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
47	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
48	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
49	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
50	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
51	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
52	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
53	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
54	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
55	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
56	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
57	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
58	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
59	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
60	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
61	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
62	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
63	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
64	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
65	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
66	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
67	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
68	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
69	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
70	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
71	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
72	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
73	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
74	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
75	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
76	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
77	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
78	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
79	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
80	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
81	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
82	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
83	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
84	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
85	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
86	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
87	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
88	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
89	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
90	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
91	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
92	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
93	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
94	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
95	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
96	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
97	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
98	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
99	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
100	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
101	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
102	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
103	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
104	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
105	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
106	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
107	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
108	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
109	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
110	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
111	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
112	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
113	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
114	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
115	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
116	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
117	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
118	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
119	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
120	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
121	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
122	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
123	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
124	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
125	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
126	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
127	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
128	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
129	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
130	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
131	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
132	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
133	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
134	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
135	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
136	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
137	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
138	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
139	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
140	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
141	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
142	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
143	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
144	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
145	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
146	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
147	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
148	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
149	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
150	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
151	3300015688	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01	Metagenome	Rhizosphere
152	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
153	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
154	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
155	3300020075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
156	3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3)	Metatranscriptome	Rhizosphere
157	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
158	3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
159	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
160	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
161	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
162	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
163	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
164	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
165	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
166	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
167	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
168	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
169	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
170	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
171	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
172	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
173	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
174	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
175	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
176	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
243	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
247	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
248	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
249	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
250	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
251	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
252	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
253	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
254	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
255	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
256	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
257	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
258	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
259	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
260	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
261	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
262	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
263	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
264	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
265	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
266	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
267	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
268	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
269	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
270	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
271	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
272	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
273	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
274	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
275	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
276	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
277	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
278	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
279	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
280	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
281	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
282	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
283	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
284	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
285	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
286	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
287	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
288	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
289	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
290	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
291	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
292	3300033524	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
293	3300033528	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
294	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
295	3300033544	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5	Metagenome	Unclassified
296	3300033545	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4	Metagenome	Unclassified
297	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
298	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
299	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
300	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
301	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
302	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
303	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
304	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
305	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
306	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
307	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
308	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
309	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
310	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
311	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
312	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
313	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
314	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
315	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
316	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
317	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
318	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
319	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
320	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
321	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
322	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
323	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
324	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
325	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
326	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
327	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
328	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
329	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
330	3300036459	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
331	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
332	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
333	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
334	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
335	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
336	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
337	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
338	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
339	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
340	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
341	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
342	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
343	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
344	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
345	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
346	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
347	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
348	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
349	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
350	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
351	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
352	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
353	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
354	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
355	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
356	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
357	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
358	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
359	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
360	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
361	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
362	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
363	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
364	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
365	3300042142	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610	Metagenome	Rhizosphere
366	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
367	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
368	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
369	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
370	3300042533	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472	Metagenome	Rhizosphere
371	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
372	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
373	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
374	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
375	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
376	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
377	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
378	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
379	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
380	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
381	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
382	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
383	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
384	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
385	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
386	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
387	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
388	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
389	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
390	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
391	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
392	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
393	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
394	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
395	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
396	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
397	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
398	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
399	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
400	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
401	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
402	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
403	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
404	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
405	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
406	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
407	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
408	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
409	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
410	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
411	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
412	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
413	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
414	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
415	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
416	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
417	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
418	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
419	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
420	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
421	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
422	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
423	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
424	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
425	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
426	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
427	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
428	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
429	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
430	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
431	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
432	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
433	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
434	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
435	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
436	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
437	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
438	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
439	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
440	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
441	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
442	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
443	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
444	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
445	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
446	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
447	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
448	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
449	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
450	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
451	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
452	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
453	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
454	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
455	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
456	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
457	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
458	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
459	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
460	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
461	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
462	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
463	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
464	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
465	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
466	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
467	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
468	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
469	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
470	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
471	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
472	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
473	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
474	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
475	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
476	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
477	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
478	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
479	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
480	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
481	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
482	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
483	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
484	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
485	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
486	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
487	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
488	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
489	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
490	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
491	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
492	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
493	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
494	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
495	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
496	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
497	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
498	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
499	3300049127	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
500	3300049129	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
501	3300049130	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
502	3300049131	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
503	3300049160	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
504	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
505	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
506	3300049527	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
507	3300049528	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
508	3300049529	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
509	3300049530	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
510	3300049532	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
511	3300049533	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
512	3300049534	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
513	3300049535	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
514	3300049538	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
515	3300049539	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
516	3300049541	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
517	3300049546	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
518	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
519	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
520	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
521	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
522	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
523	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
524	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
525	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
526	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
527	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
528	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
529	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
530	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
531	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
532	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
533	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
534	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
535	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
536	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
537	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
538	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
539	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
540	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
541	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
542	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
543	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
544	3300049653	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control	Metagenome	Rhizosphere
545	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
546	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
547	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
548	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
549	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
550	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
551	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
552	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
553	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
554	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
555	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
556	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
557	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
558	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
559	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
560	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
561	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
562	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
563	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
564	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
565	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
566	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
567	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
568	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
569	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
570	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
571	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
572	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
573	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
574	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
575	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
576	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
577	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
578	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
579	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
580	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
581	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
582	3300053099	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere	Metagenome	Endosphere
583	3300053100	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere	Metagenome	Endosphere
584	3300053101	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere	Metagenome	Endosphere
585	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
586	3300053107	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere	Metagenome	Endosphere
587	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
588	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
589	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
590	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
591	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
592	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
593	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
594	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
595	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
596	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
597	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
598	3300053143	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere	Metagenome	Endosphere
599	3300053149	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere	Metagenome	Endosphere
600	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
601	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
602	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
603	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
604	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
605	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
606	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
607	3300053732	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere	Metagenome	Endosphere
608	3300053734	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere	Metagenome	Endosphere
609	3300053739	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere	Metagenome	Endosphere
610	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
611	3300059477	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
612	3300059492	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
613	3300059510	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
614	3300059511	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
615	3300059651	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
616	3300060247	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
617	3300060346	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
618	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
619	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
620	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
621	2503198000	Mesorhizobium opportunistum WSM2075	Isolate	Nodule
622	2508501123	Mesorhizobium sp. WSM3626	Isolate	Nodule
623	2508501127	Mesorhizobium sp. WSM2561	Isolate	Nodule
624	2509276018	Mesorhizobium ciceri CMG6	Isolate	Nodule
625	2509276022	Mesorhizobium australicum WSM2073	Isolate	Nodule
626	2510065059	Mesorhizobium ciceri WSM4083	Isolate	Nodule
627	2512875016	Mesorhizobium japonicum R7A	Isolate	Nodule
628	2512875024
629	2513237164	Mesorhizobium loti CJ3sym	Isolate	Nodule
630	2513237305	Mesorhizobium amorphae CCNWGS0123	Isolate	Nodule
631	2547132111	Streptomyces sp. TOR3209	Isolate	Rhizosphere
632	2547132424	Nocardia nova SH22a	Isolate	Unclassified
633	2582581312	Streptomyces atratus OK008	Isolate	Rhizosphere
634	2582581313	Streptomyces mirabilis OV308	Isolate	Rhizosphere
635	2588253730	Mesorhizobium huakuii 7653R	Isolate	Rhizosphere
636	2597489875	Mesorhizobium ciceri ca181	Isolate	Unclassified
637	2616644814	Streptomyces mirabilis OK461	Isolate	Rhizosphere
638	2616644941	Streptomyces atratus OK807	Isolate	Rhizosphere
639	2643221548	Streptomyces sp. Root55	Isolate	Unclassified
640	2643221578	Streptomyces sp. Root63	Isolate	Unclassified
641	2643221595	Mesorhizobium sp. Root695	Isolate	Unclassified
642	2643221615	Nocardioides sp. Root224	Isolate	Unclassified
643	2643221627	Mesorhizobium sp. Root102	Isolate	Unclassified
644	2643221657	Nocardioides sp. Root1257	Isolate	Unclassified
645	2643221670	Streptomyces sp. Root431	Isolate	Unclassified
646	2643221673	Streptomyces sp. Root1295	Isolate	Unclassified
647	2643221681	Aeromicrobium sp. Root472D3	Isolate	Unclassified
648	2643221682	Streptomyces sp. Root1319	Isolate	Unclassified
649	2643221961	Aeromicrobium sp. Root236	Isolate	Unclassified
650	2643221962	Aeromicrobium sp. Root344	Isolate	Unclassified
651	2671180139	Chelativorans sp. A52C2	Isolate	Unclassified
652	2687453392	Mesorhizobium ciceri biserrulae WSM1284	Isolate	Unclassified
653	2721755686	Mesorhizobium amorphae CCNWGS0123	Isolate	Nodule
654	2738541264	Mycobacterium sp. OK889	Isolate	Unclassified
655	2738541356	Mycobacterium sp. OK887	Isolate	Unclassified
656	2756170246	Mesorhizobium loti DSM 2626	Isolate	Nodule
657	2784746763	Streptomyces ossamyceticus SAI-001	Isolate	Unclassified
658	2784746768	Streptomyces griseorubiginosus SAI-142	Isolate	Unclassified
659	2786546132	Streptomyces sp. W SAI-097	Isolate	Unclassified
660	2791355123	Mesorhizobium sophorae ICMP 19535	Isolate	Unclassified
661	2791355406	Streptomyces rhizosphaericus NRRL B-24304	Isolate	Unclassified
662	2808606982	Streptomyces sp. SLBN-118	Isolate	Unclassified
663	2811994879	Streptomyces sp. 4-17	Isolate	Unclassified
664	2811994917	Streptomyces sp. SLBN-134	Isolate	Unclassified
665	2818991463	Streptomyces argenteolus 3259	Isolate	Rhizosphere
666	2841734538	Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1	Isolate	Nodule
667	2844002411	Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1	Isolate	Nodule
668	2844009547	Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1	Isolate	Nodule
669	2856320880	Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1	Isolate	Nodule
670	2856328259	Mesorhizobium sp. Primo-B	Isolate	Nodule
671	2856334872	Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1	Isolate	Nodule
672	2856342000	Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1	Isolate	Nodule
673	2856356410	Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1	Isolate	Nodule
674	2857367948	Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1	Isolate	Nodule
675	2857710386	Brevibacterium sp. R-73093	Isolate	Unclassified
676	2862178590	Streptomyces sp. SDr-06	Isolate	Rhizosphere
677	2862281513	Streptomyces sp. Act143	Isolate	Rhizosphere
678	2862290372	Streptomyces triticagri NEAU-YY421	Isolate	Rhizosphere
679	2862382967	Streptomyces scabiei NRRL B-2795	Isolate	Nodule
680	2862507626	Streptomyces sp. NWU339	Isolate	Unclassified
681	2862574272	Streptomyces sp. AcE210	Isolate	Nodule
682	2863404153	Streptomyces scabiei SAI-025 (Annotation) (version 2)	Isolate	Unclassified
683	2867428634	Streptomyces sp. RP5T	Isolate	Unclassified
684	2867475112	Streptomyces sp. TM32	Isolate	Unclassified
685	2869162929	Mesorhizobium sanjuanii BSA136	Isolate	Nodule
686	2869169390	Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1	Isolate	Nodule
687	2869234852	Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1	Isolate	Nodule
688	2869242130	Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1	Isolate	Nodule
689	2869249662	Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1	Isolate	Nodule
690	2869256925	Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0	Isolate	Nodule
691	2869264136	Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1	Isolate	Nodule
692	2869271264	Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1	Isolate	Nodule
693	2869278585	Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1	Isolate	Nodule
694	2871435913	Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0	Isolate	Nodule
695	2871451962	Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1	Isolate	Nodule
696	2871459585	Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1	Isolate	Nodule
697	2871466892	Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1	Isolate	Nodule
698	2871474448	Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1	Isolate	Nodule
699	2871481445	Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1	Isolate	Nodule
700	2871488783	Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1	Isolate	Nodule
701	2874109183	Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1	Isolate	Nodule
702	2874116593	Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1	Isolate	Nodule
703	2874123672	Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1	Isolate	Nodule
704	2874131515	Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1	Isolate	Nodule
705	2874139085	Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1	Isolate	Nodule
706	2874162495	Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1	Isolate	Nodule
707	2874168670	Mesorhizobium kowhaii Ach-343	Isolate	Nodule
708	2875391855	Streptomyces cavourensis 1AS2a	Isolate	Rhizosphere
709	2876363079	Mesorhizobium loti R7ANS::ICEMlSym2042	Isolate	Nodule
710	2876386047	Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1	Isolate	Nodule
711	2876399893	Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1	Isolate	Nodule
712	2876406927	Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1	Isolate	Nodule
713	2876420981	Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1	Isolate	Nodule
714	2877676314	Streptomyces griseorubiginosus 3E-1	Isolate	Unclassified
715	2878730984	Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1	Isolate	Nodule
716	2878738818	Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1	Isolate	Nodule
717	2878753008	Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1	Isolate	Nodule
718	2878774303	Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1	Isolate	Nodule
719	2878781027	Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1	Isolate	Nodule
720	2878788777	Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1	Isolate	Nodule
721	2881845957	Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1	Isolate	Nodule
722	2881861095	Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2	Isolate	Nodule
723	2882632389	Mesorhizobium waimense ICMP19557	Isolate	Unclassified
724	2882912400	Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1	Isolate	Nodule
725	2885318864	Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1	Isolate	Nodule
726	2888337043	Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1	Isolate	Nodule
727	2888343758	Mesorhizobium sp. AA22	Isolate	Unclassified
728	2902810491	Mycolicibacterium sp. P9-22	Isolate	Unclassified
729	2903448605	Mesorhizobium japonicum Opo-235	Isolate	Nodule
730	2903492973	Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1	Isolate	Nodule
731	2903513507	Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2	Isolate	Nodule
732	2903521522	Mesorhizobium loti R7ANS::ICEMlSym2014	Isolate	Nodule
733	2903528002	Mesorhizobium loti R7ANS::ICEMlSym2037	Isolate	Nodule
734	2906363423	Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1	Isolate	Nodule
735	2906370794	Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1	Isolate	Nodule
736	2906378014	Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1	Isolate	Nodule
737	2906386501	Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1	Isolate	Nodule
738	2906393657	Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1	Isolate	Nodule
739	2906401398	Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1	Isolate	Nodule
740	2906408224	Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1	Isolate	Nodule
741	2906427513	Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1	Isolate	Nodule
742	2912715099	Streptomyces sp. Z423-1	Isolate	Rhizosphere
743	2912757875	Streptomyces sp. S4.7	Isolate	Rhizosphere
744	2918501144	Streptomyces sp. PvR006	Isolate	Rhizosphere
745	2919713450	Nocardia kruczakiae 4272	Isolate	Rhizosphere
746	2922151315	Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1	Isolate	Nodule
747	2922172374	Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1	Isolate	Nodule
748	2922178524	Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1	Isolate	Nodule
749	2924710171	Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2	Isolate	Nodule
750	2924718760	Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1	Isolate	Nodule
751	2924733363	Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1	Isolate	Nodule
752	2924741084	Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2	Isolate	Nodule
753	2924748358	Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2	Isolate	Nodule
754	2924754689	Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1	Isolate	Nodule
755	2924762789	Mesorhizobium sp. WSM4303	Isolate	Unclassified
756	2924776078	Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1	Isolate	Nodule
757	2924784321	Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1	Isolate	Nodule
758	2937822353	Mesorhizobium neociceri CCANP35	Isolate	Nodule
759	2937836603	Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1	Isolate	Nodule
760	2937848649	Mesorhizobium sp. WSM4310	Isolate	Unclassified
761	2937861824	Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1	Isolate	Nodule
762	2937868953	Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1	Isolate	Nodule
763	2937877337	Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1	Isolate	Nodule
764	2937972304	Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1	Isolate	Nodule
765	2937980651	Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1	Isolate	Nodule
766	2946045630	Streptomyces sp. W4I9-2	Isolate	Rhizosphere
767	2946064051	Streptomyces luteogriseus W4I19-1	Isolate	Rhizosphere
768	2954673503	Streptomyces sp. SAI-119	Isolate	Rhizosphere
769	2954682443	Streptomyces sp. SAI-149	Isolate	Rhizosphere
770	2954711539	Streptomyces sp. SAI-090	Isolate	Rhizosphere
771	2954721474	Streptomyces sp. SAI-117	Isolate	Rhizosphere
772	2954731030	Streptomyces sp. SAI-133	Isolate	Rhizosphere
773	2954740390	Streptomyces sp. SAI-041	Isolate	Rhizosphere
774	2954749733	Streptomyces sp. SAI-135	Isolate	Rhizosphere
775	2954759201	Streptomyces sp. SAI-208	Isolate	Rhizosphere
776	2958034702	Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1	Isolate	Nodule
777	2958041894	Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1	Isolate	Nodule
778	2958064165	Mesorhizobium sp. SARCC-RB16n	Isolate	Unclassified
779	2958071322	Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1	Isolate	Nodule
780	2958084443	Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1	Isolate	Nodule
781	2958092219	Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1	Isolate	Nodule
782	2958108152	Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1	Isolate	Nodule
783	2958122699	Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1	Isolate	Nodule
784	2958137437	Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1	Isolate	Nodule
785	2958144490	Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1	Isolate	Nodule
786	2958158011	Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1	Isolate	Nodule
787	2961136820	Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1	Isolate	Nodule
788	2961170736	Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1	Isolate	Nodule
789	2961183825	Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1	Isolate	Nodule
790	2963644680	Mesorhizobium japonicum R7A	Isolate	Nodule
791	2965025482	Mesorhizobium sp. Primo-A	Isolate	Nodule
792	2965032056	Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1	Isolate	Nodule
793	2965040258	Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1	Isolate	Nodule
794	2965047637	Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1	Isolate	Nodule
795	2965089291	Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1	Isolate	Nodule
796	2965102966	Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1	Isolate	Nodule
797	2965110997	Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1	Isolate	Nodule
798	2966598605	Kitasatospora papulosa SLBN-177	Isolate	Rhizosphere
799	2967996073	Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1	Isolate	Nodule
800	2968003550	Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1	Isolate	Nodule
801	2968016561	Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1	Isolate	Nodule
802	2968083720	Mesorhizobium erdmanii Opo-242	Isolate	Unclassified
803	2968138860	Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1	Isolate	Nodule
804	2970469710	Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1	Isolate	Nodule
805	2970489779	Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1	Isolate	Nodule
806	2970503327	Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1	Isolate	Nodule
807	2970510686	Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0	Isolate	Nodule
808	2970524798	Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1	Isolate	Nodule
809	2970532167	Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1	Isolate	Nodule
810	2970540015	Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1	Isolate	Nodule
811	2970547951	Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1	Isolate	Nodule
812	2970593180	Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1	Isolate	Nodule
813	2970619444	Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1	Isolate	Nodule
814	2970627176	Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1	Isolate	Nodule
815	2977821940	Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1	Isolate	Nodule
816	2977828996	Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1	Isolate	Nodule
817	2977851361	Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1	Isolate	Nodule
818	2977872689	Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1	Isolate	Nodule
819	2977898635	Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1	Isolate	Nodule
820	2977907340	Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1	Isolate	Nodule
821	2977915119	Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1	Isolate	Nodule
822	2977922695	Mesorhizobium sp. WSM4305	Isolate	Unclassified
823	2977935797	Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1	Isolate	Nodule
824	2977950692	Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1	Isolate	Nodule
825	2977957713	Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1	Isolate	Nodule
826	2977986579	Mesorhizobium intechi BD68	Isolate	Unclassified
827	2979772303	Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1	Isolate	Nodule
828	2979793036	Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1	Isolate	Nodule
829	2979808191	Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1	Isolate	Nodule
830	2987645492	Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1	Isolate	Nodule
831	2987666974	Mesorhizobium sp. WSM4306	Isolate	Unclassified
832	2990059506	Streptomyces sp. CAP261	Isolate	Unclassified
833	2995463766	Streptacidiphilus fuscans NEAU-YB345	Isolate	Unclassified
834	2996348954	Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1	Isolate	Nodule
835	2996386984	Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0	Isolate	Nodule
836	2997600082	Streptomyces coffeae CA1R205	Isolate	Unclassified
837	3000135777	Unclassified bacterium M00.F.Ca.ET.205.01.1.1	Isolate	Unclassified
838	3004167301	Mesorhizobium loti 582	Isolate	Unclassified
839	3004195979	Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1	Isolate	Nodule
840	3004211236	Mesorhizobium sp. WSM4307	Isolate	Unclassified
841	3004218560	Mesorhizobium sp. WSM4315	Isolate	Unclassified
842	3004232784	Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1	Isolate	Nodule
843	3004239961	Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1	Isolate	Nodule
844	3004248173	Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1	Isolate	Nodule
845	3004268573	Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1	Isolate	Nodule
846	3004275668	Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1	Isolate	Nodule
847	3004289098	Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1	Isolate	Nodule
848	3004334049	Mesorhizobium huakuii 583	Isolate	Unclassified
849	3006321560	Actinacidiphila epipremni PRB2-1	Isolate	Unclassified
850	3006393351	Streptomyces sp. SID4985	Isolate	Unclassified
851	3006425503	Streptomyces zingiberis PLAI1-29	Isolate	Unclassified
852	3006486233	Streptomyces sp. BR123	Isolate	Rhizosphere
853	3006493962	Streptomyces grisecoloratus TRM S81-3	Isolate	Rhizosphere
854	637000159	Mesorhizobium japonicum MAFF 303099	Isolate	Unclassified
855	649633066	Mesorhizobium ciceri bv. biserrulae WSM1271	Isolate	Nodule
856	8004300914	Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1	Isolate	Nodule
857	8004361976	Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1	Isolate	Nodule
858	8004374579	Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1	Isolate	Nodule
859	8004395343	Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1	Isolate	Nodule
860	8004633249	Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1	Isolate	Nodule
861	8004695233	Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1	Isolate	Nodule
862	8004727605	Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1	Isolate	Nodule
863	8008558824	Streptomyces scabiei NRRL B-2795	Isolate	Nodule
864	8023623736	Streptomyces sp. 111WW2	Isolate	Unclassified
865	8025478263	Streptomyces telluris AA8	Isolate	Rhizosphere
866	8025530807	Streptomyces sp. 4R-3d	Isolate	Unclassified
867	8033684223	Streptomyces phytophilus PIP175	Isolate	Unclassified
868	8047893842	Streptomyces cangkringensis DSM 41769	Isolate	Rhizosphere
869	8048127548	Streptomyces samsunensis DSM 42010	Isolate	Rhizosphere
870	8048356638	Streptomyces rhizosphaericus DSM 41760	Isolate	Rhizosphere
871	8048369669	Streptomyces indonesiensis DSM 41759	Isolate	Rhizoplane
872	8048379754	Streptomyces asiaticus DSM 41761	Isolate	Rhizosphere
873	8054160619	Streptomyces rhizoryzae RS10V-4	Isolate	Rhizosphere
874	8055617313	Mesorhizobium onobrychidis OM4	Isolate	Nodule
875	8056060235	Nocardiopsis endophytica RSe5-2	Isolate	Unclassified
876	8056447290	Streptomyces huiliensis SCA2-4	Isolate	Rhizosphere
877	8056829672	Streptomyces barringtoniae JA03	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	87.34
Metatranscriptomes	2.59
Isolates	10.07

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	7.96
Nodule	6.35
Rhizoplane	5.41
Rhizosphere	74.05
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0436365_0619963	3300039437	Bacteria	8309
2	LJQas_1003538	3300000549	Bacteria	2085
3	JGI24746J21847_1009299	3300001977	Bacteria	1469
4	JGI24747J21853_1012549	3300001978	Bacteria	866
5	JGI24739J22299_10113795	3300001989	Bacteria	811
6	JGI24737J22298_10028470	3300001990	Bacteria	1756
7	JGI24743J22301_10004175	3300001991	Bacteria	2336
8	JGI24750J21931_1008178	3300002070	Bacteria	1327
9	JGI24745J21846_1006851	3300002073	Bacteria	1272
10	JGI24748J21848_1001688	3300002074	Bacteria	2458
11	JGI24748J21848_1013647	3300002074	Bacteria	961
12	JGI24744J21845_10001803	3300002077	Bacteria	4296
13	JGI24744J21845_10001863	3300002077	Bacteria	4236
14	JGI24034J26672_10003153	3300002239	Bacteria	2293
15	JGI24034J26672_10014429	3300002239	Bacteria	1205
16	JGI24742J22300_10006040	3300002244	Bacteria	1995
17	Ga0007423J48922_100257	3300003285	Bacteria	2670
18	Ga0006758J48902_1030490	3300003300	Bacteria	1106
19	Ga0006777J48905_1036155	3300003308	Bacteria	1238
20	JGI25404J52841_10021394	3300003659	Bacteria	1400
21	Ga0032354_1035482	3300003693	Bacteria	1250
22	Ga0006780_1034030	3300003735	Bacteria	604
23	Ga0055542_1000344	3300003762	Bacteria	49138
24	Ga0055529_1006117	3300003763	Bacteria	1700
25	Ga0055540_1000085	3300003792	Bacteria	105366
26	Ga0055540_1014583	3300003792	Bacteria	2331
27	Ga0055540_1019990	3300003792	Bacteria	1787
28	Ga0070658_10069898	3300005327	Bacteria	2873
29	Ga0070658_10130301	3300005327	Bacteria	2096
30	Ga0070676_10108836	3300005328	Bacteria	1723
31	Ga0070683_100235900	3300005329	Bacteria	1739
32	Ga0070683_100359580	3300005329	Bacteria	1386
33	Ga0070683_100593702	3300005329	Bacteria	1060
34	Ga0070670_100445551	3300005331	Bacteria	1147
35	Ga0068869_100096475	3300005334	Bacteria	2232
36	Ga0068869_100158304	3300005334	Bacteria	1761
37	Ga0070666_10045683	3300005335	Bacteria	2936
38	Ga0070682_100020784	3300005337	Bacteria	3867
39	Ga0070682_100026915	3300005337	Bacteria	3446
40	Ga0070682_100186692	3300005337	Bacteria	1453
41	Ga0068868_100002447	3300005338	Bacteria	12879
42	Ga0068868_100033072	3300005338	Bacteria	3984
43	Ga0068868_100148781	3300005338	Bacteria	1927
44	Ga0070660_100044102	3300005339	Bacteria	3409
45	Ga0070660_100070517	3300005339	Bacteria	2728
46	Ga0070660_100222998	3300005339	Bacteria	1532
47	Ga0070660_100355715	3300005339	Bacteria	1206
48	Ga0070689_100316810	3300005340	Bacteria	1301
49	Ga0070691_10014028	3300005341	Bacteria	3675
50	Ga0070691_10113408	3300005341	Bacteria	1358
51	Ga0070691_10148261	3300005341	Bacteria	1201
52	Ga0070691_10261402	3300005341	Bacteria	932
53	Ga0070692_10159371	3300005345	Bacteria	1291
54	Ga0070668_100002161	3300005347	Bacteria	14391
55	Ga0070668_100184742	3300005347	Bacteria	1705
56	Ga0070668_100328656	3300005347	Bacteria	1289
57	Ga0070668_100363105	3300005347	Bacteria	1228
58	Ga0070668_100635748	3300005347	Bacteria	936
59	Ga0070675_100059053	3300005354	Bacteria	3164
60	Ga0070675_100237222	3300005354	Bacteria	1592
61	Ga0070671_100074578	3300005355	Bacteria	2834
62	Ga0070671_100093992	3300005355	Bacteria	2513
63	Ga0070671_100096727	3300005355	Bacteria	2476
64	Ga0070674_100011743	3300005356	Bacteria	5344
65	Ga0070674_100043876	3300005356	Bacteria	3044
66	Ga0070673_100191767	3300005364	Bacteria	1756
67	Ga0070673_100245757	3300005364	Bacteria	1557
68	Ga0070688_100029765	3300005365	Bacteria	3272
69	Ga0070688_100381805	3300005365	Bacteria	1039
70	Ga0070688_100532504	3300005365	Bacteria	890
71	Ga0070659_100011591	3300005366	Bacteria	6526
72	Ga0070659_100125346	3300005366	Bacteria	2083
73	Ga0070659_100342062	3300005366	Bacteria	1254
74	Ga0070659_100753821	3300005366	Bacteria	844
75	Ga0070667_100000034	3300005367	Bacteria	173652
76	Ga0070667_100001073	3300005367	Bacteria	25019
77	Ga0070667_100002881	3300005367	Bacteria	14788
78	Ga0070667_100383815	3300005367	Bacteria	1276
79	Ga0070667_100443989	3300005367	Bacteria	1185
80	Ga0070667_100661057	3300005367	Bacteria	965
81	Ga0070709_10009921	3300005434	Bacteria	5264
82	Ga0070709_10014784	3300005434	Bacteria	4423
83	Ga0070709_10053593	3300005434	Bacteria	2540
84	Ga0070709_10143904	3300005434	Bacteria	1641
85	Ga0070709_10194744	3300005434	Bacteria	1432
86	Ga0070709_11024620	3300005434	Bacteria	657
87	Ga0070714_100000290	3300005435	Bacteria	38379
88	Ga0070714_100002881	3300005435	Bacteria	12726
89	Ga0070714_100005488	3300005435	Bacteria	9681
90	Ga0070714_100012955	3300005435	Bacteria	6669
91	Ga0070714_100020406	3300005435	Bacteria	5411
92	Ga0070714_100028126	3300005435	Bacteria	4661
93	Ga0070714_100041134	3300005435	Bacteria	3899
94	Ga0070714_100076589	3300005435	Bacteria	2904
95	Ga0070714_100192184	3300005435	Bacteria	1863
96	Ga0070714_100217520	3300005435	Bacteria	1754
97	Ga0070714_100261962	3300005435	Bacteria	1601
98	Ga0070714_100290321	3300005435	Bacteria	1522
99	Ga0070714_100318186	3300005435	Bacteria	1454
100	Ga0070714_100337093	3300005435	Bacteria	1413
101	Ga0070714_100381170	3300005435	Bacteria	1329
102	Ga0070714_100645782	3300005435	Bacteria	1018
103	Ga0070714_100648299	3300005435	Bacteria	1016
104	Ga0070714_100857664	3300005435	Bacteria	881
105	Ga0070713_100018027	3300005436	Bacteria	5360
106	Ga0070713_100055086	3300005436	Bacteria	3303
107	Ga0070713_100107476	3300005436	Bacteria	2427
108	Ga0070713_100114173	3300005436	Bacteria	2359
109	Ga0070713_100127436	3300005436	Bacteria	2241
110	Ga0070713_100165475	3300005436	Bacteria	1977
111	Ga0070713_100306389	3300005436	Bacteria	1463
112	Ga0070713_100359429	3300005436	Bacteria	1352
113	Ga0070713_100424961	3300005436	Bacteria	1244
114	Ga0070713_100482817	3300005436	Bacteria	1167
115	Ga0070713_100688573	3300005436	Bacteria	975
116	Ga0070713_100749164	3300005436	Bacteria	934
117	Ga0070710_10000423	3300005437	Bacteria	19929
118	Ga0070710_10001481	3300005437	Bacteria	11057
119	Ga0070710_10030661	3300005437	Bacteria	2895
120	Ga0070710_10042345	3300005437	Bacteria	2517
121	Ga0070710_10047562	3300005437	Bacteria	2393
122	Ga0070710_10105794	3300005437	Bacteria	1683
123	Ga0070710_10333354	3300005437	Bacteria	999
124	Ga0070710_10388537	3300005437	Bacteria	932
125	Ga0070701_10564621	3300005438	Bacteria	748
126	Ga0070711_100007390	3300005439	Bacteria	6682
127	Ga0070711_100039162	3300005439	Bacteria	3191
128	Ga0070711_100093811	3300005439	Bacteria	2168
129	Ga0070711_100104175	3300005439	Bacteria	2069
130	Ga0070711_100147185	3300005439	Bacteria	1773
131	Ga0070711_100619049	3300005439	Bacteria	905
132	Ga0070711_100941710	3300005439	Bacteria	739
133	Ga0070705_100303480	3300005440	Bacteria	1145
134	Ga0070700_100001071	3300005441	Bacteria	13571
135	Ga0070700_100028795	3300005441	Bacteria	3307
136	Ga0070700_100047342	3300005441	Bacteria	2660
137	Ga0070694_100220739	3300005444	Bacteria	1421
138	Ga0070708_100016906	3300005445	Bacteria	6067
139	Ga0070708_100023790	3300005445	Bacteria	5213
140	Ga0070708_100086173	3300005445	Bacteria	2852
141	Ga0070708_100092998	3300005445	Bacteria	2748
142	Ga0070708_100191832	3300005445	Bacteria	1911
143	Ga0070708_100406690	3300005445	Bacteria	1283
144	Ga0070708_100470559	3300005445	Bacteria	1186
145	Ga0070708_100824599	3300005445	Bacteria	872
146	Ga0070708_101375271	3300005445	Bacteria	659
147	Ga0070663_100002171	3300005455	Bacteria	10972
148	Ga0070663_100075260	3300005455	Bacteria	2467
149	Ga0070663_100081837	3300005455	Bacteria	2374
150	Ga0070663_100126327	3300005455	Bacteria	1938
151	Ga0070663_100520138	3300005455	Bacteria	991
152	Ga0070678_100000075	3300005456	Bacteria	37282
153	Ga0070678_100107839	3300005456	Bacteria	2173
154	Ga0070678_100141294	3300005456	Bacteria	1927
155	Ga0070678_100545467	3300005456	Bacteria	1029
156	Ga0070662_100074480	3300005457	Bacteria	2511
157	Ga0070662_100208206	3300005457	Bacteria	1555
158	Ga0070681_10162925	3300005458	Bacteria	2154
159	Ga0068867_100081236	3300005459	Bacteria	2443
160	Ga0068867_100184763	3300005459	Bacteria	1659
161	Ga0070685_10042516	3300005466	Bacteria	2593
162	Ga0070685_10120697	3300005466	Bacteria	1627
163	Ga0070685_10558919	3300005466	Bacteria	818
164	Ga0070706_100001516	3300005467	Bacteria	24353
165	Ga0070706_100002685	3300005467	Bacteria	17812
166	Ga0070706_100003256	3300005467	Bacteria	16056
167	Ga0070706_100016626	3300005467	Bacteria	6796
168	Ga0070706_100024183	3300005467	Bacteria	5592
169	Ga0070706_100053119	3300005467	Bacteria	3740
170	Ga0070706_100059403	3300005467	Bacteria	3528
171	Ga0070706_100069190	3300005467	Bacteria	3265
172	Ga0070707_100000199	3300005468	Bacteria	60047
173	Ga0070707_100001332	3300005468	Bacteria	24324
174	Ga0070707_100021992	3300005468	Bacteria	6029
175	Ga0070707_100047832	3300005468	Bacteria	4096
176	Ga0070707_100060680	3300005468	Bacteria	3627
177	Ga0070707_100065880	3300005468	Bacteria	3480
178	Ga0070707_100071969	3300005468	Bacteria	3331
179	Ga0070707_100143075	3300005468	Bacteria	2327
180	Ga0070707_100353264	3300005468	Bacteria	1428
181	Ga0070707_100947408	3300005468	Bacteria	826
182	Ga0070707_101319945	3300005468	Bacteria	688
183	Ga0070698_100000223	3300005471	Bacteria	55997
184	Ga0070698_100000264	3300005471	Bacteria	52985
185	Ga0070698_100001732	3300005471	Bacteria	24325
186	Ga0070698_100004633	3300005471	Bacteria	15112
187	Ga0070698_100012790	3300005471	Bacteria	8889
188	Ga0070698_100041247	3300005471	Bacteria	4739
189	Ga0070698_100593517	3300005471	Bacteria	1048
190	Ga0070698_100685301	3300005471	Bacteria	967
191	Ga0070699_100031473	3300005518	Bacteria	4580
192	Ga0070699_100047031	3300005518	Bacteria	3733
193	Ga0070699_100098526	3300005518	Bacteria	2561
194	Ga0070699_100118174	3300005518	Bacteria	2330
195	Ga0070699_100690592	3300005518	Bacteria	932
196	Ga0070679_100045911	3300005530	Bacteria	4353
197	Ga0070679_101112356	3300005530	Bacteria	735
198	Ga0070684_100240100	3300005535	Bacteria	1655
199	Ga0070697_100027134	3300005536	Bacteria	4580
200	Ga0070697_100029409	3300005536	Bacteria	4405
201	Ga0070697_100036794	3300005536	Bacteria	3954
202	Ga0068853_100002826	3300005539	Bacteria	13152
203	Ga0068853_100114053	3300005539	Bacteria	2403
204	Ga0068853_100137923	3300005539	Bacteria	2188
205	Ga0068853_100370180	3300005539	Bacteria	1336
206	Ga0068853_100789507	3300005539	Bacteria	909
207	Ga0068853_100824853	3300005539	Bacteria	889
208	Ga0070672_100445547	3300005543	Bacteria	1115
209	Ga0070672_100550282	3300005543	Bacteria	1002
210	Ga0070686_100022509	3300005544	Bacteria	3754
211	Ga0070686_100042792	3300005544	Bacteria	2839
212	Ga0070686_100125696	3300005544	Bacteria	1767
213	Ga0070696_100006661	3300005546	Bacteria	7716
214	Ga0070696_100166714	3300005546	Bacteria	1626
215	Ga0070696_100480564	3300005546	Bacteria	985
216	Ga0070665_100010682	3300005548	Bacteria	9294
217	Ga0070665_100025789	3300005548	Bacteria	5920
218	Ga0070665_100030748	3300005548	Bacteria	5403
219	Ga0070665_100033302	3300005548	Bacteria	5185
220	Ga0070665_100076253	3300005548	Bacteria	3360
221	Ga0070665_100079296	3300005548	Bacteria	3289
222	Ga0070665_100103991	3300005548	Bacteria	2843
223	Ga0070665_100345739	3300005548	Bacteria	1492
224	Ga0070665_100509718	3300005548	Bacteria	1214
225	Ga0070704_100000415	3300005549	Bacteria	19786
226	Ga0070704_100081724	3300005549	Bacteria	2381
227	Ga0070704_101058115	3300005549	Bacteria	736
228	Ga0068855_100003272	3300005563	Bacteria	19828
229	Ga0068855_100046848	3300005563	Bacteria	5110
230	Ga0068855_100216874	3300005563	Bacteria	2148
231	Ga0068855_101013520	3300005563	Bacteria	872
232	Ga0070664_100208411	3300005564	Bacteria	1746
233	Ga0068857_100540980	3300005577	Bacteria	1096
234	Ga0068854_100000209	3300005578	Bacteria	39503
235	Ga0068854_100012492	3300005578	Bacteria	5564
236	Ga0068854_100075993	3300005578	Bacteria	2467
237	Ga0068856_100017537	3300005614	Bacteria	6938
238	Ga0068856_100131615	3300005614	Bacteria	2506
239	Ga0068856_100560610	3300005614	Bacteria	1164
240	Ga0068856_100874325	3300005614	Bacteria	918
241	Ga0070702_100019075	3300005615	Bacteria	3568
242	Ga0070702_100055497	3300005615	Bacteria	2284
243	Ga0070702_100183969	3300005615	Bacteria	1369
244	Ga0068852_100025393	3300005616	Bacteria	4801
245	Ga0068852_100027005	3300005616	Bacteria	4673
246	Ga0068852_100034595	3300005616	Bacteria	4205
247	Ga0068852_100200463	3300005616	Bacteria	1888
248	Ga0068852_100308138	3300005616	Bacteria	1534
249	Ga0068859_100000228	3300005617	Bacteria	55135
250	Ga0068859_100006371	3300005617	Bacteria	11971
251	Ga0068859_100197276	3300005617	Bacteria	2097
252	Ga0068864_100071757	3300005618	Bacteria	3016
253	Ga0068864_100184186	3300005618	Bacteria	1911
254	Ga0068864_100324606	3300005618	Bacteria	1446
255	Ga0068864_100749495	3300005618	Bacteria	957
256	Ga0068866_10000202	3300005718	Bacteria	27989
257	Ga0068866_10103147	3300005718	Bacteria	1577
258	Ga0068866_10260875	3300005718	Bacteria	1065
259	Ga0068861_100001529	3300005719	Bacteria	14652
260	Ga0068861_100086641	3300005719	Bacteria	2463
261	Ga0068861_100099881	3300005719	Bacteria	2305
262	Ga0068861_100372858	3300005719	Bacteria	1258
263	Ga0068861_100572428	3300005719	Bacteria	1033
264	Ga0068851_10040150	3300005834	Bacteria	2352
265	Ga0068851_10244409	3300005834	Bacteria	1016
266	Ga0068870_10119783	3300005840	Bacteria	1514
267	Ga0068863_100002759	3300005841	Bacteria	17397
268	Ga0068863_100027391	3300005841	Bacteria	5435
269	Ga0068863_100109704	3300005841	Bacteria	2627
270	Ga0068863_100179210	3300005841	Bacteria	2034
271	Ga0068863_100248869	3300005841	Bacteria	1716
272	Ga0068863_100284467	3300005841	Bacteria	1603
273	Ga0068858_100022857	3300005842	Bacteria	5833
274	Ga0068858_100059181	3300005842	Bacteria	3541
275	Ga0068858_100168230	3300005842	Bacteria	2066
276	Ga0068858_100176822	3300005842	Bacteria	2014
277	Ga0068858_100216359	3300005842	Bacteria	1814
278	Ga0068858_100576368	3300005842	Bacteria	1090
279	Ga0068860_100000011	3300005843	Bacteria	328172
280	Ga0068860_100001399	3300005843	Bacteria	26149
281	Ga0068860_100083428	3300005843	Bacteria	3039
282	Ga0068860_100201871	3300005843	Bacteria	1927
283	Ga0068860_100483909	3300005843	Bacteria	1234
284	Ga0068860_100608483	3300005843	Bacteria	1099
285	Ga0068860_100817697	3300005843	Bacteria	945
286	Ga0068862_100000021	3300005844	Bacteria	218035
287	Ga0068862_100000139	3300005844	Bacteria	82475
288	Ga0068862_100009253	3300005844	Bacteria	8157
289	Ga0068862_100883927	3300005844	Bacteria	877
290	Ga0081455_10041564	3300005937	Bacteria	4041
291	Ga0081455_10048108	3300005937	Bacteria	3687
292	Ga0081455_10169127	3300005937	Bacteria	1667
293	Ga0081455_10237493	3300005937	Bacteria	1341
294	Ga0081538_10060434	3300005981	Bacteria	2179
295	Ga0081540_1001223	3300005983	Bacteria	22441
296	Ga0081540_1028867	3300005983	Bacteria	3103
297	Ga0081540_1063160	3300005983	Bacteria	1754
298	Ga0081539_10001412	3300005985	Bacteria	41361
299	Ga0081539_10086905	3300005985	Bacteria	1626
300	Ga0070717_10021713	3300006028	Bacteria	5062
301	Ga0070717_10076455	3300006028	Bacteria	2802
302	Ga0070717_10083176	3300006028	Bacteria	2691
303	Ga0070717_10147916	3300006028	Bacteria	2031
304	Ga0070717_10266166	3300006028	Bacteria	1517
305	Ga0070717_10337373	3300006028	Bacteria	1345
306	Ga0070717_10358895	3300006028	Bacteria	1304
307	Ga0070717_10434948	3300006028	Bacteria	1181
308	Ga0070717_10764394	3300006028	Bacteria	878
309	Ga0070717_10897522	3300006028	Bacteria	807
310	Ga0075365_10000694	3300006038	Bacteria	13537
311	Ga0075365_10003722	3300006038	Bacteria	7928
312	Ga0075365_10021166	3300006038	Bacteria	4051
313	Ga0075365_10031612	3300006038	Bacteria	3396
314	Ga0075365_10108938	3300006038	Bacteria	1902
315	Ga0075365_10191153	3300006038	Bacteria	1433
316	Ga0075365_10218666	3300006038	Bacteria	1336
317	Ga0075365_10240146	3300006038	Bacteria	1272
318	Ga0075365_10272560	3300006038	Bacteria	1190
319	Ga0075365_10614317	3300006038	Bacteria	769
320	Ga0075365_10646570	3300006038	Bacteria	747
321	Ga0075368_10031885	3300006042	Bacteria	2045
322	Ga0075363_100002442	3300006048	Bacteria	7594
323	Ga0075363_100009800	3300006048	Bacteria	4515
324	Ga0075363_100012710	3300006048	Bacteria	4063
325	Ga0075363_100070171	3300006048	Bacteria	1902
326	Ga0075363_100120930	3300006048	Bacteria	1462
327	Ga0075363_100148611	3300006048	Bacteria	1322
328	Ga0075363_100159540	3300006048	Bacteria	1276
329	Ga0075363_100402591	3300006048	Bacteria	804
330	Ga0075364_10000205	3300006051	Bacteria	27728
331	Ga0075364_10016218	3300006051	Bacteria	4634
332	Ga0075364_10017530	3300006051	Bacteria	4475
333	Ga0075364_10019402	3300006051	Bacteria	4267
334	Ga0075364_10071791	3300006051	Bacteria	2281
335	Ga0075364_10117711	3300006051	Bacteria	1777
336	Ga0075364_10123872	3300006051	Bacteria	1731
337	Ga0075364_10167195	3300006051	Bacteria	1486
338	Ga0075364_10177082	3300006051	Bacteria	1443
339	Ga0075364_10363059	3300006051	Bacteria	987
340	Ga0075432_10119514	3300006058	Bacteria	989
341	Ga0070715_10001558	3300006163	Bacteria	6717
342	Ga0070715_10014337	3300006163	Bacteria	2933
343	Ga0070715_10031874	3300006163	Bacteria	2143
344	Ga0070715_10067410	3300006163	Bacteria	1589
345	Ga0070715_10068295	3300006163	Bacteria	1580
346	Ga0070716_100001175	3300006173	Bacteria	11522
347	Ga0070716_100002321	3300006173	Bacteria	8762
348	Ga0070716_100005247	3300006173	Bacteria	6263
349	Ga0070716_100015433	3300006173	Bacteria	3924
350	Ga0070716_100054266	3300006173	Bacteria	2289
351	Ga0070716_100419220	3300006173	Bacteria	968
352	Ga0070716_100655573	3300006173	Bacteria	796
353	Ga0070712_100001001	3300006175	Bacteria	17008
354	Ga0070712_100011324	3300006175	Bacteria	5651
355	Ga0070712_100047349	3300006175	Bacteria	2975
356	Ga0070712_100087142	3300006175	Bacteria	2277
357	Ga0070712_100153339	3300006175	Bacteria	1771
358	Ga0070712_100223262	3300006175	Bacteria	1492
359	Ga0070712_100302259	3300006175	Bacteria	1295
360	Ga0070712_100330403	3300006175	Bacteria	1242
361	Ga0070712_100651827	3300006175	Bacteria	895
362	Ga0075362_10017019	3300006177	Bacteria	2988
363	Ga0075362_10020161	3300006177	Bacteria	2783
364	Ga0075362_10044481	3300006177	Bacteria	1969
365	Ga0075362_10060986	3300006177	Bacteria	1706
366	Ga0075362_10076563	3300006177	Bacteria	1536
367	Ga0075362_10090113	3300006177	Bacteria	1423
368	Ga0075362_10156975	3300006177	Bacteria	1094
369	Ga0075367_10006967	3300006178	Bacteria	5757
370	Ga0075367_10024302	3300006178	Bacteria	3417
371	Ga0075367_10074800	3300006178	Bacteria	2042
372	Ga0075367_10083201	3300006178	Bacteria	1938
373	Ga0075367_10090173	3300006178	Bacteria	1864
374	Ga0075367_10165681	3300006178	Bacteria	1375
375	Ga0075369_10002919	3300006186	Bacteria	6169
376	Ga0075369_10004542	3300006186	Bacteria	5138
377	Ga0075369_10010160	3300006186	Bacteria	3677
378	Ga0075369_10091123	3300006186	Bacteria	1361
379	Ga0075369_10105037	3300006186	Bacteria	1269
380	Ga0075369_10123166	3300006186	Bacteria	1175
381	Ga0075369_10137193	3300006186	Bacteria	1114
382	Ga0075369_10158863	3300006186	Bacteria	1035
383	Ga0075369_10191703	3300006186	Bacteria	942
384	Ga0075366_10048468	3300006195	Bacteria	2520
385	Ga0075366_10346100	3300006195	Bacteria	912
386	Ga0097621_100030638	3300006237	Bacteria	4261
387	Ga0097621_100234143	3300006237	Bacteria	1604
388	Ga0097621_100432678	3300006237	Bacteria	1183
389	Ga0097621_100852268	3300006237	Bacteria	847
390	Ga0075370_10011642	3300006353	Bacteria	4628
391	Ga0075370_10059823	3300006353	Bacteria	2169
392	Ga0075370_10138488	3300006353	Bacteria	1422
393	Ga0075370_10223713	3300006353	Bacteria	1112
394	Ga0075370_10543395	3300006353	Bacteria	702
395	Ga0068871_100037007	3300006358	Bacteria	3890
396	Ga0068871_100070856	3300006358	Bacteria	2866
397	Ga0068871_100093506	3300006358	Bacteria	2509
398	Ga0068871_100289590	3300006358	Bacteria	1435
399	Ga0068871_100311962	3300006358	Bacteria	1383
400	Ga0075428_100005462	3300006844	Bacteria	14134
401	Ga0075428_100008753	3300006844	Bacteria	11226
402	Ga0075428_100850149	3300006844	Bacteria	969
403	Ga0075430_100000139	3300006846	Bacteria	46337
404	Ga0075430_100113867	3300006846	Bacteria	2254
405	Ga0075431_100036061	3300006847	Bacteria	5094
406	Ga0075431_100372468	3300006847	Bacteria	1433
407	Ga0075434_100339297	3300006871	Bacteria	1523
408	Ga0075434_100413140	3300006871	Bacteria	1370
409	Ga0068865_100000661	3300006881	Bacteria	19433
410	Ga0068865_100085135	3300006881	Bacteria	2280
411	Ga0068865_100154692	3300006881	Bacteria	1743
412	Ga0068865_100175119	3300006881	Bacteria	1648
413	Ga0068865_100256400	3300006881	Bacteria	1383
414	Ga0075436_100052435	3300006914	Bacteria	2816
415	Ga0075436_100502891	3300006914	Bacteria	887
416	Ga0075436_100533566	3300006914	Bacteria	860
417	Ga0097620_100000228	3300006931	Bacteria	55135
418	Ga0097620_100006372	3300006931	Bacteria	11971
419	Ga0097620_100021730	3300006931	Bacteria	6437
420	Ga0097620_100197257	3300006931	Bacteria	2097
421	Ga0075435_100072366	3300007076	Bacteria	2816
422	Ga0099794_10184448	3300007265	Bacteria	1066
423	Ga0099795_10071956	3300007788	Bacteria	1306
424	Ga0099795_10122874	3300007788	Bacteria	1040
425	Ga0105244_10183845	3300009036	Bacteria	990
426	Ga0105250_10052083	3300009092	Bacteria	1642
427	Ga0105250_10061639	3300009092	Bacteria	1508
428	Ga0105240_10005833	3300009093	Bacteria	18256
429	Ga0105240_10462159	3300009093	Bacteria	1418
430	Ga0111539_10015509	3300009094	Bacteria	9474
431	Ga0111539_11082232	3300009094	Bacteria	932
432	Ga0111539_11106111	3300009094	Bacteria	921
433	Ga0105245_10064465	3300009098	Bacteria	3311
434	Ga0105245_10094170	3300009098	Bacteria	2761
435	Ga0105245_10263886	3300009098	Bacteria	1677
436	Ga0105245_10765539	3300009098	Bacteria	1002
437	Ga0105245_10956246	3300009098	Bacteria	900
438	Ga0105247_10000067	3300009101	Bacteria	118585
439	Ga0105247_10000092	3300009101	Bacteria	97046
440	Ga0105247_10000164	3300009101	Bacteria	64953
441	Ga0105247_10080146	3300009101	Bacteria	2056
442	Ga0105247_10117059	3300009101	Bacteria	1722
443	Ga0105247_10192405	3300009101	Bacteria	1366
444	Ga0105247_10244299	3300009101	Bacteria	1224
445	Ga0105247_10411822	3300009101	Bacteria	966
446	Ga0114129_10002252	3300009147	Bacteria	26655
447	Ga0114129_10411265	3300009147	Bacteria	1781
448	Ga0114129_10779534	3300009147	Bacteria	1222
449	Ga0105243_10001036	3300009148	Bacteria	25549
450	Ga0105243_10038353	3300009148	Bacteria	3731
451	Ga0105243_10047614	3300009148	Bacteria	3376
452	Ga0105243_10068550	3300009148	Bacteria	2859
453	Ga0105241_10002402	3300009174	Bacteria	14064
454	Ga0105241_10159396	3300009174	Bacteria	1853
455	Ga0105241_10732833	3300009174	Bacteria	905
456	Ga0105242_10000597	3300009176	Bacteria	28284
457	Ga0105242_10021864	3300009176	Bacteria	5027
458	Ga0105242_10284724	3300009176	Bacteria	1503
459	Ga0105242_11169482	3300009176	Bacteria	787
460	Ga0105248_10000040	3300009177	Bacteria	172452
461	Ga0105248_10000162	3300009177	Bacteria	78030
462	Ga0105248_10005718	3300009177	Bacteria	13656
463	Ga0105248_10016800	3300009177	Bacteria	8057
464	Ga0105248_10035423	3300009177	Bacteria	5583
465	Ga0105248_10179329	3300009177	Bacteria	2387
466	Ga0105248_10198131	3300009177	Bacteria	2263
467	Ga0105248_10331667	3300009177	Bacteria	1713
468	Ga0105248_10448713	3300009177	Bacteria	1453
469	Ga0105248_10580716	3300009177	Bacteria	1264
470	Ga0105248_10710739	3300009177	Bacteria	1134
471	Ga0105237_10040797	3300009545	Bacteria	4681
472	Ga0105237_10047910	3300009545	Bacteria	4297
473	Ga0105237_10156010	3300009545	Bacteria	2280
474	Ga0105237_10157556	3300009545	Bacteria	2268
475	Ga0105237_10217275	3300009545	Bacteria	1912
476	Ga0105237_10771799	3300009545	Bacteria	968
477	Ga0105238_10005065	3300009551	Bacteria	13031
478	Ga0105238_10368700	3300009551	Bacteria	1426
479	Ga0105238_10506305	3300009551	Bacteria	1209
480	Ga0105238_10519025	3300009551	Bacteria	1194
481	Ga0105238_10628291	3300009551	Bacteria	1083
482	Ga0105249_10000001	3300009553	Bacteria	504948
483	Ga0105249_10001140	3300009553	Bacteria	23514
484	Ga0105249_10025675	3300009553	Bacteria	5306
485	Ga0105249_10065707	3300009553	Bacteria	3338
486	Ga0105249_10239831	3300009553	Bacteria	1792
487	Ga0105249_10286728	3300009553	Bacteria	1646
488	Ga0105249_10401399	3300009553	Bacteria	1401
489	Ga0105239_10019480	3300010375	Bacteria	7490
490	Ga0105239_10046724	3300010375	Bacteria	4745
491	Ga0105239_10090134	3300010375	Bacteria	3383
492	Ga0105239_10220435	3300010375	Bacteria	2127
493	Ga0105239_10237965	3300010375	Bacteria	2043
494	Ga0105239_10328215	3300010375	Bacteria	1726
495	Ga0105239_10420417	3300010375	Bacteria	1514
496	Ga0105239_10645281	3300010375	Bacteria	1209
497	Ga0105239_10678410	3300010375	Bacteria	1178
498	Ga0105239_10723421	3300010375	Bacteria	1139
499	Ga0105246_10065212	3300011119	Bacteria	2546
500	Ga0105246_10206332	3300011119	Bacteria	1531
501	Ga0105246_10485577	3300011119	Bacteria	1046
502	Ga0105246_10950907	3300011119	Bacteria	774
503	Ga0157373_10576755	3300013100	Bacteria	817
504	Ga0157370_10043797	3300013104	Bacteria	4305
505	Ga0157370_10187673	3300013104	Bacteria	1919
506	Ga0157370_10216878	3300013104	Bacteria	1773
507	Ga0157370_10367347	3300013104	Bacteria	1326
508	Ga0157370_10386491	3300013104	Bacteria	1289
509	Ga0157370_10740152	3300013104	Bacteria	896
510	Ga0157369_10018866	3300013105	Bacteria	7729
511	Ga0157369_10134426	3300013105	Bacteria	2619
512	Ga0157369_10164282	3300013105	Bacteria	2342
513	Ga0157369_10196725	3300013105	Bacteria	2117
514	Ga0157369_10244097	3300013105	Bacteria	1875
515	Ga0157369_10297951	3300013105	Bacteria	1678
516	Ga0157369_10982904	3300013105	Bacteria	864
517	Ga0157374_10032596	3300013296	Bacteria	4746
518	Ga0157374_10078142	3300013296	Bacteria	3133
519	Ga0157374_10086959	3300013296	Bacteria	2975
520	Ga0157374_10476467	3300013296	Bacteria	1251
521	Ga0157378_10002483	3300013297	Bacteria	16403
522	Ga0157378_10059112	3300013297	Bacteria	3420
523	Ga0157378_10401738	3300013297	Bacteria	1350
524	Ga0157378_10773049	3300013297	Bacteria	984
525	Ga0163162_10018721	3300013306	Bacteria	6787
526	Ga0163162_10066182	3300013306	Bacteria	3662
527	Ga0163162_10116505	3300013306	Bacteria	2772
528	Ga0163162_10307995	3300013306	Bacteria	1716
529	Ga0163162_10403608	3300013306	Bacteria	1499
530	Ga0163162_10526825	3300013306	Bacteria	1311
531	Ga0163162_10736457	3300013306	Bacteria	1106
532	Ga0163162_11389388	3300013306	Bacteria	799
533	Ga0157372_10002385	3300013307	Bacteria	20339
534	Ga0157372_10214655	3300013307	Bacteria	2230
535	Ga0157372_10260108	3300013307	Bacteria	2015
536	Ga0157372_10393913	3300013307	Bacteria	1614
537	Ga0157372_10835875	3300013307	Bacteria	1069
538	Ga0157372_11168237	3300013307	Bacteria	890
539	Ga0157375_10000305	3300013308	Bacteria	44365
540	Ga0157375_10011389	3300013308	Bacteria	7851
541	Ga0157375_10111370	3300013308	Bacteria	2836
542	Ga0157375_10120131	3300013308	Bacteria	2736
543	Ga0157375_10215018	3300013308	Bacteria	2080
544	Ga0157375_10326352	3300013308	Bacteria	1700
545	Ga0157375_10425929	3300013308	Bacteria	1493
546	Ga0157375_10535596	3300013308	Bacteria	1334
547	Ga0163163_10004278	3300014325	Bacteria	12165
548	Ga0163163_10008973	3300014325	Bacteria	8908
549	Ga0163163_10157183	3300014325	Bacteria	2318
550	Ga0163163_10224364	3300014325	Bacteria	1928
551	Ga0163163_10332554	3300014325	Bacteria	1574
552	Ga0163163_10865255	3300014325	Bacteria	967
553	Ga0163163_11257601	3300014325	Bacteria	802
554	Ga0157380_10000732	3300014326	Bacteria	20467
555	Ga0157380_10104479	3300014326	Bacteria	2366
556	Ga0157380_10441714	3300014326	Bacteria	1247
557	Ga0182008_10094938	3300014497	Bacteria	1471
558	Ga0182008_10229283	3300014497	Bacteria	952
559	Ga0157377_10085873	3300014745	Bacteria	1848
560	Ga0157377_10094831	3300014745	Bacteria	1768
561	Ga0157377_10251506	3300014745	Bacteria	1146
562	Ga0157377_10352713	3300014745	Bacteria	988
563	Ga0157379_10010556	3300014968	Bacteria	8054
564	Ga0157379_10022633	3300014968	Bacteria	5568
565	Ga0157379_10041960	3300014968	Bacteria	4083
566	Ga0157379_10084885	3300014968	Bacteria	2837
567	Ga0157379_10946809	3300014968	Bacteria	819
568	Ga0157379_10966445	3300014968	Bacteria	811
569	Ga0157376_10031111	3300014969	Bacteria	4269
570	Ga0157376_10193996	3300014969	Bacteria	1864
571	Ga0157376_10209724	3300014969	Bacteria	1798
572	Ga0157376_10723062	3300014969	Bacteria	1003
573	Ga0182006_1040276	3300015261	Bacteria	1840
574	Ga0182007_10223356	3300015262	Bacteria	666
575	Ga0183367_1017	3300015688	Bacteria	126691
576	Ga0163161_10004574	3300017792	Bacteria	9631
577	Ga0163161_10091270	3300017792	Bacteria	2254
578	Ga0163161_10145393	3300017792	Bacteria	1798
579	Ga0163161_10265526	3300017792	Bacteria	1342
580	Ga0163161_10298619	3300017792	Bacteria	1268
581	Ga0163161_10661597	3300017792	Bacteria	866
582	Ga0197907_10415971	3300020069	Bacteria	2567
583	Ga0197907_10943880	3300020069	Bacteria	1459
584	Ga0197907_11133073	3300020069	Bacteria	2318
585	Ga0197907_11144367	3300020069	Bacteria	936
586	Ga0206356_10897612	3300020070	Bacteria	1334
587	Ga0206356_11062788	3300020070	Bacteria	1218
588	Ga0206356_11180327	3300020070	Bacteria	997
589	Ga0206349_1518951	3300020075	Bacteria	880
590	Ga0206355_1140562	3300020076	Bacteria	944
591	Ga0206355_1702914	3300020076	Bacteria	875
592	Ga0206351_10208494	3300020077	Bacteria	659
593	Ga0206351_10218676	3300020077	Bacteria	1246
594	Ga0206352_10169214	3300020078	Bacteria	1006
595	Ga0206352_10868468	3300020078	Bacteria	813
596	Ga0206350_10966998	3300020080	Bacteria	747
597	Ga0206354_11061542	3300020081	Bacteria	1314
598	Ga0206353_10883820	3300020082	Bacteria	2349
599	Ga0206353_11554719	3300020082	Bacteria	1933
600	Ga0206353_11888474	3300020082	Bacteria	1275
601	Ga0154015_1045101	3300020610	Bacteria	843
602	Ga0154015_1299529	3300020610	Bacteria	1062
603	Ga0213872_10092250	3300021361	Bacteria	1355
604	Ga0213876_10000817	3300021384	Bacteria	21042
605	Ga0213876_10038892	3300021384	Bacteria	2512
606	Ga0213876_10088889	3300021384	Bacteria	1636
607	Ga0213876_10095326	3300021384	Bacteria	1576
608	Ga0213875_10001927	3300021388	Bacteria	12850
609	Ga0213875_10003551	3300021388	Bacteria	8854
610	Ga0213875_10015002	3300021388	Bacteria	3774
611	Ga0213875_10018051	3300021388	Bacteria	3404
612	Ga0213871_10046295	3300021441	Bacteria	1181
613	Ga0224712_10005109	3300022467	Bacteria	3618
614	Ga0224712_10363534	3300022467	Bacteria	685
615	Ga0224572_1015209	3300024225	Bacteria	1472
616	Ga0209677_109996	3300025253	Bacteria	1631
617	Ga0209148_1000123	3300025254	Bacteria	185406
618	Ga0209233_1008173	3300025261	Bacteria	3258
619	Ga0209455_1000129	3300025272	Bacteria	161691
620	Ga0209025_1041064	3300025294	Bacteria	1988
621	Ga0207426_1030467	3300025302	Bacteria	1768
622	Ga0207426_1048136	3300025302	Bacteria	1282
623	Ga0209051_1000200	3300025303	Bacteria	106484
624	Ga0209051_1000826	3300025303	Bacteria	32035
625	Ga0209051_1012923	3300025303	Bacteria	4006
626	Ga0209051_1062830	3300025303	Bacteria	1159
627	Ga0207656_10169406	3300025321	Bacteria	1043
628	Ga0207656_10206568	3300025321	Bacteria	950
629	Ga0207696_1059485	3300025711	Bacteria	1077
630	Ga0207653_10052867	3300025885	Bacteria	1355
631	Ga0207692_10000263	3300025898	Bacteria	18024
632	Ga0207692_10002656	3300025898	Bacteria	6879
633	Ga0207692_10003293	3300025898	Bacteria	6295
634	Ga0207692_10012726	3300025898	Bacteria	3622
635	Ga0207692_10042085	3300025898	Bacteria	2265
636	Ga0207692_10076931	3300025898	Bacteria	1774
637	Ga0207692_10235085	3300025898	Bacteria	1092
638	Ga0207642_10000164	3300025899	Bacteria	19066
639	Ga0207642_10169248	3300025899	Bacteria	1180
640	Ga0207642_10288960	3300025899	Bacteria	946
641	Ga0207710_10000094	3300025900	Bacteria	118590
642	Ga0207710_10000178	3300025900	Bacteria	64962
643	Ga0207710_10101917	3300025900	Bacteria	1355
644	Ga0207710_10204070	3300025900	Bacteria	977
645	Ga0207710_10247292	3300025900	Bacteria	891
646	Ga0207710_10360484	3300025900	Bacteria	742
647	Ga0207688_10000096	3300025901	Bacteria	34565
648	Ga0207688_10000339	3300025901	Bacteria	21592
649	Ga0207688_10093814	3300025901	Bacteria	1726
650	Ga0207688_10160973	3300025901	Bacteria	1330
651	Ga0207688_10174021	3300025901	Bacteria	1281
652	Ga0207680_10016867	3300025903	Bacteria	3846
653	Ga0207680_10048469	3300025903	Bacteria	2524
654	Ga0207647_10002749	3300025904	Bacteria	13274
655	Ga0207647_10034535	3300025904	Bacteria	3227
656	Ga0207647_10117645	3300025904	Bacteria	1568
657	Ga0207647_10120868	3300025904	Bacteria	1544
658	Ga0207647_10507161	3300025904	Bacteria	672
659	Ga0207685_10005172	3300025905	Bacteria	3412
660	Ga0207685_10007722	3300025905	Bacteria	3017
661	Ga0207685_10010811	3300025905	Bacteria	2715
662	Ga0207685_10016497	3300025905	Bacteria	2366
663	Ga0207685_10033161	3300025905	Bacteria	1864
664	Ga0207685_10051456	3300025905	Bacteria	1591
665	Ga0207685_10052146	3300025905	Bacteria	1584
666	Ga0207699_10000610	3300025906	Bacteria	17490
667	Ga0207699_10001927	3300025906	Bacteria	9780
668	Ga0207699_10007984	3300025906	Bacteria	5197
669	Ga0207699_10032935	3300025906	Bacteria	2924
670	Ga0207699_10042144	3300025906	Bacteria	2642
671	Ga0207699_10168856	3300025906	Bacteria	1462
672	Ga0207699_10176955	3300025906	Bacteria	1431
673	Ga0207699_10481441	3300025906	Bacteria	894
674	Ga0207645_10074704	3300025907	Bacteria	2170
675	Ga0207645_10216184	3300025907	Bacteria	1263
676	Ga0207643_10031868	3300025908	Bacteria	2941
677	Ga0207643_10201844	3300025908	Bacteria	1211
678	Ga0207643_10240216	3300025908	Bacteria	1113
679	Ga0207643_10525344	3300025908	Bacteria	758
680	Ga0207705_10056162	3300025909	Bacteria	2838
681	Ga0207684_10001106	3300025910	Bacteria	30154
682	Ga0207684_10001458	3300025910	Bacteria	25491
683	Ga0207684_10003530	3300025910	Bacteria	15239
684	Ga0207684_10041510	3300025910	Bacteria	3901
685	Ga0207684_10093377	3300025910	Bacteria	2566
686	Ga0207684_10169859	3300025910	Bacteria	1880
687	Ga0207684_10552982	3300025910	Bacteria	985
688	Ga0207684_10685694	3300025910	Bacteria	871
689	Ga0207654_10011204	3300025911	Bacteria	4568
690	Ga0207707_10297000	3300025912	Bacteria	1397
691	Ga0207695_10002892	3300025913	Bacteria	24881
692	Ga0207671_10000492	3300025914	Bacteria	53745
693	Ga0207671_10008904	3300025914	Bacteria	8451
694	Ga0207671_10182215	3300025914	Bacteria	1635
695	Ga0207671_10237311	3300025914	Bacteria	1432
696	Ga0207693_10000634	3300025915	Bacteria	31449
697	Ga0207693_10000717	3300025915	Bacteria	29831
698	Ga0207693_10017906	3300025915	Bacteria	5648
699	Ga0207693_10022433	3300025915	Bacteria	5016
700	Ga0207693_10024942	3300025915	Bacteria	4742
701	Ga0207693_10025360	3300025915	Bacteria	4701
702	Ga0207693_10113273	3300025915	Bacteria	2128
703	Ga0207693_10168294	3300025915	Bacteria	1726
704	Ga0207693_10177806	3300025915	Bacteria	1674
705	Ga0207693_10192770	3300025915	Bacteria	1603
706	Ga0207663_10004272	3300025916	Bacteria	7091
707	Ga0207663_10026843	3300025916	Bacteria	3348
708	Ga0207663_10036412	3300025916	Bacteria	2960
709	Ga0207663_10080754	3300025916	Bacteria	2127
710	Ga0207663_10103941	3300025916	Bacteria	1914
711	Ga0207663_10117588	3300025916	Bacteria	1814
712	Ga0207663_10198217	3300025916	Bacteria	1446
713	Ga0207663_10215982	3300025916	Bacteria	1393
714	Ga0207663_10233833	3300025916	Bacteria	1344
715	Ga0207660_10151756	3300025917	Bacteria	1780
716	Ga0207662_10087424	3300025918	Bacteria	1912
717	Ga0207657_10036453	3300025919	Bacteria	4402
718	Ga0207657_10039367	3300025919	Bacteria	4202
719	Ga0207657_10046993	3300025919	Bacteria	3778
720	Ga0207652_10142808	3300025921	Bacteria	2141
721	Ga0207652_10616268	3300025921	Bacteria	972
722	Ga0207646_10000278	3300025922	Bacteria	70066
723	Ga0207646_10002274	3300025922	Bacteria	22856
724	Ga0207646_10032456	3300025922	Bacteria	4726
725	Ga0207646_10048454	3300025922	Bacteria	3809
726	Ga0207646_10075177	3300025922	Bacteria	3018
727	Ga0207646_10094625	3300025922	Bacteria	2676
728	Ga0207646_10101784	3300025922	Bacteria	2575
729	Ga0207646_10122262	3300025922	Bacteria	2339
730	Ga0207646_10791861	3300025922	Bacteria	845
731	Ga0207646_11109684	3300025922	Bacteria	696
732	Ga0207681_10028367	3300025923	Bacteria	3625
733	Ga0207681_10671500	3300025923	Bacteria	860
734	Ga0207694_10002567	3300025924	Bacteria	14741
735	Ga0207694_10099420	3300025924	Bacteria	2304
736	Ga0207650_10070031	3300025925	Bacteria	2636
737	Ga0207659_10038839	3300025926	Bacteria	3314
738	Ga0207659_10207574	3300025926	Bacteria	1568
739	Ga0207687_10001922	3300025927	Bacteria	14298
740	Ga0207687_10017942	3300025927	Bacteria	4670
741	Ga0207687_10442494	3300025927	Bacteria	1077
742	Ga0207700_10003840	3300025928	Bacteria	8778
743	Ga0207700_10004108	3300025928	Bacteria	8538
744	Ga0207700_10005449	3300025928	Bacteria	7620
745	Ga0207700_10007536	3300025928	Bacteria	6660
746	Ga0207700_10010589	3300025928	Bacteria	5829
747	Ga0207700_10013898	3300025928	Bacteria	5259
748	Ga0207700_10028540	3300025928	Bacteria	3924
749	Ga0207700_10033437	3300025928	Bacteria	3679
750	Ga0207700_10038204	3300025928	Bacteria	3483
751	Ga0207700_10076566	3300025928	Bacteria	2596
752	Ga0207700_10088796	3300025928	Bacteria	2435
753	Ga0207700_10123859	3300025928	Bacteria	2099
754	Ga0207700_10249995	3300025928	Bacteria	1514
755	Ga0207700_10273605	3300025928	Bacteria	1450
756	Ga0207700_10836013	3300025928	Bacteria	824
757	Ga0207664_10001479	3300025929	Bacteria	15414
758	Ga0207664_10007686	3300025929	Bacteria	7482
759	Ga0207664_10008327	3300025929	Bacteria	7225
760	Ga0207664_10015082	3300025929	Bacteria	5597
761	Ga0207664_10018328	3300025929	Bacteria	5150
762	Ga0207664_10025086	3300025929	Bacteria	4484
763	Ga0207664_10026538	3300025929	Bacteria	4379
764	Ga0207664_10034325	3300025929	Bacteria	3906
765	Ga0207664_10071267	3300025929	Bacteria	2799
766	Ga0207664_10122594	3300025929	Bacteria	2177
767	Ga0207664_10184588	3300025929	Bacteria	1792
768	Ga0207664_10196436	3300025929	Bacteria	1739
769	Ga0207664_10200232	3300025929	Bacteria	1723
770	Ga0207664_10207824	3300025929	Bacteria	1692
771	Ga0207664_10550767	3300025929	Bacteria	1035
772	Ga0207664_10951042	3300025929	Bacteria	770
773	Ga0207664_11271316	3300025929	Bacteria	655
774	Ga0207644_10010272	3300025931	Bacteria	6169
775	Ga0207644_10014182	3300025931	Bacteria	5331
776	Ga0207644_10072405	3300025931	Bacteria	2524
777	Ga0207644_10125771	3300025931	Bacteria	1957
778	Ga0207644_10690296	3300025931	Bacteria	851
779	Ga0207690_10068287	3300025932	Bacteria	2441
780	Ga0207690_10198126	3300025932	Bacteria	1523
781	Ga0207690_10312034	3300025932	Bacteria	1234
782	Ga0207690_10388743	3300025932	Bacteria	1110
783	Ga0207690_10392298	3300025932	Bacteria	1105
784	Ga0207706_10023920	3300025933	Bacteria	5481
785	Ga0207706_10229252	3300025933	Bacteria	1625
786	Ga0207686_10031551	3300025934	Bacteria	3147
787	Ga0207686_10074003	3300025934	Bacteria	2200
788	Ga0207686_10407376	3300025934	Bacteria	1037
789	Ga0207709_10015396	3300025935	Bacteria	4240
790	Ga0207709_10111098	3300025935	Bacteria	1833
791	Ga0207709_10215850	3300025935	Bacteria	1380
792	Ga0207670_10005154	3300025936	Bacteria	7145
793	Ga0207670_10141385	3300025936	Bacteria	1775
794	Ga0207669_10002349	3300025937	Bacteria	8037
795	Ga0207669_10156799	3300025937	Bacteria	1602
796	Ga0207704_10003687	3300025938	Bacteria	6967
797	Ga0207704_10090201	3300025938	Bacteria	2011
798	Ga0207704_10175834	3300025938	Bacteria	1541
799	Ga0207704_10180486	3300025938	Bacteria	1525
800	Ga0207665_10002349	3300025939	Bacteria	12773
801	Ga0207665_10004622	3300025939	Bacteria	9141
802	Ga0207665_10013522	3300025939	Bacteria	5366
803	Ga0207665_10014943	3300025939	Bacteria	5101
804	Ga0207665_10015474	3300025939	Bacteria	5007
805	Ga0207665_10015730	3300025939	Bacteria	4965
806	Ga0207665_10031991	3300025939	Bacteria	3483
807	Ga0207665_10852425	3300025939	Bacteria	721
808	Ga0207691_10061032	3300025940	Bacteria	3425
809	Ga0207691_10074146	3300025940	Bacteria	3069
810	Ga0207691_10157609	3300025940	Bacteria	1993
811	Ga0207691_10506837	3300025940	Bacteria	1025
812	Ga0207691_10871234	3300025940	Bacteria	755
813	Ga0207711_10000112	3300025941	Bacteria	84952
814	Ga0207711_10000126	3300025941	Bacteria	80235
815	Ga0207711_10053307	3300025941	Bacteria	3469
816	Ga0207711_10104690	3300025941	Bacteria	2508
817	Ga0207711_10114555	3300025941	Bacteria	2401
818	Ga0207711_10175950	3300025941	Bacteria	1944
819	Ga0207711_10190107	3300025941	Bacteria	1871
820	Ga0207711_10292670	3300025941	Bacteria	1501
821	Ga0207711_10390458	3300025941	Bacteria	1292
822	Ga0207711_10734479	3300025941	Bacteria	920
823	Ga0207689_10029503	3300025942	Bacteria	4580
824	Ga0207689_10100237	3300025942	Bacteria	2379
825	Ga0207661_10268271	3300025944	Bacteria	1522
826	Ga0207661_10392772	3300025944	Bacteria	1257
827	Ga0207661_10748123	3300025944	Bacteria	900
828	Ga0207679_10142795	3300025945	Bacteria	1937
829	Ga0207667_10007907	3300025949	Bacteria	12697
830	Ga0207667_10244765	3300025949	Bacteria	1835
831	Ga0207667_10252370	3300025949	Bacteria	1805
832	Ga0207667_10278466	3300025949	Bacteria	1709
833	Ga0207667_10287919	3300025949	Bacteria	1679
834	Ga0207667_10727080	3300025949	Bacteria	993
835	Ga0207651_10145183	3300025960	Bacteria	1839
836	Ga0207651_10428324	3300025960	Bacteria	1131
837	Ga0207712_10000006	3300025961	Bacteria	573204
838	Ga0207712_10008843	3300025961	Bacteria	6367
839	Ga0207712_10035833	3300025961	Bacteria	3374
840	Ga0207712_10232874	3300025961	Bacteria	1480
841	Ga0207712_10473011	3300025961	Bacteria	1067
842	Ga0207712_10723623	3300025961	Bacteria	870
843	Ga0207668_10004608	3300025972	Bacteria	8106
844	Ga0207668_10057791	3300025972	Bacteria	2708
845	Ga0207640_10004268	3300025981	Bacteria	7738
846	Ga0207640_10013966	3300025981	Bacteria	4612
847	Ga0207640_10071857	3300025981	Bacteria	2332
848	Ga0207640_10341030	3300025981	Bacteria	1200
849	Ga0207640_10657814	3300025981	Bacteria	894
850	Ga0207658_10000108	3300025986	Bacteria	90165
851	Ga0207658_10003296	3300025986	Bacteria	11456
852	Ga0207658_10007702	3300025986	Bacteria	7334
853	Ga0207658_10028606	3300025986	Bacteria	3926
854	Ga0207658_10310152	3300025986	Bacteria	1362
855	Ga0207658_10542010	3300025986	Bacteria	1040
856	Ga0207658_10751159	3300025986	Bacteria	883
857	Ga0207677_10001300	3300026023	Bacteria	13408
858	Ga0207677_10057209	3300026023	Bacteria	2676
859	Ga0207677_10174147	3300026023	Bacteria	1686
860	Ga0207677_10174456	3300026023	Bacteria	1685
861	Ga0207677_10526563	3300026023	Bacteria	1026
862	Ga0207703_10046111	3300026035	Bacteria	3509
863	Ga0207703_10149562	3300026035	Bacteria	2035
864	Ga0207703_10162284	3300026035	Bacteria	1958
865	Ga0207703_10235150	3300026035	Bacteria	1644
866	Ga0207703_10238289	3300026035	Bacteria	1634
867	Ga0207639_10019367	3300026041	Bacteria	4852
868	Ga0207639_10175472	3300026041	Bacteria	1819
869	Ga0207639_10250904	3300026041	Bacteria	1543
870	Ga0207639_10671106	3300026041	Bacteria	960
871	Ga0207678_10004438	3300026067	Bacteria	12622
872	Ga0207678_10025301	3300026067	Bacteria	5182
873	Ga0207678_10062414	3300026067	Bacteria	3203
874	Ga0207678_10258662	3300026067	Bacteria	1492
875	Ga0207678_10291114	3300026067	Bacteria	1403
876	Ga0207678_10319218	3300026067	Bacteria	1336
877	Ga0207678_10596440	3300026067	Bacteria	968
878	Ga0207708_10038842	3300026075	Bacteria	3627
879	Ga0207708_10068628	3300026075	Bacteria	2713
880	Ga0207702_10012783	3300026078	Bacteria	6986
881	Ga0207702_10765879	3300026078	Bacteria	953
882	Ga0207702_11517920	3300026078	Bacteria	663
883	Ga0207641_10004858	3300026088	Bacteria	11567
884	Ga0207641_10018642	3300026088	Bacteria	5688
885	Ga0207641_10090840	3300026088	Bacteria	2671
886	Ga0207641_10096178	3300026088	Bacteria	2601
887	Ga0207641_10406518	3300026088	Bacteria	1308
888	Ga0207641_10765751	3300026088	Bacteria	953
889	Ga0207648_10001107	3300026089	Bacteria	30199
890	Ga0207648_10043288	3300026089	Bacteria	3953
891	Ga0207648_10152216	3300026089	Bacteria	2041
892	Ga0207648_10187859	3300026089	Bacteria	1830
893	Ga0207648_10598365	3300026089	Bacteria	1016
894	Ga0207676_10100139	3300026095	Bacteria	2400
895	Ga0207676_10160976	3300026095	Bacteria	1944
896	Ga0207676_10533637	3300026095	Bacteria	1119
897	Ga0207676_10672443	3300026095	Bacteria	1001
898	Ga0207674_10025085	3300026116	Bacteria	6363
899	Ga0207674_10036369	3300026116	Bacteria	5132
900	Ga0207674_10236768	3300026116	Bacteria	1773
901	Ga0207674_10400902	3300026116	Bacteria	1326
902	Ga0207675_100000555	3300026118	Bacteria	36440
903	Ga0207675_100020354	3300026118	Bacteria	6184
904	Ga0207675_100040607	3300026118	Bacteria	4345
905	Ga0207675_100660956	3300026118	Bacteria	1052
906	Ga0207683_10000795	3300026121	Bacteria	28807
907	Ga0207683_10087918	3300026121	Bacteria	2764
908	Ga0207683_10105912	3300026121	Bacteria	2514
909	Ga0207683_10309862	3300026121	Bacteria	1445
910	Ga0207698_10006857	3300026142	Bacteria	7125
911	Ga0207698_10061977	3300026142	Bacteria	2918
912	Ga0207698_10330721	3300026142	Bacteria	1431
913	Ga0207698_10414057	3300026142	Bacteria	1291
914	Ga0207698_10468399	3300026142	Bacteria	1220
915	Ga0207698_11177373	3300026142	Bacteria	780
916	Ga0209813_10002378	3300027866	Bacteria	4316
917	Ga0209813_10050881	3300027866	Bacteria	1294
918	Ga0268266_10003769	3300028379	Bacteria	14856
919	Ga0268266_10005376	3300028379	Bacteria	11963
920	Ga0268266_10026053	3300028379	Bacteria	4974
921	Ga0268266_10037420	3300028379	Bacteria	4134
922	Ga0268266_10067099	3300028379	Bacteria	3104
923	Ga0268266_10075196	3300028379	Bacteria	2934
924	Ga0268266_10110271	3300028379	Bacteria	2437
925	Ga0268266_10218332	3300028379	Bacteria	1751
926	Ga0268266_10247291	3300028379	Bacteria	1648
927	Ga0268266_10267629	3300028379	Bacteria	1586
928	Ga0268266_10429954	3300028379	Bacteria	1252
929	Ga0268266_10825157	3300028379	Bacteria	896
930	Ga0268265_10000032	3300028380	Bacteria	225953
931	Ga0268265_10000034	3300028380	Bacteria	218695
932	Ga0268265_10005171	3300028380	Bacteria	8940
933	Ga0268265_10073017	3300028380	Bacteria	2678
934	Ga0268265_10748443	3300028380	Bacteria	948
935	Ga0268264_10000026	3300028381	Bacteria	459088
936	Ga0268264_10010060	3300028381	Bacteria	7830
937	Ga0268264_10300291	3300028381	Bacteria	1511
938	Ga0268264_10381635	3300028381	Bacteria	1350
939	Ga0268264_10423023	3300028381	Bacteria	1285
940	Ga0268264_10573493	3300028381	Bacteria	1109
941	Ga0268264_10677030	3300028381	Bacteria	1023
942	Ga0268264_10720006	3300028381	Bacteria	992
943	Ga0265337_1000279	3300028556	Bacteria	27809
944	Ga0265337_1038114	3300028556	Bacteria	1395
945	Ga0265326_10000533	3300028558	Bacteria	14447
946	Ga0265319_1001077	3300028563	Bacteria	16964
947	Ga0265334_10000292	3300028573	Bacteria	27991
948	Ga0265323_10001007	3300028653	Bacteria	14691
949	Ga0265322_10002610	3300028654	Bacteria	5538
950	Ga0265336_10007568	3300028666	Bacteria	3859
951	Ga0265336_10010609	3300028666	Bacteria	3153
952	Ga0307517_10006575	3300028786	Bacteria	17165
953	Ga0307517_10006948	3300028786	Bacteria	16631
954	Ga0307515_10002608	3300028794	Bacteria	38833
955	Ga0265338_10000827	3300028800	Bacteria	52237
956	Ga0265338_10003087	3300028800	Bacteria	23899
957	Ga0265324_10000826	3300029957	Bacteria	20096
958	Ga0307511_10004244	3300030521	Bacteria	14631
959	Ga0307511_10171324	3300030521	Bacteria	1192
960	Ga0316182_1288760	3300030745	Bacteria	811
961	Ga0265760_10088362	3300031090	Bacteria	968
962	Ga0265332_10000688	3300031238	Bacteria	21619
963	Ga0265320_10000591	3300031240	Bacteria	27892
964	Ga0265325_10005697	3300031241	Bacteria	7658
965	Ga0265340_10000611	3300031247	Bacteria	19983
966	Ga0265327_10000062	3300031251	Bacteria	234320
967	Ga0265327_10008428	3300031251	Bacteria	7678
968	Ga0265316_10005669	3300031344	Bacteria	12084
969	Ga0307509_10178836	3300031507	Bacteria	1990
970	Ga0307509_10255380	3300031507	Bacteria	1533
971	Ga0307509_10360763	3300031507	Bacteria	1173
972	Ga0307408_100550818	3300031548	Bacteria	1018
973	Ga0265313_10002273	3300031595	Bacteria	16850
974	Ga0307508_10001597	3300031616	Bacteria	25266
975	Ga0307508_10109641	3300031616	Bacteria	2360
976	Ga0307508_10184597	3300031616	Bacteria	1688
977	Ga0307508_10456693	3300031616	Bacteria	870
978	Ga0316575_10009061	3300031665	Bacteria	3639
979	Ga0265314_10002719	3300031711	Bacteria	17696
980	Ga0265342_10064883	3300031712	Bacteria	2141
981	Ga0316576_10000047	3300031727	Bacteria	37553
982	Ga0316576_10000224	3300031727	Bacteria	24153
983	Ga0316576_10013172	3300031727	Bacteria	5485
984	Ga0316576_10045801	3300031727	Bacteria	3164
985	Ga0316576_10105104	3300031727	Bacteria	2113
986	Ga0316576_10203214	3300031727	Bacteria	1492
987	Ga0316576_10220436	3300031727	Bacteria	1427
988	Ga0316576_10319060	3300031727	Bacteria	1159
989	Ga0316578_10021255	3300031728	Bacteria	3600
990	Ga0316578_10026984	3300031728	Bacteria	3243
991	Ga0316578_10042136	3300031728	Bacteria	2646
992	Ga0316578_10044739	3300031728	Bacteria	2575
993	Ga0316578_10064442	3300031728	Bacteria	2163
994	Ga0316578_10080516	3300031728	Bacteria	1937
995	Ga0316578_10116881	3300031728	Bacteria	1602
996	Ga0307516_10017360	3300031730	Bacteria	7506
997	Ga0316577_10024944	3300031733	Bacteria	3325
998	Ga0316577_10153014	3300031733	Bacteria	1300
999	Ga0307410_10076162	3300031852	Bacteria	2341
1000	Ga0307410_10260042	3300031852	Bacteria	1353
1001	Ga0307410_10650126	3300031852	Bacteria	884
1002	Ga0307406_10062332	3300031901	Bacteria	2412
1003	Ga0307406_10719033	3300031901	Bacteria	835
1004	Ga0307407_10037189	3300031903	Bacteria	2688
1005	Ga0307412_10124321	3300031911	Bacteria	1863
1006	Ga0307412_10376584	3300031911	Bacteria	1148
1007	Ga0307409_100395735	3300031995	Bacteria	1318
1008	Ga0307416_100042058	3300032002	Bacteria	3564
1009	Ga0307416_100071956	3300032002	Bacteria	2875
1010	Ga0307416_100313945	3300032002	Bacteria	1566
1011	Ga0307416_100624292	3300032002	Bacteria	1160
1012	Ga0307414_10683111	3300032004	Bacteria	928
1013	Ga0307411_10571622	3300032005	Bacteria	968
1014	Ga0307415_100048527	3300032126	Bacteria	2866
1015	Ga0307415_100084574	3300032126	Bacteria	2277
1016	Ga0307415_100546284	3300032126	Bacteria	1022
1017	Ga0316583_10001644	3300032133	Bacteria	7556
1018	Ga0316583_10137729	3300032133	Bacteria	851
1019	Ga0316585_10001443	3300032137	Bacteria	6279
1020	Ga0316580_10025377	3300032139	Bacteria	1833
1021	Ga0316580_10043081	3300032139	Bacteria	1393
1022	Ga0316593_10053451	3300032168	Bacteria	1369
1023	Ga0316593_10074628	3300032168	Bacteria	1177
1024	Ga0316593_10144960	3300032168	Bacteria	861
1025	Ga0307507_10000361	3300033179	Bacteria	93081
1026	Ga0307507_10066218	3300033179	Bacteria	3314
1027	Ga0307510_10242177	3300033180	Bacteria	1297
1028	Ga0316592_1022373	3300033524	Bacteria	1351
1029	Ga0316592_1058930	3300033524	Bacteria	861
1030	Ga0316588_1069172	3300033528	Bacteria	866
1031	Ga0316596_1026015	3300033541	Bacteria	1507
1032	Ga0316596_1033555	3300033541	Bacteria	1338
1033	Ga0316215_1009279	3300033544	Bacteria	968
1034	Ga0316214_1000463	3300033545	Bacteria	4131
1035	Ga0373930_0059994	3300034816	Bacteria	847
1036	Ga0373958_0003737	3300034819	Bacteria	2217
1037	Ga0373959_0005258	3300034820	Bacteria	2119
1038	Ga0373938_0014302	3300034957	Bacteria	1521
1039	Ga0373926_0002125	3300035083	Bacteria	6234
1040	Ga0373926_0003995	3300035083	Bacteria	4816
1041	Ga0373926_0049257	3300035083	Bacteria	1517
1042	Ga0373926_0142801	3300035083	Bacteria	910
1043	Ga0373926_0168974	3300035083	Bacteria	836
1044	Ga0373926_0275988	3300035083	Bacteria	654
1045	Ga0373928_0009099	3300035084	Bacteria	1938
1046	Ga0373934_0000247	3300035086	Bacteria	19377
1047	Ga0373934_0008465	3300035086	Bacteria	3834
1048	Ga0373934_0014037	3300035086	Bacteria	3032
1049	Ga0373934_0107932	3300035086	Bacteria	1128
1050	Ga0373934_0126930	3300035086	Bacteria	1039
1051	Ga0373934_0210885	3300035086	Bacteria	800
1052	Ga0373944_0001778	3300035089	Bacteria	5443
1053	Ga0373944_0016159	3300035089	Bacteria	2101
1054	Ga0373951_0021903	3300035091	Bacteria	1469
1055	Ga0373923_0001766	3300035111	Bacteria	6372
1056	Ga0373923_0014924	3300035111	Bacteria	2925
1057	Ga0373923_0050967	3300035111	Bacteria	1736
1058	Ga0373923_0154305	3300035111	Bacteria	1044
1059	Ga0373932_0010985	3300035112	Bacteria	2203
1060	Ga0373932_0031757	3300035112	Bacteria	1473
1061	Ga0373936_0000285	3300035113	Bacteria	16957
1062	Ga0373936_0000488	3300035113	Bacteria	13427
1063	Ga0373936_0020327	3300035113	Bacteria	2579
1064	Ga0373936_0110376	3300035113	Bacteria	1167
1065	Ga0373936_0151360	3300035113	Bacteria	1006
1066	Ga0373936_0301246	3300035113	Bacteria	723
1067	Ga0373941_0010456	3300035115	Bacteria	2370
1068	Ga0373945_0004036	3300035116	Bacteria	4645
1069	Ga0373945_0015574	3300035116	Bacteria	2559
1070	Ga0373945_0061910	3300035116	Bacteria	1398
1071	Ga0373945_0204425	3300035116	Bacteria	821
1072	Ga0373953_0000261	3300035117	Bacteria	14347
1073	Ga0373953_0004937	3300035117	Bacteria	4292
1074	Ga0373953_0014508	3300035117	Bacteria	2835
1075	Ga0373953_0039969	3300035117	Bacteria	1861
1076	Ga0373954_0013306	3300035118	Bacteria	3666
1077	Ga0373954_0014713	3300035118	Bacteria	3491
1078	Ga0373954_0049605	3300035118	Bacteria	1968
1079	Ga0373954_0050548	3300035118	Bacteria	1951
1080	Ga0373954_0088184	3300035118	Bacteria	1488
1081	Ga0373956_0001137	3300035119	Bacteria	10996
1082	Ga0373956_0004924	3300035119	Bacteria	5348
1083	Ga0373956_0019029	3300035119	Bacteria	2909
1084	Ga0373956_0035881	3300035119	Bacteria	2187
1085	Ga0373957_0000320	3300035120	Bacteria	12082
1086	Ga0373957_0003232	3300035120	Bacteria	4788
1087	Ga0373957_0056658	3300035120	Bacteria	1509
1088	Ga0373957_0093642	3300035120	Bacteria	1196
1089	Ga0373960_0011561	3300035121	Bacteria	2176
1090	Ga0373943_0007992	3300035170	Bacteria	4747
1091	Ga0373943_0126872	3300035170	Bacteria	1361
1092	Ga0373943_0129049	3300035170	Bacteria	1351
1093	Ga0373946_0000249	3300035171	Bacteria	17016
1094	Ga0373955_0000034	3300035172	Bacteria	53524
1095	Ga0373955_0031928	3300035172	Bacteria	2760
1096	Ga0373955_0067536	3300035172	Bacteria	1990
1097	Ga0373955_0143081	3300035172	Bacteria	1403
1098	Ga0373955_0328731	3300035172	Bacteria	924
1099	Ga0373955_0442837	3300035172	Bacteria	791
1100	Ga0373942_0002010	3300035207	Bacteria	5059
1101	Ga0373961_0134145	3300035241	Bacteria	831
1102	Ga0373962_0019150	3300035242	Bacteria	1788
1103	Ga0316574_0010412	3300035398	Bacteria	5255
1104	Ga0316574_0023456	3300035398	Bacteria	3683
1105	Ga0316574_0034399	3300035398	Bacteria	3089
1106	Ga0316574_0047721	3300035398	Bacteria	2659
1107	Ga0316574_0059358	3300035398	Bacteria	2398
1108	Ga0316574_0091559	3300035398	Bacteria	1939
1109	Ga0316574_0133106	3300035398	Bacteria	1600
1110	Ga0316574_0168669	3300035398	Bacteria	1409
1111	Ga0316574_0256070	3300035398	Bacteria	1118
1112	Ga0373924_0004120	3300035410	Bacteria	5059
1113	Ga0373924_0007146	3300035410	Bacteria	4024
1114	Ga0373924_0014051	3300035410	Bacteria	3020
1115	Ga0373924_0050150	3300035410	Bacteria	1728
1116	Ga0373924_0051351	3300035410	Bacteria	1709
1117	Ga0373924_0240986	3300035410	Bacteria	800
1118	Ga0373931_0125122	3300035691	Bacteria	1473
1119	Ga0373931_0347801	3300035691	Bacteria	927
1120	Ga0373935_0000284	3300035692	Bacteria	24989
1121	Ga0373935_0000618	3300035692	Bacteria	18647
1122	Ga0373935_0070577	3300035692	Bacteria	2252
1123	Ga0373935_0074581	3300035692	Bacteria	2193
1124	Ga0373935_0503421	3300035692	Bacteria	879
1125	Ga0373927_0000383	3300035695	Bacteria	34290
1126	Ga0373927_0192040	3300035695	Bacteria	1340
1127	Ga0373927_0241711	3300035695	Bacteria	1186
1128	Ga0373933_0000161	3300035724	Bacteria	43422
1129	Ga0373933_0004639	3300035724	Bacteria	7525
1130	Ga0373933_0021068	3300035724	Bacteria	3699
1131	Ga0373933_0093474	3300035724	Bacteria	1858
1132	Ga0373933_0215713	3300035724	Bacteria	1230
1133	Ga0373947_0000002	3300035725	Bacteria	383924
1134	Ga0373947_0000546	3300035725	Bacteria	22043
1135	Ga0373947_0036310	3300035725	Bacteria	2922
1136	Ga0373947_0047751	3300035725	Bacteria	2566
1137	Ga0373947_0135463	3300035725	Bacteria	1575
1138	Ga0373947_0227513	3300035725	Bacteria	1227
1139	Ga0373937_0000126	3300036401	Bacteria	73508
1140	Ga0373937_0004750	3300036401	Bacteria	11555
1141	Ga0373937_0053822	3300036401	Bacteria	3691
1142	Ga0373937_0065463	3300036401	Bacteria	3345
1143	Ga0373937_0072697	3300036401	Bacteria	3172
1144	Ga0373937_0477262	3300036401	Bacteria	1184
1145	Ga0373937_1057590	3300036401	Bacteria	760
1146	Ga0372808_003120	3300036459	Bacteria	1997
1147	Ga0316582_0022043	3300036647	Bacteria	3774
1148	Ga0316582_0037270	3300036647	Bacteria	3014
1149	Ga0316582_0088329	3300036647	Bacteria	2036
1150	Ga0316582_0369039	3300036647	Bacteria	988
1151	Ga0316584_0000644	3300036712	Bacteria	18952
1152	Ga0316584_0021402	3300036712	Bacteria	4699
1153	Ga0316584_0040901	3300036712	Bacteria	3454
1154	Ga0316584_0044342	3300036712	Bacteria	3316
1155	Ga0316584_0120761	3300036712	Bacteria	1958
1156	Ga0316584_0218705	3300036712	Bacteria	1400
1157	Ga0373925_0000010	3300037068	Bacteria	229059
1158	Ga0373925_0002907	3300037068	Bacteria	13518
1159	Ga0373925_0003663	3300037068	Bacteria	11823
1160	Ga0373925_0010913	3300037068	Bacteria	6591
1161	Ga0373925_0058168	3300037068	Bacteria	2898
1162	Ga0373925_0279416	3300037068	Bacteria	1344
1163	Ga0395899_0000390	3300037312	Bacteria	52344
1164	Ga0395900_0041537	3300037418	Bacteria	4741
1165	Ga0395900_0329397	3300037418	Bacteria	1505
1166	Ga0395900_0942008	3300037418	Bacteria	785
1167	Ga0395898_1011921	3300037466	Bacteria	766
1168	Ga0395898_1047833	3300037466	Bacteria	750
1169	Ga0395898_1452703	3300037466	Bacteria	612
1170	Ga0395905_0342500	3300037471	Bacteria	1386
1171	Ga0316581_0000850	3300037588	Bacteria	6395
1172	Ga0436364_0182063	3300037853	Bacteria	3933
1173	Ga0436364_0805657	3300037853	Bacteria	63201
1174	Ga0436364_0829857	3300037853	Bacteria	1475
1175	Ga0436364_0862502	3300037853	Bacteria	7944
1176	Ga0436364_1099017	3300037853	Bacteria	1482
1177	Ga0436364_1127757	3300037853	Bacteria	43348
1178	Ga0436364_1324934	3300037853	Bacteria	6135
1179	Ga0395901_0016556	3300038443	Bacteria	7512
1180	Ga0395901_0046298	3300038443	Bacteria	4518
1181	Ga0395901_0157962	3300038443	Bacteria	2381
1182	Ga0436365_0191332	3300039437	Bacteria	8367
1183	Ga0436365_0308474	3300039437	Bacteria	32517
1184	Ga0436365_1275647	3300039437	Bacteria	11736
1185	Ga0436365_1329697	3300039437	Bacteria	1005
1186	Ga0436365_1853859	3300039437	Bacteria	711
1187	Ga0436365_1854608	3300039437	Bacteria	2021
1188	Ga0436365_1880606	3300039437	Bacteria	3206
1189	Ga0436360_0170308	3300039438	Bacteria	1029
1190	Ga0436360_0454629	3300039438	Bacteria	2481
1191	Ga0436363_0186259	3300039450	Bacteria	2082
1192	Ga0436362_0513224	3300039453	Bacteria	973
1193	Ga0436362_0958683	3300039453	Bacteria	1142
1194	Ga0439436_0004500	3300041404	Bacteria	4272
1195	Ga0439439_0004399	3300041406	Bacteria	3172
1196	Ga0439453_0108865	3300041408	Bacteria	625
1197	Ga0439461_0000660	3300041410	Bacteria	4983
1198	Ga0439461_0001053	3300041410	Bacteria	4152
1199	Ga0439466_0006285	3300041411	Bacteria	4522
1200	Ga0439466_0017969	3300041411	Bacteria	2541
1201	Ga0439466_0055196	3300041411	Bacteria	1292
1202	Ga0439466_0076016	3300041411	Bacteria	1064
1203	Ga0439465_0000611	3300041413	Bacteria	10848
1204	Ga0439465_0010623	3300041413	Bacteria	2889
1205	Ga0439465_0017397	3300041413	Bacteria	2244
1206	Ga0439465_0062475	3300041413	Bacteria	1236
1207	Ga0439465_0066017	3300041413	Bacteria	1205
1208	Ga0451791_0827407	3300041451	Bacteria	1548
1209	Ga0451795_0858677	3300041456	Bacteria	891
1210	Ga0451833_1272832	3300041491	Bacteria	14889
1211	Ga0451841_0956914	3300041498	Bacteria	1046
1212	Ga0451853_0211892	3300041512	Bacteria	1254
1213	Ga0451853_0893932	3300041512	Bacteria	776
1214	Ga0439431_0000231	3300041997	Bacteria	11288
1215	Ga0439433_0008791	3300041999	Bacteria	2195
1216	Ga0439442_003399	3300042002	Bacteria	3146
1217	Ga0439442_012415	3300042002	Bacteria	1742
1218	Ga0439445_0118586	3300042004	Bacteria	759
1219	Ga0439448_0004263	3300042005	Bacteria	4032
1220	Ga0439448_0011854	3300042005	Bacteria	2600
1221	Ga0439448_0067036	3300042005	Bacteria	1192
1222	Ga0439432_082000	3300042006	Bacteria	976
1223	Ga0439449_0032393	3300042007	Bacteria	1948
1224	Ga0439455_0029376	3300042012	Bacteria	1358
1225	Ga0439457_001721	3300042014	Bacteria	6485
1226	Ga0450903_000046	3300042138	Bacteria	24085
1227	Ga0450905_025750	3300042142	Bacteria	887
1228	Ga0450910_028525	3300042147	Bacteria	869
1229	Ga0439458_0004062	3300042157	Bacteria	3377
1230	Ga0439434_0025194	3300042435	Bacteria	1794
1231	Ga0439459_0011917	3300042438	Bacteria	1540
1232	Ga0450901_006803	3300042533	Bacteria	1178
1233	Ga0466969_0009684	3300044656	Bacteria	5107
1234	Ga0466969_0015686	3300044656	Bacteria	3969
1235	Ga0466969_0029596	3300044656	Bacteria	2795
1236	Ga0466969_0047811	3300044656	Bacteria	2117
1237	Ga0466969_0084379	3300044656	Bacteria	1512
1238	Ga0466972_0000856	3300044658	Bacteria	14601
1239	Ga0466972_0011837	3300044658	Bacteria	4382
1240	Ga0466972_0043538	3300044658	Bacteria	2180
1241	Ga0466972_0050787	3300044658	Bacteria	2001
1242	Ga0466972_0070800	3300044658	Bacteria	1664
1243	Ga0466972_0311632	3300044658	Bacteria	735
1244	Ga0466965_0012698	3300044683	Bacteria	3966
1245	Ga0466965_0017280	3300044683	Bacteria	3446
1246	Ga0466965_0018506	3300044683	Bacteria	3340
1247	Ga0466965_0028567	3300044683	Bacteria	2710
1248	Ga0466965_0124449	3300044683	Bacteria	1333
1249	Ga0466965_0137373	3300044683	Bacteria	1271
1250	Ga0466965_0187717	3300044683	Bacteria	1092
1251	Ga0466965_0189173	3300044683	Bacteria	1088
1252	Ga0466965_0475566	3300044683	Bacteria	698
1253	Ga0466966_0005651	3300044684	Bacteria	8226
1254	Ga0466966_0007385	3300044684	Bacteria	7289
1255	Ga0466966_0008597	3300044684	Bacteria	6759
1256	Ga0466966_0025734	3300044684	Bacteria	3844
1257	Ga0466966_0059720	3300044684	Bacteria	2408
1258	Ga0466966_0101348	3300044684	Bacteria	1780
1259	Ga0466966_0112029	3300044684	Bacteria	1681
1260	Ga0466966_0112053	3300044684	Bacteria	1681
1261	Ga0466966_0160177	3300044684	Bacteria	1370
1262	Ga0466966_0205945	3300044684	Bacteria	1189
1263	Ga0466966_0228528	3300044684	Bacteria	1123
1264	Ga0466966_0313480	3300044684	Bacteria	943
1265	Ga0466966_0342589	3300044684	Bacteria	898
1266	Ga0466961_0009126	3300044693	Bacteria	6316
1267	Ga0466961_0016597	3300044693	Bacteria	4735
1268	Ga0466961_0038630	3300044693	Bacteria	3062
1269	Ga0466961_0050603	3300044693	Bacteria	2653
1270	Ga0466961_0084211	3300044693	Bacteria	2011
1271	Ga0466961_0088831	3300044693	Bacteria	1952
1272	Ga0466961_0093733	3300044693	Bacteria	1895
1273	Ga0466961_0135261	3300044693	Bacteria	1544
1274	Ga0466961_0496165	3300044693	Bacteria	737
1275	Ga0466963_0016001	3300044694	Bacteria	4657
1276	Ga0466963_0016907	3300044694	Bacteria	4544
1277	Ga0466963_0019825	3300044694	Bacteria	4223
1278	Ga0466963_0048020	3300044694	Bacteria	2818
1279	Ga0466963_0075063	3300044694	Bacteria	2281
1280	Ga0466963_0083525	3300044694	Bacteria	2166
1281	Ga0466963_0086133	3300044694	Bacteria	2134
1282	Ga0466963_0129519	3300044694	Bacteria	1742
1283	Ga0466963_0263601	3300044694	Bacteria	1210
1284	Ga0466963_0333802	3300044694	Bacteria	1067
1285	Ga0466963_0388684	3300044694	Bacteria	983
1286	Ga0466964_0044094	3300044706	Bacteria	1811
1287	Ga0466964_0133253	3300044706	Bacteria	1134
1288	Ga0466971_0004385	3300044719	Bacteria	6087
1289	Ga0466971_0063520	3300044719	Bacteria	1671
1290	Ga0466968_0000991	3300044735	Bacteria	9976
1291	Ga0466968_0004353	3300044735	Bacteria	5285
1292	Ga0466968_0020056	3300044735	Bacteria	2695
1293	Ga0466968_0030190	3300044735	Bacteria	2245
1294	Ga0466968_0033075	3300044735	Bacteria	2154
1295	Ga0466968_0115418	3300044735	Bacteria	1211
1296	Ga0466968_0360186	3300044735	Bacteria	708
1297	Ga0466970_0018644	3300044765	Bacteria	3595
1298	Ga0466970_0035718	3300044765	Bacteria	2633
1299	Ga0466970_0074154	3300044765	Bacteria	1831
1300	Ga0466970_0115994	3300044765	Bacteria	1464
1301	Ga0466970_0161006	3300044765	Bacteria	1241
1302	Ga0466970_0188364	3300044765	Bacteria	1146
1303	Ga0466970_0330549	3300044765	Bacteria	863
1304	Ga0466970_0335462	3300044765	Bacteria	856
1305	Ga0466970_0508689	3300044765	Bacteria	694
1306	Ga0466957_0009450	3300044842	Bacteria	5566
1307	Ga0466957_0010713	3300044842	Bacteria	5272
1308	Ga0466957_0013716	3300044842	Bacteria	4706
1309	Ga0466957_0040071	3300044842	Bacteria	2828
1310	Ga0466957_0258245	3300044842	Bacteria	1160
1311	Ga0466957_0285313	3300044842	Bacteria	1106
1312	Ga0466957_0373602	3300044842	Bacteria	971
1313	Ga0466957_0519538	3300044842	Bacteria	827
1314	Ga0466957_0666908	3300044842	Bacteria	732
1315	Ga0466957_0899526	3300044842	Bacteria	633
1316	Ga0466960_0000241	3300044901	Bacteria	18889
1317	Ga0466960_0003659	3300044901	Bacteria	5931
1318	Ga0466960_0012369	3300044901	Bacteria	3599
1319	Ga0466960_0015018	3300044901	Bacteria	3331
1320	Ga0466960_0047430	3300044901	Bacteria	2060
1321	Ga0466960_0067839	3300044901	Bacteria	1768
1322	Ga0466960_0260255	3300044901	Bacteria	966
1323	Ga0466960_0352719	3300044901	Bacteria	839
1324	Ga0466959_0004152	3300045049	Bacteria	9648
1325	Ga0466959_0005771	3300045049	Bacteria	8522
1326	Ga0466959_0007110	3300045049	Bacteria	7831
1327	Ga0466959_0021880	3300045049	Bacteria	4722
1328	Ga0466959_0030027	3300045049	Bacteria	4026
1329	Ga0466959_0052465	3300045049	Bacteria	2986
1330	Ga0466959_0067857	3300045049	Bacteria	2585
1331	Ga0466959_0157436	3300045049	Bacteria	1598
1332	Ga0466959_0309213	3300045049	Bacteria	1081
1333	Ga0466958_0024910	3300045836	Bacteria	3523
1334	Ga0466958_0035849	3300045836	Bacteria	2965
1335	Ga0466958_0067958	3300045836	Bacteria	2178
1336	Ga0466958_0238455	3300045836	Bacteria	1162
1337	Ga0466967_0014000	3300045976	Bacteria	6227
1338	Ga0466967_0014788	3300045976	Bacteria	6096
1339	Ga0466967_0028593	3300045976	Bacteria	4656
1340	Ga0466967_0042267	3300045976	Bacteria	3937
1341	Ga0466967_0047921	3300045976	Bacteria	3728
1342	Ga0466967_0277625	3300045976	Bacteria	1607
1343	Ga0466967_0312068	3300045976	Bacteria	1515
1344	Ga0466967_0325764	3300045976	Bacteria	1483
1345	Ga0466967_0352585	3300045976	Bacteria	1424
1346	Ga0466967_0461199	3300045976	Bacteria	1243
1347	Ga0466967_0826411	3300045976	Bacteria	920
1348	Ga0466967_0938051	3300045976	Bacteria	861
1349	Ga0466967_0985327	3300045976	Bacteria	839
1350	Ga0495617_018716	3300046452	Bacteria	2342
1351	Ga0495627_028646	3300046453	Bacteria	1778
1352	Ga0495592_0000030	3300046454	Bacteria	129103
1353	Ga0495592_0019863	3300046454	Bacteria	5109
1354	Ga0495592_0033363	3300046454	Bacteria	3883
1355	Ga0495592_0036940	3300046454	Bacteria	3677
1356	Ga0495592_0037960	3300046454	Bacteria	3625
1357	Ga0495592_0044805	3300046454	Bacteria	3303
1358	Ga0495592_0050170	3300046454	Bacteria	3101
1359	Ga0495592_0089311	3300046454	Bacteria	2213
1360	Ga0495592_0144398	3300046454	Bacteria	1651
1361	Ga0495592_0291562	3300046454	Bacteria	1063
1362	Ga0495592_0333229	3300046454	Bacteria	977
1363	Ga0495603_0006352	3300046455	Bacteria	7071
1364	Ga0495603_0035005	3300046455	Bacteria	3018
1365	Ga0495603_0059603	3300046455	Bacteria	2256
1366	Ga0495590_0046480	3300046457	Bacteria	1514
1367	Ga0495629_0000784	3300046459	Bacteria	25630
1368	Ga0495629_0009695	3300046459	Bacteria	7034
1369	Ga0495629_0029219	3300046459	Bacteria	3911
1370	Ga0495629_0099380	3300046459	Bacteria	2030
1371	Ga0495629_0334410	3300046459	Bacteria	1034
1372	Ga0495629_0408343	3300046459	Bacteria	922
1373	Ga0495638_0009750	3300046460	Bacteria	6708
1374	Ga0495638_0044492	3300046460	Bacteria	2796
1375	Ga0495641_0012727	3300046461	Bacteria	4682
1376	Ga0495641_0016866	3300046461	Bacteria	3829
1377	Ga0495641_0150820	3300046461	Bacteria	1039
1378	Ga0495641_0156140	3300046461	Bacteria	1020
1379	Ga0495651_0000128	3300046462	Bacteria	56236
1380	Ga0495651_0000221	3300046462	Bacteria	43412
1381	Ga0495651_0003277	3300046462	Bacteria	12427
1382	Ga0495651_0009950	3300046462	Bacteria	7311
1383	Ga0495651_0019596	3300046462	Bacteria	5247
1384	Ga0495651_0030718	3300046462	Bacteria	4189
1385	Ga0495651_0034863	3300046462	Bacteria	3921
1386	Ga0495651_0048941	3300046462	Bacteria	3263
1387	Ga0495651_0098510	3300046462	Bacteria	2181
1388	Ga0495653_0009860	3300046463	Bacteria	7811
1389	Ga0495653_0016811	3300046463	Bacteria	5953
1390	Ga0495653_0030982	3300046463	Bacteria	4254
1391	Ga0495653_0089944	3300046463	Bacteria	2247
1392	Ga0495653_0096489	3300046463	Bacteria	2149
1393	Ga0495653_0277330	3300046463	Bacteria	1101
1394	Ga0495653_0363941	3300046463	Bacteria	927
1395	Ga0495653_0415401	3300046463	Bacteria	852
1396	Ga0495650_0110122	3300046471	Bacteria	1024
1397	Ga0495580_0012117	3300046472	Bacteria	6635
1398	Ga0495580_0138645	3300046472	Bacteria	1686
1399	Ga0495580_0525295	3300046472	Bacteria	788
1400	Ga0495582_0010063	3300046473	Bacteria	5207
1401	Ga0495582_0012048	3300046473	Bacteria	4764
1402	Ga0495582_0020836	3300046473	Bacteria	3590
1403	Ga0495582_0049325	3300046473	Bacteria	2318
1404	Ga0495582_0051526	3300046473	Bacteria	2269
1405	Ga0495582_0074334	3300046473	Bacteria	1881
1406	Ga0495605_0104447	3300046474	Bacteria	1298
1407	Ga0495639_0044222	3300046475	Bacteria	2013
1408	Ga0495639_0047435	3300046475	Bacteria	1946
1409	Ga0495639_0165599	3300046475	Bacteria	1071
1410	Ga0495662_0010214	3300046476	Bacteria	4600
1411	Ga0495662_0024016	3300046476	Bacteria	2941
1412	Ga0495662_0032420	3300046476	Bacteria	2523
1413	Ga0495662_0042526	3300046476	Bacteria	2193
1414	Ga0495662_0045806	3300046476	Bacteria	2112
1415	Ga0495662_0124218	3300046476	Bacteria	1267
1416	Ga0495662_0148482	3300046476	Bacteria	1154
1417	Ga0495662_0463766	3300046476	Bacteria	621
1418	Ga0495664_0011230	3300046477	Bacteria	5045
1419	Ga0495664_0016764	3300046477	Bacteria	4179
1420	Ga0495664_0029397	3300046477	Bacteria	3214
1421	Ga0495664_0040138	3300046477	Bacteria	2766
1422	Ga0495664_0045273	3300046477	Bacteria	2609
1423	Ga0495664_0059634	3300046477	Bacteria	2271
1424	Ga0495664_0060799	3300046477	Bacteria	2249
1425	Ga0495664_0116291	3300046477	Bacteria	1616
1426	Ga0495664_0149545	3300046477	Bacteria	1416
1427	Ga0495584_0125757	3300046491	Bacteria	1299
1428	Ga0495585_0007220	3300046492	Bacteria	6827
1429	Ga0495594_0022258	3300046499	Bacteria	3389
1430	Ga0495594_0084940	3300046499	Bacteria	1770
1431	Ga0495594_0123831	3300046499	Bacteria	1462
1432	Ga0495594_0167670	3300046499	Bacteria	1249
1433	Ga0495594_0268090	3300046499	Bacteria	972
1434	Ga0495596_0036541	3300046500	Bacteria	1945
1435	Ga0495607_0065283	3300046501	Bacteria	2053
1436	Ga0495583_0168280	3300046506	Bacteria	901
1437	Ga0495583_0259560	3300046506	Bacteria	695
1438	Ga0495606_0041254	3300046507	Bacteria	3095
1439	Ga0495608_0000191	3300046511	Bacteria	43426
1440	Ga0495608_0011548	3300046511	Bacteria	6144
1441	Ga0495608_0013786	3300046511	Bacteria	5608
1442	Ga0495608_0017188	3300046511	Bacteria	5005
1443	Ga0495608_0021141	3300046511	Bacteria	4468
1444	Ga0495608_0118373	3300046511	Bacteria	1699
1445	Ga0495608_0246621	3300046511	Bacteria	1114
1446	Ga0495608_0337151	3300046511	Bacteria	929
1447	Ga0495610_0025212	3300046512	Bacteria	3196
1448	Ga0495616_0030172	3300046513	Bacteria	2852
1449	Ga0495618_0004749	3300046514	Bacteria	8308
1450	Ga0495618_0010566	3300046514	Bacteria	5586
1451	Ga0495618_0014004	3300046514	Bacteria	4882
1452	Ga0495618_0036740	3300046514	Bacteria	3074
1453	Ga0495618_0072653	3300046514	Bacteria	2189
1454	Ga0495618_0095575	3300046514	Bacteria	1900
1455	Ga0495618_0096574	3300046514	Bacteria	1890
1456	Ga0495618_0097715	3300046514	Bacteria	1879
1457	Ga0495618_0176716	3300046514	Bacteria	1357
1458	Ga0495620_0152141	3300046515	Bacteria	901
1459	Ga0495620_0172111	3300046515	Bacteria	839
1460	Ga0495628_0002526	3300046516	Bacteria	16465
1461	Ga0495628_0019731	3300046516	Bacteria	5570
1462	Ga0495628_0053813	3300046516	Bacteria	3174
1463	Ga0495628_0064063	3300046516	Bacteria	2878
1464	Ga0495628_0148922	3300046516	Bacteria	1783
1465	Ga0495628_0161669	3300046516	Bacteria	1701
1466	Ga0495628_0364420	3300046516	Bacteria	1060
1467	Ga0495628_0398009	3300046516	Bacteria	1006
1468	Ga0495630_0023828	3300046517	Bacteria	4524
1469	Ga0495630_0026337	3300046517	Bacteria	4304
1470	Ga0495630_0044258	3300046517	Bacteria	3326
1471	Ga0495630_0050798	3300046517	Bacteria	3103
1472	Ga0495630_0088688	3300046517	Bacteria	2336
1473	Ga0495630_0436552	3300046517	Bacteria	1003
1474	Ga0495631_0052433	3300046518	Bacteria	1781
1475	Ga0495637_0039914	3300046520	Bacteria	2023
1476	Ga0495643_0005160	3300046522	Bacteria	8920
1477	Ga0495643_0142932	3300046522	Bacteria	1191
1478	Ga0495648_0083800	3300046524	Bacteria	1805
1479	Ga0495666_0003258	3300046526	Bacteria	8187
1480	Ga0495666_0054026	3300046526	Bacteria	1927
1481	Ga0495666_0331446	3300046526	Bacteria	686
1482	Ga0495652_0000358	3300046529	Bacteria	54461
1483	Ga0495652_0000921	3300046529	Bacteria	33833
1484	Ga0495652_0003076	3300046529	Bacteria	16719
1485	Ga0495652_0003476	3300046529	Bacteria	15527
1486	Ga0495652_0028050	3300046529	Bacteria	4958
1487	Ga0495652_0031235	3300046529	Bacteria	4665
1488	Ga0495652_0039137	3300046529	Bacteria	4101
1489	Ga0495652_0051971	3300046529	Bacteria	3497
1490	Ga0495652_0066063	3300046529	Bacteria	3037
1491	Ga0495652_0073097	3300046529	Bacteria	2856
1492	Ga0495654_0052156	3300046530	Bacteria	1993
1493	Ga0495665_0004161	3300046531	Bacteria	7807
1494	Ga0495665_0005151	3300046531	Bacteria	7048
1495	Ga0495665_0022189	3300046531	Bacteria	3413
1496	Ga0495665_0052098	3300046531	Bacteria	2167
1497	Ga0495665_0101459	3300046531	Bacteria	1510
1498	Ga0495665_0168655	3300046531	Bacteria	1140
1499	Ga0495640_0010859	3300046533	Bacteria	7024
1500	Ga0495640_0018656	3300046533	Bacteria	5136
1501	Ga0495640_0037748	3300046533	Bacteria	3404
1502	Ga0495640_0037971	3300046533	Bacteria	3392
1503	Ga0495640_0043119	3300046533	Bacteria	3143
1504	Ga0495640_0045585	3300046533	Bacteria	3042
1505	Ga0495640_0072908	3300046533	Bacteria	2299
1506	Ga0495640_0092740	3300046533	Bacteria	1991
1507	Ga0495640_0156877	3300046533	Bacteria	1460
1508	Ga0495640_0202777	3300046533	Bacteria	1256
1509	Ga0495586_0011058	3300046535	Bacteria	4795
1510	Ga0495586_0015581	3300046535	Bacteria	4045
1511	Ga0495586_0017115	3300046535	Bacteria	3853
1512	Ga0495586_0021977	3300046535	Bacteria	3405
1513	Ga0495586_0027372	3300046535	Bacteria	3051
1514	Ga0495586_0069861	3300046535	Bacteria	1917
1515	Ga0495587_0000210	3300046536	Bacteria	43426
1516	Ga0495587_0002593	3300046536	Bacteria	12073
1517	Ga0495587_0003878	3300046536	Bacteria	9922
1518	Ga0495587_0009022	3300046536	Bacteria	6401
1519	Ga0495587_0016175	3300046536	Bacteria	4643
1520	Ga0495587_0024647	3300046536	Bacteria	3684
1521	Ga0495587_0201134	3300046536	Bacteria	1126
1522	Ga0495597_0029329	3300046542	Bacteria	2512
1523	Ga0495645_0011307	3300046543	Bacteria	6275
1524	Ga0495645_0012811	3300046543	Bacteria	5918
1525	Ga0495645_0019428	3300046543	Bacteria	4892
1526	Ga0495645_0057218	3300046543	Bacteria	2831
1527	Ga0495645_0093872	3300046543	Bacteria	2141
1528	Ga0495645_0102836	3300046543	Bacteria	2030
1529	Ga0495645_0119221	3300046543	Bacteria	1859
1530	Ga0495645_0140389	3300046543	Bacteria	1686
1531	Ga0495645_0155220	3300046543	Bacteria	1586
1532	Ga0495645_0160944	3300046543	Bacteria	1552
1533	Ga0495622_0032353	3300046557	Bacteria	2442
1534	Ga0495633_0028713	3300046558	Bacteria	2708
1535	Ga0495667_0000040	3300046559	Bacteria	129118
1536	Ga0495667_0001694	3300046559	Bacteria	14631
1537	Ga0495667_0002506	3300046559	Bacteria	12259
1538	Ga0495667_0010993	3300046559	Bacteria	6118
1539	Ga0495667_0017093	3300046559	Bacteria	4898
1540	Ga0495667_0119716	3300046559	Bacteria	1700
1541	Ga0495667_0123451	3300046559	Bacteria	1671
1542	Ga0495667_0125896	3300046559	Bacteria	1653
1543	Ga0495667_0152104	3300046559	Bacteria	1490
1544	Ga0495668_0110549	3300046616	Bacteria	1503
1545	Ga0495668_0117904	3300046616	Bacteria	1452
1546	Ga0495634_0004847	3300046642	Bacteria	10437
1547	Ga0495634_0013383	3300046642	Bacteria	5928
1548	Ga0495634_0025545	3300046642	Bacteria	4131
1549	Ga0495634_0027931	3300046642	Bacteria	3921
1550	Ga0495634_0069786	3300046642	Bacteria	2317
1551	Ga0495634_0100686	3300046642	Bacteria	1867
1552	Ga0495634_0127335	3300046642	Bacteria	1626
1553	Ga0495634_0141588	3300046642	Bacteria	1526
1554	Ga0495634_0233621	3300046642	Bacteria	1130
1555	Ga0495611_0188488	3300046648	Bacteria	963
1556	Ga0495625_0138882	3300046660	Bacteria	1640
1557	Ga0495625_0165932	3300046660	Bacteria	1476
1558	Ga0495625_0171241	3300046660	Bacteria	1450
1559	Ga0495625_0279133	3300046660	Bacteria	1075
1560	Ga0495635_0000464	3300046663	Bacteria	25665
1561	Ga0495635_0002756	3300046663	Bacteria	12047
1562	Ga0495635_0004937	3300046663	Bacteria	9285
1563	Ga0495635_0008628	3300046663	Bacteria	7117
1564	Ga0495635_0019614	3300046663	Bacteria	4710
1565	Ga0495635_0032901	3300046663	Bacteria	3596
1566	Ga0495635_0056882	3300046663	Bacteria	2692
1567	Ga0495635_0097805	3300046663	Bacteria	2006
1568	Ga0495635_0141406	3300046663	Bacteria	1639
1569	Ga0495588_0014001	3300046674	Bacteria	3832
1570	Ga0495588_0108484	3300046674	Bacteria	1461
1571	Ga0495588_0125578	3300046674	Bacteria	1353
1572	Ga0495588_0159731	3300046674	Bacteria	1192
1573	Ga0495657_0000029	3300046675	Bacteria	129126
1574	Ga0495657_0001735	3300046675	Bacteria	18663
1575	Ga0495657_0002935	3300046675	Bacteria	14138
1576	Ga0495657_0008006	3300046675	Bacteria	8106
1577	Ga0495657_0008709	3300046675	Bacteria	7742
1578	Ga0495657_0043952	3300046675	Bacteria	3042
1579	Ga0495657_0089694	3300046675	Bacteria	1974
1580	Ga0495657_0211618	3300046675	Bacteria	1178
1581	Ga0495657_0236978	3300046675	Bacteria	1102
1582	Ga0495657_0357390	3300046675	Bacteria	863
1583	Ga0495599_0000680	3300046678	Bacteria	19277
1584	Ga0495599_0001491	3300046678	Bacteria	13447
1585	Ga0495599_0033171	3300046678	Bacteria	3243
1586	Ga0495599_0079499	3300046678	Bacteria	2047
1587	Ga0495599_0080696	3300046678	Bacteria	2031
1588	Ga0495599_0109345	3300046678	Bacteria	1722
1589	Ga0495599_0119153	3300046678	Bacteria	1641
1590	Ga0495599_0153991	3300046678	Bacteria	1422
1591	Ga0495599_0156067	3300046678	Bacteria	1412
1592	Ga0495623_0001327	3300046679	Bacteria	16812
1593	Ga0495623_0010603	3300046679	Bacteria	5965
1594	Ga0495623_0012772	3300046679	Bacteria	5437
1595	Ga0495623_0033497	3300046679	Bacteria	3296
1596	Ga0495623_0041735	3300046679	Bacteria	2925
1597	Ga0495623_0079803	3300046679	Bacteria	2027
1598	Ga0495623_0148134	3300046679	Bacteria	1390
1599	Ga0495623_0235356	3300046679	Bacteria	1037
1600	Ga0495646_0001643	3300046680	Bacteria	13336
1601	Ga0495646_0004464	3300046680	Bacteria	8813
1602	Ga0495646_0005844	3300046680	Bacteria	7803
1603	Ga0495646_0017967	3300046680	Bacteria	4480
1604	Ga0495646_0021142	3300046680	Bacteria	4113
1605	Ga0495646_0031187	3300046680	Bacteria	3323
1606	Ga0495646_0052910	3300046680	Bacteria	2450
1607	Ga0495646_0090302	3300046680	Bacteria	1770
1608	Ga0495646_0181435	3300046680	Bacteria	1155
1609	Ga0495647_0075794	3300046681	Bacteria	1355
1610	Ga0495647_0172396	3300046681	Bacteria	937
1611	Ga0495658_0006157	3300046683	Bacteria	5887
1612	Ga0495658_0007199	3300046683	Bacteria	5496
1613	Ga0495658_0118618	3300046683	Bacteria	1598
1614	Ga0495658_0164035	3300046683	Bacteria	1372
1615	Ga0495669_0141763	3300046684	Bacteria	1135
1616	Ga0495669_0305138	3300046684	Bacteria	768
1617	Ga0495613_0014244	3300046689	Bacteria	5901
1618	Ga0495613_0019221	3300046689	Bacteria	5093
1619	Ga0495613_0033718	3300046689	Bacteria	3802
1620	Ga0495613_0053918	3300046689	Bacteria	2956
1621	Ga0495613_0237702	3300046689	Bacteria	1274
1622	Ga0495613_0244105	3300046689	Bacteria	1255
1623	Ga0495613_0260001	3300046689	Bacteria	1209
1624	Ga0495613_0271224	3300046689	Bacteria	1180
1625	Ga0495613_0274402	3300046689	Bacteria	1172
1626	Ga0495613_0282576	3300046689	Bacteria	1152
1627	Ga0495624_0002811	3300046690	Bacteria	13038
1628	Ga0495624_0031968	3300046690	Bacteria	3415
1629	Ga0495624_0077592	3300046690	Bacteria	2060
1630	Ga0495624_0163850	3300046690	Bacteria	1357
1631	Ga0495624_0194739	3300046690	Bacteria	1232
1632	Ga0495624_0567140	3300046690	Bacteria	677
1633	Ga0495670_0024416	3300046691	Bacteria	2987
1634	Ga0495670_0062969	3300046691	Bacteria	1867
1635	Ga0495671_0070870	3300046692	Bacteria	1712
1636	Ga0495649_0104394	3300046694	Bacteria	1505
1637	Ga0495649_0123737	3300046694	Bacteria	1366
1638	Ga0495600_0001874	3300046809	Bacteria	11799
1639	Ga0495600_0002980	3300046809	Bacteria	9880
1640	Ga0495600_0010512	3300046809	Bacteria	5748
1641	Ga0495600_0020700	3300046809	Bacteria	4207
1642	Ga0495600_0026537	3300046809	Bacteria	3738
1643	Ga0495600_0037627	3300046809	Bacteria	3146
1644	Ga0495600_0045021	3300046809	Bacteria	2878
1645	Ga0495600_0066334	3300046809	Bacteria	2359
1646	Ga0495600_0083310	3300046809	Bacteria	2087
1647	Ga0495600_0150075	3300046809	Bacteria	1509
1648	Ga0495660_0085225	3300046810	Bacteria	1651
1649	Ga0495660_0139744	3300046810	Bacteria	1206
1650	Ga0495581_0025321	3300047315	Bacteria	3440
1651	Ga0495581_0048759	3300047315	Bacteria	2445
1652	Ga0495581_0049794	3300047315	Bacteria	2419
1653	Ga0495581_0088443	3300047315	Bacteria	1796
1654	Ga0495581_0209406	3300047315	Bacteria	1140
1655	Ga0495581_0311472	3300047315	Bacteria	920
1656	Ga0495581_0407124	3300047315	Bacteria	793
1657	Ga0495604_0000034	3300047317	Bacteria	129099
1658	Ga0495604_0002080	3300047317	Bacteria	16140
1659	Ga0495604_0002330	3300047317	Bacteria	15212
1660	Ga0495604_0003371	3300047317	Bacteria	12743
1661	Ga0495604_0005465	3300047317	Bacteria	10079
1662	Ga0495604_0033920	3300047317	Bacteria	4038
1663	Ga0495604_0061548	3300047317	Bacteria	2870
1664	Ga0495604_0067294	3300047317	Bacteria	2723
1665	Ga0495604_0074500	3300047317	Bacteria	2558
1666	Ga0495604_0121758	3300047317	Bacteria	1887
1667	Ga0495636_0079509	3300047318	Bacteria	1410
1668	Ga0495674_0002068	3300047319	Bacteria	19680
1669	Ga0495674_0008781	3300047319	Bacteria	9614
1670	Ga0495674_0013321	3300047319	Bacteria	7733
1671	Ga0495674_0030890	3300047319	Bacteria	4867
1672	Ga0495674_0034874	3300047319	Bacteria	4545
1673	Ga0495674_0046441	3300047319	Bacteria	3854
1674	Ga0495674_0119774	3300047319	Bacteria	2224
1675	Ga0495674_0131933	3300047319	Bacteria	2104
1676	Ga0495674_0145983	3300047319	Bacteria	1986
1677	Ga0495674_0163005	3300047319	Bacteria	1864
1678	Ga0495674_0165712	3300047319	Bacteria	1847
1679	Ga0495674_0592027	3300047319	Bacteria	879
1680	Ga0495674_0603367	3300047319	Bacteria	869
1681	Ga0495672_0081248	3300047320	Bacteria	1805
1682	Ga0495672_0295751	3300047320	Bacteria	768
1683	Ga0495676_0004289	3300047321	Bacteria	13019
1684	Ga0495676_0004409	3300047321	Bacteria	12868
1685	Ga0495676_0029226	3300047321	Bacteria	4695
1686	Ga0495676_0084656	3300047321	Bacteria	2392
1687	Ga0495676_0199728	3300047321	Bacteria	1390
1688	Ga0495676_0248986	3300047321	Bacteria	1213
1689	Ga0495676_0289283	3300047321	Bacteria	1107
1690	Ga0495676_0461846	3300047321	Bacteria	837
1691	Ga0495680_0000522	3300047322	Bacteria	43426
1692	Ga0495680_0005749	3300047322	Bacteria	11609
1693	Ga0495680_0014514	3300047322	Bacteria	6819
1694	Ga0495680_0019297	3300047322	Bacteria	5760
1695	Ga0495680_0054020	3300047322	Bacteria	3121
1696	Ga0495680_0120830	3300047322	Bacteria	1934
1697	Ga0495680_0129780	3300047322	Bacteria	1853
1698	Ga0495680_0453218	3300047322	Bacteria	877
1699	Ga0495680_0762714	3300047322	Bacteria	634
1700	Ga0495683_0038000	3300047323	Bacteria	2438
1701	Ga0495687_009612	3300047443	Bacteria	5385
1702	Ga0495687_025609	3300047443	Bacteria	2785
1703	Ga0495687_045737	3300047443	Bacteria	1893
1704	Ga0495687_058847	3300047443	Bacteria	1593
1705	Ga0495675_0009553	3300047444	Bacteria	6041
1706	Ga0495675_0012775	3300047444	Bacteria	5289
1707	Ga0495675_0018436	3300047444	Bacteria	4429
1708	Ga0495675_0051898	3300047444	Bacteria	2604
1709	Ga0495675_0072106	3300047444	Bacteria	2179
1710	Ga0495675_0073235	3300047444	Bacteria	2160
1711	Ga0495675_0077663	3300047444	Bacteria	2091
1712	Ga0495675_0190149	3300047444	Bacteria	1253
1713	Ga0495677_0035866	3300047445	Bacteria	1810
1714	Ga0495685_000258	3300047447	Bacteria	18267
1715	Ga0495681_0001206	3300047470	Bacteria	19657
1716	Ga0495684_0007798	3300047471	Bacteria	8287
1717	Ga0495684_0011230	3300047471	Bacteria	6922
1718	Ga0495684_0014686	3300047471	Bacteria	6026
1719	Ga0495684_0015058	3300047471	Bacteria	5956
1720	Ga0495684_0035254	3300047471	Bacteria	3837
1721	Ga0495684_0115306	3300047471	Bacteria	2025
1722	Ga0495684_0170623	3300047471	Bacteria	1618
1723	Ga0495684_0273442	3300047471	Bacteria	1221
1724	Ga0495686_0001212	3300047472	Bacteria	29644
1725	Ga0495686_0098686	3300047472	Bacteria	1764
1726	Ga0495686_0211328	3300047472	Bacteria	1108
1727	Ga0495593_0002951	3300047673	Bacteria	10237
1728	Ga0495593_0033838	3300047673	Bacteria	2781
1729	Ga0495593_0149771	3300047673	Bacteria	1180
1730	Ga0495593_0251148	3300047673	Bacteria	885
1731	Ga0495602_0002950	3300048088	Bacteria	17453
1732	Ga0495602_0045356	3300048088	Bacteria	3978
1733	Ga0495602_0070910	3300048088	Bacteria	2978
1734	Ga0495602_0080694	3300048088	Bacteria	2739
1735	Ga0495602_0112757	3300048088	Bacteria	2206
1736	Ga0495602_0132925	3300048088	Bacteria	1981
1737	Ga0495602_0138891	3300048088	Bacteria	1926
1738	Ga0495614_0013942	3300048089	Bacteria	3523
1739	Ga0495614_0065358	3300048089	Bacteria	1565
1740	Ga0495614_0093641	3300048089	Bacteria	1308
1741	Ga0495614_0096318	3300048089	Bacteria	1290
1742	Ga0495626_0025863	3300048091	Bacteria	2866
1743	Ga0495626_0044137	3300048091	Bacteria	2088
1744	Ga0495626_0115872	3300048091	Bacteria	1156
1745	Ga0496100_0000079	3300048903	Bacteria	54215
1746	Ga0496100_0000113	3300048903	Bacteria	46589
1747	Ga0496100_0005184	3300048903	Bacteria	6991
1748	Ga0496100_0008547	3300048903	Bacteria	5714
1749	Ga0496100_0022949	3300048903	Bacteria	3783
1750	Ga0496100_0052080	3300048903	Bacteria	2660
1751	Ga0496100_0311985	3300048903	Bacteria	1179
1752	Ga0496101_0000011	3300048904	Bacteria	272153
1753	Ga0496101_0000173	3300048904	Bacteria	51777
1754	Ga0496101_0004302	3300048904	Bacteria	8938
1755	Ga0496101_0014665	3300048904	Bacteria	5271
1756	Ga0496101_0028189	3300048904	Bacteria	3919
1757	Ga0496101_0113746	3300048904	Bacteria	2040
1758	Ga0496101_0126865	3300048904	Bacteria	1934
1759	Ga0496101_0187895	3300048904	Bacteria	1593
1760	Ga0496101_0624060	3300048904	Bacteria	852
1761	Ga0496101_0885713	3300048904	Bacteria	703
1762	Ga0496102_0000012	3300048905	Bacteria	315470
1763	Ga0496102_0001872	3300048905	Bacteria	18125
1764	Ga0496102_0013028	3300048905	Bacteria	7198
1765	Ga0496102_0016862	3300048905	Bacteria	6390
1766	Ga0496102_0040837	3300048905	Bacteria	4199
1767	Ga0496102_0047324	3300048905	Bacteria	3908
1768	Ga0496102_0052675	3300048905	Bacteria	3709
1769	Ga0496102_0122107	3300048905	Bacteria	2433
1770	Ga0496102_0135691	3300048905	Bacteria	2306
1771	Ga0496102_0170191	3300048905	Bacteria	2051
1772	Ga0496102_0241085	3300048905	Bacteria	1705
1773	Ga0496103_0000005	3300048906	Bacteria	505416
1774	Ga0496103_0000238	3300048906	Bacteria	53761
1775	Ga0496103_0000277	3300048906	Bacteria	48396
1776	Ga0496103_0000543	3300048906	Bacteria	30314
1777	Ga0496103_0027124	3300048906	Bacteria	3469
1778	Ga0496103_0260079	3300048906	Bacteria	1117
1779	Ga0496103_0314669	3300048906	Bacteria	1007
1780	Ga0496103_0321927	3300048906	Bacteria	994
1781	Ga0496103_0464341	3300048906	Bacteria	811
1782	Ga0496104_0000813	3300048907	Bacteria	26826
1783	Ga0496104_0002275	3300048907	Bacteria	16561
1784	Ga0496104_0043157	3300048907	Bacteria	4235
1785	Ga0496104_0098835	3300048907	Bacteria	2794
1786	Ga0496104_0158612	3300048907	Bacteria	2171
1787	Ga0496104_0195218	3300048907	Bacteria	1936
1788	Ga0496104_0242758	3300048907	Bacteria	1714
1789	Ga0496104_0381033	3300048907	Bacteria	1323
1790	Ga0496104_0381529	3300048907	Bacteria	1322
1791	Ga0496104_0449963	3300048907	Bacteria	1199
1792	Ga0496104_0814287	3300048907	Bacteria	840
1793	Ga0496104_0976302	3300048907	Bacteria	751
1794	Ga0496105_0008498	3300048908	Bacteria	7975
1795	Ga0496105_0043335	3300048908	Bacteria	3711
1796	Ga0496105_0075329	3300048908	Bacteria	2787
1797	Ga0496105_0166293	3300048908	Bacteria	1809
1798	Ga0496105_0336817	3300048908	Bacteria	1207
1799	Ga0496105_0387520	3300048908	Bacteria	1111
1800	Ga0496105_0429694	3300048908	Bacteria	1045
1801	Ga0496105_0588142	3300048908	Bacteria	865
1802	Ga0496106_0000372	3300048909	Bacteria	31847
1803	Ga0496106_0011370	3300048909	Bacteria	6589
1804	Ga0496106_0012167	3300048909	Bacteria	6350
1805	Ga0496106_0030493	3300048909	Bacteria	4020
1806	Ga0496106_0034858	3300048909	Bacteria	3761
1807	Ga0496106_0090950	3300048909	Bacteria	2355
1808	Ga0496106_0186212	3300048909	Bacteria	1649
1809	Ga0496106_0212290	3300048909	Bacteria	1542
1810	Ga0496106_0619936	3300048909	Bacteria	866
1811	Ga0496106_0640256	3300048909	Bacteria	850
1812	Ga0496107_0001450	3300048910	Bacteria	14665
1813	Ga0496107_0002787	3300048910	Bacteria	11529
1814	Ga0496107_0030750	3300048910	Bacteria	3828
1815	Ga0496107_0047803	3300048910	Bacteria	3081
1816	Ga0496107_0051856	3300048910	Bacteria	2960
1817	Ga0496107_0716999	3300048910	Bacteria	735
1818	Ga0496107_0747239	3300048910	Bacteria	718
1819	Ga0496108_0003404	3300048911	Bacteria	12772
1820	Ga0496108_0012710	3300048911	Bacteria	6857
1821	Ga0496108_0075141	3300048911	Bacteria	2854
1822	Ga0496108_0082240	3300048911	Bacteria	2730
1823	Ga0496108_0089352	3300048911	Bacteria	2618
1824	Ga0496108_0096097	3300048911	Bacteria	2523
1825	Ga0496108_0177461	3300048911	Bacteria	1844
1826	Ga0496108_0347941	3300048911	Bacteria	1293
1827	Ga0496108_0769973	3300048911	Bacteria	832
1828	Ga0496109_0000108	3300048912	Bacteria	86134
1829	Ga0496109_0018062	3300048912	Bacteria	6192
1830	Ga0496109_0027943	3300048912	Bacteria	5042
1831	Ga0496109_0041175	3300048912	Bacteria	4186
1832	Ga0496109_0047106	3300048912	Bacteria	3918
1833	Ga0496109_0062588	3300048912	Bacteria	3403
1834	Ga0496109_0155763	3300048912	Bacteria	2140
1835	Ga0496109_0434971	3300048912	Bacteria	1239
1836	Ga0496109_0626581	3300048912	Bacteria	1012
1837	Ga0496110_0002526	3300048913	Bacteria	13748
1838	Ga0496110_0042770	3300048913	Bacteria	3954
1839	Ga0496110_0096863	3300048913	Bacteria	2644
1840	Ga0496110_0143187	3300048913	Bacteria	2161
1841	Ga0496110_0301245	3300048913	Bacteria	1460
1842	Ga0496110_0303012	3300048913	Bacteria	1455
1843	Ga0496110_0399242	3300048913	Bacteria	1253
1844	Ga0496110_0555853	3300048913	Bacteria	1043
1845	Ga0496110_0687035	3300048913	Bacteria	924
1846	Ga0496110_0905792	3300048913	Bacteria	788
1847	Ga0496111_0034675	3300048914	Bacteria	3604
1848	Ga0496111_0081153	3300048914	Bacteria	2367
1849	Ga0496111_0414810	3300048914	Bacteria	995
1850	Ga0496112_0004025	3300048915	Bacteria	12328
1851	Ga0496112_0058201	3300048915	Bacteria	3806
1852	Ga0496112_0063265	3300048915	Bacteria	3650
1853	Ga0496112_0070252	3300048915	Bacteria	3460
1854	Ga0496112_0075493	3300048915	Bacteria	3333
1855	Ga0496112_0075802	3300048915	Bacteria	3326
1856	Ga0496112_0103417	3300048915	Bacteria	2818
1857	Ga0496112_0924834	3300048915	Bacteria	793
1858	Ga0496113_0007035	3300048916	Bacteria	7196
1859	Ga0496113_0011555	3300048916	Bacteria	5898
1860	Ga0496113_0054138	3300048916	Bacteria	3002
1861	Ga0496113_0069212	3300048916	Bacteria	2680
1862	Ga0496113_0118114	3300048916	Bacteria	2071
1863	Ga0496113_0306635	3300048916	Bacteria	1272
1864	Ga0496113_0368924	3300048916	Bacteria	1152
1865	Ga0496113_0423001	3300048916	Bacteria	1070
1866	Ga0496113_0562946	3300048916	Bacteria	914
1867	Ga0496114_0000458	3300048917	Bacteria	29890
1868	Ga0496114_0000951	3300048917	Bacteria	21669
1869	Ga0496114_0066342	3300048917	Bacteria	3025
1870	Ga0496114_0095360	3300048917	Bacteria	2532
1871	Ga0496114_0210265	3300048917	Bacteria	1706
1872	Ga0496114_0986169	3300048917	Bacteria	725
1873	Ga0496115_0005896	3300048918	Bacteria	8933
1874	Ga0496115_0016385	3300048918	Bacteria	5644
1875	Ga0496115_0082692	3300048918	Bacteria	2617
1876	Ga0496115_0113932	3300048918	Bacteria	2222
1877	Ga0496115_0122386	3300048918	Bacteria	2141
1878	Ga0496115_0188628	3300048918	Bacteria	1703
1879	Ga0496115_0496558	3300048918	Bacteria	981
1880	Ga0496116_0000050	3300048919	Bacteria	311670
1881	Ga0496116_0008681	3300048919	Bacteria	8781
1882	Ga0496116_0049212	3300048919	Bacteria	2821
1883	Ga0496117_0000042	3300048920	Bacteria	315470
1884	Ga0496117_0000904	3300048920	Bacteria	45615
1885	Ga0496117_0032769	3300048920	Bacteria	3941
1886	Ga0496117_0078015	3300048920	Bacteria	2188
1887	Ga0496117_0126874	3300048920	Bacteria	1555
1888	Ga0496117_0276592	3300048920	Bacteria	901
1889	Ga0496118_0000037	3300048921	Bacteria	315470
1890	Ga0496118_0000694	3300048921	Bacteria	54687
1891	Ga0496118_0001360	3300048921	Bacteria	36838
1892	Ga0496118_0009084	3300048921	Bacteria	10124
1893	Ga0496118_0023181	3300048921	Bacteria	5400
1894	Ga0496118_0085898	3300048921	Bacteria	2188
1895	Ga0496118_0140623	3300048921	Bacteria	1531
1896	Ga0496119_0000375	3300048922	Bacteria	61774
1897	Ga0496119_0001856	3300048922	Bacteria	24383
1898	Ga0496119_0004263	3300048922	Bacteria	14329
1899	Ga0496119_0029164	3300048922	Bacteria	3749
1900	Ga0496119_0046877	3300048922	Bacteria	2694
1901	Ga0496119_0124041	3300048922	Bacteria	1415
1902	Ga0496119_0153172	3300048922	Bacteria	1233
1903	Ga0496120_0000453	3300048923	Bacteria	64868
1904	Ga0496120_0022748	3300048923	Bacteria	3940
1905	Ga0496120_0046953	3300048923	Bacteria	2493
1906	Ga0496120_0047626	3300048923	Bacteria	2471
1907	Ga0496120_0216990	3300048923	Bacteria	916
1908	Ga0496120_0230997	3300048923	Bacteria	879
1909	Ga0496120_0265219	3300048923	Bacteria	800
1910	Ga0496121_0000014	3300048924	Bacteria	609379
1911	Ga0496121_0001091	3300048924	Bacteria	47947
1912	Ga0496121_0002871	3300048924	Bacteria	25391
1913	Ga0496121_0475628	3300048924	Bacteria	799
1914	Ga0496122_0000132	3300048925	Bacteria	172228
1915	Ga0496122_0000899	3300048925	Bacteria	54992
1916	Ga0496122_0004913	3300048925	Bacteria	16215
1917	Ga0496123_0009435	3300048926	Bacteria	8789
1918	Ga0496123_0023400	3300048926	Bacteria	4729
1919	Ga0496124_0000106	3300048927	Bacteria	172511
1920	Ga0496124_0025494	3300048927	Bacteria	5354
1921	Ga0496124_0308141	3300048927	Bacteria	1140
1922	Ga0496124_0522861	3300048927	Bacteria	790
1923	Ga0496125_0000014	3300048928	Bacteria	610124
1924	Ga0496125_0000025	3300048928	Bacteria	440074
1925	Ga0496125_0069855	3300048928	Bacteria	2752
1926	Ga0496125_0202529	3300048928	Bacteria	1298
1927	Ga0496125_0384699	3300048928	Bacteria	826
1928	Ga0496126_0000017	3300048929	Bacteria	610676
1929	Ga0496126_0000236	3300048929	Bacteria	119350
1930	Ga0496126_0008111	3300048929	Bacteria	11371
1931	Ga0496126_0009442	3300048929	Bacteria	10357
1932	Ga0496126_0158798	3300048929	Bacteria	1933
1933	Ga0496126_0290346	3300048929	Bacteria	1352
1934	Ga0501306_035393	3300049127	Bacteria	757
1935	Ga0501309_011539	3300049129	Bacteria	1153
1936	Ga0501310_039904	3300049130	Bacteria	651
1937	Ga0501341_09668	3300049131	Bacteria	628
1938	Ga0501304_013287	3300049160	Bacteria	751
1939	Ga0495678_028156	3300049459	Bacteria	2375
1940	Ga0495682_0174892	3300049460	Bacteria	763
1941	Ga0501311_058941	3300049527	Bacteria	616
1942	Ga0501312_020101	3300049528	Bacteria	986
1943	Ga0501313_029079	3300049529	Bacteria	711
1944	Ga0501313_033675	3300049529	Bacteria	671
1945	Ga0501314_005414	3300049530	Bacteria	1086
1946	Ga0501316_026789	3300049532	Bacteria	756
1947	Ga0501317_034960	3300049533	Bacteria	746
1948	Ga0501317_054630	3300049533	Bacteria	642
1949	Ga0501318_005240	3300049534	Bacteria	1277
1950	Ga0501319_006950	3300049535	Bacteria	847
1951	Ga0501322_002054	3300049538	Bacteria	1205
1952	Ga0501323_007984	3300049539	Bacteria	1220
1953	Ga0501325_013418	3300049541	Bacteria	784
1954	Ga0501325_016426	3300049541	Bacteria	739
1955	Ga0501330_006852	3300049546	Bacteria	754
1956	Ga0501031_0001063	3300049568	Bacteria	16659
1957	Ga0501031_0144997	3300049568	Bacteria	1551
1958	Ga0501031_0249599	3300049568	Bacteria	1153
1959	Ga0501031_0253136	3300049568	Bacteria	1144
1960	Ga0501031_0279482	3300049568	Bacteria	1083
1961	Ga0501032_0006508	3300049569	Bacteria	8585
1962	Ga0501032_0010542	3300049569	Bacteria	6664
1963	Ga0501032_0011853	3300049569	Bacteria	6245
1964	Ga0501032_0036378	3300049569	Bacteria	3360
1965	Ga0501032_0037570	3300049569	Bacteria	3301
1966	Ga0501032_0113025	3300049569	Bacteria	1796
1967	Ga0501032_0205930	3300049569	Bacteria	1283
1968	Ga0501033_0004692	3300049570	Bacteria	10937
1969	Ga0501033_0011012	3300049570	Bacteria	6927
1970	Ga0501033_0026249	3300049570	Bacteria	4385
1971	Ga0501033_0038775	3300049570	Bacteria	3559
1972	Ga0501033_0045310	3300049570	Bacteria	3273
1973	Ga0501033_0073598	3300049570	Bacteria	2508
1974	Ga0501033_0096889	3300049570	Bacteria	2156
1975	Ga0501033_0158604	3300049570	Bacteria	1629
1976	Ga0501034_0002753	3300049571	Bacteria	20648
1977	Ga0501034_0003876	3300049571	Bacteria	16841
1978	Ga0501034_0004049	3300049571	Bacteria	16445
1979	Ga0501034_0032813	3300049571	Bacteria	5272
1980	Ga0501034_0034121	3300049571	Bacteria	5159
1981	Ga0501034_0061146	3300049571	Bacteria	3783
1982	Ga0501034_0137341	3300049571	Bacteria	2425
1983	Ga0501034_0232847	3300049571	Bacteria	1790
1984	Ga0501034_0724797	3300049571	Bacteria	891
1985	Ga0501036_0002186	3300049572	Bacteria	15263
1986	Ga0501036_0002657	3300049572	Bacteria	14101
1987	Ga0501036_0013223	3300049572	Bacteria	6854
1988	Ga0501036_0013951	3300049572	Bacteria	6681
1989	Ga0501036_0033322	3300049572	Bacteria	4356
1990	Ga0501036_0060745	3300049572	Bacteria	3201
1991	Ga0501036_0062835	3300049572	Bacteria	3145
1992	Ga0501037_0002849	3300049573	Bacteria	12534
1993	Ga0501037_0002998	3300049573	Bacteria	12259
1994	Ga0501037_0044526	3300049573	Bacteria	3259
1995	Ga0501037_0051960	3300049573	Bacteria	2997
1996	Ga0501038_0003343	3300049574	Bacteria	14956
1997	Ga0501038_0008847	3300049574	Bacteria	9238
1998	Ga0501038_0015266	3300049574	Bacteria	6983
1999	Ga0501038_0020828	3300049574	Bacteria	5893
2000	Ga0501038_0023267	3300049574	Bacteria	5541
2001	Ga0501038_0140473	3300049574	Bacteria	1976
2002	Ga0501038_0175610	3300049574	Bacteria	1731
2003	Ga0501039_0000887	3300049575	Bacteria	21753
2004	Ga0501039_0002709	3300049575	Bacteria	13220
2005	Ga0501039_0064490	3300049575	Bacteria	2839
2006	Ga0501039_0075647	3300049575	Bacteria	2617
2007	Ga0501039_0084519	3300049575	Bacteria	2472
2008	Ga0501040_0016468	3300049576	Bacteria	4894
2009	Ga0501041_0014510	3300049577	Bacteria	4679
2010	Ga0501042_0002745	3300049578	Bacteria	10860
2011	Ga0501042_0021040	3300049578	Bacteria	4543
2012	Ga0501042_0120948	3300049578	Bacteria	1885
2013	Ga0501042_0536566	3300049578	Bacteria	850
2014	Ga0501042_0551093	3300049578	Bacteria	838
2015	Ga0501043_0002135	3300049579	Bacteria	16882
2016	Ga0501043_0002160	3300049579	Bacteria	16773
2017	Ga0501043_0006675	3300049579	Bacteria	9226
2018	Ga0501043_0014191	3300049579	Bacteria	6234
2019	Ga0501043_0029997	3300049579	Bacteria	4273
2020	Ga0501043_0066196	3300049579	Bacteria	2837
2021	Ga0501043_0089762	3300049579	Bacteria	2416
2022	Ga0501043_0113250	3300049579	Bacteria	2130
2023	Ga0501043_0531696	3300049579	Bacteria	875
2024	Ga0501046_0000737	3300049580	Bacteria	31648
2025	Ga0501046_0001024	3300049580	Bacteria	27292
2026	Ga0501046_0004493	3300049580	Bacteria	12643
2027	Ga0501046_0008676	3300049580	Bacteria	8834
2028	Ga0501046_0261077	3300049580	Bacteria	1272
2029	Ga0501046_0540550	3300049580	Bacteria	831
2030	Ga0501047_0000089	3300049581	Bacteria	117033
2031	Ga0501047_0000248	3300049581	Bacteria	63961
2032	Ga0501047_0008538	3300049581	Bacteria	9663
2033	Ga0501047_0012454	3300049581	Bacteria	8053
2034	Ga0501047_0018108	3300049581	Bacteria	6750
2035	Ga0501047_0031371	3300049581	Bacteria	5125
2036	Ga0501047_0050702	3300049581	Bacteria	4008
2037	Ga0501047_0088989	3300049581	Bacteria	2964
2038	Ga0501047_0262735	3300049581	Bacteria	1573
2039	Ga0501047_0265753	3300049581	Bacteria	1562
2040	Ga0501047_0296912	3300049581	Bacteria	1459
2041	Ga0501047_0423784	3300049581	Bacteria	1162
2042	Ga0501047_0727987	3300049581	Bacteria	809
2043	Ga0501048_0003271	3300049582	Bacteria	12342
2044	Ga0501048_0150239	3300049582	Bacteria	1647
2045	Ga0501048_0417908	3300049582	Bacteria	959
2046	Ga0501067_0003554	3300049583	Bacteria	8578
2047	Ga0501067_0063189	3300049583	Bacteria	2050
2048	Ga0501068_0000719	3300049584	Bacteria	16975
2049	Ga0501068_0587207	3300049584	Bacteria	725
2050	Ga0501069_0032331	3300049585	Bacteria	2879
2051	Ga0501069_0150053	3300049585	Bacteria	1339
2052	Ga0501070_0004347	3300049586	Bacteria	12181
2053	Ga0501070_0009277	3300049586	Bacteria	8322
2054	Ga0501070_0012050	3300049586	Bacteria	7297
2055	Ga0501070_0023421	3300049586	Bacteria	5173
2056	Ga0501070_0043686	3300049586	Bacteria	3729
2057	Ga0501070_0072127	3300049586	Bacteria	2859
2058	Ga0501070_0103104	3300049586	Bacteria	2359
2059	Ga0501070_0165532	3300049586	Bacteria	1822
2060	Ga0501070_0180237	3300049586	Bacteria	1739
2061	Ga0501070_0211163	3300049586	Bacteria	1593
2062	Ga0501070_0466125	3300049586	Bacteria	1017
2063	Ga0501071_0000025	3300049587	Bacteria	49332
2064	Ga0501071_0334282	3300049587	Bacteria	1151
2065	Ga0501072_0000410	3300049588	Bacteria	30636
2066	Ga0501072_0623010	3300049588	Bacteria	850
2067	Ga0501073_0083687	3300049589	Bacteria	2220
2068	Ga0501073_0117475	3300049589	Bacteria	1843
2069	Ga0501073_0167170	3300049589	Bacteria	1523
2070	Ga0501073_0254082	3300049589	Bacteria	1213
2071	Ga0501074_0014815	3300049590	Bacteria	5670
2072	Ga0501074_0253721	3300049590	Bacteria	1251
2073	Ga0501074_0329114	3300049590	Bacteria	1085
2074	Ga0501075_0146280	3300049591	Bacteria	1801
2075	Ga0501076_0006349	3300049592	Bacteria	8571
2076	Ga0501076_0221765	3300049592	Bacteria	1545
2077	Ga0501077_0001957	3300049593	Bacteria	12453
2078	Ga0501206_054625	3300049653	Bacteria	643
2079	Ga0501079_0032626	3300049741	Bacteria	4004
2080	Ga0501080_0002814	3300049742	Bacteria	15291
2081	Ga0501080_0041695	3300049742	Bacteria	4276
2082	Ga0501080_0132042	3300049742	Bacteria	2312
2083	Ga0501083_0000422	3300049744	Bacteria	27169
2084	Ga0501083_0101006	3300049744	Bacteria	1902
2085	Ga0501035_0000162	3300049822	Bacteria	81903
2086	Ga0501035_0000416	3300049822	Bacteria	48248
2087	Ga0501035_0003983	3300049822	Bacteria	14082
2088	Ga0501035_0006603	3300049822	Bacteria	10857
2089	Ga0501035_0038021	3300049822	Bacteria	4357
2090	Ga0501035_0043263	3300049822	Bacteria	4059
2091	Ga0501035_0058146	3300049822	Bacteria	3446
2092	Ga0501035_0096680	3300049822	Bacteria	2594
2093	Ga0501035_0282501	3300049822	Bacteria	1402
2094	Ga0501044_0000166	3300049823	Bacteria	81728
2095	Ga0501044_0001535	3300049823	Bacteria	27090
2096	Ga0501044_0022142	3300049823	Bacteria	6776
2097	Ga0501044_0040369	3300049823	Bacteria	4863
2098	Ga0501044_0062999	3300049823	Bacteria	3789
2099	Ga0501044_0265256	3300049823	Bacteria	1655
2100	Ga0501044_0312618	3300049823	Bacteria	1497
2101	Ga0501044_0356772	3300049823	Bacteria	1380
2102	Ga0501044_0364058	3300049823	Bacteria	1363
2103	Ga0501044_0402835	3300049823	Bacteria	1280
2104	Ga0501044_0422780	3300049823	Bacteria	1242
2105	Ga0501044_0696863	3300049823	Bacteria	901
2106	Ga0501044_0709159	3300049823	Bacteria	891
2107	Ga0501045_0001009	3300049824	Bacteria	18478
2108	Ga0501045_0327625	3300049824	Bacteria	1140
2109	Ga0501045_0406271	3300049824	Bacteria	1013
2110	nmdc:mga03683_12106_c1	3300050489	Bacteria	3141
2111	nmdc:mga03683_132693_c1	3300050489	Bacteria	1115
2112	nmdc:mga03683_14300_c1	3300050489	Bacteria	2934
2113	nmdc:mga03683_148260_c1	3300050489	Bacteria	1058
2114	nmdc:mga03683_54316_c1	3300050489	Bacteria	1679
2115	nmdc:mga03n38_10843_c1	3300050490	Bacteria	3371
2116	nmdc:mga03n38_14633_c1	3300050490	Bacteria	3012
2117	nmdc:mga03n38_15808_c1	3300050490	Bacteria	2922
2118	nmdc:mga03n38_18408_c1	3300050490	Bacteria	2757
2119	nmdc:mga03n38_25334_c1	3300050490	Bacteria	2435
2120	nmdc:mga03n38_38681_c1	3300050490	Bacteria	2065
2121	nmdc:mga03n38_4001_c1	3300050490	Bacteria	4816
2122	nmdc:mga03n38_45395_c1	3300050490	Bacteria	1935
2123	nmdc:mga03n38_508524_c1	3300050490	Bacteria	677
2124	nmdc:mga03n38_71288_c1	3300050490	Bacteria	1218
2125	nmdc:mga03n38_8312_c1	3300050490	Bacteria	3718
2126	nmdc:mga00v17_10423_c1	3300050491	Bacteria	5074
2127	nmdc:mga00v17_106325_c1	3300050491	Bacteria	1776
2128	nmdc:mga00v17_155612_c1	3300050491	Bacteria	1470
2129	nmdc:mga00v17_20172_c1	3300050491	Bacteria	3816
2130	nmdc:mga00v17_246987_c1	3300050491	Bacteria	1157
2131	nmdc:mga00v17_247786_c1	3300050491	Bacteria	1155
2132	nmdc:mga00v17_252622_c1	3300050491	Bacteria	1143
2133	nmdc:mga00v17_25951_c1	3300050491	Bacteria	3409
2134	nmdc:mga00v17_3695_c1	3300050491	Bacteria	7906
2135	nmdc:mga00v17_54442_c1	3300050491	Bacteria	2440
2136	nmdc:mga00v17_85154_c1	3300050491	Bacteria	1979
2137	nmdc:mga00v17_8595_c1	3300050491	Bacteria	5498
2138	nmdc:mga00v17_91425_c1	3300050491	Bacteria	1912
2139	nmdc:mga00v17_98692_c1	3300050491	Bacteria	1842
2140	nmdc:mga0yw44_100068_c1	3300050492	Bacteria	1845
2141	nmdc:mga0yw44_120184_c1	3300050492	Bacteria	1692
2142	nmdc:mga0yw44_150191_c1	3300050492	Bacteria	1519
2143	nmdc:mga0yw44_192833_c1	3300050492	Bacteria	1344
2144	nmdc:mga0yw44_23005_c1	3300050492	Bacteria	3505
2145	nmdc:mga0yw44_316895_c1	3300050492	Bacteria	1047
2146	nmdc:mga0yw44_334558_c1	3300050492	Bacteria	1018
2147	nmdc:mga0yw44_35816_c1	3300050492	Bacteria	2920
2148	nmdc:mga0yw44_45566_c1	3300050492	Bacteria	2630
2149	nmdc:mga0yw44_471609_c1	3300050492	Bacteria	851
2150	nmdc:mga0yw44_57345_c1	3300050492	Bacteria	2376
2151	nmdc:mga0yw44_75832_c1	3300050492	Bacteria	2098
2152	nmdc:mga0yw44_764784_c1	3300050492	Bacteria	656
2153	nmdc:mga0yw44_76986_c1	3300050492	Bacteria	2083
2154	nmdc:mga0yw44_7865_c2	3300050492	Bacteria	4050
2155	nmdc:mga0yw44_988_c1	3300050492	Bacteria	4723
2156	nmdc:mga0k408_134375_c1	3300050493	Bacteria	1469
2157	nmdc:mga06z11_13879_c1	3300050494	Bacteria	3551
2158	nmdc:mga06z11_179324_c1	3300050494	Bacteria	1221
2159	nmdc:mga06z11_511623_c1	3300050494	Bacteria	728
2160	nmdc:mga06z11_546027_c1	3300050494	Bacteria	704
2161	nmdc:mga06z11_66207_c1	3300050494	Bacteria	1898
2162	nmdc:mga06z11_92490_c1	3300050494	Bacteria	1645
2163	nmdc:mga04h51_1471_c1	3300050495	Bacteria	5446
2164	nmdc:mga04h51_168393_c1	3300050495	Bacteria	847
2165	nmdc:mga07m45_10260_c1	3300050496	Bacteria	4887
2166	nmdc:mga07m45_13609_c1	3300050496	Bacteria	4321
2167	nmdc:mga07m45_268899_c1	3300050496	Bacteria	992
2168	nmdc:mga07m45_42421_c1	3300050496	Bacteria	2550
2169	nmdc:mga07m45_51553_c1	3300050496	Bacteria	2321
2170	nmdc:mga07m45_655780_c1	3300050496	Bacteria	605
2171	nmdc:mga07m45_9656_c1	3300050496	Bacteria	5014
2172	nmdc:mga05p37_274115_c1	3300050507	Bacteria	2015
2173	nmdc:mga05p37_354076_c1	3300050507	Bacteria	1728
2174	nmdc:mga09592_107755_c1	3300050508	Bacteria	2390
2175	nmdc:mga0qj67_562_c1	3300050509	Bacteria	25304
2176	nmdc:mga0qj67_7738_c1	3300050509	Bacteria	7941
2177	nmdc:mga06r32_129078_c1	3300050510	Bacteria	2498
2178	nmdc:mga06r32_29022_c1	3300050510	Bacteria	5180
2179	nmdc:mga06r32_486804_c1	3300050510	Bacteria	1211
2180	nmdc:mga08y16_1344972_c1	3300050511	Bacteria	679
2181	nmdc:mga08y16_41067_c1	3300050511	Bacteria	4846
2182	nmdc:mga08y16_454991_c1	3300050511	Bacteria	1305
2183	nmdc:mga0n895_19740_c1	3300050512	Bacteria	6270
2184	nmdc:mga0n895_349367_c1	3300050512	Bacteria	1498
2185	nmdc:mga0n895_66350_c1	3300050512	Bacteria	3574
2186	nmdc:mga0n895_8441_c1	3300050512	Bacteria	8919
2187	nmdc:mga0rr50_10065_c1	3300050513	Bacteria	5984
2188	nmdc:mga0rr50_129077_c1	3300050513	Bacteria	2022
2189	nmdc:mga0rr50_285022_c1	3300050513	Bacteria	1379
2190	nmdc:mga0rr50_4610_c1	3300050513	Bacteria	8117
2191	nmdc:mga0a205_35828_c1	3300050515	Bacteria	4767
2192	nmdc:mga0a205_53436_c1	3300050515	Bacteria	3899
2193	nmdc:mga0a205_57479_c1	3300050515	Bacteria	3756
2194	nmdc:mga0sz30_11610_c1	3300050516	Bacteria	3406
2195	nmdc:mga0sz30_12513_c1	3300050516	Bacteria	3303
2196	nmdc:mga0sz30_128261_c1	3300050516	Bacteria	1117
2197	nmdc:mga0sz30_133173_c1	3300050516	Bacteria	1096
2198	nmdc:mga0sz30_187545_c1	3300050516	Bacteria	918
2199	nmdc:mga0sz30_203614_c1	3300050516	Bacteria	879
2200	nmdc:mga0sz30_269061_c1	3300050516	Bacteria	759
2201	nmdc:mga0sz30_307855_c1	3300050516	Bacteria	707
2202	nmdc:mga0sz30_32515_c1	3300050516	Bacteria	2164
2203	nmdc:mga0sz30_993_c2	3300050516	Bacteria	7499
2204	Ga0495601_0027282	3300053077	Bacteria	3530
2205	Ga0495601_0039166	3300053077	Bacteria	2967
2206	Ga0495601_0053023	3300053077	Bacteria	2563
2207	Ga0495601_0072902	3300053077	Bacteria	2194
2208	Ga0495601_0145440	3300053077	Bacteria	1547
2209	Ga0495601_0180302	3300053077	Bacteria	1381
2210	Ga0495601_0193721	3300053077	Bacteria	1328
2211	Ga0495601_0560999	3300053077	Bacteria	734
2212	Ga0495612_0011008	3300053078	Bacteria	3652
2213	Ga0495612_0038760	3300053078	Bacteria	1937
2214	Ga0495612_0067755	3300053078	Bacteria	1485
2215	Ga0495612_0092507	3300053078	Bacteria	1282
2216	Ga0500610_0032441	3300053079	Bacteria	2659
2217	Ga0495655_0025457	3300053083	Bacteria	1384
2218	Ga0495595_0009489	3300053084	Bacteria	4027
2219	Ga0495595_0015556	3300053084	Bacteria	3245
2220	Ga0495595_0050992	3300053084	Bacteria	1917
2221	Ga0495619_0009377	3300053085	Bacteria	6176
2222	Ga0495619_0011792	3300053085	Bacteria	5505
2223	Ga0495619_0036492	3300053085	Bacteria	3202
2224	Ga0495619_0246431	3300053085	Bacteria	1238
2225	Ga0500578_0015819	3300053086	Bacteria	4843
2226	Ga0500644_0012288	3300053088	Bacteria	2364
2227	Ga0500646_0032759	3300053090	Bacteria	1435
2228	Ga0500583_0147570	3300053092	Bacteria	1170
2229	Ga0500583_0323995	3300053092	Bacteria	751
2230	Ga0500651_0224695	3300053093	Bacteria	1100
2231	Ga0500566_0062625	3300053094	Bacteria	2102
2232	Ga0500640_001709	3300053095	Bacteria	6841
2233	Ga0500650_0117839	3300053098	Bacteria	1239
2234	Ga0500654_029379	3300053099	Bacteria	3338
2235	Ga0500660_062614	3300053100	Bacteria	1784
2236	Ga0500553_078599	3300053101	Bacteria	1493
2237	Ga0500553_086794	3300053101	Bacteria	1389
2238	Ga0500556_0001967	3300053104	Bacteria	7255
2239	Ga0500556_0009543	3300053104	Bacteria	2822
2240	Ga0500560_030100	3300053107	Bacteria	1633
2241	Ga0500569_024007	3300053109	Bacteria	1645
2242	Ga0500572_019854	3300053111	Bacteria	1760
2243	Ga0500593_000733	3300053117	Bacteria	12399
2244	Ga0500595_066830	3300053119	Bacteria	1074
2245	Ga0500608_086267	3300053122	Bacteria	1474
2246	Ga0500628_001962	3300053129	Bacteria	3458
2247	Ga0500652_000914	3300053131	Bacteria	9744
2248	Ga0500652_022031	3300053131	Bacteria	2407
2249	Ga0500561_0001570	3300053137	Bacteria	3727
2250	Ga0500568_0000054	3300053139	Bacteria	111105
2251	Ga0500568_0037859	3300053139	Bacteria	1955
2252	Ga0500573_0003282	3300053140	Bacteria	8343
2253	Ga0500573_0142081	3300053140	Bacteria	1321
2254	Ga0500573_0197020	3300053140	Bacteria	1072
2255	Ga0500574_085407	3300053141	Bacteria	933
2256	Ga0500579_077488	3300053143	Bacteria	1880
2257	Ga0500600_0016706	3300053149	Bacteria	4439
2258	Ga0500604_0005995	3300053151	Bacteria	3208
2259	Ga0500604_0060796	3300053151	Bacteria	1186
2260	Ga0500616_0006235	3300053153	Bacteria	7865
2261	Ga0500616_0007010	3300053153	Bacteria	7239
2262	Ga0500616_0081420	3300053153	Bacteria	1626
2263	Ga0500616_0249670	3300053153	Bacteria	758
2264	Ga0500620_000606	3300053155	Bacteria	6157
2265	Ga0500620_079091	3300053155	Bacteria	1137
2266	Ga0500627_0022186	3300053158	Bacteria	2571
2267	Ga0500627_0230339	3300053158	Bacteria	824
2268	Ga0500627_0302565	3300053158	Bacteria	698
2269	Ga0500633_0003334	3300053160	Bacteria	3488
2270	Ga0500633_0118289	3300053160	Bacteria	985
2271	Ga0500634_0027131	3300053161	Bacteria	3120
2272	Ga0500634_0180384	3300053161	Bacteria	951
2273	Ga0500645_000350	3300053730	Bacteria	32773
2274	Ga0500645_008940	3300053730	Bacteria	3388
2275	Ga0500656_000691	3300053732	Bacteria	2618
2276	Ga0500565_002669	3300053734	Bacteria	1351
2277	Ga0500587_000159	3300053739	Bacteria	6630
2278	Ga0501084_0011064	3300054114	Bacteria	7471
2279	Ga0501084_0070360	3300054114	Bacteria	2930
2280	Ga0587084_017773	3300059477	Bacteria	1030
2281	Ga0587084_067902	3300059477	Bacteria	667
2282	Ga0587073_0042187	3300059492	Bacteria	999
2283	Ga0587090_063075	3300059510	Bacteria	707
2284	Ga0587091_100773	3300059511	Bacteria	677
2285	Ga0587105_003981	3300059651	Bacteria	925
2286	Ga0587096_01793	3300060247	Bacteria	763
2287	Ga0587111_0146663	3300060346	Bacteria	630
2288	Ga0501082_0007246	3300060353	Bacteria	9566
2289	Ga0466962_0000702	3300061719	Bacteria	14905
2290	Ga0466962_0005074	3300061719	Bacteria	6334
2291	Ga0466962_0009107	3300061719	Bacteria	4755
2292	Ga0466962_0012434	3300061719	Bacteria	4091
2293	Ga0466962_0023780	3300061719	Bacteria	2944
2294	Ga0530510_0211608	3300061734	Bacteria	1440
2295	2503203107	2503198000	Bacteria	6884444
2296	2509114892	2508501123	Bacteria	6283661
2297	2509143888	2508501127	Bacteria	7037543
2298	2509372686	2509276018	Bacteria	6910194
2299	2509397569	2509276022	Bacteria	6200534
2300	2510319757	2510065059	Bacteria	6847884
2301	2512930084	2512875016	Bacteria	6529530
2302	2512964768	2512875024	Bacteria	7195110
2303	2514033133	2513237164	Bacteria	7563725
2304	2514420744	2513237305	Bacteria	7293571
2305	2547406515	2547132111	Bacteria	8013147
2306	2548696796	2547132424	Bacteria	8348532
2307	2585300376	2582581312	Bacteria	7308206
2308	2585303512	2582581313	Bacteria	10042643
2309	2588515700	2588253730	Bacteria	6881675
2310	2597813030	2597489875	Bacteria	7010078
2311	2616695605	2616644814	Bacteria	11555299
2312	2616900841	2616644941	Bacteria	8510691
2313	2643760230	2643221548	Bacteria	8053412
2314	2643904472	2643221578	Bacteria	9213798
2315	2643986602	2643221595	Bacteria	6565519
2316	2644093919	2643221615	Bacteria	5487866
2317	2644157537	2643221627	Bacteria	6761570
2318	2644323763	2643221657	Bacteria	5490246
2319	2644389081	2643221670	Bacteria	6497041
2320	2644406260	2643221673	Bacteria	9196637
2321	2644456905	2643221681	Bacteria	3707866
2322	2644460074	2643221682	Bacteria	6743283
2323	2645719835	2643221961	Bacteria	3919167
2324	2645726713	2643221962	Bacteria	3874254
2325	2671695268	2671180139	Bacteria	4196045
2326	2688599967	2687453392	Bacteria	6880454
2327	2723576766	2721755686	Bacteria	7343952
2328	2738668683	2738541264	Bacteria	5935393
2329	2739147875	2738541356	Bacteria	5935017
2330	2756673485	2756170246	Bacteria	7451806
2331	2785345754	2784746763	Bacteria	9783172
2332	2785367135	2784746768	Bacteria	10036182
2333	2786668183	2786546132	Bacteria	10419719
2334	2792748953	2791355123	Bacteria	8049106
2335	2793976638	2791355406	Bacteria	11364898
2336	2811846951	2808606982	Bacteria	7791042
2337	2812360334	2811994879	Bacteria	9313447
2338	2812482434	2811994917	Bacteria	7761064
2339	2819696351	2818991463	Bacteria	7948711
2340	2841738887	2841734538	Bacteria	6784580
2341	2844005946	2844002411	Bacteria	7168230
2342	2844015233	2844009547	Bacteria	6728125
2343	2856324569	2856320880	Bacteria	7263508
2344	2856333219	2856328259	Bacteria	6528202
2345	2856338672	2856334872	Bacteria	7037011
2346	2856343269	2856342000	Bacteria	7176905
2347	2856356725	2856356410	Bacteria	6297484
2348	2857374843	2857367948	Bacteria	6965560
2349	2857712976	2857710386	Bacteria	3186771
2350	2862186266	2862178590	Bacteria	8583590
2351	2862289677	2862281513	Bacteria	9621493
2352	2862292449	2862290372	Bacteria	7471434
2353	2862386974	2862382967	Bacteria	10317375
2354	2862510402	2862507626	Bacteria	9425308
2355	2862583736	2862574272	Bacteria	10567477
2356	2863406989	2863404153	Bacteria	9672205
2357	2867430062	2867428634	Bacteria	9590268
2358	2867475683	2867475112	Bacteria	6909112
2359	2869164213	2869162929	Bacteria	6399702
2360	2869176781	2869169390	Bacteria	6659796
2361	2869240066	2869234852	Bacteria	6654993
2362	2869246275	2869242130	Bacteria	6609239
2363	2869251448	2869249662	Bacteria	6868783
2364	2869260913	2869256925	Bacteria	6981691
2365	2869269817	2869264136	Bacteria	6880765
2366	2869275162	2869271264	Bacteria	6908218
2367	2869281433	2869278585	Bacteria	7077053
2368	2871438849	2871435913	Bacteria	6880295
2369	2871459003	2871451962	Bacteria	7336357
2370	2871465439	2871459585	Bacteria	6866887
2371	2871469837	2871466892	Bacteria	6923287
2372	2871476881	2871474448	Bacteria	6806570
2373	2871485672	2871481445	Bacteria	6700002
2374	2871489275	2871488783	Bacteria	6929816
2375	2874112624	2874109183	Bacteria	6517025
2376	2874118877	2874116593	Bacteria	6674494
2377	2874131171	2874123672	Bacteria	7238285
2378	2874131853	2874131515	Bacteria	6820270
2379	2874140901	2874139085	Bacteria	7021506
2380	2874164591	2874162495	Bacteria	6174670
2381	2874170455	2874168670	Bacteria	8062617
2382	2875392676	2875391855	Bacteria	7600475
2383	2876366352	2876363079	Bacteria	6544991
2384	2876388984	2876386047	Bacteria	6698674
2385	2876404000	2876399893	Bacteria	6927900
2386	2876408770	2876406927	Bacteria	6191900
2387	2876427030	2876420981	Bacteria	6687741
2388	2877683411	2877676314	Bacteria	9512378
2389	2878735257	2878730984	Bacteria	6380721
2390	2878742679	2878738818	Bacteria	7136951
2391	2878753811	2878753008	Bacteria	6922523
2392	2878779615	2878774303	Bacteria	6108671
2393	2878782176	2878781027	Bacteria	6834456
2394	2878790220	2878788777	Bacteria	6567085
2395	2881849528	2881845957	Bacteria	6611900
2396	2881862075	2881861095	Bacteria	7128710
2397	2882632961	2882632389	Bacteria	8154593
2398	2882913572	2882912400	Bacteria	6801539
2399	2885319816	2885318864	Bacteria	6729568
2400	2888341145	2888337043	Bacteria	6629336
2401	2888345618	2888343758	Bacteria	6611049
2402	2902815114	2902810491	Bacteria	6794147
2403	2903452612	2903448605	Bacteria	7357801
2404	2903497155	2903492973	Bacteria	13473544
2405	2903520758	2903513507	Bacteria	6344008
2406	2903524220	2903521522	Bacteria	6525694
2407	2903533597	2903528002	Bacteria	6586099
2408	2906368196	2906363423	Bacteria	6856682
2409	2906373870	2906370794	Bacteria	6881062
2410	2906381302	2906378014	Bacteria	6911440
2411	2906390160	2906386501	Bacteria	5977019
2412	2906395126	2906393657	Bacteria	6790866
2413	2906403870	2906401398	Bacteria	6693206
2414	2906413476	2906408224	Bacteria	6162342
2415	2906427607	2906427513	Bacteria	6375796
2416	2912722418	2912715099	Bacteria	9460473
2417	2912758874	2912757875	Bacteria	7940295
2418	2918502503	2918501144	Bacteria	8668083
2419	2919717590	2919713450	Bacteria	7431245
2420	2922154695	2922151315	Bacteria	6902399
2421	2922172980	2922172374	Bacteria	6167644
2422	2922181442	2922178524	Bacteria	6025201
2423	2924714710	2924710171	Bacteria	6752351
2424	2924721259	2924718760	Bacteria	6331356
2425	2924735215	2924733363	Bacteria	7574837
2426	2924743145	2924741084	Bacteria	6661321
2427	2924753616	2924748358	Bacteria	6154725
2428	2924761177	2924754689	Bacteria	6774424
2429	2924765761	2924762789	Bacteria	6561353
2430	2924780479	2924776078	Bacteria	7492003
2431	2924791942	2924784321	Bacteria	7416538
2432	2937823194	2937822353	Bacteria	7290551
2433	2937842951	2937836603	Bacteria	6811263
2434	2937855285	2937848649	Bacteria	6983481
2435	2937865545	2937861824	Bacteria	6660327
2436	2937870208	2937868953	Bacteria	6639878
2437	2937883006	2937877337	Bacteria	7246526
2438	2937973758	2937972304	Bacteria	7532020
2439	2937986917	2937980651	Bacteria	6517427
2440	2946052038	2946045630	Bacteria	8527308
2441	2946065554	2946064051	Bacteria	8957905
2442	2954674466	2954673503	Bacteria	9685905
2443	2954689666	2954682443	Bacteria	9862841
2444	2954718389	2954711539	Bacteria	10867210
2445	2954728359	2954721474	Bacteria	10456478
2446	2954733450	2954731030	Bacteria	10243860
2447	2954747255	2954740390	Bacteria	10229294
2448	2954752333	2954749733	Bacteria	10366972
2449	2954766370	2954759201	Bacteria	9358192
2450	2958037395	2958034702	Bacteria	6989922
2451	2958047107	2958041894	Bacteria	13082850
2452	2958069640	2958064165	Bacteria	7158582
2453	2958072232	2958071322	Bacteria	6815895
2454	2958090132	2958084443	Bacteria	7312792
2455	2958093454	2958092219	Bacteria	6861151
2456	2958110030	2958108152	Bacteria	6681128
2457	2958122878	2958122699	Bacteria	7280457
2458	2958139564	2958137437	Bacteria	6050276
2459	2958150612	2958144490	Bacteria	6677056
2460	2958159638	2958158011	Bacteria	6058449
2461	2961139435	2961136820	Bacteria	6775228
2462	2961171583	2961170736	Bacteria	7072258
2463	2961186214	2961183825	Bacteria	6688536
2464	2963649148	2963644680	Bacteria	6530403
2465	2965030491	2965025482	Bacteria	6532201
2466	2965035460	2965032056	Bacteria	6887443
2467	2965045941	2965040258	Bacteria	6855979
2468	2965052473	2965047637	Bacteria	6623551
2469	2965094303	2965089291	Bacteria	6866420
2470	2965110289	2965102966	Bacteria	6800987
2471	2965112615	2965110997	Bacteria	6693150
2472	2966604434	2966598605	Bacteria	7676064
2473	2967996340	2967996073	Bacteria	6787468
2474	2968004573	2968003550	Bacteria	6929263
2475	2968019765	2968016561	Bacteria	7022047
2476	2968084393	2968083720	Bacteria	7351627
2477	2968139784	2968138860	Bacteria	6605449
2478	2970473086	2970469710	Bacteria	6969209
2479	2970495233	2970489779	Bacteria	6517260
2480	2970504040	2970503327	Bacteria	7099517
2481	2970515695	2970510686	Bacteria	7006402
2482	2970528323	2970524798	Bacteria	6840927
2483	2970535430	2970532167	Bacteria	6553173
2484	2970540082	2970540015	Bacteria	6977556
2485	2970553528	2970547951	Bacteria	6931819
2486	2970596037	2970593180	Bacteria	7073582
2487	2970623868	2970619444	Bacteria	6986144
2488	2970630804	2970627176	Bacteria	6680862
2489	2977823029	2977821940	Bacteria	6906439
2490	2977834361	2977828996	Bacteria	7007971
2491	2977854114	2977851361	Bacteria	6694324
2492	2977874143	2977872689	Bacteria	7270173
2493	2977904717	2977898635	Bacteria	6675551
2494	2977910245	2977907340	Bacteria	6577984
2495	2977917962	2977915119	Bacteria	6829656
2496	2977926966	2977922695	Bacteria	6956781
2497	2977939390	2977935797	Bacteria	6252826
2498	2977951571	2977950692	Bacteria	6893264
2499	2977963760	2977957713	Bacteria	6877875
2500	2977987300	2977986579	Bacteria	6581278
2501	2979778037	2979772303	Bacteria	6618277
2502	2979797689	2979793036	Bacteria	6808957
2503	2979808675	2979808191	Bacteria	7179355
2504	2987648873	2987645492	Bacteria	6117018
2505	2987673085	2987666974	Bacteria	6509233
2506	2990059593	2990059506	Bacteria	9321252
2507	2995469374	2995463766	Bacteria	8577691
2508	2996351790	2996348954	Bacteria	7239054
2509	2996390607	2996386984	Bacteria	6978667
2510	2997605691	2997600082	Bacteria	9896405
2511	3000139061	3000135777	Bacteria	6891109
2512	3004170718	3004167301	Bacteria	8330599
2513	3004200410	3004195979	Bacteria	6776956
2514	3004214823	3004211236	Bacteria	7417683
2515	3004222586	3004218560	Bacteria	7421728
2516	3004234411	3004232784	Bacteria	6662140
2517	3004244511	3004239961	Bacteria	6892290
2518	3004251811	3004248173	Bacteria	6563236
2519	3004270838	3004268573	Bacteria	7043476
2520	3004278489	3004275668	Bacteria	7114440
2521	3004289618	3004289098	Bacteria	6135450
2522	3004339620	3004334049	Bacteria	8449246
2523	3006328029	3006321560	Bacteria	8247479
2524	3006399557	3006393351	Bacteria	6615579
2525	3006430689	3006425503	Bacteria	6491253
2526	3006490459	3006486233	Bacteria	8157040
2527	3006495136	3006493962	Bacteria	8825450
2528	637079866	637000159	Bacteria	7596297
2529	649874445	649633066	Bacteria	6690028
2530	8004307360	8004300914	Bacteria	6132239
2531	8004365105	8004361976	Bacteria	6858373
2532	8004375385	8004374579	Bacteria	6898112
2533	8004402750	8004395343	Bacteria	6620908
2534	8004634351	8004633249	Bacteria	6723080
2535	8004702484	8004695233	Bacteria	6731676
2536	8004728580	8004727605	Bacteria	6643904
2537	8008561296	8008558824	Bacteria	10610750
2538	8023625010	8023623736	Bacteria	8593882
2539	8025484320	8025478263	Bacteria	8209203
2540	8025534174	8025530807	Bacteria	8495698
2541	8033685008	8033684223	Bacteria	6906479
2542	8047894830	8047893842	Bacteria	11723082
2543	8048130386	8048127548	Bacteria	11053136
2544	8048364219	8048356638	Bacteria	11044339
2545	8048371849	8048369669	Bacteria	11666822
2546	8048380782	8048379754	Bacteria	11877923
2547	8054163830	8054160619	Bacteria	7783213
2548	8055620495	8055617313	Bacteria	7548464
2549	8056066455	8056060235	Bacteria	7259403
2550	8056449965	8056447290	Bacteria	7680491
2551	8056835719	8056829672	Bacteria	9045328
2552	Ga0436365_0619963
2553	LJQas_1003538
2554	JGI24746J21847_1009299
2555	JGI24747J21853_1012549
2556	JGI24739J22299_10113795
2557	JGI24737J22298_10028470
2558	JGI24743J22301_10004175
2559	JGI24750J21931_1008178
2560	JGI24745J21846_1006851
2561	JGI24748J21848_1001688
2562	JGI24748J21848_1013647
2563	JGI24744J21845_10001803
2564	JGI24744J21845_10001863
2565	JGI24034J26672_10003153
2566	JGI24034J26672_10014429
2567	JGI24742J22300_10006040
2568	Ga0007423J48922_100257
2569	Ga0006758J48902_1030490
2570	Ga0006777J48905_1036155
2571	JGI25404J52841_10021394
2572	Ga0032354_1035482
2573	Ga0006780_1034030
2574	Ga0055542_1000344
2575	Ga0055529_1006117
2576	Ga0055540_1000085
2577	Ga0055540_1014583
2578	Ga0055540_1019990
2579	Ga0070658_10069898
2580	Ga0070658_10130301
2581	Ga0070676_10108836
2582	Ga0070683_100235900
2583	Ga0070683_100359580
2584	Ga0070683_100593702
2585	Ga0070670_100445551
2586	Ga0068869_100096475
2587	Ga0068869_100158304
2588	Ga0070666_10045683
2589	Ga0070682_100020784
2590	Ga0070682_100026915
2591	Ga0070682_100186692
2592	Ga0068868_100002447
2593	Ga0068868_100033072
2594	Ga0068868_100148781
2595	Ga0070660_100044102
2596	Ga0070660_100070517
2597	Ga0070660_100222998
2598	Ga0070660_100355715
2599	Ga0070689_100316810
2600	Ga0070691_10014028
2601	Ga0070691_10113408
2602	Ga0070691_10148261
2603	Ga0070691_10261402
2604	Ga0070692_10159371
2605	Ga0070668_100002161
2606	Ga0070668_100184742
2607	Ga0070668_100328656
2608	Ga0070668_100363105
2609	Ga0070668_100635748
2610	Ga0070675_100059053
2611	Ga0070675_100237222
2612	Ga0070671_100074578
2613	Ga0070671_100093992
2614	Ga0070671_100096727
2615	Ga0070674_100011743
2616	Ga0070674_100043876
2617	Ga0070673_100191767
2618	Ga0070673_100245757
2619	Ga0070688_100029765
2620	Ga0070688_100381805
2621	Ga0070688_100532504
2622	Ga0070659_100011591
2623	Ga0070659_100125346
2624	Ga0070659_100342062
2625	Ga0070659_100753821
2626	Ga0070667_100000034
2627	Ga0070667_100001073
2628	Ga0070667_100002881
2629	Ga0070667_100383815
2630	Ga0070667_100443989
2631	Ga0070667_100661057
2632	Ga0070709_10009921
2633	Ga0070709_10014784
2634	Ga0070709_10053593
2635	Ga0070709_10143904
2636	Ga0070709_10194744
2637	Ga0070709_11024620
2638	Ga0070714_100000290
2639	Ga0070714_100002881
2640	Ga0070714_100005488
2641	Ga0070714_100012955
2642	Ga0070714_100020406
2643	Ga0070714_100028126
2644	Ga0070714_100041134
2645	Ga0070714_100076589
2646	Ga0070714_100192184
2647	Ga0070714_100217520
2648	Ga0070714_100261962
2649	Ga0070714_100290321
2650	Ga0070714_100318186
2651	Ga0070714_100337093
2652	Ga0070714_100381170
2653	Ga0070714_100645782
2654	Ga0070714_100648299
2655	Ga0070714_100857664
2656	Ga0070713_100018027
2657	Ga0070713_100055086
2658	Ga0070713_100107476
2659	Ga0070713_100114173
2660	Ga0070713_100127436
2661	Ga0070713_100165475
2662	Ga0070713_100306389
2663	Ga0070713_100359429
2664	Ga0070713_100424961
2665	Ga0070713_100482817
2666	Ga0070713_100688573
2667	Ga0070713_100749164
2668	Ga0070710_10000423
2669	Ga0070710_10001481
2670	Ga0070710_10030661
2671	Ga0070710_10042345
2672	Ga0070710_10047562
2673	Ga0070710_10105794
2674	Ga0070710_10333354
2675	Ga0070710_10388537
2676	Ga0070701_10564621
2677	Ga0070711_100007390
2678	Ga0070711_100039162
2679	Ga0070711_100093811
2680	Ga0070711_100104175
2681	Ga0070711_100147185
2682	Ga0070711_100619049
2683	Ga0070711_100941710
2684	Ga0070705_100303480
2685	Ga0070700_100001071
2686	Ga0070700_100028795
2687	Ga0070700_100047342
2688	Ga0070694_100220739
2689	Ga0070708_100016906
2690	Ga0070708_100023790
2691	Ga0070708_100086173
2692	Ga0070708_100092998
2693	Ga0070708_100191832
2694	Ga0070708_100406690
2695	Ga0070708_100470559
2696	Ga0070708_100824599
2697	Ga0070708_101375271
2698	Ga0070663_100002171
2699	Ga0070663_100075260
2700	Ga0070663_100081837
2701	Ga0070663_100126327
2702	Ga0070663_100520138
2703	Ga0070678_100000075
2704	Ga0070678_100107839
2705	Ga0070678_100141294
2706	Ga0070678_100545467
2707	Ga0070662_100074480
2708	Ga0070662_100208206
2709	Ga0070681_10162925
2710	Ga0068867_100081236
2711	Ga0068867_100184763
2712	Ga0070685_10042516
2713	Ga0070685_10120697
2714	Ga0070685_10558919
2715	Ga0070706_100001516
2716	Ga0070706_100002685
2717	Ga0070706_100003256
2718	Ga0070706_100016626
2719	Ga0070706_100024183
2720	Ga0070706_100053119
2721	Ga0070706_100059403
2722	Ga0070706_100069190
2723	Ga0070707_100000199
2724	Ga0070707_100001332
2725	Ga0070707_100021992
2726	Ga0070707_100047832
2727	Ga0070707_100060680
2728	Ga0070707_100065880
2729	Ga0070707_100071969
2730	Ga0070707_100143075
2731	Ga0070707_100353264
2732	Ga0070707_100947408
2733	Ga0070707_101319945
2734	Ga0070698_100000223
2735	Ga0070698_100000264
2736	Ga0070698_100001732
2737	Ga0070698_100004633
2738	Ga0070698_100012790
2739	Ga0070698_100041247
2740	Ga0070698_100593517
2741	Ga0070698_100685301
2742	Ga0070699_100031473
2743	Ga0070699_100047031
2744	Ga0070699_100098526
2745	Ga0070699_100118174
2746	Ga0070699_100690592
2747	Ga0070679_100045911
2748	Ga0070679_101112356
2749	Ga0070684_100240100
2750	Ga0070697_100027134
2751	Ga0070697_100029409
2752	Ga0070697_100036794
2753	Ga0068853_100002826
2754	Ga0068853_100114053
2755	Ga0068853_100137923
2756	Ga0068853_100370180
2757	Ga0068853_100789507
2758	Ga0068853_100824853
2759	Ga0070672_100445547
2760	Ga0070672_100550282
2761	Ga0070686_100022509
2762	Ga0070686_100042792
2763	Ga0070686_100125696
2764	Ga0070696_100006661
2765	Ga0070696_100166714
2766	Ga0070696_100480564
2767	Ga0070665_100010682
2768	Ga0070665_100025789
2769	Ga0070665_100030748
2770	Ga0070665_100033302
2771	Ga0070665_100076253
2772	Ga0070665_100079296
2773	Ga0070665_100103991
2774	Ga0070665_100345739
2775	Ga0070665_100509718
2776	Ga0070704_100000415
2777	Ga0070704_100081724
2778	Ga0070704_101058115
2779	Ga0068855_100003272
2780	Ga0068855_100046848
2781	Ga0068855_100216874
2782	Ga0068855_101013520
2783	Ga0070664_100208411
2784	Ga0068857_100540980
2785	Ga0068854_100000209
2786	Ga0068854_100012492
2787	Ga0068854_100075993
2788	Ga0068856_100017537
2789	Ga0068856_100131615
2790	Ga0068856_100560610
2791	Ga0068856_100874325
2792	Ga0070702_100019075
2793	Ga0070702_100055497
2794	Ga0070702_100183969
2795	Ga0068852_100025393
2796	Ga0068852_100027005
2797	Ga0068852_100034595
2798	Ga0068852_100200463
2799	Ga0068852_100308138
2800	Ga0068859_100000228
2801	Ga0068859_100006371
2802	Ga0068859_100197276
2803	Ga0068864_100071757
2804	Ga0068864_100184186
2805	Ga0068864_100324606
2806	Ga0068864_100749495
2807	Ga0068866_10000202
2808	Ga0068866_10103147
2809	Ga0068866_10260875
2810	Ga0068861_100001529
2811	Ga0068861_100086641
2812	Ga0068861_100099881
2813	Ga0068861_100372858
2814	Ga0068861_100572428
2815	Ga0068851_10040150
2816	Ga0068851_10244409
2817	Ga0068870_10119783
2818	Ga0068863_100002759
2819	Ga0068863_100027391
2820	Ga0068863_100109704
2821	Ga0068863_100179210
2822	Ga0068863_100248869
2823	Ga0068863_100284467
2824	Ga0068858_100022857
2825	Ga0068858_100059181
2826	Ga0068858_100168230
2827	Ga0068858_100176822
2828	Ga0068858_100216359
2829	Ga0068858_100576368
2830	Ga0068860_100000011
2831	Ga0068860_100001399
2832	Ga0068860_100083428
2833	Ga0068860_100201871
2834	Ga0068860_100483909
2835	Ga0068860_100608483
2836	Ga0068860_100817697
2837	Ga0068862_100000021
2838	Ga0068862_100000139
2839	Ga0068862_100009253
2840	Ga0068862_100883927
2841	Ga0081455_10041564
2842	Ga0081455_10048108
2843	Ga0081455_10169127
2844	Ga0081455_10237493
2845	Ga0081538_10060434
2846	Ga0081540_1001223
2847	Ga0081540_1028867
2848	Ga0081540_1063160
2849	Ga0081539_10001412
2850	Ga0081539_10086905
2851	Ga0070717_10021713
2852	Ga0070717_10076455
2853	Ga0070717_10083176
2854	Ga0070717_10147916
2855	Ga0070717_10266166
2856	Ga0070717_10337373
2857	Ga0070717_10358895
2858	Ga0070717_10434948
2859	Ga0070717_10764394
2860	Ga0070717_10897522
2861	Ga0075365_10000694
2862	Ga0075365_10003722
2863	Ga0075365_10021166
2864	Ga0075365_10031612
2865	Ga0075365_10108938
2866	Ga0075365_10191153
2867	Ga0075365_10218666
2868	Ga0075365_10240146
2869	Ga0075365_10272560
2870	Ga0075365_10614317
2871	Ga0075365_10646570
2872	Ga0075368_10031885
2873	Ga0075363_100002442
2874	Ga0075363_100009800
2875	Ga0075363_100012710
2876	Ga0075363_100070171
2877	Ga0075363_100120930
2878	Ga0075363_100148611
2879	Ga0075363_100159540
2880	Ga0075363_100402591
2881	Ga0075364_10000205
2882	Ga0075364_10016218
2883	Ga0075364_10017530
2884	Ga0075364_10019402
2885	Ga0075364_10071791
2886	Ga0075364_10117711
2887	Ga0075364_10123872
2888	Ga0075364_10167195
2889	Ga0075364_10177082
2890	Ga0075364_10363059
2891	Ga0075432_10119514
2892	Ga0070715_10001558
2893	Ga0070715_10014337
2894	Ga0070715_10031874
2895	Ga0070715_10067410
2896	Ga0070715_10068295
2897	Ga0070716_100001175
2898	Ga0070716_100002321
2899	Ga0070716_100005247
2900	Ga0070716_100015433
2901	Ga0070716_100054266
2902	Ga0070716_100419220
2903	Ga0070716_100655573
2904	Ga0070712_100001001
2905	Ga0070712_100011324
2906	Ga0070712_100047349
2907	Ga0070712_100087142
2908	Ga0070712_100153339
2909	Ga0070712_100223262
2910	Ga0070712_100302259
2911	Ga0070712_100330403
2912	Ga0070712_100651827
2913	Ga0075362_10017019
2914	Ga0075362_10020161
2915	Ga0075362_10044481
2916	Ga0075362_10060986
2917	Ga0075362_10076563
2918	Ga0075362_10090113
2919	Ga0075362_10156975
2920	Ga0075367_10006967
2921	Ga0075367_10024302
2922	Ga0075367_10074800
2923	Ga0075367_10083201
2924	Ga0075367_10090173
2925	Ga0075367_10165681
2926	Ga0075369_10002919
2927	Ga0075369_10004542
2928	Ga0075369_10010160
2929	Ga0075369_10091123
2930	Ga0075369_10105037
2931	Ga0075369_10123166
2932	Ga0075369_10137193
2933	Ga0075369_10158863
2934	Ga0075369_10191703
2935	Ga0075366_10048468
2936	Ga0075366_10346100
2937	Ga0097621_100030638
2938	Ga0097621_100234143
2939	Ga0097621_100432678
2940	Ga0097621_100852268
2941	Ga0075370_10011642
2942	Ga0075370_10059823
2943	Ga0075370_10138488
2944	Ga0075370_10223713
2945	Ga0075370_10543395
2946	Ga0068871_100037007
2947	Ga0068871_100070856
2948	Ga0068871_100093506
2949	Ga0068871_100289590
2950	Ga0068871_100311962
2951	Ga0075428_100005462
2952	Ga0075428_100008753
2953	Ga0075428_100850149
2954	Ga0075430_100000139
2955	Ga0075430_100113867
2956	Ga0075431_100036061
2957	Ga0075431_100372468
2958	Ga0075434_100339297
2959	Ga0075434_100413140
2960	Ga0068865_100000661
2961	Ga0068865_100085135
2962	Ga0068865_100154692
2963	Ga0068865_100175119
2964	Ga0068865_100256400
2965	Ga0075436_100052435
2966	Ga0075436_100502891
2967	Ga0075436_100533566
2968	Ga0097620_100000228
2969	Ga0097620_100006372
2970	Ga0097620_100021730
2971	Ga0097620_100197257
2972	Ga0075435_100072366
2973	Ga0099794_10184448
2974	Ga0099795_10071956
2975	Ga0099795_10122874
2976	Ga0105244_10183845
2977	Ga0105250_10052083
2978	Ga0105250_10061639
2979	Ga0105240_10005833
2980	Ga0105240_10462159
2981	Ga0111539_10015509
2982	Ga0111539_11082232
2983	Ga0111539_11106111
2984	Ga0105245_10064465
2985	Ga0105245_10094170
2986	Ga0105245_10263886
2987	Ga0105245_10765539
2988	Ga0105245_10956246
2989	Ga0105247_10000067
2990	Ga0105247_10000092
2991	Ga0105247_10000164
2992	Ga0105247_10080146
2993	Ga0105247_10117059
2994	Ga0105247_10192405
2995	Ga0105247_10244299
2996	Ga0105247_10411822
2997	Ga0114129_10002252
2998	Ga0114129_10411265
2999	Ga0114129_10779534
3000	Ga0105243_10001036
3001	Ga0105243_10038353
3002	Ga0105243_10047614
3003	Ga0105243_10068550
3004	Ga0105241_10002402
3005	Ga0105241_10159396
3006	Ga0105241_10732833
3007	Ga0105242_10000597
3008	Ga0105242_10021864
3009	Ga0105242_10284724
3010	Ga0105242_11169482
3011	Ga0105248_10000040
3012	Ga0105248_10000162
3013	Ga0105248_10005718
3014	Ga0105248_10016800
3015	Ga0105248_10035423
3016	Ga0105248_10179329
3017	Ga0105248_10198131
3018	Ga0105248_10331667
3019	Ga0105248_10448713
3020	Ga0105248_10580716
3021	Ga0105248_10710739
3022	Ga0105237_10040797
3023	Ga0105237_10047910
3024	Ga0105237_10156010
3025	Ga0105237_10157556
3026	Ga0105237_10217275
3027	Ga0105237_10771799
3028	Ga0105238_10005065
3029	Ga0105238_10368700
3030	Ga0105238_10506305
3031	Ga0105238_10519025
3032	Ga0105238_10628291
3033	Ga0105249_10000001
3034	Ga0105249_10001140
3035	Ga0105249_10025675
3036	Ga0105249_10065707
3037	Ga0105249_10239831
3038	Ga0105249_10286728
3039	Ga0105249_10401399
3040	Ga0105239_10019480
3041	Ga0105239_10046724
3042	Ga0105239_10090134
3043	Ga0105239_10220435
3044	Ga0105239_10237965
3045	Ga0105239_10328215
3046	Ga0105239_10420417
3047	Ga0105239_10645281
3048	Ga0105239_10678410
3049	Ga0105239_10723421
3050	Ga0105246_10065212
3051	Ga0105246_10206332
3052	Ga0105246_10485577
3053	Ga0105246_10950907
3054	Ga0157373_10576755
3055	Ga0157370_10043797
3056	Ga0157370_10187673
3057	Ga0157370_10216878
3058	Ga0157370_10367347
3059	Ga0157370_10386491
3060	Ga0157370_10740152
3061	Ga0157369_10018866
3062	Ga0157369_10134426
3063	Ga0157369_10164282
3064	Ga0157369_10196725
3065	Ga0157369_10244097
3066	Ga0157369_10297951
3067	Ga0157369_10982904
3068	Ga0157374_10032596
3069	Ga0157374_10078142
3070	Ga0157374_10086959
3071	Ga0157374_10476467
3072	Ga0157378_10002483
3073	Ga0157378_10059112
3074	Ga0157378_10401738
3075	Ga0157378_10773049
3076	Ga0163162_10018721
3077	Ga0163162_10066182
3078	Ga0163162_10116505
3079	Ga0163162_10307995
3080	Ga0163162_10403608
3081	Ga0163162_10526825
3082	Ga0163162_10736457
3083	Ga0163162_11389388
3084	Ga0157372_10002385
3085	Ga0157372_10214655
3086	Ga0157372_10260108
3087	Ga0157372_10393913
3088	Ga0157372_10835875
3089	Ga0157372_11168237
3090	Ga0157375_10000305
3091	Ga0157375_10011389
3092	Ga0157375_10111370
3093	Ga0157375_10120131
3094	Ga0157375_10215018
3095	Ga0157375_10326352
3096	Ga0157375_10425929
3097	Ga0157375_10535596
3098	Ga0163163_10004278
3099	Ga0163163_10008973
3100	Ga0163163_10157183
3101	Ga0163163_10224364
3102	Ga0163163_10332554
3103	Ga0163163_10865255
3104	Ga0163163_11257601
3105	Ga0157380_10000732
3106	Ga0157380_10104479
3107	Ga0157380_10441714
3108	Ga0182008_10094938
3109	Ga0182008_10229283
3110	Ga0157377_10085873
3111	Ga0157377_10094831
3112	Ga0157377_10251506
3113	Ga0157377_10352713
3114	Ga0157379_10010556
3115	Ga0157379_10022633
3116	Ga0157379_10041960
3117	Ga0157379_10084885
3118	Ga0157379_10946809
3119	Ga0157379_10966445
3120	Ga0157376_10031111
3121	Ga0157376_10193996
3122	Ga0157376_10209724
3123	Ga0157376_10723062
3124	Ga0182006_1040276
3125	Ga0182007_10223356
3126	Ga0183367_1017
3127	Ga0163161_10004574
3128	Ga0163161_10091270
3129	Ga0163161_10145393
3130	Ga0163161_10265526
3131	Ga0163161_10298619
3132	Ga0163161_10661597
3133	Ga0197907_10415971
3134	Ga0197907_10943880
3135	Ga0197907_11133073
3136	Ga0197907_11144367
3137	Ga0206356_10897612
3138	Ga0206356_11062788
3139	Ga0206356_11180327
3140	Ga0206349_1518951
3141	Ga0206355_1140562
3142	Ga0206355_1702914
3143	Ga0206351_10208494
3144	Ga0206351_10218676
3145	Ga0206352_10169214
3146	Ga0206352_10868468
3147	Ga0206350_10966998
3148	Ga0206354_11061542
3149	Ga0206353_10883820
3150	Ga0206353_11554719
3151	Ga0206353_11888474
3152	Ga0154015_1045101
3153	Ga0154015_1299529
3154	Ga0213872_10092250
3155	Ga0213876_10000817
3156	Ga0213876_10038892
3157	Ga0213876_10088889
3158	Ga0213876_10095326
3159	Ga0213875_10001927
3160	Ga0213875_10003551
3161	Ga0213875_10015002
3162	Ga0213875_10018051
3163	Ga0213871_10046295
3164	Ga0224712_10005109
3165	Ga0224712_10363534
3166	Ga0224572_1015209
3167	Ga0209677_109996
3168	Ga0209148_1000123
3169	Ga0209233_1008173
3170	Ga0209455_1000129
3171	Ga0209025_1041064
3172	Ga0207426_1030467
3173	Ga0207426_1048136
3174	Ga0209051_1000200
3175	Ga0209051_1000826
3176	Ga0209051_1012923
3177	Ga0209051_1062830
3178	Ga0207656_10169406
3179	Ga0207656_10206568
3180	Ga0207696_1059485
3181	Ga0207653_10052867
3182	Ga0207692_10000263
3183	Ga0207692_10002656
3184	Ga0207692_10003293
3185	Ga0207692_10012726
3186	Ga0207692_10042085
3187	Ga0207692_10076931
3188	Ga0207692_10235085
3189	Ga0207642_10000164
3190	Ga0207642_10169248
3191	Ga0207642_10288960
3192	Ga0207710_10000094
3193	Ga0207710_10000178
3194	Ga0207710_10101917
3195	Ga0207710_10204070
3196	Ga0207710_10247292
3197	Ga0207710_10360484
3198	Ga0207688_10000096
3199	Ga0207688_10000339
3200	Ga0207688_10093814
3201	Ga0207688_10160973
3202	Ga0207688_10174021
3203	Ga0207680_10016867
3204	Ga0207680_10048469
3205	Ga0207647_10002749
3206	Ga0207647_10034535
3207	Ga0207647_10117645
3208	Ga0207647_10120868
3209	Ga0207647_10507161
3210	Ga0207685_10005172
3211	Ga0207685_10007722
3212	Ga0207685_10010811
3213	Ga0207685_10016497
3214	Ga0207685_10033161
3215	Ga0207685_10051456
3216	Ga0207685_10052146
3217	Ga0207699_10000610
3218	Ga0207699_10001927
3219	Ga0207699_10007984
3220	Ga0207699_10032935
3221	Ga0207699_10042144
3222	Ga0207699_10168856
3223	Ga0207699_10176955
3224	Ga0207699_10481441
3225	Ga0207645_10074704
3226	Ga0207645_10216184
3227	Ga0207643_10031868
3228	Ga0207643_10201844
3229	Ga0207643_10240216
3230	Ga0207643_10525344
3231	Ga0207705_10056162
3232	Ga0207684_10001106
3233	Ga0207684_10001458
3234	Ga0207684_10003530
3235	Ga0207684_10041510
3236	Ga0207684_10093377
3237	Ga0207684_10169859
3238	Ga0207684_10552982
3239	Ga0207684_10685694
3240	Ga0207654_10011204
3241	Ga0207707_10297000
3242	Ga0207695_10002892
3243	Ga0207671_10000492
3244	Ga0207671_10008904
3245	Ga0207671_10182215
3246	Ga0207671_10237311
3247	Ga0207693_10000634
3248	Ga0207693_10000717
3249	Ga0207693_10017906
3250	Ga0207693_10022433
3251	Ga0207693_10024942
3252	Ga0207693_10025360
3253	Ga0207693_10113273
3254	Ga0207693_10168294
3255	Ga0207693_10177806
3256	Ga0207693_10192770
3257	Ga0207663_10004272
3258	Ga0207663_10026843
3259	Ga0207663_10036412
3260	Ga0207663_10080754
3261	Ga0207663_10103941
3262	Ga0207663_10117588
3263	Ga0207663_10198217
3264	Ga0207663_10215982
3265	Ga0207663_10233833
3266	Ga0207660_10151756
3267	Ga0207662_10087424
3268	Ga0207657_10036453
3269	Ga0207657_10039367
3270	Ga0207657_10046993
3271	Ga0207652_10142808
3272	Ga0207652_10616268
3273	Ga0207646_10000278
3274	Ga0207646_10002274
3275	Ga0207646_10032456
3276	Ga0207646_10048454
3277	Ga0207646_10075177
3278	Ga0207646_10094625
3279	Ga0207646_10101784
3280	Ga0207646_10122262
3281	Ga0207646_10791861
3282	Ga0207646_11109684
3283	Ga0207681_10028367
3284	Ga0207681_10671500
3285	Ga0207694_10002567
3286	Ga0207694_10099420
3287	Ga0207650_10070031
3288	Ga0207659_10038839
3289	Ga0207659_10207574
3290	Ga0207687_10001922
3291	Ga0207687_10017942
3292	Ga0207687_10442494
3293	Ga0207700_10003840
3294	Ga0207700_10004108
3295	Ga0207700_10005449
3296	Ga0207700_10007536
3297	Ga0207700_10010589
3298	Ga0207700_10013898
3299	Ga0207700_10028540
3300	Ga0207700_10033437
3301	Ga0207700_10038204
3302	Ga0207700_10076566
3303	Ga0207700_10088796
3304	Ga0207700_10123859
3305	Ga0207700_10249995
3306	Ga0207700_10273605
3307	Ga0207700_10836013
3308	Ga0207664_10001479
3309	Ga0207664_10007686
3310	Ga0207664_10008327
3311	Ga0207664_10015082
3312	Ga0207664_10018328
3313	Ga0207664_10025086
3314	Ga0207664_10026538
3315	Ga0207664_10034325
3316	Ga0207664_10071267
3317	Ga0207664_10122594
3318	Ga0207664_10184588
3319	Ga0207664_10196436
3320	Ga0207664_10200232
3321	Ga0207664_10207824
3322	Ga0207664_10550767
3323	Ga0207664_10951042
3324	Ga0207664_11271316
3325	Ga0207644_10010272
3326	Ga0207644_10014182
3327	Ga0207644_10072405
3328	Ga0207644_10125771
3329	Ga0207644_10690296
3330	Ga0207690_10068287
3331	Ga0207690_10198126
3332	Ga0207690_10312034
3333	Ga0207690_10388743
3334	Ga0207690_10392298
3335	Ga0207706_10023920
3336	Ga0207706_10229252
3337	Ga0207686_10031551
3338	Ga0207686_10074003
3339	Ga0207686_10407376
3340	Ga0207709_10015396
3341	Ga0207709_10111098
3342	Ga0207709_10215850
3343	Ga0207670_10005154
3344	Ga0207670_10141385
3345	Ga0207669_10002349
3346	Ga0207669_10156799
3347	Ga0207704_10003687
3348	Ga0207704_10090201
3349	Ga0207704_10175834
3350	Ga0207704_10180486
3351	Ga0207665_10002349
3352	Ga0207665_10004622
3353	Ga0207665_10013522
3354	Ga0207665_10014943
3355	Ga0207665_10015474
3356	Ga0207665_10015730
3357	Ga0207665_10031991
3358	Ga0207665_10852425
3359	Ga0207691_10061032
3360	Ga0207691_10074146
3361	Ga0207691_10157609
3362	Ga0207691_10506837
3363	Ga0207691_10871234
3364	Ga0207711_10000112
3365	Ga0207711_10000126
3366	Ga0207711_10053307
3367	Ga0207711_10104690
3368	Ga0207711_10114555
3369	Ga0207711_10175950
3370	Ga0207711_10190107
3371	Ga0207711_10292670
3372	Ga0207711_10390458
3373	Ga0207711_10734479
3374	Ga0207689_10029503
3375	Ga0207689_10100237
3376	Ga0207661_10268271
3377	Ga0207661_10392772
3378	Ga0207661_10748123
3379	Ga0207679_10142795
3380	Ga0207667_10007907
3381	Ga0207667_10244765
3382	Ga0207667_10252370
3383	Ga0207667_10278466
3384	Ga0207667_10287919
3385	Ga0207667_10727080
3386	Ga0207651_10145183
3387	Ga0207651_10428324
3388	Ga0207712_10000006
3389	Ga0207712_10008843
3390	Ga0207712_10035833
3391	Ga0207712_10232874
3392	Ga0207712_10473011
3393	Ga0207712_10723623
3394	Ga0207668_10004608
3395	Ga0207668_10057791
3396	Ga0207640_10004268
3397	Ga0207640_10013966
3398	Ga0207640_10071857
3399	Ga0207640_10341030
3400	Ga0207640_10657814
3401	Ga0207658_10000108
3402	Ga0207658_10003296
3403	Ga0207658_10007702
3404	Ga0207658_10028606
3405	Ga0207658_10310152
3406	Ga0207658_10542010
3407	Ga0207658_10751159
3408	Ga0207677_10001300
3409	Ga0207677_10057209
3410	Ga0207677_10174147
3411	Ga0207677_10174456
3412	Ga0207677_10526563
3413	Ga0207703_10046111
3414	Ga0207703_10149562
3415	Ga0207703_10162284
3416	Ga0207703_10235150
3417	Ga0207703_10238289
3418	Ga0207639_10019367
3419	Ga0207639_10175472
3420	Ga0207639_10250904
3421	Ga0207639_10671106
3422	Ga0207678_10004438
3423	Ga0207678_10025301
3424	Ga0207678_10062414
3425	Ga0207678_10258662
3426	Ga0207678_10291114
3427	Ga0207678_10319218
3428	Ga0207678_10596440
3429	Ga0207708_10038842
3430	Ga0207708_10068628
3431	Ga0207702_10012783
3432	Ga0207702_10765879
3433	Ga0207702_11517920
3434	Ga0207641_10004858
3435	Ga0207641_10018642
3436	Ga0207641_10090840
3437	Ga0207641_10096178
3438	Ga0207641_10406518
3439	Ga0207641_10765751
3440	Ga0207648_10001107
3441	Ga0207648_10043288
3442	Ga0207648_10152216
3443	Ga0207648_10187859
3444	Ga0207648_10598365
3445	Ga0207676_10100139
3446	Ga0207676_10160976
3447	Ga0207676_10533637
3448	Ga0207676_10672443
3449	Ga0207674_10025085
3450	Ga0207674_10036369
3451	Ga0207674_10236768
3452	Ga0207674_10400902
3453	Ga0207675_100000555
3454	Ga0207675_100020354
3455	Ga0207675_100040607
3456	Ga0207675_100660956
3457	Ga0207683_10000795
3458	Ga0207683_10087918
3459	Ga0207683_10105912
3460	Ga0207683_10309862
3461	Ga0207698_10006857
3462	Ga0207698_10061977
3463	Ga0207698_10330721
3464	Ga0207698_10414057
3465	Ga0207698_10468399
3466	Ga0207698_11177373
3467	Ga0209813_10002378
3468	Ga0209813_10050881
3469	Ga0268266_10003769
3470	Ga0268266_10005376
3471	Ga0268266_10026053
3472	Ga0268266_10037420
3473	Ga0268266_10067099
3474	Ga0268266_10075196
3475	Ga0268266_10110271
3476	Ga0268266_10218332
3477	Ga0268266_10247291
3478	Ga0268266_10267629
3479	Ga0268266_10429954
3480	Ga0268266_10825157
3481	Ga0268265_10000032
3482	Ga0268265_10000034
3483	Ga0268265_10005171
3484	Ga0268265_10073017
3485	Ga0268265_10748443
3486	Ga0268264_10000026
3487	Ga0268264_10010060
3488	Ga0268264_10300291
3489	Ga0268264_10381635
3490	Ga0268264_10423023
3491	Ga0268264_10573493
3492	Ga0268264_10677030
3493	Ga0268264_10720006
3494	Ga0265337_1000279
3495	Ga0265337_1038114
3496	Ga0265326_10000533
3497	Ga0265319_1001077
3498	Ga0265334_10000292
3499	Ga0265323_10001007
3500	Ga0265322_10002610
3501	Ga0265336_10007568
3502	Ga0265336_10010609
3503	Ga0307517_10006575
3504	Ga0307517_10006948
3505	Ga0307515_10002608
3506	Ga0265338_10000827
3507	Ga0265338_10003087
3508	Ga0265324_10000826
3509	Ga0307511_10004244
3510	Ga0307511_10171324
3511	Ga0316182_1288760
3512	Ga0265760_10088362
3513	Ga0265332_10000688
3514	Ga0265320_10000591
3515	Ga0265325_10005697
3516	Ga0265340_10000611
3517	Ga0265327_10000062
3518	Ga0265327_10008428
3519	Ga0265316_10005669
3520	Ga0307509_10178836
3521	Ga0307509_10255380
3522	Ga0307509_10360763
3523	Ga0307408_100550818
3524	Ga0265313_10002273
3525	Ga0307508_10001597
3526	Ga0307508_10109641
3527	Ga0307508_10184597
3528	Ga0307508_10456693
3529	Ga0316575_10009061
3530	Ga0265314_10002719
3531	Ga0265342_10064883
3532	Ga0316576_10000047
3533	Ga0316576_10000224
3534	Ga0316576_10013172
3535	Ga0316576_10045801
3536	Ga0316576_10105104
3537	Ga0316576_10203214
3538	Ga0316576_10220436
3539	Ga0316576_10319060
3540	Ga0316578_10021255
3541	Ga0316578_10026984
3542	Ga0316578_10042136
3543	Ga0316578_10044739
3544	Ga0316578_10064442
3545	Ga0316578_10080516
3546	Ga0316578_10116881
3547	Ga0307516_10017360
3548	Ga0316577_10024944
3549	Ga0316577_10153014
3550	Ga0307410_10076162
3551	Ga0307410_10260042
3552	Ga0307410_10650126
3553	Ga0307406_10062332
3554	Ga0307406_10719033
3555	Ga0307407_10037189
3556	Ga0307412_10124321
3557	Ga0307412_10376584
3558	Ga0307409_100395735
3559	Ga0307416_100042058
3560	Ga0307416_100071956
3561	Ga0307416_100313945
3562	Ga0307416_100624292
3563	Ga0307414_10683111
3564	Ga0307411_10571622
3565	Ga0307415_100048527
3566	Ga0307415_100084574
3567	Ga0307415_100546284
3568	Ga0316583_10001644
3569	Ga0316583_10137729
3570	Ga0316585_10001443
3571	Ga0316580_10025377
3572	Ga0316580_10043081
3573	Ga0316593_10053451
3574	Ga0316593_10074628
3575	Ga0316593_10144960
3576	Ga0307507_10000361
3577	Ga0307507_10066218
3578	Ga0307510_10242177
3579	Ga0316592_1022373
3580	Ga0316592_1058930
3581	Ga0316588_1069172
3582	Ga0316596_1026015
3583	Ga0316596_1033555
3584	Ga0316215_1009279
3585	Ga0316214_1000463
3586	Ga0373930_0059994
3587	Ga0373958_0003737
3588	Ga0373959_0005258
3589	Ga0373938_0014302
3590	Ga0373926_0002125
3591	Ga0373926_0003995
3592	Ga0373926_0049257
3593	Ga0373926_0142801
3594	Ga0373926_0168974
3595	Ga0373926_0275988
3596	Ga0373928_0009099
3597	Ga0373934_0000247
3598	Ga0373934_0008465
3599	Ga0373934_0014037
3600	Ga0373934_0107932
3601	Ga0373934_0126930
3602	Ga0373934_0210885
3603	Ga0373944_0001778
3604	Ga0373944_0016159
3605	Ga0373951_0021903
3606	Ga0373923_0001766
3607	Ga0373923_0014924
3608	Ga0373923_0050967
3609	Ga0373923_0154305
3610	Ga0373932_0010985
3611	Ga0373932_0031757
3612	Ga0373936_0000285
3613	Ga0373936_0000488
3614	Ga0373936_0020327
3615	Ga0373936_0110376
3616	Ga0373936_0151360
3617	Ga0373936_0301246
3618	Ga0373941_0010456
3619	Ga0373945_0004036
3620	Ga0373945_0015574
3621	Ga0373945_0061910
3622	Ga0373945_0204425
3623	Ga0373953_0000261
3624	Ga0373953_0004937
3625	Ga0373953_0014508
3626	Ga0373953_0039969
3627	Ga0373954_0013306
3628	Ga0373954_0014713
3629	Ga0373954_0049605
3630	Ga0373954_0050548
3631	Ga0373954_0088184
3632	Ga0373956_0001137
3633	Ga0373956_0004924
3634	Ga0373956_0019029
3635	Ga0373956_0035881
3636	Ga0373957_0000320
3637	Ga0373957_0003232
3638	Ga0373957_0056658
3639	Ga0373957_0093642
3640	Ga0373960_0011561
3641	Ga0373943_0007992
3642	Ga0373943_0126872
3643	Ga0373943_0129049
3644	Ga0373946_0000249
3645	Ga0373955_0000034
3646	Ga0373955_0031928
3647	Ga0373955_0067536
3648	Ga0373955_0143081
3649	Ga0373955_0328731
3650	Ga0373955_0442837
3651	Ga0373942_0002010
3652	Ga0373961_0134145
3653	Ga0373962_0019150
3654	Ga0316574_0010412
3655	Ga0316574_0023456
3656	Ga0316574_0034399
3657	Ga0316574_0047721
3658	Ga0316574_0059358
3659	Ga0316574_0091559
3660	Ga0316574_0133106
3661	Ga0316574_0168669
3662	Ga0316574_0256070
3663	Ga0373924_0004120
3664	Ga0373924_0007146
3665	Ga0373924_0014051
3666	Ga0373924_0050150
3667	Ga0373924_0051351
3668	Ga0373924_0240986
3669	Ga0373931_0125122
3670	Ga0373931_0347801
3671	Ga0373935_0000284
3672	Ga0373935_0000618
3673	Ga0373935_0070577
3674	Ga0373935_0074581
3675	Ga0373935_0503421
3676	Ga0373927_0000383
3677	Ga0373927_0192040
3678	Ga0373927_0241711
3679	Ga0373933_0000161
3680	Ga0373933_0004639
3681	Ga0373933_0021068
3682	Ga0373933_0093474
3683	Ga0373933_0215713
3684	Ga0373947_0000002
3685	Ga0373947_0000546
3686	Ga0373947_0036310
3687	Ga0373947_0047751
3688	Ga0373947_0135463
3689	Ga0373947_0227513
3690	Ga0373937_0000126
3691	Ga0373937_0004750
3692	Ga0373937_0053822
3693	Ga0373937_0065463
3694	Ga0373937_0072697
3695	Ga0373937_0477262
3696	Ga0373937_1057590
3697	Ga0372808_003120
3698	Ga0316582_0022043
3699	Ga0316582_0037270
3700	Ga0316582_0088329
3701	Ga0316582_0369039
3702	Ga0316584_0000644
3703	Ga0316584_0021402
3704	Ga0316584_0040901
3705	Ga0316584_0044342
3706	Ga0316584_0120761
3707	Ga0316584_0218705
3708	Ga0373925_0000010
3709	Ga0373925_0002907
3710	Ga0373925_0003663
3711	Ga0373925_0010913
3712	Ga0373925_0058168
3713	Ga0373925_0279416
3714	Ga0395899_0000390
3715	Ga0395900_0041537
3716	Ga0395900_0329397
3717	Ga0395900_0942008
3718	Ga0395898_1011921
3719	Ga0395898_1047833
3720	Ga0395898_1452703
3721	Ga0395905_0342500
3722	Ga0316581_0000850
3723	Ga0436364_0182063
3724	Ga0436364_0805657
3725	Ga0436364_0829857
3726	Ga0436364_0862502
3727	Ga0436364_1099017
3728	Ga0436364_1127757
3729	Ga0436364_1324934
3730	Ga0395901_0016556
3731	Ga0395901_0046298
3732	Ga0395901_0157962
3733	Ga0436365_0191332
3734	Ga0436365_0308474
3735	Ga0436365_1275647
3736	Ga0436365_1329697
3737	Ga0436365_1853859
3738	Ga0436365_1854608
3739	Ga0436365_1880606
3740	Ga0436360_0170308
3741	Ga0436360_0454629
3742	Ga0436363_0186259
3743	Ga0436362_0513224
3744	Ga0436362_0958683
3745	Ga0439436_0004500
3746	Ga0439439_0004399
3747	Ga0439453_0108865
3748	Ga0439461_0000660
3749	Ga0439461_0001053
3750	Ga0439466_0006285
3751	Ga0439466_0017969
3752	Ga0439466_0055196
3753	Ga0439466_0076016
3754	Ga0439465_0000611
3755	Ga0439465_0010623
3756	Ga0439465_0017397
3757	Ga0439465_0062475
3758	Ga0439465_0066017
3759	Ga0451791_0827407
3760	Ga0451795_0858677
3761	Ga0451833_1272832
3762	Ga0451841_0956914
3763	Ga0451853_0211892
3764	Ga0451853_0893932
3765	Ga0439431_0000231
3766	Ga0439433_0008791
3767	Ga0439442_003399
3768	Ga0439442_012415
3769	Ga0439445_0118586
3770	Ga0439448_0004263
3771	Ga0439448_0011854
3772	Ga0439448_0067036
3773	Ga0439432_082000
3774	Ga0439449_0032393
3775	Ga0439455_0029376
3776	Ga0439457_001721
3777	Ga0450903_000046
3778	Ga0450905_025750
3779	Ga0450910_028525
3780	Ga0439458_0004062
3781	Ga0439434_0025194
3782	Ga0439459_0011917
3783	Ga0450901_006803
3784	Ga0466969_0009684
3785	Ga0466969_0015686
3786	Ga0466969_0029596
3787	Ga0466969_0047811
3788	Ga0466969_0084379
3789	Ga0466972_0000856
3790	Ga0466972_0011837
3791	Ga0466972_0043538
3792	Ga0466972_0050787
3793	Ga0466972_0070800
3794	Ga0466972_0311632
3795	Ga0466965_0012698
3796	Ga0466965_0017280
3797	Ga0466965_0018506
3798	Ga0466965_0028567
3799	Ga0466965_0124449
3800	Ga0466965_0137373
3801	Ga0466965_0187717
3802	Ga0466965_0189173
3803	Ga0466965_0475566
3804	Ga0466966_0005651
3805	Ga0466966_0007385
3806	Ga0466966_0008597
3807	Ga0466966_0025734
3808	Ga0466966_0059720
3809	Ga0466966_0101348
3810	Ga0466966_0112029
3811	Ga0466966_0112053
3812	Ga0466966_0160177
3813	Ga0466966_0205945
3814	Ga0466966_0228528
3815	Ga0466966_0313480
3816	Ga0466966_0342589
3817	Ga0466961_0009126
3818	Ga0466961_0016597
3819	Ga0466961_0038630
3820	Ga0466961_0050603
3821	Ga0466961_0084211
3822	Ga0466961_0088831
3823	Ga0466961_0093733
3824	Ga0466961_0135261
3825	Ga0466961_0496165
3826	Ga0466963_0016001
3827	Ga0466963_0016907
3828	Ga0466963_0019825
3829	Ga0466963_0048020
3830	Ga0466963_0075063
3831	Ga0466963_0083525
3832	Ga0466963_0086133
3833	Ga0466963_0129519
3834	Ga0466963_0263601
3835	Ga0466963_0333802
3836	Ga0466963_0388684
3837	Ga0466964_0044094
3838	Ga0466964_0133253
3839	Ga0466971_0004385
3840	Ga0466971_0063520
3841	Ga0466968_0000991
3842	Ga0466968_0004353
3843	Ga0466968_0020056
3844	Ga0466968_0030190
3845	Ga0466968_0033075
3846	Ga0466968_0115418
3847	Ga0466968_0360186
3848	Ga0466970_0018644
3849	Ga0466970_0035718
3850	Ga0466970_0074154
3851	Ga0466970_0115994
3852	Ga0466970_0161006
3853	Ga0466970_0188364
3854	Ga0466970_0330549
3855	Ga0466970_0335462
3856	Ga0466970_0508689
3857	Ga0466957_0009450
3858	Ga0466957_0010713
3859	Ga0466957_0013716
3860	Ga0466957_0040071
3861	Ga0466957_0258245
3862	Ga0466957_0285313
3863	Ga0466957_0373602
3864	Ga0466957_0519538
3865	Ga0466957_0666908
3866	Ga0466957_0899526
3867	Ga0466960_0000241
3868	Ga0466960_0003659
3869	Ga0466960_0012369
3870	Ga0466960_0015018
3871	Ga0466960_0047430
3872	Ga0466960_0067839
3873	Ga0466960_0260255
3874	Ga0466960_0352719
3875	Ga0466959_0004152
3876	Ga0466959_0005771
3877	Ga0466959_0007110
3878	Ga0466959_0021880
3879	Ga0466959_0030027
3880	Ga0466959_0052465
3881	Ga0466959_0067857
3882	Ga0466959_0157436
3883	Ga0466959_0309213
3884	Ga0466958_0024910
3885	Ga0466958_0035849
3886	Ga0466958_0067958
3887	Ga0466958_0238455
3888	Ga0466967_0014000
3889	Ga0466967_0014788
3890	Ga0466967_0028593
3891	Ga0466967_0042267
3892	Ga0466967_0047921
3893	Ga0466967_0277625
3894	Ga0466967_0312068
3895	Ga0466967_0325764
3896	Ga0466967_0352585
3897	Ga0466967_0461199
3898	Ga0466967_0826411
3899	Ga0466967_0938051
3900	Ga0466967_0985327
3901	Ga0495617_018716
3902	Ga0495627_028646
3903	Ga0495592_0000030
3904	Ga0495592_0019863
3905	Ga0495592_0033363
3906	Ga0495592_0036940
3907	Ga0495592_0037960
3908	Ga0495592_0044805
3909	Ga0495592_0050170
3910	Ga0495592_0089311
3911	Ga0495592_0144398
3912	Ga0495592_0291562
3913	Ga0495592_0333229
3914	Ga0495603_0006352
3915	Ga0495603_0035005
3916	Ga0495603_0059603
3917	Ga0495590_0046480
3918	Ga0495629_0000784
3919	Ga0495629_0009695
3920	Ga0495629_0029219
3921	Ga0495629_0099380
3922	Ga0495629_0334410
3923	Ga0495629_0408343
3924	Ga0495638_0009750
3925	Ga0495638_0044492
3926	Ga0495641_0012727
3927	Ga0495641_0016866
3928	Ga0495641_0150820
3929	Ga0495641_0156140
3930	Ga0495651_0000128
3931	Ga0495651_0000221
3932	Ga0495651_0003277
3933	Ga0495651_0009950
3934	Ga0495651_0019596
3935	Ga0495651_0030718
3936	Ga0495651_0034863
3937	Ga0495651_0048941
3938	Ga0495651_0098510
3939	Ga0495653_0009860
3940	Ga0495653_0016811
3941	Ga0495653_0030982
3942	Ga0495653_0089944
3943	Ga0495653_0096489
3944	Ga0495653_0277330
3945	Ga0495653_0363941
3946	Ga0495653_0415401
3947	Ga0495650_0110122
3948	Ga0495580_0012117
3949	Ga0495580_0138645
3950	Ga0495580_0525295
3951	Ga0495582_0010063
3952	Ga0495582_0012048
3953	Ga0495582_0020836
3954	Ga0495582_0049325
3955	Ga0495582_0051526
3956	Ga0495582_0074334
3957	Ga0495605_0104447
3958	Ga0495639_0044222
3959	Ga0495639_0047435
3960	Ga0495639_0165599
3961	Ga0495662_0010214
3962	Ga0495662_0024016
3963	Ga0495662_0032420
3964	Ga0495662_0042526
3965	Ga0495662_0045806
3966	Ga0495662_0124218
3967	Ga0495662_0148482
3968	Ga0495662_0463766
3969	Ga0495664_0011230
3970	Ga0495664_0016764
3971	Ga0495664_0029397
3972	Ga0495664_0040138
3973	Ga0495664_0045273
3974	Ga0495664_0059634
3975	Ga0495664_0060799
3976	Ga0495664_0116291
3977	Ga0495664_0149545
3978	Ga0495584_0125757
3979	Ga0495585_0007220
3980	Ga0495594_0022258
3981	Ga0495594_0084940
3982	Ga0495594_0123831
3983	Ga0495594_0167670
3984	Ga0495594_0268090
3985	Ga0495596_0036541
3986	Ga0495607_0065283
3987	Ga0495583_0168280
3988	Ga0495583_0259560
3989	Ga0495606_0041254
3990	Ga0495608_0000191
3991	Ga0495608_0011548
3992	Ga0495608_0013786
3993	Ga0495608_0017188
3994	Ga0495608_0021141
3995	Ga0495608_0118373
3996	Ga0495608_0246621
3997	Ga0495608_0337151
3998	Ga0495610_0025212
3999	Ga0495616_0030172
4000	Ga0495618_0004749
4001	Ga0495618_0010566
4002	Ga0495618_0014004
4003	Ga0495618_0036740
4004	Ga0495618_0072653
4005	Ga0495618_0095575
4006	Ga0495618_0096574
4007	Ga0495618_0097715
4008	Ga0495618_0176716
4009	Ga0495620_0152141
4010	Ga0495620_0172111
4011	Ga0495628_0002526
4012	Ga0495628_0019731
4013	Ga0495628_0053813
4014	Ga0495628_0064063
4015	Ga0495628_0148922
4016	Ga0495628_0161669
4017	Ga0495628_0364420
4018	Ga0495628_0398009
4019	Ga0495630_0023828
4020	Ga0495630_0026337
4021	Ga0495630_0044258
4022	Ga0495630_0050798
4023	Ga0495630_0088688
4024	Ga0495630_0436552
4025	Ga0495631_0052433
4026	Ga0495637_0039914
4027	Ga0495643_0005160
4028	Ga0495643_0142932
4029	Ga0495648_0083800
4030	Ga0495666_0003258
4031	Ga0495666_0054026
4032	Ga0495666_0331446
4033	Ga0495652_0000358
4034	Ga0495652_0000921
4035	Ga0495652_0003076
4036	Ga0495652_0003476
4037	Ga0495652_0028050
4038	Ga0495652_0031235
4039	Ga0495652_0039137
4040	Ga0495652_0051971
4041	Ga0495652_0066063
4042	Ga0495652_0073097
4043	Ga0495654_0052156
4044	Ga0495665_0004161
4045	Ga0495665_0005151
4046	Ga0495665_0022189
4047	Ga0495665_0052098
4048	Ga0495665_0101459
4049	Ga0495665_0168655
4050	Ga0495640_0010859
4051	Ga0495640_0018656
4052	Ga0495640_0037748
4053	Ga0495640_0037971
4054	Ga0495640_0043119
4055	Ga0495640_0045585
4056	Ga0495640_0072908
4057	Ga0495640_0092740
4058	Ga0495640_0156877
4059	Ga0495640_0202777
4060	Ga0495586_0011058
4061	Ga0495586_0015581
4062	Ga0495586_0017115
4063	Ga0495586_0021977
4064	Ga0495586_0027372
4065	Ga0495586_0069861
4066	Ga0495587_0000210
4067	Ga0495587_0002593
4068	Ga0495587_0003878
4069	Ga0495587_0009022
4070	Ga0495587_0016175
4071	Ga0495587_0024647
4072	Ga0495587_0201134
4073	Ga0495597_0029329
4074	Ga0495645_0011307
4075	Ga0495645_0012811
4076	Ga0495645_0019428
4077	Ga0495645_0057218
4078	Ga0495645_0093872
4079	Ga0495645_0102836
4080	Ga0495645_0119221
4081	Ga0495645_0140389
4082	Ga0495645_0155220
4083	Ga0495645_0160944
4084	Ga0495622_0032353
4085	Ga0495633_0028713
4086	Ga0495667_0000040
4087	Ga0495667_0001694
4088	Ga0495667_0002506
4089	Ga0495667_0010993
4090	Ga0495667_0017093
4091	Ga0495667_0119716
4092	Ga0495667_0123451
4093	Ga0495667_0125896
4094	Ga0495667_0152104
4095	Ga0495668_0110549
4096	Ga0495668_0117904
4097	Ga0495634_0004847
4098	Ga0495634_0013383
4099	Ga0495634_0025545
4100	Ga0495634_0027931
4101	Ga0495634_0069786
4102	Ga0495634_0100686
4103	Ga0495634_0127335
4104	Ga0495634_0141588
4105	Ga0495634_0233621
4106	Ga0495611_0188488
4107	Ga0495625_0138882
4108	Ga0495625_0165932
4109	Ga0495625_0171241
4110	Ga0495625_0279133
4111	Ga0495635_0000464
4112	Ga0495635_0002756
4113	Ga0495635_0004937
4114	Ga0495635_0008628
4115	Ga0495635_0019614
4116	Ga0495635_0032901
4117	Ga0495635_0056882
4118	Ga0495635_0097805
4119	Ga0495635_0141406
4120	Ga0495588_0014001
4121	Ga0495588_0108484
4122	Ga0495588_0125578
4123	Ga0495588_0159731
4124	Ga0495657_0000029
4125	Ga0495657_0001735
4126	Ga0495657_0002935
4127	Ga0495657_0008006
4128	Ga0495657_0008709
4129	Ga0495657_0043952
4130	Ga0495657_0089694
4131	Ga0495657_0211618
4132	Ga0495657_0236978
4133	Ga0495657_0357390
4134	Ga0495599_0000680
4135	Ga0495599_0001491
4136	Ga0495599_0033171
4137	Ga0495599_0079499
4138	Ga0495599_0080696
4139	Ga0495599_0109345
4140	Ga0495599_0119153
4141	Ga0495599_0153991
4142	Ga0495599_0156067
4143	Ga0495623_0001327
4144	Ga0495623_0010603
4145	Ga0495623_0012772
4146	Ga0495623_0033497
4147	Ga0495623_0041735
4148	Ga0495623_0079803
4149	Ga0495623_0148134
4150	Ga0495623_0235356
4151	Ga0495646_0001643
4152	Ga0495646_0004464
4153	Ga0495646_0005844
4154	Ga0495646_0017967
4155	Ga0495646_0021142
4156	Ga0495646_0031187
4157	Ga0495646_0052910
4158	Ga0495646_0090302
4159	Ga0495646_0181435
4160	Ga0495647_0075794
4161	Ga0495647_0172396
4162	Ga0495658_0006157
4163	Ga0495658_0007199
4164	Ga0495658_0118618
4165	Ga0495658_0164035
4166	Ga0495669_0141763
4167	Ga0495669_0305138
4168	Ga0495613_0014244
4169	Ga0495613_0019221
4170	Ga0495613_0033718
4171	Ga0495613_0053918
4172	Ga0495613_0237702
4173	Ga0495613_0244105
4174	Ga0495613_0260001
4175	Ga0495613_0271224
4176	Ga0495613_0274402
4177	Ga0495613_0282576
4178	Ga0495624_0002811
4179	Ga0495624_0031968
4180	Ga0495624_0077592
4181	Ga0495624_0163850
4182	Ga0495624_0194739
4183	Ga0495624_0567140
4184	Ga0495670_0024416
4185	Ga0495670_0062969
4186	Ga0495671_0070870
4187	Ga0495649_0104394
4188	Ga0495649_0123737
4189	Ga0495600_0001874
4190	Ga0495600_0002980
4191	Ga0495600_0010512
4192	Ga0495600_0020700
4193	Ga0495600_0026537
4194	Ga0495600_0037627
4195	Ga0495600_0045021
4196	Ga0495600_0066334
4197	Ga0495600_0083310
4198	Ga0495600_0150075
4199	Ga0495660_0085225
4200	Ga0495660_0139744
4201	Ga0495581_0025321
4202	Ga0495581_0048759
4203	Ga0495581_0049794
4204	Ga0495581_0088443
4205	Ga0495581_0209406
4206	Ga0495581_0311472
4207	Ga0495581_0407124
4208	Ga0495604_0000034
4209	Ga0495604_0002080
4210	Ga0495604_0002330
4211	Ga0495604_0003371
4212	Ga0495604_0005465
4213	Ga0495604_0033920
4214	Ga0495604_0061548
4215	Ga0495604_0067294
4216	Ga0495604_0074500
4217	Ga0495604_0121758
4218	Ga0495636_0079509
4219	Ga0495674_0002068
4220	Ga0495674_0008781
4221	Ga0495674_0013321
4222	Ga0495674_0030890
4223	Ga0495674_0034874
4224	Ga0495674_0046441
4225	Ga0495674_0119774
4226	Ga0495674_0131933
4227	Ga0495674_0145983
4228	Ga0495674_0163005
4229	Ga0495674_0165712
4230	Ga0495674_0592027
4231	Ga0495674_0603367
4232	Ga0495672_0081248
4233	Ga0495672_0295751
4234	Ga0495676_0004289
4235	Ga0495676_0004409
4236	Ga0495676_0029226
4237	Ga0495676_0084656
4238	Ga0495676_0199728
4239	Ga0495676_0248986
4240	Ga0495676_0289283
4241	Ga0495676_0461846
4242	Ga0495680_0000522
4243	Ga0495680_0005749
4244	Ga0495680_0014514
4245	Ga0495680_0019297
4246	Ga0495680_0054020
4247	Ga0495680_0120830
4248	Ga0495680_0129780
4249	Ga0495680_0453218
4250	Ga0495680_0762714
4251	Ga0495683_0038000
4252	Ga0495687_009612
4253	Ga0495687_025609
4254	Ga0495687_045737
4255	Ga0495687_058847
4256	Ga0495675_0009553
4257	Ga0495675_0012775
4258	Ga0495675_0018436
4259	Ga0495675_0051898
4260	Ga0495675_0072106
4261	Ga0495675_0073235
4262	Ga0495675_0077663
4263	Ga0495675_0190149
4264	Ga0495677_0035866
4265	Ga0495685_000258
4266	Ga0495681_0001206
4267	Ga0495684_0007798
4268	Ga0495684_0011230
4269	Ga0495684_0014686
4270	Ga0495684_0015058
4271	Ga0495684_0035254
4272	Ga0495684_0115306
4273	Ga0495684_0170623
4274	Ga0495684_0273442
4275	Ga0495686_0001212
4276	Ga0495686_0098686
4277	Ga0495686_0211328
4278	Ga0495593_0002951
4279	Ga0495593_0033838
4280	Ga0495593_0149771
4281	Ga0495593_0251148
4282	Ga0495602_0002950
4283	Ga0495602_0045356
4284	Ga0495602_0070910
4285	Ga0495602_0080694
4286	Ga0495602_0112757
4287	Ga0495602_0132925
4288	Ga0495602_0138891
4289	Ga0495614_0013942
4290	Ga0495614_0065358
4291	Ga0495614_0093641
4292	Ga0495614_0096318
4293	Ga0495626_0025863
4294	Ga0495626_0044137
4295	Ga0495626_0115872
4296	Ga0496100_0000079
4297	Ga0496100_0000113
4298	Ga0496100_0005184
4299	Ga0496100_0008547
4300	Ga0496100_0022949
4301	Ga0496100_0052080
4302	Ga0496100_0311985
4303	Ga0496101_0000011
4304	Ga0496101_0000173
4305	Ga0496101_0004302
4306	Ga0496101_0014665
4307	Ga0496101_0028189
4308	Ga0496101_0113746
4309	Ga0496101_0126865
4310	Ga0496101_0187895
4311	Ga0496101_0624060
4312	Ga0496101_0885713
4313	Ga0496102_0000012
4314	Ga0496102_0001872
4315	Ga0496102_0013028
4316	Ga0496102_0016862
4317	Ga0496102_0040837
4318	Ga0496102_0047324
4319	Ga0496102_0052675
4320	Ga0496102_0122107
4321	Ga0496102_0135691
4322	Ga0496102_0170191
4323	Ga0496102_0241085
4324	Ga0496103_0000005
4325	Ga0496103_0000238
4326	Ga0496103_0000277
4327	Ga0496103_0000543
4328	Ga0496103_0027124
4329	Ga0496103_0260079
4330	Ga0496103_0314669
4331	Ga0496103_0321927
4332	Ga0496103_0464341
4333	Ga0496104_0000813
4334	Ga0496104_0002275
4335	Ga0496104_0043157
4336	Ga0496104_0098835
4337	Ga0496104_0158612
4338	Ga0496104_0195218
4339	Ga0496104_0242758
4340	Ga0496104_0381033
4341	Ga0496104_0381529
4342	Ga0496104_0449963
4343	Ga0496104_0814287
4344	Ga0496104_0976302
4345	Ga0496105_0008498
4346	Ga0496105_0043335
4347	Ga0496105_0075329
4348	Ga0496105_0166293
4349	Ga0496105_0336817
4350	Ga0496105_0387520
4351	Ga0496105_0429694
4352	Ga0496105_0588142
4353	Ga0496106_0000372
4354	Ga0496106_0011370
4355	Ga0496106_0012167
4356	Ga0496106_0030493
4357	Ga0496106_0034858
4358	Ga0496106_0090950
4359	Ga0496106_0186212
4360	Ga0496106_0212290
4361	Ga0496106_0619936
4362	Ga0496106_0640256
4363	Ga0496107_0001450
4364	Ga0496107_0002787
4365	Ga0496107_0030750
4366	Ga0496107_0047803
4367	Ga0496107_0051856
4368	Ga0496107_0716999
4369	Ga0496107_0747239
4370	Ga0496108_0003404
4371	Ga0496108_0012710
4372	Ga0496108_0075141
4373	Ga0496108_0082240
4374	Ga0496108_0089352
4375	Ga0496108_0096097
4376	Ga0496108_0177461
4377	Ga0496108_0347941
4378	Ga0496108_0769973
4379	Ga0496109_0000108
4380	Ga0496109_0018062
4381	Ga0496109_0027943
4382	Ga0496109_0041175
4383	Ga0496109_0047106
4384	Ga0496109_0062588
4385	Ga0496109_0155763
4386	Ga0496109_0434971
4387	Ga0496109_0626581
4388	Ga0496110_0002526
4389	Ga0496110_0042770
4390	Ga0496110_0096863
4391	Ga0496110_0143187
4392	Ga0496110_0301245
4393	Ga0496110_0303012
4394	Ga0496110_0399242
4395	Ga0496110_0555853
4396	Ga0496110_0687035
4397	Ga0496110_0905792
4398	Ga0496111_0034675
4399	Ga0496111_0081153
4400	Ga0496111_0414810
4401	Ga0496112_0004025
4402	Ga0496112_0058201
4403	Ga0496112_0063265
4404	Ga0496112_0070252
4405	Ga0496112_0075493
4406	Ga0496112_0075802
4407	Ga0496112_0103417
4408	Ga0496112_0924834
4409	Ga0496113_0007035
4410	Ga0496113_0011555
4411	Ga0496113_0054138
4412	Ga0496113_0069212
4413	Ga0496113_0118114
4414	Ga0496113_0306635
4415	Ga0496113_0368924
4416	Ga0496113_0423001
4417	Ga0496113_0562946
4418	Ga0496114_0000458
4419	Ga0496114_0000951
4420	Ga0496114_0066342
4421	Ga0496114_0095360
4422	Ga0496114_0210265
4423	Ga0496114_0986169
4424	Ga0496115_0005896
4425	Ga0496115_0016385
4426	Ga0496115_0082692
4427	Ga0496115_0113932
4428	Ga0496115_0122386
4429	Ga0496115_0188628
4430	Ga0496115_0496558
4431	Ga0496116_0000050
4432	Ga0496116_0008681
4433	Ga0496116_0049212
4434	Ga0496117_0000042
4435	Ga0496117_0000904
4436	Ga0496117_0032769
4437	Ga0496117_0078015
4438	Ga0496117_0126874
4439	Ga0496117_0276592
4440	Ga0496118_0000037
4441	Ga0496118_0000694
4442	Ga0496118_0001360
4443	Ga0496118_0009084
4444	Ga0496118_0023181
4445	Ga0496118_0085898
4446	Ga0496118_0140623
4447	Ga0496119_0000375
4448	Ga0496119_0001856
4449	Ga0496119_0004263
4450	Ga0496119_0029164
4451	Ga0496119_0046877
4452	Ga0496119_0124041
4453	Ga0496119_0153172
4454	Ga0496120_0000453
4455	Ga0496120_0022748
4456	Ga0496120_0046953
4457	Ga0496120_0047626
4458	Ga0496120_0216990
4459	Ga0496120_0230997
4460	Ga0496120_0265219
4461	Ga0496121_0000014
4462	Ga0496121_0001091
4463	Ga0496121_0002871
4464	Ga0496121_0475628
4465	Ga0496122_0000132
4466	Ga0496122_0000899
4467	Ga0496122_0004913
4468	Ga0496123_0009435
4469	Ga0496123_0023400
4470	Ga0496124_0000106
4471	Ga0496124_0025494
4472	Ga0496124_0308141
4473	Ga0496124_0522861
4474	Ga0496125_0000014
4475	Ga0496125_0000025
4476	Ga0496125_0069855
4477	Ga0496125_0202529
4478	Ga0496125_0384699
4479	Ga0496126_0000017
4480	Ga0496126_0000236
4481	Ga0496126_0008111
4482	Ga0496126_0009442
4483	Ga0496126_0158798
4484	Ga0496126_0290346
4485	Ga0501306_035393
4486	Ga0501309_011539
4487	Ga0501310_039904
4488	Ga0501341_09668
4489	Ga0501304_013287
4490	Ga0495678_028156
4491	Ga0495682_0174892
4492	Ga0501311_058941
4493	Ga0501312_020101
4494	Ga0501313_029079
4495	Ga0501313_033675
4496	Ga0501314_005414
4497	Ga0501316_026789
4498	Ga0501317_034960
4499	Ga0501317_054630
4500	Ga0501318_005240
4501	Ga0501319_006950
4502	Ga0501322_002054
4503	Ga0501323_007984
4504	Ga0501325_013418
4505	Ga0501325_016426
4506	Ga0501330_006852
4507	Ga0501031_0001063
4508	Ga0501031_0144997
4509	Ga0501031_0249599
4510	Ga0501031_0253136
4511	Ga0501031_0279482
4512	Ga0501032_0006508
4513	Ga0501032_0010542
4514	Ga0501032_0011853
4515	Ga0501032_0036378
4516	Ga0501032_0037570
4517	Ga0501032_0113025
4518	Ga0501032_0205930
4519	Ga0501033_0004692
4520	Ga0501033_0011012
4521	Ga0501033_0026249
4522	Ga0501033_0038775
4523	Ga0501033_0045310
4524	Ga0501033_0073598
4525	Ga0501033_0096889
4526	Ga0501033_0158604
4527	Ga0501034_0002753
4528	Ga0501034_0003876
4529	Ga0501034_0004049
4530	Ga0501034_0032813
4531	Ga0501034_0034121
4532	Ga0501034_0061146
4533	Ga0501034_0137341
4534	Ga0501034_0232847
4535	Ga0501034_0724797
4536	Ga0501036_0002186
4537	Ga0501036_0002657
4538	Ga0501036_0013223
4539	Ga0501036_0013951
4540	Ga0501036_0033322
4541	Ga0501036_0060745
4542	Ga0501036_0062835
4543	Ga0501037_0002849
4544	Ga0501037_0002998
4545	Ga0501037_0044526
4546	Ga0501037_0051960
4547	Ga0501038_0003343
4548	Ga0501038_0008847
4549	Ga0501038_0015266
4550	Ga0501038_0020828
4551	Ga0501038_0023267
4552	Ga0501038_0140473
4553	Ga0501038_0175610
4554	Ga0501039_0000887
4555	Ga0501039_0002709
4556	Ga0501039_0064490
4557	Ga0501039_0075647
4558	Ga0501039_0084519
4559	Ga0501040_0016468
4560	Ga0501041_0014510
4561	Ga0501042_0002745
4562	Ga0501042_0021040
4563	Ga0501042_0120948
4564	Ga0501042_0536566
4565	Ga0501042_0551093
4566	Ga0501043_0002135
4567	Ga0501043_0002160
4568	Ga0501043_0006675
4569	Ga0501043_0014191
4570	Ga0501043_0029997
4571	Ga0501043_0066196
4572	Ga0501043_0089762
4573	Ga0501043_0113250
4574	Ga0501043_0531696
4575	Ga0501046_0000737
4576	Ga0501046_0001024
4577	Ga0501046_0004493
4578	Ga0501046_0008676
4579	Ga0501046_0261077
4580	Ga0501046_0540550
4581	Ga0501047_0000089
4582	Ga0501047_0000248
4583	Ga0501047_0008538
4584	Ga0501047_0012454
4585	Ga0501047_0018108
4586	Ga0501047_0031371
4587	Ga0501047_0050702
4588	Ga0501047_0088989
4589	Ga0501047_0262735
4590	Ga0501047_0265753
4591	Ga0501047_0296912
4592	Ga0501047_0423784
4593	Ga0501047_0727987
4594	Ga0501048_0003271
4595	Ga0501048_0150239
4596	Ga0501048_0417908
4597	Ga0501067_0003554
4598	Ga0501067_0063189
4599	Ga0501068_0000719
4600	Ga0501068_0587207
4601	Ga0501069_0032331
4602	Ga0501069_0150053
4603	Ga0501070_0004347
4604	Ga0501070_0009277
4605	Ga0501070_0012050
4606	Ga0501070_0023421
4607	Ga0501070_0043686
4608	Ga0501070_0072127
4609	Ga0501070_0103104
4610	Ga0501070_0165532
4611	Ga0501070_0180237
4612	Ga0501070_0211163
4613	Ga0501070_0466125
4614	Ga0501071_0000025
4615	Ga0501071_0334282
4616	Ga0501072_0000410
4617	Ga0501072_0623010
4618	Ga0501073_0083687
4619	Ga0501073_0117475
4620	Ga0501073_0167170
4621	Ga0501073_0254082
4622	Ga0501074_0014815
4623	Ga0501074_0253721
4624	Ga0501074_0329114
4625	Ga0501075_0146280
4626	Ga0501076_0006349
4627	Ga0501076_0221765
4628	Ga0501077_0001957
4629	Ga0501206_054625
4630	Ga0501079_0032626
4631	Ga0501080_0002814
4632	Ga0501080_0041695
4633	Ga0501080_0132042
4634	Ga0501083_0000422
4635	Ga0501083_0101006
4636	Ga0501035_0000162
4637	Ga0501035_0000416
4638	Ga0501035_0003983
4639	Ga0501035_0006603
4640	Ga0501035_0038021
4641	Ga0501035_0043263
4642	Ga0501035_0058146
4643	Ga0501035_0096680
4644	Ga0501035_0282501
4645	Ga0501044_0000166
4646	Ga0501044_0001535
4647	Ga0501044_0022142
4648	Ga0501044_0040369
4649	Ga0501044_0062999
4650	Ga0501044_0265256
4651	Ga0501044_0312618
4652	Ga0501044_0356772
4653	Ga0501044_0364058
4654	Ga0501044_0402835
4655	Ga0501044_0422780
4656	Ga0501044_0696863
4657	Ga0501044_0709159
4658	Ga0501045_0001009
4659	Ga0501045_0327625
4660	Ga0501045_0406271
4661	nmdc:mga03683_12106_c1
4662	nmdc:mga03683_132693_c1
4663	nmdc:mga03683_14300_c1
4664	nmdc:mga03683_148260_c1
4665	nmdc:mga03683_54316_c1
4666	nmdc:mga03n38_10843_c1
4667	nmdc:mga03n38_14633_c1
4668	nmdc:mga03n38_15808_c1
4669	nmdc:mga03n38_18408_c1
4670	nmdc:mga03n38_25334_c1
4671	nmdc:mga03n38_38681_c1
4672	nmdc:mga03n38_4001_c1
4673	nmdc:mga03n38_45395_c1
4674	nmdc:mga03n38_508524_c1
4675	nmdc:mga03n38_71288_c1
4676	nmdc:mga03n38_8312_c1
4677	nmdc:mga00v17_10423_c1
4678	nmdc:mga00v17_106325_c1
4679	nmdc:mga00v17_155612_c1
4680	nmdc:mga00v17_20172_c1
4681	nmdc:mga00v17_246987_c1
4682	nmdc:mga00v17_247786_c1
4683	nmdc:mga00v17_252622_c1
4684	nmdc:mga00v17_25951_c1
4685	nmdc:mga00v17_3695_c1
4686	nmdc:mga00v17_54442_c1
4687	nmdc:mga00v17_85154_c1
4688	nmdc:mga00v17_8595_c1
4689	nmdc:mga00v17_91425_c1
4690	nmdc:mga00v17_98692_c1
4691	nmdc:mga0yw44_100068_c1
4692	nmdc:mga0yw44_120184_c1
4693	nmdc:mga0yw44_150191_c1
4694	nmdc:mga0yw44_192833_c1
4695	nmdc:mga0yw44_23005_c1
4696	nmdc:mga0yw44_316895_c1
4697	nmdc:mga0yw44_334558_c1
4698	nmdc:mga0yw44_35816_c1
4699	nmdc:mga0yw44_45566_c1
4700	nmdc:mga0yw44_471609_c1
4701	nmdc:mga0yw44_57345_c1
4702	nmdc:mga0yw44_75832_c1
4703	nmdc:mga0yw44_764784_c1
4704	nmdc:mga0yw44_76986_c1
4705	nmdc:mga0yw44_7865_c2
4706	nmdc:mga0yw44_988_c1
4707	nmdc:mga0k408_134375_c1
4708	nmdc:mga06z11_13879_c1
4709	nmdc:mga06z11_179324_c1
4710	nmdc:mga06z11_511623_c1
4711	nmdc:mga06z11_546027_c1
4712	nmdc:mga06z11_66207_c1
4713	nmdc:mga06z11_92490_c1
4714	nmdc:mga04h51_1471_c1
4715	nmdc:mga04h51_168393_c1
4716	nmdc:mga07m45_10260_c1
4717	nmdc:mga07m45_13609_c1
4718	nmdc:mga07m45_268899_c1
4719	nmdc:mga07m45_42421_c1
4720	nmdc:mga07m45_51553_c1
4721	nmdc:mga07m45_655780_c1
4722	nmdc:mga07m45_9656_c1
4723	nmdc:mga05p37_274115_c1
4724	nmdc:mga05p37_354076_c1
4725	nmdc:mga09592_107755_c1
4726	nmdc:mga0qj67_562_c1
4727	nmdc:mga0qj67_7738_c1
4728	nmdc:mga06r32_129078_c1
4729	nmdc:mga06r32_29022_c1
4730	nmdc:mga06r32_486804_c1
4731	nmdc:mga08y16_1344972_c1
4732	nmdc:mga08y16_41067_c1
4733	nmdc:mga08y16_454991_c1
4734	nmdc:mga0n895_19740_c1
4735	nmdc:mga0n895_349367_c1
4736	nmdc:mga0n895_66350_c1
4737	nmdc:mga0n895_8441_c1
4738	nmdc:mga0rr50_10065_c1
4739	nmdc:mga0rr50_129077_c1
4740	nmdc:mga0rr50_285022_c1
4741	nmdc:mga0rr50_4610_c1
4742	nmdc:mga0a205_35828_c1
4743	nmdc:mga0a205_53436_c1
4744	nmdc:mga0a205_57479_c1
4745	nmdc:mga0sz30_11610_c1
4746	nmdc:mga0sz30_12513_c1
4747	nmdc:mga0sz30_128261_c1
4748	nmdc:mga0sz30_133173_c1
4749	nmdc:mga0sz30_187545_c1
4750	nmdc:mga0sz30_203614_c1
4751	nmdc:mga0sz30_269061_c1
4752	nmdc:mga0sz30_307855_c1
4753	nmdc:mga0sz30_32515_c1
4754	nmdc:mga0sz30_993_c2
4755	Ga0495601_0027282
4756	Ga0495601_0039166
4757	Ga0495601_0053023
4758	Ga0495601_0072902
4759	Ga0495601_0145440
4760	Ga0495601_0180302
4761	Ga0495601_0193721
4762	Ga0495601_0560999
4763	Ga0495612_0011008
4764	Ga0495612_0038760
4765	Ga0495612_0067755
4766	Ga0495612_0092507
4767	Ga0500610_0032441
4768	Ga0495655_0025457
4769	Ga0495595_0009489
4770	Ga0495595_0015556
4771	Ga0495595_0050992
4772	Ga0495619_0009377
4773	Ga0495619_0011792
4774	Ga0495619_0036492
4775	Ga0495619_0246431
4776	Ga0500578_0015819
4777	Ga0500644_0012288
4778	Ga0500646_0032759
4779	Ga0500583_0147570
4780	Ga0500583_0323995
4781	Ga0500651_0224695
4782	Ga0500566_0062625
4783	Ga0500640_001709
4784	Ga0500650_0117839
4785	Ga0500654_029379
4786	Ga0500660_062614
4787	Ga0500553_078599
4788	Ga0500553_086794
4789	Ga0500556_0001967
4790	Ga0500556_0009543
4791	Ga0500560_030100
4792	Ga0500569_024007
4793	Ga0500572_019854
4794	Ga0500593_000733
4795	Ga0500595_066830
4796	Ga0500608_086267
4797	Ga0500628_001962
4798	Ga0500652_000914
4799	Ga0500652_022031
4800	Ga0500561_0001570
4801	Ga0500568_0000054
4802	Ga0500568_0037859
4803	Ga0500573_0003282
4804	Ga0500573_0142081
4805	Ga0500573_0197020
4806	Ga0500574_085407
4807	Ga0500579_077488
4808	Ga0500600_0016706
4809	Ga0500604_0005995
4810	Ga0500604_0060796
4811	Ga0500616_0006235
4812	Ga0500616_0007010
4813	Ga0500616_0081420
4814	Ga0500616_0249670
4815	Ga0500620_000606
4816	Ga0500620_079091
4817	Ga0500627_0022186
4818	Ga0500627_0230339
4819	Ga0500627_0302565
4820	Ga0500633_0003334
4821	Ga0500633_0118289
4822	Ga0500634_0027131
4823	Ga0500634_0180384
4824	Ga0500645_000350
4825	Ga0500645_008940
4826	Ga0500656_000691
4827	Ga0500565_002669
4828	Ga0500587_000159
4829	Ga0501084_0011064
4830	Ga0501084_0070360
4831	Ga0587084_017773
4832	Ga0587084_067902
4833	Ga0587073_0042187
4834	Ga0587090_063075
4835	Ga0587091_100773
4836	Ga0587105_003981
4837	Ga0587096_01793
4838	Ga0587111_0146663
4839	Ga0501082_0007246
4840	Ga0466962_0000702
4841	Ga0466962_0005074
4842	Ga0466962_0009107
4843	Ga0466962_0012434
4844	Ga0466962_0023780
4845	Ga0530510_0211608
4846	2503203107
4847	2509114892
4848	2509143888
4849	2509372686
4850	2509397569
4851	2510319757
4852	2512930084
4853	2512964768
4854	2514033133
4855	2514420744
4856	2547406515
4857	2548696796
4858	2585300376
4859	2585303512
4860	2588515700
4861	2597813030
4862	2616695605
4863	2616900841
4864	2643760230
4865	2643904472
4866	2643986602
4867	2644093919
4868	2644157537
4869	2644323763
4870	2644389081
4871	2644406260
4872	2644456905
4873	2644460074
4874	2645719835
4875	2645726713
4876	2671695268
4877	2688599967
4878	2723576766
4879	2738668683
4880	2739147875
4881	2756673485
4882	2785345754
4883	2785367135
4884	2786668183
4885	2792748953
4886	2793976638
4887	2811846951
4888	2812360334
4889	2812482434
4890	2819696351
4891	2841738887
4892	2844005946
4893	2844015233
4894	2856324569
4895	2856333219
4896	2856338672
4897	2856343269
4898	2856356725
4899	2857374843
4900	2857712976
4901	2862186266
4902	2862289677
4903	2862292449
4904	2862386974
4905	2862510402
4906	2862583736
4907	2863406989
4908	2867430062
4909	2867475683
4910	2869164213
4911	2869176781
4912	2869240066
4913	2869246275
4914	2869251448
4915	2869260913
4916	2869269817
4917	2869275162
4918	2869281433
4919	2871438849
4920	2871459003
4921	2871465439
4922	2871469837
4923	2871476881
4924	2871485672
4925	2871489275
4926	2874112624
4927	2874118877
4928	2874131171
4929	2874131853
4930	2874140901
4931	2874164591
4932	2874170455
4933	2875392676
4934	2876366352
4935	2876388984
4936	2876404000
4937	2876408770
4938	2876427030
4939	2877683411
4940	2878735257
4941	2878742679
4942	2878753811
4943	2878779615
4944	2878782176
4945	2878790220
4946	2881849528
4947	2881862075
4948	2882632961
4949	2882913572
4950	2885319816
4951	2888341145
4952	2888345618
4953	2902815114
4954	2903452612
4955	2903497155
4956	2903520758
4957	2903524220
4958	2903533597
4959	2906368196
4960	2906373870
4961	2906381302
4962	2906390160
4963	2906395126
4964	2906403870
4965	2906413476
4966	2906427607
4967	2912722418
4968	2912758874
4969	2918502503
4970	2919717590
4971	2922154695
4972	2922172980
4973	2922181442
4974	2924714710
4975	2924721259
4976	2924735215
4977	2924743145
4978	2924753616
4979	2924761177
4980	2924765761
4981	2924780479
4982	2924791942
4983	2937823194
4984	2937842951
4985	2937855285
4986	2937865545
4987	2937870208
4988	2937883006
4989	2937973758
4990	2937986917
4991	2946052038
4992	2946065554
4993	2954674466
4994	2954689666
4995	2954718389
4996	2954728359
4997	2954733450
4998	2954747255
4999	2954752333
5000	2954766370
5001	2958037395
5002	2958047107
5003	2958069640
5004	2958072232
5005	2958090132
5006	2958093454
5007	2958110030
5008	2958122878
5009	2958139564
5010	2958150612
5011	2958159638
5012	2961139435
5013	2961171583
5014	2961186214
5015	2963649148
5016	2965030491
5017	2965035460
5018	2965045941
5019	2965052473
5020	2965094303
5021	2965110289
5022	2965112615
5023	2966604434
5024	2967996340
5025	2968004573
5026	2968019765
5027	2968084393
5028	2968139784
5029	2970473086
5030	2970495233
5031	2970504040
5032	2970515695
5033	2970528323
5034	2970535430
5035	2970540082
5036	2970553528
5037	2970596037
5038	2970623868
5039	2970630804
5040	2977823029
5041	2977834361
5042	2977854114
5043	2977874143
5044	2977904717
5045	2977910245
5046	2977917962
5047	2977926966
5048	2977939390
5049	2977951571
5050	2977963760
5051	2977987300
5052	2979778037
5053	2979797689
5054	2979808675
5055	2987648873
5056	2987673085
5057	2990059593
5058	2995469374
5059	2996351790
5060	2996390607
5061	2997605691
5062	3000139061
5063	3004170718
5064	3004200410
5065	3004214823
5066	3004222586
5067	3004234411
5068	3004244511
5069	3004251811
5070	3004270838
5071	3004278489
5072	3004289618
5073	3004339620
5074	3006328029
5075	3006399557
5076	3006430689
5077	3006490459
5078	3006495136
5079	637079866
5080	649874445
5081	8004307360
5082	8004365105
5083	8004375385
5084	8004402750
5085	8004634351
5086	8004702484
5087	8004728580
5088	8008561296
5089	8023625010
5090	8025484320
5091	8025534174
5092	8033685008
5093	8047894830
5094	8048130386
5095	8048364219
5096	8048371849
5097	8048380782
5098	8054163830
5099	8055620495
5100	8056066455
5101	8056449965
5102	8056835719

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09285

Elong-fact-P_C

Elongation factor P, C-terminal

134

189

0.99 PF08207

EFP_N

Elongation factor P (EF-P) KOW-like domain

22

79

0.98 PF01132

EFP

Elongation factor P (EF-P) OB domain

89

126

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4v6a-assembly2.cif.gz_CV	structure of ef-p bound to the 70s ribosome.	0.9485	1	185
4v6a-assembly2.cif.gz_CV	structure of ef-p bound to the 70s ribosome.	0.9433	1	185
3a5z-assembly2.cif.gz_F	crystal structure of escherichia coli genx in complex with elongation factor p	0.9415	1	59
3a5z-assembly2.cif.gz_F	crystal structure of escherichia coli genx in complex with elongation factor p	0.9268	1	59
5j3b-assembly1.cif.gz_A	structure of translation elongation factor p from acinetobacter baumannii	0.915	2	185

ID	Description	Score	Start	End	Superfamily
af_P9WNM3_64_126_2.40.50.140	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.978	64	126	2.40.50.140
af_Q2QYK4_39_108_2.30.30.30	Mainly Beta;Roll;SH3 type barrels.;	0.9764	2	63	2.30.30.30
af_I1JVU1_64_124_2.30.30.30	Mainly Beta;Roll;SH3 type barrels.;	0.9709	2	61	2.30.30.30
5j3bA03	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.9685	129	185	2.40.50.140
5j3bB01	Mainly Beta;Roll;SH3 type barrels.;	0.9678	1	63	2.30.30.30

ID	Description	Score	Start	End	GO Terms
AF-A0A6H9YGU9-F1-model_v4	Elongation factor P (EF-P)	0.9807	1	185	GO:0003746 GO:0005737 GO:0043043
AF-A0A6H9YGU9-F1-model_v4	Elongation factor P (EF-P)	0.9755	1	185	GO:0003746 GO:0005737 GO:0043043
AF-A0A8B3FV59-F1-model_v4	Elongation factor P (EF-P)	0.9743	2	187	GO:0003746 GO:0005737 GO:0043043
AF-A0A7V9F6L7-F1-model_v4	Elongation factor P	0.9719	1	137	GO:0003746 GO:0005737
AF-A0A7K1UKR8-F1-model_v4	Elongation factor P (EF-P)	0.9716	1	187	GO:0003746 GO:0005737 GO:0043043

F496909

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF09285

Elong-fact-P_C

Elongation factor P, C-terminal

134

189

0.99

PF08207

EFP_N

Elongation factor P (EF-P) KOW-like domain

22

79

0.98

PF01132

EFP

Elongation factor P (EF-P) OB domain

89

126

0.97

Structural Annotation

Top 5 Hits

Map