metagRoot

F496868

General Info

Members	Datasets	Scaffolds	Average Seq Length
2507	1512	1545	259

Family's Representative Sequence

Representative Sequence	3300003794\|Ga0055531_10019620\|Ga0055531_100196204
Length	291
Sequence	MTDTPLLKVSGVSKFYGSRIGCKDVSFELWPGEVLAIVGESGSGKTTLLNCLSTRLMPTTGSVEYRMRDGNFRDLYHMSEAERRFLMRTDWGFVHQNPADGLRMTVSAGANVGERLMAVGDRHYGKIRETASDWLTRVEIGTDRIDDQPRAFSGGMRQRLQIARNLVTGPRLVFMDEPTGGLDVSVQARLLDLVRGLVNDLGLSAIVVTHDLAVARLLSHRMMVMKDGHVIEHGLTDRVLDDPRALYPAARLIHSSGLRRYRWPLPSSFPKSSRASPCTCATASSCRSSTM

Samples

	Sample ID	Description	Type	Environment
1	2503198000	Mesorhizobium opportunistum WSM2075	Isolate	Nodule
2	2508501050	Microvirga lupini Lut6	Isolate	Nodule
3	2508501114	Microvirga lotononidis WSM3557	Isolate	Nodule
4	2508501122	Ensifer yinggardensis WSM1721	Isolate	Nodule
5	2508501123	Mesorhizobium sp. WSM3626	Isolate	Nodule
6	2508501127	Mesorhizobium sp. WSM2561	Isolate	Nodule
7	2509276018	Mesorhizobium ciceri CMG6	Isolate	Nodule
8	2509276019	Ensifer aridi TW10	Isolate	Nodule
9	2509276021	Rhizobium leguminosarum bv. trifolii WSM597	Isolate	Nodule
10	2509276022	Mesorhizobium australicum WSM2073	Isolate	Nodule
11	2509276033	Rhizobium leguminosarum bv. trifolii WSM2012	Isolate	Nodule
12	2510065019	Rhizobium leguminosarum bv. trifolii WSM1689	Isolate	Nodule
13	2510065057	Sinorhizobium meliloti WSM1022	Isolate	Nodule
14	2510065059	Mesorhizobium ciceri WSM4083	Isolate	Nodule
15	2510461069	Rhizobium sp. PDO1-076	Isolate	Rhizosphere
16	2510461076	Rhizobium leguminosarum bv. trifolii TA1	Isolate	Nodule
17	2510917022	Rhizobium sp. AP16	Isolate	Rhizosphere
18	2510917026	Rhizobium sp. CF80	Isolate	Rhizosphere
19	2510917028	Rhizobium sp. CF122	Isolate	Rhizosphere
20	2510917030	Rhizobium sp. CF142	Isolate	Rhizosphere
21	2511231027	Phyllobacterium sp. YR531	Isolate	Rhizosphere
22	2511231052	Sinorhizobium meliloti AK58	Isolate	Nodule
23	2512047086	Sinorhizobium arboris LMG 14919	Isolate	Nodule
24	2512875016	Mesorhizobium japonicum R7A	Isolate	Nodule
25	2512875024	Mesorhizobium loti R88b	Isolate	Nodule
26	2512875026	Sinorhizobium medicae WSM1115	Isolate	Nodule
27	2513237084	Rhizobium leguminosarum bv. viciae UPM1131	Isolate	Nodule
28	2513237085	Rhizobium leguminosarum bv. viciae UPM1137	Isolate	Nodule
29	2513237086	Sinorhizobium meliloti MVII-I	Isolate	Nodule
30	2513237087	Azorhizobium doebereinerae UFLA1-100	Isolate	Nodule
31	2513237088	Rhizobium mesoamericanum STM6155	Isolate	Nodule
32	2513237089	Sinorhizobium medicae DI28	Isolate	Nodule
33	2513237090	Mesorhizobium sp. WSM3224	Isolate	Nodule
34	2513237091	Sinorhizobium meliloti RRI128	Isolate	Nodule
35	2513237093	Rhizobium leguminosarum bv. phaseoli FA23	Isolate	Nodule
36	2513237094	Bradyrhizobium sp. WSM3983	Isolate	Nodule
37	2513237098	Bradyrhizobium elkanii WSM2783	Isolate	Nodule
38	2513237103	Rhizobium leguminosarum bv. viciae VF39	Isolate	Nodule
39	2513237104	Bradyrhizobium sp. EC3.3	Isolate	Nodule
40	2513237138	Rhizobium favelukesii OR191	Isolate	Nodule
41	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
42	2513237140	Sinorhizobium meliloti GVPV12	Isolate	Nodule
43	2513237143	Sinorhizobium meliloti Mlalz-1	Isolate	Nodule
44	2513237144	Rhizobium sullae WSM1592	Isolate	Nodule
45	2513237146	Rhizobium mongolense USDA 1844 (Illumina)	Isolate	Nodule
46	2513237156	Sinorhizobium medicae WSM1369	Isolate	Nodule
47	2513237159	Rhizobium giardinii bv. giardinii H152	Isolate	Nodule
48	2513237160	Sinorhizobium medicae WSM244	Isolate	Nodule
49	2513237162	Rhizobium ruizarguesonis GB30	Isolate	Nodule
50	2513237164	Mesorhizobium loti CJ3sym	Isolate	Nodule
51	2513237165	Cupriavidus neocaledonicus STM6070	Isolate	Nodule
52	2513237305	Mesorhizobium amorphae CCNWGS0123	Isolate	Nodule
53	2513237351	Mesorhizobium alhagi CCNWXJ12-2	Isolate	Nodule
54	2515075009	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
55	2515154107	Sinorhizobium meliloti 4H41	Isolate	Nodule
56	2515154113	Rhizobium ruizarguesonis Vc2	Isolate	Nodule
57	2515154114	Rhizobium ruizarguesonis Vh3	Isolate	Nodule
58	2515154116	Rhizobium ruizarguesonis Ps8	Isolate	Nodule
59	2515154134	Rhizobium gallicum bv. gallicum R602sp	Isolate	Nodule
60	2516143018	Ensifer sp. BR816	Isolate	Nodule
61	2516653046	Sinorhizobium meliloti BO21CC	Isolate	Nodule
62	2516653077	Rhizobium acaciae WSM1481	Isolate	Nodule
63	2516653085	Rhizobium leguminosarum bv. phaseoli 4292	Isolate	Nodule
64	2517093000	Rhizobium leguminosarum bv. trifolii SRDI943	Isolate	Nodule
65	2517287029	Rhizobium leguminosarum bv. trifolii SRDI565	Isolate	Nodule
66	2517487022	Sinorhizobium medicae WSM4191	Isolate	Nodule
67	2519899620	Rhizobium sp. Pop5	Isolate	Nodule
68	2523231067	Pleomorphomonas oryzae DSM 16300	Isolate	Unclassified
69	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
70	2524023207	Ensifer sp. USDA 6670	Isolate	Nodule
71	2524023209	Rhizobium leucaenae USDA 9039	Isolate	Nodule
72	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
73	2529292951	Rhizobium sp. CCGE 510	Isolate	Nodule
74	2534681796	Rhizobium grahamii CCGE 502	Isolate	Nodule
75	2537561587	Agrobacterium tumefaciens Cherry 2E-2-2	Isolate	Rhizosphere
76	2545555834	Methylobacterium sp. WSM2598	Isolate	Nodule
77	2551306084	Sinorhizobium meliloti 5A14	Isolate	Nodule
78	2551306085	Sinorhizobium meliloti AE608H	Isolate	Nodule
79	2551306087	Sinorhizobium meliloti A0643DD	Isolate	Nodule
80	2551306089	Sinorhizobium meliloti 1A42	Isolate	Nodule
81	2551306090	Sinorhizobium meliloti A0641M	Isolate	Nodule
82	2554235003	Agrobacterium tumefaciens WRT31	Isolate	Rhizosphere
83	2558860100	Sinorhizobium sp. PC2	Isolate	Nodule
84	2558860242	Agrobacterium fabacearum P4	Isolate	Rhizosphere
85	2582581283	Rhizobium sp. OK665	Isolate	Rhizosphere
86	2582581294	Rhizobium sp. CF394	Isolate	Rhizosphere
87	2582581298	Rhizobium alamii YR540	Isolate	Rhizosphere
88	2582581299	Rhizobium leguminosarum OV483	Isolate	Rhizosphere
89	2582581304	Rhizobium sp. YR519	Isolate	Rhizosphere
90	2582581306	Rhizobium sp. YR295	Isolate	Rhizosphere
91	2582581307	Rhizobium sp. YR060	Isolate	Rhizosphere
92	2582581308	Rhizobium sp. OK494	Isolate	Rhizosphere
93	2582581315	Agrobacterium rhizogenes YR147	Isolate	Rhizosphere
94	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
95	2582581865	Rhizobium sp. CF258	Isolate	Rhizosphere
96	2582581866	Rhizobium sp. CF097	Isolate	Rhizosphere
97	2582581867	Rhizobium sp. OV201	Isolate	Rhizosphere
98	2585427526	Rhizobium leguminosarum OV152	Isolate	Rhizosphere
99	2585427527	Rhizobium lusitanum YR374	Isolate	Rhizosphere
100	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
101	2585427529	Rhizobium alamii YR584	Isolate	Rhizosphere
102	2585427530	Rhizobium tropici YR635	Isolate	Rhizosphere
103	2585427531	Agrobacterium rhizogenes YR530	Isolate	Rhizosphere
104	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
105	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
106	2585427594	Rhizobium sp. YR528	Isolate	Rhizosphere
107	2585427608	Agrobacterium rhizogenes OV677	Isolate	Rhizosphere
108	2585427609	Agrobacterium rhizogenes CF263	Isolate	Rhizosphere
109	2585427633	Neorhizobium galegae bv. officinalis HAMBI 1141	Isolate	Nodule
110	2585427634	Neorhizobium galegae bv. orientalis HAMBI 540	Isolate	Nodule
111	2585428125	Agrobacterium rhizogenes CF262	Isolate	Rhizosphere
112	2597489875	Mesorhizobium ciceri ca181	Isolate	Unclassified
113	2599185156	Rhizobium sp. NFR03	Isolate	Rhizoplane
114	2599185170	Rhizobium mongolense USDA 1844 (PacBio)	Isolate	Nodule
115	2599185210	Rhizobium sp. NFACC06-2	Isolate	Rhizoplane
116	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
117	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
118	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
119	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
120	2599185236	Rhizobium sp. NFR07	Isolate	Rhizoplane
121	2599185301	Mesorhizobium sp. NFR06	Isolate	Rhizoplane
122	2599185352	Sinorhizobium sp. NFACC03	Isolate	Rhizoplane
123	2600254933	Rhizobium sp. NFR12	Isolate	Rhizoplane
124	2600255279	Rhizobium sp. NFIX01	Isolate	Rhizoplane
125	2600255308	Rhizobium sp. NFIX02	Isolate	Rhizoplane
126	2602042107	Bradyrhizobium sp. NFR13	Isolate	Rhizoplane
127	2615840624	Rhizobium aethiopicum HBR26	Isolate	Nodule
128	2615840626	Rhizobium lusitanum P1-7	Isolate	Nodule
129	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
130	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
131	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
132	2643221547	Pseudolabrys sp. Root1462	Isolate	Unclassified
133	2643221551	Mesorhizobium sp. Root1471	Isolate	Unclassified
134	2643221555	Mesorhizobium sp. Root554	Isolate	Unclassified
135	2643221557	Ensifer sp. Root558	Isolate	Unclassified
136	2643221558	Rhizobium sp. Root149	Isolate	Unclassified
137	2643221568	Rhizobium sp. Root564	Isolate	Unclassified
138	2643221570	Acidovorax sp. Root568	Isolate	Unclassified
139	2643221580	Devosia sp. Root635	Isolate	Unclassified
140	2643221582	Rhizobium sp. Root651	Isolate	Unclassified
141	2643221591	Devosia sp. Root685	Isolate	Unclassified
142	2643221595	Mesorhizobium sp. Root695	Isolate	Unclassified
143	2643221596	Acidovorax sp. Root70	Isolate	Unclassified
144	2643221599	Rhizobium sp. Root708	Isolate	Unclassified
145	2643221603	Noviherbaspirillum sp. Root189	Isolate	Unclassified
146	2643221607	Rhizobium sp. Root73	Isolate	Unclassified
147	2643221609	Acidovorax sp. Root217	Isolate	Unclassified
148	2643221610	Ensifer sp. Root74	Isolate	Unclassified
149	2643221611	Acidovorax sp. Root219	Isolate	Unclassified
150	2643221618	Ensifer sp. Root231	Isolate	Unclassified
151	2643221621	Achromobacter sp. Root83	Isolate	Unclassified
152	2643221623	Aminobacter sp. DSM 101952 Root100	Isolate	Unclassified
153	2643221626	Ensifer sp. Root31	Isolate	Unclassified
154	2643221627	Mesorhizobium sp. Root102	Isolate	Unclassified
155	2643221629	Devosia sp. Root105	Isolate	Unclassified
156	2643221634	Rhizobium sp. Root1203	Isolate	Unclassified
157	2643221636	Rhizobium sp. Root1204	Isolate	Unclassified
158	2643221637	Rhizobium sp. Root1212	Isolate	Unclassified
159	2643221643	Rhizobium sp. Root1220	Isolate	Unclassified
160	2643221652	Acidovorax sp. Root402	Isolate	Unclassified
161	2643221655	Ensifer sp. Root1252	Isolate	Unclassified
162	2643221659	Ensifer sp. Root127	Isolate	Unclassified
163	2643221662	Devosia sp. Root413D1	Isolate	Unclassified
164	2643221668	Ensifer sp. Root423	Isolate	Unclassified
165	2643221674	Devosia sp. Root436	Isolate	Unclassified
166	2643221675	Ensifer sp. Root1298	Isolate	Unclassified
167	2643221680	Ensifer sp. Root1312	Isolate	Unclassified
168	2643221686	Rhizobium sp. Root1334	Isolate	Unclassified
169	2643221688	Rhizobium sp. Root482	Isolate	Unclassified
170	2643221689	Rhizobium sp. Root483D2	Isolate	Unclassified
171	2643221693	Rhizobium sp. Root491	Isolate	Unclassified
172	2643221698	Ensifer sp. Root142	Isolate	Unclassified
173	2643221712	Ensifer sp. Root258	Isolate	Unclassified
174	2643221718	Rhizobium sp. Root268	Isolate	Unclassified
175	2643221723	Ensifer sp. Root278	Isolate	Unclassified
176	2643221726	Ensifer sp. Root954	Isolate	Unclassified
177	2657244999	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
178	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
179	2687453129	Halotalea alkalilenta IHB B 13600	Isolate	Unclassified
180	2687453392	Mesorhizobium ciceri biserrulae WSM1284	Isolate	Unclassified
181	2690316117	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
182	2693429783	Mesorhizobium sp. LCM 4577	Isolate	Rhizosphere
183	2693429784	Mesorhizobium sp. LCM 4576	Isolate	Rhizosphere
184	2718217882	Rhizobium sp. N741	Isolate	Nodule
185	2718217927	Rhizobium sp. N324	Isolate	Nodule
186	2718217997	Rhizobium phaseoli sv. phaseoli R723	Isolate	Nodule
187	2718218009	Rhizobium sp. N561	Isolate	Nodule
188	2718218199	Rhizobium phaseoli sv. phaseoli N261	Isolate	Nodule
189	2718218232	Rhizobium phaseoli sv. phaseoli N161	Isolate	Nodule
190	2718218233	Rhizobium phaseoli sv. phaseoli R744	Isolate	Nodule
191	2718218235	Rhizobium phaseoli sv. phaseoli R620	Isolate	Nodule
192	2718218269	Rhizobium phaseoli sv. phaseoli N671	Isolate	Nodule
193	2718218363	Rhizobium sp. N113	Isolate	Nodule
194	2718218365	Rhizobium sp. N731	Isolate	Nodule
195	2718218366	Rhizobium sp. N621	Isolate	Nodule
196	2718218423	Rhizobium sp. N941	Isolate	Nodule
197	2721755514	Rhizobium sp. N6212	Isolate	Nodule
198	2721755556	Rhizobium phaseoli sv. phaseoli N931	Isolate	Nodule
199	2721755684	Rhizobium phaseoli sv. phaseoli N841	Isolate	Nodule
200	2721755685	Rhizobium phaseoli sv. phaseoli R611	Isolate	Nodule
201	2721755686	Mesorhizobium amorphae CCNWGS0123	Isolate	Nodule
202	2721755809	Rhizobium sp. N541	Isolate	Nodule
203	2721755810	Rhizobium sp. N871	Isolate	Nodule
204	2721755819	Rhizobium phaseoli sv. phaseoli N771	Isolate	Nodule
205	2721755822	Rhizobium phaseoli sv. phaseoli R650	Isolate	Nodule
206	2721755823	Rhizobium phaseoli sv. phaseoli R630	Isolate	Nodule
207	2724679232	Rhizobium leguminosarum Vaf12	Isolate	Unclassified
208	2728369352	Rhizobium phaseoli sv. phaseoli N831	Isolate	Nodule
209	2728369365	Rhizobium sp. N1341	Isolate	Nodule
210	2728369397	Rhizobium sp. N1314	Isolate	Nodule
211	2738541281	Methylobacterium sp. GV094	Isolate	Unclassified
212	2738541293	Rhizobium sp. GV031	Isolate	Unclassified
213	2738541317	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
214	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
215	2738543012	Acidovorax sp. CF301	Isolate	Unclassified
216	2738543024	Aminobacter sp. AP02	Isolate	Unclassified
217	2738543031	Pleomorphomonas sp. CF100	Isolate	Unclassified
218	2738543032	Methylobacterium sp. GV104	Isolate	Unclassified
219	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
220	2751185800	Brucella pituitosa AA2	Isolate	Unclassified
221	2751185821	Ensifer shofinae CCBAU 251167	Isolate	Unclassified
222	2756170246	Mesorhizobium loti DSM 2626	Isolate	Nodule
223	2757320392	Phyllobacterium leguminum ORS 1419	Isolate	Nodule
224	2758568016	[Ochrobactrum] quorumnocens A44	Isolate	Rhizosphere
225	2765235802	Phyllobacterium bourgognense 31-25a	Isolate	Rhizoplane
226	2765235942	Rhizobium sp. WYCCWR10014	Isolate	Nodule
227	2767802442	Phyllobacterium brassicacearum 29-15	Isolate	Rhizoplane
228	2775506902	Phyllobacterium zundukense Tri-48	Isolate	Unclassified
229	2775506904	Phyllobacterium zundukense Tri-38	Isolate	Unclassified
230	2775507049	Rhizobium sp. ACO-34A	Isolate	Unclassified
231	2775507266	Rhizobium tropici PRF 81	Isolate	Nodule
232	2791355082	Ensifer alkalisoli YIC4027	Isolate	Nodule
233	2791355091	Sinorhizobium sp. FG01	Isolate	Nodule
234	2791355092	Sinorhizobium sp. NG07B	Isolate	Nodule
235	2791355094	Sinorhizobium sp. BJ1	Isolate	Nodule
236	2791355123	Mesorhizobium sophorae ICMP 19535	Isolate	Unclassified
237	2791355196	Bradyrhizobium sp. Y36	Isolate	Nodule
238	2791355199
239	2791355253	Rhizobium rhizosphaerae RD15	Isolate	Rhizosphere
240	2791355256	Rhizobium sp. M10	Isolate	Nodule
241	2791355259	Rhizobium hidalgonense FH14	Isolate	Nodule
242	2791355260	Rhizobium sp. L9	Isolate	Nodule
243	2791355261	Rhizobium sp. J15	Isolate	Nodule
244	2791355262	Rhizobium sp. M1	Isolate	Nodule
245	2791355263	Rhizobium chutanense C5	Isolate	Nodule
246	2791355264	Rhizobium sp. S9	Isolate	Nodule
247	2791355265	Rhizobium sp. H4	Isolate	Nodule
248	2791355266	Rhizobium sp. L43	Isolate	Nodule
249	2791355267	Rhizobium sp. L18	Isolate	Nodule
250	2802428858	Sinorhizobium medicae M14-1	Isolate	Nodule
251	2802428859	Sinorhizobium medicae SF3.41	Isolate	Nodule
252	2802428860	Sinorhizobium medicae M19-1	Isolate	Nodule
253	2802428861	Sinorhizobium medicae USDA1037	Isolate	Nodule
254	2802428862	Sinorhizobium medicae M7-4	Isolate	Nodule
255	2802428863	Sinorhizobium medicae M26-2	Isolate	Nodule
256	2802429268	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
257	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
258	2802429605	Rhizobium sophoriradicis L101	Isolate	Nodule
259	2802429606	Rhizobium sophoriradicis JJW1	Isolate	Nodule
260	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
261	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
262	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
263	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
264	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
265	2808606387	Rhizobium sp. SJZ105	Isolate	Rhizosphere
266	2816332133	Acidovorax radicis 2721A	Isolate	Unclassified
267	2818991272	Rhizobium sp. SLBN-4	Isolate	Unclassified
268	2818991439	Agrobacterium tumefaciens 1187	Isolate	Unclassified
269	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
270	2818991453	Rhizobium lusitanum 1158	Isolate	Unclassified
271	2818991461	Neorhizobium alkalisoli 1225	Isolate	Unclassified
272	2821123053	Rhizobium cellulosilyticum 1193	Isolate	Unclassified
273	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
274	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
275	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
276	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
277	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
278	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
279	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
280	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
281	2837678835	Jiella endophytica CBS5Q-3	Isolate	Unclassified
282	2838016132	Rhizobium phaseoli SEMIA 4071	Isolate	Nodule
283	2838022645	Rhizobium aethiopicum SEMIA 4074	Isolate	Nodule
284	2838029111	Rhizobium tropici SEMIA 4079	Isolate	Nodule
285	2838035591	Rhizobium mongolense SEMIA 4087	Isolate	Nodule
286	2838042994	Rhizobium esperanzae SEMIA 4089	Isolate	Nodule
287	2838048938	Rhizobium pisi 27/80	Isolate	Nodule
288	2838061910	Rhizobium phaseoli L15	Isolate	Nodule
289	2838068647	Rhizobium esperanzae VC28	Isolate	Nodule
290	2838074704	Sinorhizobium terangae SEMIA 6460	Isolate	Unclassified
291	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
292	2838661181	Rhizobium mongolense SEMIA 402	Isolate	Nodule
293	2838668709	Rhizobium sophoriradicis SEMIA 403	Isolate	Nodule
294	2838675328	Agrobacterium radiobacter SEMIA 410	Isolate	Nodule
295	2838680041	Rhizobium leguminosarum SEMIA 415	Isolate	Nodule
296	2838686498	Rhizobium leguminosarum SEMIA 416	Isolate	Nodule
297	2838694306	Rhizobium leguminosarum SEMIA 421	Isolate	Nodule
298	2838701080	Rhizobium aethiopicum SEMIA 428	Isolate	Nodule
299	2838707686	Rhizobium leguminosarum SEMIA 430	Isolate	Nodule
300	2838714209	Agrobacterium radiobacter SEMIA 435	Isolate	Nodule
301	2838719591	Agrobacterium radiobacter SEMIA 436	Isolate	Nodule
302	2838724970	Agrobacterium radiobacter SEMIA 437	Isolate	Nodule
303	2838729681	Rhizobium leguminosarum SEMIA 445	Isolate	Nodule
304	2838736955	Rhizobium cellulosilyticum SEMIA 448	Isolate	Nodule
305	2838742623	Rhizobium leguminosarum SEMIA 449	Isolate	Nodule
306	2839993093	Phyllobacterium endophyticum PEPV15	Isolate	Unclassified
307	2840764183	Phyllobacterium sophorae CCBAU 03422	Isolate	Unclassified
308	2841734538	Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1	Isolate	Nodule
309	2841840854	Rhizobium cellulosilyticum SEMIA 444	Isolate	Nodule
310	2841846520	Agrobacterium radiobacter SEMIA 440	Isolate	Nodule
311	2841851746	Rhizobium leguminosarum SEMIA 498	Isolate	Nodule
312	2841859092	Agrobacterium radiobacter SEMIA 4026	Isolate	Nodule
313	2841864319	Rhizobium leguminosarum SEMIA 4052	Isolate	Nodule
314	2841941048	Bradyrhizobium sp. SBR1B	Isolate	Nodule
315	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
316	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
317	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
318	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
319	2842077413	Rhizobium leguminosarum SEMIA 422	Isolate	Nodule
320	2842110456	Rhizobium esperanzae SEMIA 414	Isolate	Nodule
321	2842118031	Rhizobium esperanzae SEMIA 420	Isolate	Nodule
322	2842124991	Agrobacterium radiobacter SEMIA 434	Isolate	Nodule
323	2842130223	Agrobacterium radiobacter SEMIA 441	Isolate	Nodule
324	2842140634	Rhizobium cellulosilyticum SEMIA 452	Isolate	Nodule
325	2842146304	Rhizobium sophoriradicis SEMIA 454	Isolate	Nodule
326	2842152218	Agrobacterium radiobacter SEMIA 457	Isolate	Nodule
327	2842156927	Rhizobium leguminosarum SEMIA 459	Isolate	Nodule
328	2842163707	Rhizobium leguminosarum SEMIA 460	Isolate	Nodule
329	2842170452	Agrobacterium radiobacter SEMIA 461	Isolate	Nodule
330	2842175837	Agrobacterium radiobacter SEMIA 462	Isolate	Nodule
331	2842180545	Rhizobium leguminosarum SEMIA 463	Isolate	Nodule
332	2842187318	Agrobacterium radiobacter SEMIA 464	Isolate	Nodule
333	2842192696	Rhizobium esperanzae SEMIA 468	Isolate	Nodule
334	2842198810	Rhizobium aethiopicum SEMIA 470	Isolate	Nodule
335	2842205361	Rhizobium etli SEMIA 471	Isolate	Nodule
336	2842211629	Agrobacterium radiobacter SEMIA 472	Isolate	Nodule
337	2842217011	Rhizobium leguminosarum SEMIA 475	Isolate	Nodule
338	2842224351	Agrobacterium radiobacter SEMIA 480	Isolate	Nodule
339	2842229732	Rhizobium leguminosarum SEMIA 481	Isolate	Nodule
340	2842237096	Rhizobium leguminosarum SEMIA 482	Isolate	Nodule
341	2842243621	Rhizobium leguminosarum SEMIA 483	Isolate	Nodule
342	2842250916	Rhizobium etli SEMIA 484	Isolate	Nodule
343	2842257432	Rhizobium leguminosarum SEMIA 485	Isolate	Nodule
344	2842264693	Rhizobium phaseoli SEMIA 487	Isolate	Nodule
345	2842271015	Rhizobium leguminosarum SEMIA 488	Isolate	Nodule
346	2842278818	Rhizobium etli SEMIA 489	Isolate	Nodule
347	2842285085	Rhizobium lentis SEMIA 490	Isolate	Nodule
348	2842291075	Rhizobium leguminosarum SEMIA 491	Isolate	Nodule
349	2842298080	Rhizobium leucaenae SEMIA 492	Isolate	Nodule
350	2842304105	Rhizobium leguminosarum SEMIA 499	Isolate	Nodule
351	2842311132	Rhizobium phaseoli SEMIA 4002	Isolate	Nodule
352	2842317721	Rhizobium etli SEMIA 4004	Isolate	Nodule
353	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
354	2842357229	Rhizobium leucaenae SEMIA 4015	Isolate	Nodule
355	2842363717	Rhizobium leguminosarum SEMIA 4016	Isolate	Nodule
356	2842370503	Rhizobium leguminosarum SEMIA 4022	Isolate	Nodule
357	2842377471	Rhizobium leguminosarum SEMIA 4024	Isolate	Nodule
358	2842384541	Rhizobium leguminosarum SEMIA 4025	Isolate	Nodule
359	2842395702	Rhizobium ecuadorense SEMIA 4029	Isolate	Nodule
360	2842402390	Rhizobium lentis SEMIA 4033	Isolate	Nodule
361	2842409023	Rhizobium lentis SEMIA 4034	Isolate	Nodule
362	2842415677	Rhizobium lentis SEMIA 4036	Isolate	Nodule
363	2842422224	Rhizobium esperanzae SEMIA 4042	Isolate	Nodule
364	2842428310	Rhizobium phaseoli SEMIA 4050	Isolate	Nodule
365	2842434925	Rhizobium esperanzae SEMIA 4051	Isolate	Nodule
366	2842441272	Rhizobium esperanzae SEMIA 4053	Isolate	Nodule
367	2842447887	Rhizobium esperanzae SEMIA 4055	Isolate	Nodule
368	2842462802	Rhizobium phaseoli SEMIA 4057	Isolate	Nodule
369	2842469257	Rhizobium phaseoli SEMIA 4058	Isolate	Nodule
370	2842475841	Rhizobium tropici SEMIA 4059	Isolate	Nodule
371	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
372	2842489311	Rhizobium sophoriradicis SEMIA 4061	Isolate	Nodule
373	2842495871	Rhizobium etli SEMIA 4062	Isolate	Nodule
374	2842502639	Rhizobium tropici SEMIA 4063	Isolate	Nodule
375	2842509118	Rhizobium paranaense SEMIA 4064	Isolate	Nodule
376	2842515876	Agrobacterium radiobacter SEMIA 4072	Isolate	Nodule
377	2842521101	Rhizobium giardinii SEMIA 4084	Isolate	Nodule
378	2842733646	Variovorax sp. R-72446	Isolate	Unclassified
379	2842871566	Phyllobacterium sp. R-73111	Isolate	Unclassified
380	2842922631	Pararhizobium sp. R-72066	Isolate	Unclassified
381	2844002411	Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1	Isolate	Nodule
382	2844009547	Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1	Isolate	Nodule
383	2844163670	Ensifer sp. 1H6	Isolate	Unclassified
384	2844315083	Bradyrhizobium guangzhouense CCBAU 51670	Isolate	Unclassified
385	2844454524	Rhizobium leguminosarum bv. viciae BIHB 1217	Isolate	Nodule
386	2844533157	Inquilinus sp. R-72501 v. 2	Isolate	Unclassified
387	2847417321	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
388	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
389	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
390	2848992105	Sinorhizobium fredii CCBAU 25509	Isolate	Unclassified
391	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
392	2850079185	Ensifer aridi JNVU TP6	Isolate	Unclassified
393	2852387548	Rhizobium jaguaris CCGE525	Isolate	Unclassified
394	2854896431	Neorhizobium alkalisoli DSM 21826	Isolate	Unclassified
395	2854911287	Brucella lupini LUP21	Isolate	Unclassified
396	2854916844	Neorhizobium huautlense DSM 21817	Isolate	Unclassified
397	2855767633	Achromobacter sp. HZ34	Isolate	Nodule
398	2855825444	Sinorhizobium meliloti CXM1-105	Isolate	Nodule
399	2855839649	Sinorhizobium meliloti AK555	Isolate	Unclassified
400	2855872281	Sinorhizobium fredii PCH1	Isolate	Nodule
401	2856320880	Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1	Isolate	Nodule
402	2856328259	Mesorhizobium sp. Primo-B	Isolate	Nodule
403	2856334872	Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1	Isolate	Nodule
404	2856342000	Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1	Isolate	Nodule
405	2856349417	Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1	Isolate	Nodule
406	2856356410	Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1	Isolate	Nodule
407	2856364286	Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1	Isolate	Nodule
408	2857349434	Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1	Isolate	Nodule
409	2857367948	Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1	Isolate	Nodule
410	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
411	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
412	2857524615	Tardiphaga sp. R-73074	Isolate	Unclassified
413	2857531043	Neorhizobium sp. R-72160	Isolate	Unclassified
414	2857537821	Achromobacter sp. R-71975	Isolate	Unclassified
415	2857542790	Achromobacter sp. R-72367	Isolate	Unclassified
416	2857576091	Pigmentiphaga sp. R-72090	Isolate	Unclassified
417	2858800743	Sinorhizobium meliloti AK170	Isolate	Unclassified
418	2858950400	Achromobacter sp. K91	Isolate	Unclassified
419	2869162929	Mesorhizobium sanjuanii BSA136	Isolate	Nodule
420	2869169390	Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1	Isolate	Nodule
421	2869234852	Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1	Isolate	Nodule
422	2869242130	Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1	Isolate	Nodule
423	2869249662	Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1	Isolate	Nodule
424	2869256925	Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0	Isolate	Nodule
425	2869264136	Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1	Isolate	Nodule
426	2869271264	Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1	Isolate	Nodule
427	2869278585	Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1	Isolate	Nodule
428	2869285874	Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1	Isolate	Nodule
429	2871429161	Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1	Isolate	Nodule
430	2871435913	Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0	Isolate	Nodule
431	2871451962	Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1	Isolate	Nodule
432	2871459585	Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1	Isolate	Nodule
433	2871466892	Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1	Isolate	Nodule
434	2871474448	Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1	Isolate	Nodule
435	2871481445	Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1	Isolate	Nodule
436	2871488783	Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1	Isolate	Nodule
437	2871495908	Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1	Isolate	Nodule
438	2874109183	Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1	Isolate	Nodule
439	2874116593	Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1	Isolate	Nodule
440	2874123672	Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1	Isolate	Nodule
441	2874139085	Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1	Isolate	Nodule
442	2874146452	Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1	Isolate	Nodule
443	2874155637	Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1	Isolate	Nodule
444	2874162495	Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1	Isolate	Nodule
445	2874168670	Mesorhizobium kowhaii Ach-343	Isolate	Nodule
446	2874612657	Bradyrhizobium forestalis INPA54B	Isolate	Nodule
447	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
448	2876363079	Mesorhizobium loti R7ANS::ICEMlSym2042	Isolate	Nodule
449	2876386047	Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1	Isolate	Nodule
450	2876392853	Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1	Isolate	Nodule
451	2876399893	Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1	Isolate	Nodule
452	2876406927	Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1	Isolate	Nodule
453	2876413966	Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1	Isolate	Nodule
454	2876420981	Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1	Isolate	Nodule
455	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
456	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
457	2878730984	Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1	Isolate	Nodule
458	2878738818	Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1	Isolate	Nodule
459	2878745973	Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1	Isolate	Nodule
460	2878753008	Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1	Isolate	Nodule
461	2878760144	Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1	Isolate	Nodule
462	2878767105	Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1	Isolate	Nodule
463	2878774303	Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1	Isolate	Nodule
464	2878781027	Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1	Isolate	Nodule
465	2879083081	Bradyrhizobium zhanjiangense CCBAU 51787	Isolate	Unclassified
466	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
467	2881147464	Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1	Isolate	Nodule
468	2881155292	Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1	Isolate	Nodule
469	2881161766	Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1	Isolate	Nodule
470	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
471	2881412998	Achromobacter aloeverae AVA-1	Isolate	Unclassified
472	2881845957	Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1	Isolate	Nodule
473	2881853255	Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1	Isolate	Nodule
474	2881861095	Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2	Isolate	Nodule
475	2882632389	Mesorhizobium waimense ICMP19557	Isolate	Unclassified
476	2882912400	Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1	Isolate	Nodule
477	2885192300	Variovorax sp. MHTC-1	Isolate	Rhizosphere
478	2885198086	Variovorax sp. 679	Isolate	Unclassified
479	2885211737	Variovorax sp. 553	Isolate	Unclassified
480	2885305155	Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1	Isolate	Nodule
481	2885312484	Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2	Isolate	Nodule
482	2885318864	Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1	Isolate	Nodule
483	2885326080	Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1	Isolate	Nodule
484	2885334103	Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1	Isolate	Nodule
485	2885342637	Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1	Isolate	Nodule
486	2885350715	Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1	Isolate	Nodule
487	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
488	2885383462	Bradyrhizobium sp. Leo170	Isolate	Unclassified
489	2888337043	Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1	Isolate	Nodule
490	2888343758	Mesorhizobium sp. AA22	Isolate	Unclassified
491	2888350351	Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1	Isolate	Nodule
492	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
493	2889010040	Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1	Isolate	Nodule
494	2889016732	Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1	Isolate	Nodule
495	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
496	2891373044	Shinella sp. AETb1-6	Isolate	Rhizosphere
497	2893066018	Tardiphaga sp. P9-11	Isolate	Unclassified
498	2894232714	Microvirga tunisiensis Lmie10	Isolate	Nodule
499	2894652903	Phyllobacterium sp. SYP-B3895	Isolate	Rhizosphere
500	2896384573	Ensifer sp. MPMI2T	Isolate	Unclassified
501	2899792073	Agrobacterium deltaense CNPSo 3391	Isolate	Nodule
502	2899803654	Agrobacterium sp. a22-2	Isolate	Unclassified
503	2899845264	Agrobacterium fabacearum CNPSo 675	Isolate	Unclassified
504	2902330777	Methylobacterium sp. 2A	Isolate	Unclassified
505	2903448605	Mesorhizobium japonicum Opo-235	Isolate	Nodule
506	2903492973	Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1	Isolate	Nodule
507	2903521522	Mesorhizobium loti R7ANS::ICEMlSym2014	Isolate	Nodule
508	2903528002	Mesorhizobium loti R7ANS::ICEMlSym2037	Isolate	Nodule
509	2903540706	Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1	Isolate	Nodule
510	2903727486	Bradyrhizobium guangzhouense CCBAU 53424	Isolate	Unclassified
511	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
512	2904434214	Robbsia andropogonis 1567	Isolate	Rhizosphere
513	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
514	2904456579	Variovorax sp. 2002	Isolate	Unclassified
515	2904578770	Phyllobacterium sp. 586	Isolate	Unclassified
516	2904659560	Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1	Isolate	Nodule
517	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
518	2906308376	Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1	Isolate	Nodule
519	2906321335	Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1	Isolate	Nodule
520	2906354277	Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1	Isolate	Nodule
521	2906363423	Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1	Isolate	Nodule
522	2906370794	Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1	Isolate	Nodule
523	2906401398	Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1	Isolate	Nodule
524	2906408224	Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1	Isolate	Nodule
525	2906602504	Bradyrhizobium guangzhouense CCBAU 53426	Isolate	Unclassified
526	2906626472	Bradyrhizobium hipponense aSej3	Isolate	Unclassified
527	2909042592	Labrys sp. LIt4	Isolate	Nodule
528	2913295892	Sinorhizobium kostiensis DSM 13372	Isolate	Nodule
529	2913308742	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
530	2915650412	Ochrobactrum sp. CM-21-5	Isolate	Rhizosphere
531	2915980308	Sinorhizobium medicae USDA1149	Isolate	Nodule
532	2915986958	Sinorhizobium meliloti USDA1659	Isolate	Nodule
533	2915993759	Sinorhizobium meliloti USDA1336	Isolate	Nodule
534	2916000859	Sinorhizobium meliloti USDA1562	Isolate	Nodule
535	2916007675	Sinorhizobium meliloti USDA1289	Isolate	Nodule
536	2916014648	Sinorhizobium meliloti USDA1583	Isolate	Nodule
537	2916021584	Sinorhizobium meliloti USDA1550	Isolate	Nodule
538	2916028427	Sinorhizobium meliloti USDA1613	Isolate	Nodule
539	2916035215	Sinorhizobium meliloti 3011	Isolate	Nodule
540	2916041962	Sinorhizobium meliloti USDA1795	Isolate	Nodule
541	2916048683	Sinorhizobium meliloti USDA1796	Isolate	Nodule
542	2916055098	Sinorhizobium meliloti USDA1770	Isolate	Nodule
543	2916061851	Sinorhizobium medicae USDA1638	Isolate	Nodule
544	2916068649	Sinorhizobium meliloti USDA1220	Isolate	Nodule
545	2916076590	Sinorhizobium meliloti USDA1661	Isolate	Nodule
546	2917554339	Chthonobacter rhizosphaerae yh7-1	Isolate	Rhizosphere
547	2919073203	Tardiphaga robiniae 1155	Isolate	Unclassified
548	2919100787	Rhizobium sp. 1399	Isolate	Rhizosphere
549	2919114240	Agrobacterium tumefaciens 1457	Isolate	Rhizosphere
550	2919119836	Phyllobacterium sp. 1468	Isolate	Rhizosphere
551	2919166419	Agrobacterium cavarae 2074	Isolate	Unclassified
552	2919171160	Neorhizobium sp. 2083	Isolate	Unclassified
553	2919408235	Rhizobium miluonense 3199	Isolate	Unclassified
554	2919450847	Ancylobacter sp. 3268	Isolate	Rhizosphere
555	2919704043	Hydrogenophaga palleronii 4249	Isolate	Unclassified
556	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
557	2920822456	Ensifer sesbaniae CCBAU 65729	Isolate	Unclassified
558	2921201388	Sinorhizobium meliloti USDA1692	Isolate	Nodule
559	2921208531	Sinorhizobium meliloti USDA1660	Isolate	Nodule
560	2921237296	Sinorhizobium meliloti USDA1508	Isolate	Nodule
561	2921244191	Sinorhizobium meliloti 2119	Isolate	Nodule
562	2921250672	Sinorhizobium medicae USDA1169	Isolate	Nodule
563	2921257292	Sinorhizobium meliloti USDA1320	Isolate	Nodule
564	2921263974	Sinorhizobium meliloti USDA1107	Isolate	Nodule
565	2921282425	Sinorhizobium meliloti USDA1203	Isolate	Nodule
566	2921289301	Sinorhizobium meliloti USDA1730	Isolate	Nodule
567	2921296804	Sinorhizobium meliloti USDA1200	Isolate	Nodule
568	2922130491	Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1	Isolate	Nodule
569	2922151315	Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1	Isolate	Nodule
570	2922172374	Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1	Isolate	Nodule
571	2922178524	Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1	Isolate	Nodule
572	2922185730	Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1	Isolate	Nodule
573	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
574	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
575	2923556063	Rhizobium tibeticum 3740	Isolate	Unclassified
576	2924144063	Sinorhizobium meliloti USDA1022	Isolate	Nodule
577	2924150972	Sinorhizobium meliloti USDA1700	Isolate	Nodule
578	2924158325	Sinorhizobium meliloti USDA1146	Isolate	Nodule
579	2924165586	Sinorhizobium meliloti USDA1264	Isolate	Nodule
580	2924172951	Sinorhizobium meliloti USDA1626	Isolate	Nodule
581	2924179722	Sinorhizobium meliloti USDA1280	Isolate	Nodule
582	2924186466	Sinorhizobium meliloti USDA1389	Isolate	Nodule
583	2924193448	Sinorhizobium meliloti USDA1158	Isolate	Nodule
584	2924200457	Sinorhizobium meliloti USDA1007	Isolate	Nodule
585	2924207177	Sinorhizobium meliloti USDA1589	Isolate	Nodule
586	2924221636	Sinorhizobium meliloti USDA1416	Isolate	Nodule
587	2924228884	Sinorhizobium meliloti USDA1581	Isolate	Nodule
588	2924733363	Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1	Isolate	Nodule
589	2924741084	Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2	Isolate	Nodule
590	2924748358	Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2	Isolate	Nodule
591	2924754689	Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1	Isolate	Nodule
592	2924762789	Mesorhizobium sp. WSM4303	Isolate	Unclassified
593	2924776078	Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1	Isolate	Nodule
594	2924784321	Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1	Isolate	Nodule
595	2926754445	Agrobacterium radiobacter SLBN-94	Isolate	Rhizosphere
596	2926760298	Agrobacterium tumefaciens SLBN-170	Isolate	Rhizosphere
597	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
598	2928521798	Phyllobacterium ifriqiyense 1451	Isolate	Rhizosphere
599	2929138655	Agrobacterium sp. R-72433 Hybrid assembly	Isolate	Unclassified
600	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
601	2932401849	Devosia sp. 2618	Isolate	Rhizosphere
602	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
603	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
604	2933006813	Rhizobium sp. SEMIA 439	Isolate	Unclassified
605	2933011516	Rhizobium sp. SEMIA 4032	Isolate	Unclassified
606	2933016740	Rhizobium sp. SEMIA 4085	Isolate	Nodule
607	2933570622	Rhizobium leguminosarum SEMIA 409	Isolate	Nodule
608	2933586486	Rhizobium leguminosarum SEMIA 4039	Isolate	Nodule
609	2933594066	Agrobacterium fabrum 35/80	Isolate	Nodule
610	2933599457	Rhizobium phaseoli M3	Isolate	Nodule
611	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
612	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
613	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
614	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
615	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
616	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
617	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
618	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
619	2935894831	Rhizobium leguminosarum SEMIA 419	Isolate	Nodule
620	2935901341	Rhizobium leguminosarum SEMIA 4082	Isolate	Nodule
621	2935959822	Bradyrhizobium sp. F1.4.3	Isolate	Nodule
622	2936367885	Rhizobium changzhiense WYCCWR 11290	Isolate	Nodule
623	2936375103	Rhizobium changzhiense WYCCWR 11317	Isolate	Nodule
624	2936381700	Rhizobium chutanense C16	Isolate	Unclassified
625	2936996657	Sinorhizobium meliloti USDA1025	Isolate	Nodule
626	2937002841	Sinorhizobium meliloti USDA1006	Isolate	Nodule
627	2937009748	Sinorhizobium meliloti USDA1162	Isolate	Nodule
628	2937016420	Sinorhizobium meliloti USDA1027	Isolate	Nodule
629	2937023124	Sinorhizobium meliloti USDA1335	Isolate	Nodule
630	2937029754	Sinorhizobium medicae USDA1624	Isolate	Nodule
631	2937036028	Sinorhizobium medicae USDA1608	Isolate	Nodule
632	2937042894	Sinorhizobium meliloti USDA1687	Isolate	Nodule
633	2937049772	Sinorhizobium meliloti USDA1691	Isolate	Nodule
634	2937056579	Sinorhizobium meliloti USDA1357	Isolate	Nodule
635	2937063883	Sinorhizobium meliloti USDA1808	Isolate	Nodule
636	2937071275	Sinorhizobium meliloti USDA1623	Isolate	Nodule
637	2937078374	Sinorhizobium medicae USDA1004	Isolate	Nodule
638	2937084907	Sinorhizobium medicae USDA1664	Isolate	Nodule
639	2937091812	Sinorhizobium meliloti USDA1221	Isolate	Nodule
640	2937098957	Sinorhizobium meliloti USDA1519	Isolate	Nodule
641	2937106411	Sinorhizobium meliloti USDA1214	Isolate	Nodule
642	2937113482	Sinorhizobium meliloti USDA1180	Isolate	Nodule
643	2937119839	Sinorhizobium meliloti USDA1790	Isolate	Nodule
644	2937126314	Sinorhizobium meliloti USDA1612	Isolate	Nodule
645	2937813078	Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1	Isolate	Nodule
646	2937822353	Mesorhizobium neociceri CCANP35	Isolate	Nodule
647	2937836603	Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1	Isolate	Nodule
648	2937843397	Mesorhizobium xinjiangense lm94	Isolate	Rhizosphere
649	2937848649	Mesorhizobium sp. WSM4310	Isolate	Unclassified
650	2937861824	Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1	Isolate	Nodule
651	2937877337	Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1	Isolate	Nodule
652	2937972304	Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1	Isolate	Nodule
653	2937994558	Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1	Isolate	Nodule
654	2938014810	Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1	Isolate	Nodule
655	2939669807	Kaistia defluvii 3207	Isolate	Rhizosphere
656	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
657	2941499720	Ensifer sp. 4252	Isolate	Rhizosphere
658	2941531003	Bradyrhizobium sp. LB11.1	Isolate	Nodule
659	2954011201	Phyllobacterium ifrigiyense W4I11	Isolate	Rhizosphere
660	2957375807	Sinorhizobium medicae USDA1632	Isolate	Nodule
661	2957382221	Sinorhizobium meliloti USDA1919	Isolate	Nodule
662	2957388812	Sinorhizobium meliloti USDA1195	Isolate	Nodule
663	2957395598	Sinorhizobium meliloti USDA1237	Isolate	Nodule
664	2957402308	Sinorhizobium meliloti USDA1794	Isolate	Nodule
665	2957408893	Sinorhizobium meliloti USDA1163	Isolate	Nodule
666	2957415311	Sinorhizobium meliloti USDA1724	Isolate	Nodule
667	2957422303	Sinorhizobium meliloti USDA1497	Isolate	Nodule
668	2957430029	Sinorhizobium meliloti USDA1590	Isolate	Nodule
669	2957437181	Sinorhizobium medicae USDA1694	Isolate	Nodule
670	2957443900	Sinorhizobium meliloti USDA1734	Isolate	Nodule
671	2957450854	Sinorhizobium meliloti USDA1655	Isolate	Nodule
672	2957457609	Sinorhizobium meliloti USDA1751	Isolate	Nodule
673	2957464669	Sinorhizobium meliloti USDA1520	Isolate	Nodule
674	2957471148	Sinorhizobium meliloti USDA1204	Isolate	Nodule
675	2957478035	Sinorhizobium meliloti USDA1171	Isolate	Nodule
676	2957484790	Sinorhizobium meliloti USDA1464	Isolate	Nodule
677	2957491536	Sinorhizobium meliloti USDA1804	Isolate	Nodule
678	2957498199	Sinorhizobium meliloti USDA1561	Isolate	Nodule
679	2957505466	Sinorhizobium meliloti USDA1696	Isolate	Nodule
680	2958034702	Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1	Isolate	Nodule
681	2958041894	Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1	Isolate	Nodule
682	2958064165	Mesorhizobium sp. SARCC-RB16n	Isolate	Unclassified
683	2958071322	Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1	Isolate	Nodule
684	2958084443	Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1	Isolate	Nodule
685	2958092219	Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1	Isolate	Nodule
686	2958100919	Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1	Isolate	Nodule
687	2958108152	Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1	Isolate	Nodule
688	2958122699	Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1	Isolate	Nodule
689	2958130278	Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1	Isolate	Nodule
690	2958165035	Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1	Isolate	Nodule
691	2958172287	Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1	Isolate	Nodule
692	2958179912	Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1	Isolate	Nodule
693	2960584000	Sinorhizobium meliloti USDA1530	Isolate	Nodule
694	2960591022	Sinorhizobium medicae USDA1066	Isolate	Nodule
695	2960597568	Sinorhizobium meliloti 3085	Isolate	Nodule
696	2960603979	Sinorhizobium meliloti USDA1580	Isolate	Nodule
697	2960610863	Sinorhizobium meliloti USDA1792	Isolate	Nodule
698	2960617483	Sinorhizobium meliloti USDA1719	Isolate	Nodule
699	2960624210	Sinorhizobium meliloti USDA1415	Isolate	Nodule
700	2960631154	Sinorhizobium medicae USDA1629	Isolate	Nodule
701	2960637947	Sinorhizobium meliloti USDA1202	Isolate	Nodule
702	2960645483	Sinorhizobium meliloti USDA1703	Isolate	Nodule
703	2960652885	Sinorhizobium meliloti USDA1199	Isolate	Nodule
704	2960660292	Sinorhizobium meliloti USDA1883	Isolate	Nodule
705	2960667422	Sinorhizobium meliloti USDA1170	Isolate	Nodule
706	2960674078	Sinorhizobium meliloti USDA1666	Isolate	Nodule
707	2960680706	Sinorhizobium medicae USDA1150	Isolate	Nodule
708	2960687367	Sinorhizobium meliloti USDA1462	Isolate	Nodule
709	2960693952	Sinorhizobium medicae USDA1630	Isolate	Nodule
710	2961077736	Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1	Isolate	Nodule
711	2961114664	Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1	Isolate	Nodule
712	2961127735	Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1	Isolate	Nodule
713	2961163497	Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1	Isolate	Nodule
714	2961170736	Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1	Isolate	Nodule
715	2961183825	Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1	Isolate	Nodule
716	2963644680	Mesorhizobium japonicum R7A	Isolate	Nodule
717	2964607997	Sinorhizobium meliloti USDA1212	Isolate	Nodule
718	2964615318	Sinorhizobium meliloti USDA1248	Isolate	Nodule
719	2964621998	Sinorhizobium meliloti USDA1235	Isolate	Nodule
720	2964628898	Sinorhizobium meliloti USDA1191	Isolate	Nodule
721	2964636051	Sinorhizobium meliloti USDA1594	Isolate	Nodule
722	2964643177	Sinorhizobium meliloti USDA1760	Isolate	Nodule
723	2964649959	Sinorhizobium meliloti USDA1591	Isolate	Nodule
724	2964656573	Sinorhizobium meliloti USDA1308	Isolate	Nodule
725	2964663802	Sinorhizobium meliloti USDA1688	Isolate	Nodule
726	2964670856	Sinorhizobium meliloti USDA1211	Isolate	Nodule
727	2964678106	Sinorhizobium meliloti USDA1210	Isolate	Nodule
728	2964685014	Sinorhizobium meliloti USDA1232	Isolate	Nodule
729	2964691889	Sinorhizobium meliloti USDA1379	Isolate	Nodule
730	2964698721	Sinorhizobium meliloti USDA1656	Isolate	Nodule
731	2964705432	Sinorhizobium meliloti USDA1614	Isolate	Nodule
732	2964712639	Sinorhizobium meliloti USDA1616	Isolate	Nodule
733	2964719344	Sinorhizobium meliloti USDA1456	Isolate	Nodule
734	2965018300	Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1	Isolate	Nodule
735	2965025482	Mesorhizobium sp. Primo-A	Isolate	Nodule
736	2965032056	Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1	Isolate	Nodule
737	2965047637	Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1	Isolate	Nodule
738	2965062239	Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1	Isolate	Nodule
739	2965089291	Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1	Isolate	Nodule
740	2965102966	Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1	Isolate	Nodule
741	2965119406	Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1	Isolate	Nodule
742	2967664464	Sinorhizobium meliloti USDA1208	Isolate	Nodule
743	2967671571	Sinorhizobium meliloti USDA1496	Isolate	Nodule
744	2967678726	Sinorhizobium meliloti USDA1467	Isolate	Nodule
745	2967686174	Sinorhizobium medicae USDA1641	Isolate	Nodule
746	2967693043	Sinorhizobium meliloti USDA1183	Isolate	Nodule
747	2967699805	Sinorhizobium meliloti USDA1695	Isolate	Nodule
748	2967706974	Sinorhizobium meliloti USDA1206	Isolate	Nodule
749	2967714385	Sinorhizobium meliloti USDA1023	Isolate	Nodule
750	2967721400	Sinorhizobium meliloti USDA1742	Isolate	Nodule
751	2967728569	Sinorhizobium medicae USDA1607	Isolate	Nodule
752	2967735183	Sinorhizobium meliloti USDA1710	Isolate	Nodule
753	2967742019	Sinorhizobium meliloti USDA1676	Isolate	Nodule
754	2967748971	Sinorhizobium meliloti USDA1024A	Isolate	Nodule
755	2967755722	Sinorhizobium meliloti USDA1302	Isolate	Nodule
756	2967762386	Sinorhizobium meliloti USDA1397	Isolate	Nodule
757	2967769361	Sinorhizobium meliloti USDA1005	Isolate	Nodule
758	2967775926	Sinorhizobium meliloti USDA1678	Isolate	Nodule
759	2967996073	Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1	Isolate	Nodule
760	2968003550	Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1	Isolate	Nodule
761	2968016561	Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1	Isolate	Nodule
762	2968083720	Mesorhizobium erdmanii Opo-242	Isolate	Unclassified
763	2968110612	Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1	Isolate	Nodule
764	2968117919	Mesorhizobium atlanticum CNPSo 3140	Isolate	Unclassified
765	2968128360	Mesorhizobium sp. WSM3873	Isolate	Unclassified
766	2968171901	Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1	Isolate	Nodule
767	2970019648	Sinorhizobium meliloti USDA1603	Isolate	Nodule
768	2970026789	Sinorhizobium medicae USDA1611	Isolate	Nodule
769	2970033650	Sinorhizobium meliloti USDA1565	Isolate	Nodule
770	2970040964	Sinorhizobium meliloti USDA1501	Isolate	Nodule
771	2970047711	Sinorhizobium meliloti USDA1793	Isolate	Nodule
772	2970054988	Sinorhizobium meliloti USDA1031	Isolate	Nodule
773	2970061556	Sinorhizobium meliloti USDA1810	Isolate	Nodule
774	2970068827	Sinorhizobium meliloti USDA1227	Isolate	Nodule
775	2970076120	Sinorhizobium meliloti USDA1706	Isolate	Nodule
776	2970082768	Sinorhizobium meliloti USDA1803	Isolate	Nodule
777	2970088815	Sinorhizobium meliloti USDA1819	Isolate	Nodule
778	2970095765	Sinorhizobium meliloti USDA1225	Isolate	Nodule
779	2970102677	Sinorhizobium meliloti USDA1325	Isolate	Nodule
780	2970109326	Sinorhizobium meliloti USDA1186	Isolate	Nodule
781	2970116247	Sinorhizobium meliloti USDA1566	Isolate	Nodule
782	2970122695	Sinorhizobium medicae 3082	Isolate	Nodule
783	2970129317	Sinorhizobium meliloti USDA1008	Isolate	Nodule
784	2970136068	Sinorhizobium meliloti USDA1699	Isolate	Nodule
785	2970143518	Sinorhizobium medicae USDA1652	Isolate	Nodule
786	2970149975	Sinorhizobium meliloti USDA1215	Isolate	Nodule
787	2970156795	Sinorhizobium meliloti USDA1491	Isolate	Nodule
788	2970164137	Sinorhizobium meliloti USDA1018	Isolate	Nodule
789	2970170962	Sinorhizobium meliloti USDA1571	Isolate	Nodule
790	2970177841	Sinorhizobium meliloti USDA1533	Isolate	Nodule
791	2970184632	Sinorhizobium meliloti USDA1593	Isolate	Nodule
792	2970191845	Sinorhizobium meliloti USDA1187	Isolate	Nodule
793	2970469710	Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1	Isolate	Nodule
794	2970489779	Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1	Isolate	Nodule
795	2970503327	Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1	Isolate	Nodule
796	2970510686	Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0	Isolate	Nodule
797	2970524798	Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1	Isolate	Nodule
798	2970532167	Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1	Isolate	Nodule
799	2970540015	Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1	Isolate	Nodule
800	2970547951	Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1	Isolate	Nodule
801	2970554993	Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1	Isolate	Nodule
802	2970593180	Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1	Isolate	Nodule
803	2970627176	Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1	Isolate	Nodule
804	2977516862	Sinorhizobium meliloti USDA1791	Isolate	Nodule
805	2977523885	Sinorhizobium meliloti USDA1777	Isolate	Nodule
806	2977530762	Sinorhizobium medicae USDA1606	Isolate	Nodule
807	2977537788	Sinorhizobium meliloti USDA1184	Isolate	Nodule
808	2977544691	Sinorhizobium medicae USDA1631	Isolate	Nodule
809	2977551784	Sinorhizobium meliloti USDA1035	Isolate	Nodule
810	2977558990	Sinorhizobium meliloti USDA1222	Isolate	Nodule
811	2977565890	Sinorhizobium meliloti USDA1617	Isolate	Nodule
812	2977572785	Sinorhizobium meliloti USDA1767	Isolate	Nodule
813	2977579622	Sinorhizobium meliloti USDA1161	Isolate	Nodule
814	2977821940	Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1	Isolate	Nodule
815	2977828996	Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1	Isolate	Nodule
816	2977843712	Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1	Isolate	Nodule
817	2977851361	Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1	Isolate	Nodule
818	2977864932	Mesorhizobium tamadayense DSM 28320	Isolate	Nodule
819	2977872689	Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1	Isolate	Nodule
820	2977907340	Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1	Isolate	Nodule
821	2977922695	Mesorhizobium sp. WSM4305	Isolate	Unclassified
822	2977935797	Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1	Isolate	Nodule
823	2977942078	Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1	Isolate	Nodule
824	2977950692	Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1	Isolate	Nodule
825	2977957713	Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1	Isolate	Nodule
826	2977971508	Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1	Isolate	Nodule
827	2977986579	Mesorhizobium intechi BD68	Isolate	Unclassified
828	2978969890	Agrobacterium sp. SORGH_AS 787	Isolate	Unclassified
829	2979089926	Agrobacterium sp. SORGH_AS 745	Isolate	Unclassified
830	2979095461	Agrobacterium tumefaciens SORGH_AS 749	Isolate	Unclassified
831	2979100975	Agrobacterium pusense SORGH_AS 755	Isolate	Unclassified
832	2979710463	Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1	Isolate	Nodule
833	2979742915	Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1	Isolate	Nodule
834	2979764755	Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1	Isolate	Nodule
835	2979772303	Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1	Isolate	Nodule
836	2979793036	Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1	Isolate	Nodule
837	2979808191	Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1	Isolate	Nodule
838	2984509177	Agrobacterium pusense SORGH_AS260	Isolate	Aerial Root
839	2984518228	Agrobacterium pusense SORGH_AS285	Isolate	Aerial Root
840	2984537506	Agrobacterium sp. SORGH_AS440	Isolate	Aerial Root
841	2984601300	Rhizobium pusense SORGH_AS1083	Isolate	Aerial Root
842	2987636660	Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1	Isolate	Nodule
843	2987645492	Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1	Isolate	Nodule
844	2987652177	Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1	Isolate	Nodule
845	2987659509	Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1	Isolate	Nodule
846	2987666974	Mesorhizobium sp. WSM4306	Isolate	Unclassified
847	2987673487	Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1	Isolate	Nodule
848	2989349275	Shinella kummerowiae CCBAU 25048	Isolate	Unclassified
849	2989771324	Rhizobium rhizolycopersici DBTS2	Isolate	Rhizosphere
850	2989776772	Rhizobium glycinendophyticum CL12	Isolate	Unclassified
851	2990710928	Acidovorax delafieldii SLBN-75	Isolate	Rhizosphere
852	2996310559	Mesorhizobium zhangyense CGMCC 1.15528	Isolate	Unclassified
853	2996336353	Mesorhizobium sp. YM1C-6-2	Isolate	Unclassified
854	2996348954	Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1	Isolate	Nodule
855	2996386984	Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0	Isolate	Nodule
856	2996887358	Rhizobium sp. R711	Isolate	Nodule
857	2996893221	Rhizobium sp. R635	Isolate	Nodule
858	3000135777	Unclassified bacterium M00.F.Ca.ET.205.01.1.1	Isolate	Unclassified
859	3002141150	Phyllobacterium sp. 628	Isolate	Unclassified
860	3003665799	Methylobacterium aquaticum BG2	Isolate	Unclassified
861	3003930520	Sinorhizobium sp. BG8	Isolate	Unclassified
862	3004167301	Mesorhizobium loti 582	Isolate	Unclassified
863	3004188549	Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1	Isolate	Nodule
864	3004203850	Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1	Isolate	Nodule
865	3004211236	Mesorhizobium sp. WSM4307	Isolate	Unclassified
866	3004218560	Mesorhizobium sp. WSM4315	Isolate	Unclassified
867	3004232784	Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1	Isolate	Nodule
868	3004268573	Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1	Isolate	Nodule
869	3004275668	Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1	Isolate	Nodule
870	3004289098	Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1	Isolate	Nodule
871	3004334049	Mesorhizobium huakuii 583	Isolate	Unclassified
872	3005409236	Rhizobium sp. P32RR-XVIII	Isolate	Rhizosphere
873	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
874	3005445848	Rhizobium sp. WYJ-E13	Isolate	Unclassified
875	3005452660	Rhizobium grahamii BG7	Isolate	Unclassified
876	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
877	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
878	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
879	3005718088	Bradyrhizobium sp. CCBAU 53338	Isolate	Nodule
880	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
881	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
882	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
883	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
884	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
885	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
886	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
887	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
888	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
889	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
890	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
891	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
892	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
893	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
894	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
895	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
896	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
897	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
898	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
899	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
900	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
901	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
902	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
903	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
904	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
905	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
906	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
907	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
908	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
909	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
910	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
911	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
912	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
913	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
914	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
915	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
916	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
917	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
918	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
919	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
920	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
921	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
922	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
923	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
924	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
925	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
926	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
927	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
928	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
929	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
930	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
931	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
932	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
933	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
934	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
935	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
936	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
937	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
938	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
939	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
940	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
941	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
942	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
943	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
944	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
945	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
946	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
947	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
948	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
949	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
950	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
951	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
952	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
953	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
954	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
955	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
956	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
957	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
958	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
959	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
960	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
961	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
962	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
963	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
964	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
965	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
966	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
967	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
968	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
969	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
970	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
971	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
972	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
973	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
974	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
975	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
976	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
977	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
978	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
979	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
980	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
981	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
982	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
983	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
984	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
985	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
986	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
987	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
988	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
989	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
990	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
991	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
992	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
993	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
994	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
995	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
996	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
997	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
998	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
999	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
1000	3300009765	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule	Metagenome	Nodule
1001	3300009766	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule	Metagenome	Nodule
1002	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
1003	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
1004	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
1005	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
1006	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
1007	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
1008	3300013249	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06	Metagenome	Rhizosphere
1009	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
1010	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
1011	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
1012	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
1013	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
1014	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
1015	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
1016	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
1017	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
1018	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
1019	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
1020	3300015690	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05	Metagenome	Rhizosphere
1021	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
1022	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
1023	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
1024	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
1025	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
1026	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
1027	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
1028	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
1029	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
1030	3300022739	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules	Metagenome	Nodule
1031	3300022740	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules	Metagenome	Nodule
1032	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
1033	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
1034	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
1035	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
1036	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
1037	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
1038	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
1039	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
1040	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
1041	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
1042	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
1043	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
1044	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
1045	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
1046	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
1047	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
1048	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
1049	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
1050	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
1051	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
1052	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
1053	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
1054	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
1055	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
1056	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
1057	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
1058	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1059	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1060	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
1061	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
1062	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1063	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1064	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1065	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
1066	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1067	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1068	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1069	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1070	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1071	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1072	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1073	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1074	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1075	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1076	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1077	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1078	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1079	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1080	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1081	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1082	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1083	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1084	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
1085	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1086	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1087	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1088	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
1089	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1090	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
1091	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1092	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
1093	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
1094	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
1095	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
1096	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1097	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1098	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
1099	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
1100	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
1101	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
1102	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
1103	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1104	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
1105	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
1106	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
1107	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
1108	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
1109	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
1110	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
1111	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
1112	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
1113	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
1114	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
1115	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
1116	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
1117	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
1118	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
1119	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
1120	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
1121	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
1122	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
1123	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
1124	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
1125	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
1126	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
1127	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
1128	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
1129	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
1130	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
1131	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
1132	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
1133	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
1134	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
1135	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
1136	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
1137	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
1138	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
1139	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
1140	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
1141	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
1142	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
1143	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
1144	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
1145	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
1146	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
1147	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
1148	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
1149	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
1150	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
1151	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
1152	3300031967	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules	Metagenome	Nodule
1153	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
1154	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
1155	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
1156	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
1157	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
1158	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
1159	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
1160	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
1161	3300033430	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules	Metagenome	Nodule
1162	3300033464	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules	Metagenome	Nodule
1163	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
1164	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
1165	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
1166	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
1167	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
1168	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
1169	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
1170	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
1171	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
1172	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
1173	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
1174	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
1175	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
1176	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
1177	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
1178	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
1179	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
1180	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
1181	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
1182	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
1183	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
1184	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
1185	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
1186	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
1187	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
1188	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
1189	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
1190	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
1191	3300038735	Seagrass microbial communities from Seahorse Key, FL, USA - SH0319	Metagenome	Unclassified
1192	3300038742	Seagrass microbial communities from Seahorse Key, FL, USA - SH0818	Metagenome	Unclassified
1193	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
1194	3300039110	Seagrass microbial communities from Seahorse Key, FL, USA - SV0319	Metagenome	Unclassified
1195	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
1196	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
1197	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
1198	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
1199	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
1200	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
1201	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
1202	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
1203	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
1204	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
1205	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
1206	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
1207	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
1208	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
1209	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
1210	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
1211	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
1212	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
1213	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
1214	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
1215	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
1216	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
1217	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
1218	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
1219	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
1220	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
1221	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
1222	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
1223	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
1224	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
1225	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
1226	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
1227	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
1228	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
1229	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
1230	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
1231	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
1232	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
1233	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
1234	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
1235	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
1236	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
1237	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
1238	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
1239	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
1240	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
1241	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
1242	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
1243	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
1244	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
1245	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
1246	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
1247	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
1248	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
1249	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
1250	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
1251	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
1252	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
1253	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
1254	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
1255	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
1256	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
1257	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
1258	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
1259	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
1260	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
1261	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
1262	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
1263	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
1264	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
1265	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
1266	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
1267	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
1268	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
1269	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
1270	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
1271	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
1272	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
1273	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
1274	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
1275	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
1276	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
1277	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
1278	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
1279	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
1280	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
1281	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
1282	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
1283	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
1284	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
1285	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
1286	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
1287	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
1288	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
1289	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
1290	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
1291	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
1292	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
1293	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
1294	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
1295	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
1296	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
1297	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
1298	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
1299	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
1300	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
1301	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
1302	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
1303	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
1304	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
1305	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
1306	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
1307	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
1308	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
1309	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
1310	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
1311	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
1312	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
1313	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
1314	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
1315	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
1316	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
1317	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
1318	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
1319	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
1320	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
1321	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
1322	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
1323	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
1324	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
1325	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
1326	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
1327	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
1328	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
1329	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
1330	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
1331	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
1332	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
1333	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
1334	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
1335	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
1336	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
1337	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
1338	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
1339	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
1340	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
1341	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
1342	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
1343	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
1344	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
1345	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
1346	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
1347	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
1348	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
1349	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
1350	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
1351	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
1352	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
1353	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
1354	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
1355	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
1356	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
1357	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
1358	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
1359	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
1360	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
1361	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
1362	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
1363	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
1364	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
1365	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
1366	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
1367	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
1368	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
1369	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
1370	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
1371	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
1372	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
1373	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
1374	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
1375	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
1376	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
1377	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
1378	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
1379	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
1380	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
1381	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
1382	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
1383	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
1384	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
1385	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
1386	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
1387	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
1388	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
1389	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
1390	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
1391	3300053089	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere	Metagenome	Endosphere
1392	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
1393	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
1394	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
1395	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
1396	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
1397	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
1398	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
1399	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
1400	3300053107	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere	Metagenome	Endosphere
1401	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
1402	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
1403	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
1404	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
1405	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
1406	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
1407	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
1408	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
1409	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
1410	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
1411	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
1412	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
1413	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
1414	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
1415	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
1416	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
1417	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
1418	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
1419	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
1420	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
1421	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
1422	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
1423	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
1424	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
1425	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
1426	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
1427	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
1428	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
1429	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
1430	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
1431	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
1432	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
1433	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
1434	637000159	Mesorhizobium japonicum MAFF 303099	Isolate	Unclassified
1435	639633055	Rhizobium leguminosarum bv. viciae 3841	Isolate	Unclassified
1436	641522639	Methylobacterium sp. 4-46	Isolate	Nodule
1437	643348564	Methylobacterium nodulans ORS 2060	Isolate	Nodule
1438	643692032	Sinorhizobium fredii NGR234	Isolate	Nodule
1439	648276728	Sinorhizobium meliloti BL225C	Isolate	Nodule
1440	649633066	Mesorhizobium ciceri bv. biserrulae WSM1271	Isolate	Nodule
1441	650716007	Agrobacterium fabacearum H13-3	Isolate	Rhizosphere
1442	8001845381	Ancylobacter sonchi VKM B-3145	Isolate	Unclassified
1443	8002285264	Aminobacter anthyllidis LMG 26462	Isolate	Nodule
1444	8002745576	Marinomonas spartinae USM8	Isolate	Rhizosphere
1445	8003570095	Agrobacterium rhizogenes GBBC3284	Isolate	Unclassified
1446	8003992118	Sinorhizobium meliloti RRI128	Isolate	Nodule
1447	8003999396	Sinorhizobium medicae WSM1115	Isolate	Nodule
1448	8004300914	Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1	Isolate	Nodule
1449	8004312739	Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0	Isolate	Nodule
1450	8004361976	Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1	Isolate	Nodule
1451	8004374579	Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1	Isolate	Nodule
1452	8004387939	Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1	Isolate	Nodule
1453	8004395343	Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1	Isolate	Nodule
1454	8004633249	Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1	Isolate	Nodule
1455	8004640170	Mesorhizobium sp. GbtcB19	Isolate	Unclassified
1456	8004714634	Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1	Isolate	Nodule
1457	8004727605	Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1	Isolate	Nodule
1458	8005246636	Rhizobium wuzhouense W44	Isolate	Rhizosphere
1459	8005258706	Rhizobium sp. R693	Isolate	Nodule
1460	8005275841	Rhizobium sp. N4311	Isolate	Nodule
1461	8005282627	Rhizobium phaseoli NC1	Isolate	Nodule
1462	8005289223	Rhizobium bangladeshense 1002	Isolate	Nodule
1463	8005301065	Rhizobium bangladeshense 1017	Isolate	Nodule
1464	8005307578	Rhizobium leguminosarum bv. phaseoli LCS0306	Isolate	Unclassified
1465	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
1466	8005321885	Rhizobium sp. R72	Isolate	Nodule
1467	8005376324	Rhizobium changzhiense WYCCWR 11279	Isolate	Nodule
1468	8005382845	Rhizobium sp. R634	Isolate	Nodule
1469	8005395548	Rhizobium sp. R339	Isolate	Nodule
1470	8005430974	Rhizobium phaseoli Y20	Isolate	Nodule
1471	8005460587	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
1472	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
1473	8005497431	Rhizobium phaseoli CCGM8	Isolate	Unclassified
1474	8005542996	Rhizobium grahamii CCGM3	Isolate	Unclassified
1475	8005556819	Rhizobium sp. WYCCWR 11128	Isolate	Nodule
1476	8005563573	Rhizobium sp. WYCCWR 11152	Isolate	Nodule
1477	8005570704	Rhizobium anhuiense bv. trifolii WYCCWR10015	Isolate	Nodule
1478	8005619151	Rhizobium phaseoli CCGM2	Isolate	Unclassified
1479	8005626139	Rhizobium phaseoli Y18	Isolate	Nodule
1480	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
1481	8005658619	Rhizobium terrae CC-HIH110	Isolate	Unclassified
1482	8005668836	Rhizobium phaseoli CCGM9	Isolate	Unclassified
1483	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
1484	8005688590	Rhizobium bangladeshense 1024	Isolate	Nodule
1485	8005695170	Rhizobium sp. RMa-01	Isolate	Unclassified
1486	8006926726	Bradyrhizobium guangdongense SM32	Isolate	Unclassified
1487	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
1488	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
1489	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
1490	8016583857	Bradyrhizobium sp. LM2.7	Isolate	Nodule
1491	8018127388	Rhizobium aegyptiacum 950	Isolate	Nodule
1492	8018150411	Rhizobium straminoryzae SM12	Isolate	Rhizosphere
1493	8018163183	Rhizobium sp. WYCCWR 11146	Isolate	Nodule
1494	8018176218	Rhizobium sp. N122	Isolate	Nodule
1495	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
1496	8023680758	Rhizobium leguminosarum SARCC-132	Isolate	Nodule
1497	8024479707	Rhizobium leguminosarum Tri-43	Isolate	Nodule
1498	8024486573	Rhizobium tubonense CCBAU 85046	Isolate	Nodule
1499	8024501048	Rhizobium sp. H4	Isolate	Nodule
1500	8046767195	Rhizobium calliandrae CCGE524	Isolate	Unclassified
1501	8049293176	Ensifer alkalisoli YIC4027	Isolate	Nodule
1502	8054460903	Agrobacterium vaccinii B7.6	Isolate	Unclassified
1503	8054558443	Rhizobium alarense TRM95111	Isolate	Nodule
1504	8055431914	Allorhizobium sonneratiae BGMRC 0089	Isolate	Unclassified
1505	8055617313	Mesorhizobium onobrychidis OM4	Isolate	Nodule
1506	8056375014	Rhizobium redzepovicii 18T	Isolate	Nodule
1507	8056382006	Rhizobium croatiense 13T	Isolate	Nodule
1508	8056681323	Bradyrhizobium cenepequi CNPSo 4026	Isolate	Nodule
1509	8056875544	Rhizobium halophilum TRM95001	Isolate	Rhizosphere
1510	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule
1511	8057575449	Rhizobium mayense CCGE526	Isolate	Nodule
1512	8057874678	Rhizobium acaciae 1AS12	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	61.57
Metatranscriptomes	0.08
Isolates	38.35

Biome Distribution

Category	Percentage (%)
Aerial Root	0.16
Bulb	0
Endosphere	15.04
Nodule	27.8
Rhizoplane	2.63
Rhizosphere	37.69
Stem	0
Stem Tuber	0
Unclassified	16.67

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10000714	3300001979	Bacteria	14412
2	JGI24740J21852_10015548	3300001979	Bacteria	2775
3	JGI25155J39150_1000075	3300002704	Bacteria	62215
4	JGI25156J39149_1000103	3300002705	Bacteria	62289
5	JGI25162J39368_1001664	3300002737	Bacteria	10969
6	JGI25154J39366_1000018	3300002738	Bacteria	251612
7	JGI25158J39367_1000444	3300002739	Bacteria	8576
8	JGI25158J39367_1000860	3300002739	Bacteria	5791
9	JGI25157J39369_1000074	3300002741	Bacteria	88240
10	JGI25157J39369_1001580	3300002741	Bacteria	8032
11	JGI25152J39213_1001744	3300002773	Bacteria	8895
12	JGI25152J39213_1004252	3300002773	Bacteria	4578
13	JGI25152J39213_1005493	3300002773	Bacteria	3675
14	JGI25152J39213_1008225	3300002773	Bacteria	2607
15	JGI25150J39212_1000403	3300002774	Bacteria	20227
16	JGI25150J39212_1001783	3300002774	Bacteria	5731
17	JGI25159J45721_1002297	3300002987	Bacteria	7360
18	JGI25159J45721_1003043	3300002987	Bacteria	6069
19	JGI25151J46595_10000359	3300003187	Bacteria	48264
20	JGI25151J46595_10000369	3300003187	Bacteria	47210
21	JGI25151J46595_10001468	3300003187	Bacteria	15938
22	JGI25151J46595_10002371	3300003187	Bacteria	11429
23	JGI25151J46595_10002402	3300003187	Bacteria	11322
24	JGI25151J46595_10004694	3300003187	Bacteria	7183
25	JGI25151J46595_10018684	3300003187	Bacteria	2967
26	JGI25151J46595_10057965	3300003187	Bacteria	1258
27	JGI25406J46586_10001163	3300003203	Bacteria	12382
28	JGI25406J46586_10007755	3300003203	Bacteria	4883
29	JGI25165J46597_1000034	3300003214	Bacteria	292458
30	JGI25165J46597_1000431	3300003214	Bacteria	42779
31	JGI25165J46597_1000533	3300003214	Bacteria	35421
32	JGI25165J46597_1005326	3300003214	Bacteria	2507
33	JGI25165J46597_1011581	3300003214	Bacteria	1257
34	JGI25153J46596_10001090	3300003215	Bacteria	16506
35	JGI25153J46596_10001143	3300003215	Bacteria	16067
36	JGI25153J46596_10010548	3300003215	Bacteria	4170
37	JGI25153J46596_10011153	3300003215	Bacteria	3995
38	JGI25153J46596_10011180	3300003215	Bacteria	3989
39	JGI25153J46596_10032632	3300003215	Bacteria	1733
40	JGI25153J46596_10057916	3300003215	Bacteria	1069
41	JGI25160J50197_1000044	3300003354	Bacteria	145379
42	JGI25160J50197_1000419	3300003354	Bacteria	26931
43	JGI25160J50197_1004671	3300003354	Bacteria	5876
44	JGI25160J50197_1012233	3300003354	Bacteria	2993
45	JGI25160J50197_1012556	3300003354	Bacteria	2934
46	JGI25161J50226_1000028	3300003374	Bacteria	145379
47	JGI25161J50226_1000078	3300003374	Bacteria	83416
48	JGI25161J50226_1000220	3300003374	Bacteria	35319
49	JGI25161J50226_1001317	3300003374	Bacteria	7784
50	Ga0006562J51391_1104273	3300003578	Bacteria	1280
51	Ga0006562J51391_1104274	3300003578	Bacteria	3040
52	JGI25404J52841_10032380	3300003659	Bacteria	1115
53	Ga0055542_1007075	3300003762	Bacteria	2324
54	Ga0055526_1002069	3300003771	Bacteria	13782
55	Ga0055526_1011751	3300003771	Bacteria	3899
56	Ga0055526_1014578	3300003771	Bacteria	3222
57	Ga0055526_1015633	3300003771	Bacteria	3035
58	Ga0055526_1026448	3300003771	Bacteria	1828
59	Ga0055526_1032633	3300003771	Bacteria	1464
60	Ga0055524_1003742	3300003775	Bacteria	7263
61	Ga0055524_1005816	3300003775	Bacteria	5446
62	Ga0055524_1009459	3300003775	Bacteria	3959
63	Ga0055524_1010135	3300003775	Bacteria	3773
64	Ga0055524_1010584	3300003775	Bacteria	3662
65	Ga0055524_1022051	3300003775	Bacteria	2091
66	Ga0055536_1014259	3300003781	Bacteria	2806
67	Ga0055536_1022098	3300003781	Bacteria	1908
68	Ga0055528_1000113	3300003790	Bacteria	65323
69	Ga0055528_1000734	3300003790	Bacteria	22897
70	Ga0055528_1004792	3300003790	Bacteria	6440
71	Ga0055528_1004934	3300003790	Bacteria	6304
72	Ga0055528_1008122	3300003790	Bacteria	4545
73	Ga0055530_10014753	3300003791	Bacteria	2584
74	Ga0055540_1000305	3300003792	Bacteria	43619
75	Ga0055540_1000495	3300003792	Bacteria	30041
76	Ga0055540_1004656	3300003792	Bacteria	6085
77	Ga0055540_1005461	3300003792	Bacteria	5335
78	Ga0055531_10000281	3300003794	Bacteria	51971
79	Ga0055531_10003992	3300003794	Bacteria	9151
80	Ga0055531_10012777	3300003794	Bacteria	3918
81	Ga0055531_10019620	3300003794	Bacteria	2722
82	Ga0058692_1011904	3300003856	Bacteria	2083
83	Ga0055543_1000054	3300004625	Bacteria	104176
84	Ga0055543_1000069	3300004625	Bacteria	94040
85	Ga0055543_1000921	3300004625	Bacteria	13706
86	Ga0055543_1001068	3300004625	Bacteria	12069
87	Ga0065165_1000002	3300005262	Bacteria	444192
88	Ga0065165_1000318	3300005262	Bacteria	78352
89	Ga0065165_1006145	3300005262	Bacteria	6420
90	Ga0065165_1006328	3300005262	Bacteria	6254
91	Ga0065165_1018137	3300005262	Bacteria	2561
92	Ga0065704_10125547	3300005289	Bacteria	1701
93	Ga0070658_10182399	3300005327	Bacteria	1766
94	Ga0070676_10070205	3300005328	Bacteria	2100
95	Ga0070683_100070049	3300005329	Bacteria	3271
96	Ga0070670_100000200	3300005331	Bacteria	55525
97	Ga0068869_100231468	3300005334	Bacteria	1468
98	Ga0070680_100046852	3300005336	Bacteria	3518
99	Ga0070680_100172792	3300005336	Bacteria	1819
100	Ga0068868_100387470	3300005338	Bacteria	1203
101	Ga0070660_100391876	3300005339	Bacteria	1147
102	Ga0070692_10062320	3300005345	Bacteria	1968
103	Ga0070668_100093299	3300005347	Bacteria	2375
104	Ga0070669_100463173	3300005353	Bacteria	1046
105	Ga0070671_100017305	3300005355	Bacteria	5837
106	Ga0070674_100130097	3300005356	Bacteria	1875
107	Ga0070674_100206748	3300005356	Bacteria	1519
108	Ga0070667_100303963	3300005367	Bacteria	1437
109	Ga0070709_10000484	3300005434	Bacteria	23482
110	Ga0070709_10083139	3300005434	Bacteria	2093
111	Ga0070714_100040671	3300005435	Bacteria	3919
112	Ga0070714_100051804	3300005435	Bacteria	3500
113	Ga0070713_100144784	3300005436	Bacteria	2108
114	Ga0070713_100207698	3300005436	Bacteria	1771
115	Ga0070713_100282618	3300005436	Bacteria	1523
116	Ga0070710_10025475	3300005437	Bacteria	3133
117	Ga0070710_10371338	3300005437	Bacteria	952
118	Ga0070711_100010198	3300005439	Bacteria	5808
119	Ga0070700_100191035	3300005441	Bacteria	1432
120	Ga0070700_100414817	3300005441	Bacteria	1016
121	Ga0070708_100011012	3300005445	Bacteria	7346
122	Ga0070663_100156237	3300005455	Bacteria	1753
123	Ga0070678_100167262	3300005456	Bacteria	1787
124	Ga0070678_100466625	3300005456	Bacteria	1108
125	Ga0070678_100535597	3300005456	Bacteria	1038
126	Ga0070681_10066058	3300005458	Bacteria	3586
127	Ga0070706_100107476	3300005467	Bacteria	2596
128	Ga0070706_100746756	3300005467	Bacteria	907
129	Ga0070707_100133288	3300005468	Bacteria	2416
130	Ga0070707_100344816	3300005468	Bacteria	1447
131	Ga0070707_100784964	3300005468	Bacteria	916
132	Ga0070698_100128567	3300005471	Bacteria	2489
133	Ga0070698_100510145	3300005471	Bacteria	1141
134	Ga0070699_100016359	3300005518	Bacteria	6370
135	Ga0070699_100161043	3300005518	Bacteria	1986
136	Ga0070679_100015435	3300005530	Bacteria	7342
137	Ga0070679_100079942	3300005530	Bacteria	3259
138	Ga0070684_100006610	3300005535	Bacteria	8982
139	Ga0070697_100179801	3300005536	Bacteria	1793
140	Ga0068853_100144679	3300005539	Bacteria	2136
141	Ga0068853_100343390	3300005539	Bacteria	1387
142	Ga0068853_100433862	3300005539	Bacteria	1234
143	Ga0070672_100263577	3300005543	Bacteria	1454
144	Ga0070696_100089256	3300005546	Bacteria	2192
145	Ga0070665_100019862	3300005548	Bacteria	6747
146	Ga0070665_100026486	3300005548	Bacteria	5838
147	Ga0070665_100051436	3300005548	Bacteria	4132
148	Ga0070665_100122328	3300005548	Bacteria	2604
149	Ga0070665_100261582	3300005548	Bacteria	1731
150	Ga0070665_100381117	3300005548	Bacteria	1417
151	Ga0070665_100396515	3300005548	Bacteria	1388
152	Ga0070665_100476049	3300005548	Bacteria	1259
153	Ga0070704_100254097	3300005549	Bacteria	1445
154	Ga0068855_100035950	3300005563	Bacteria	5898
155	Ga0068855_100048524	3300005563	Bacteria	5010
156	Ga0068855_100288503	3300005563	Bacteria	1820
157	Ga0068857_100090103	3300005577	Bacteria	2745
158	Ga0068857_100258785	3300005577	Bacteria	1597
159	Ga0068854_100322424	3300005578	Bacteria	1256
160	Ga0068854_100513871	3300005578	Bacteria	1010
161	Ga0068856_100121036	3300005614	Bacteria	2618
162	Ga0068856_100383590	3300005614	Bacteria	1425
163	Ga0068852_100005223	3300005616	Bacteria	9260
164	Ga0068852_100349959	3300005616	Bacteria	1442
165	Ga0068852_100664760	3300005616	Bacteria	1050
166	Ga0068866_10043328	3300005718	Bacteria	2245
167	Ga0068861_100046188	3300005719	Bacteria	3282
168	Ga0068863_100270561	3300005841	Bacteria	1645
169	Ga0068860_100124202	3300005843	Bacteria	2474
170	Ga0068860_100195863	3300005843	Bacteria	1957
171	Ga0068860_100275397	3300005843	Bacteria	1643
172	Ga0068862_100180632	3300005844	Bacteria	1893
173	Ga0068862_100289556	3300005844	Bacteria	1504
174	Ga0068862_100380466	3300005844	Bacteria	1316
175	Ga0068862_100509329	3300005844	Bacteria	1144
176	Ga0068862_100543480	3300005844	Bacteria	1108
177	Ga0081455_10000015	3300005937	Bacteria	189655
178	Ga0081455_10000041	3300005937	Bacteria	134032
179	Ga0081455_10014229	3300005937	Bacteria	7808
180	Ga0081455_10015792	3300005937	Bacteria	7315
181	Ga0081455_10055358	3300005937	Bacteria	3374
182	Ga0081455_10080287	3300005937	Bacteria	2675
183	Ga0081538_10068108	3300005981	Bacteria	1981
184	Ga0081540_1000090	3300005983	Bacteria	95488
185	Ga0081540_1002060	3300005983	Bacteria	16774
186	Ga0081540_1006026	3300005983	Bacteria	8920
187	Ga0081540_1006827	3300005983	Bacteria	8241
188	Ga0081540_1012569	3300005983	Bacteria	5562
189	Ga0081540_1013103	3300005983	Bacteria	5414
190	Ga0081540_1013684	3300005983	Bacteria	5259
191	Ga0081540_1014281	3300005983	Bacteria	5099
192	Ga0081540_1067986	3300005983	Bacteria	1662
193	Ga0081540_1123962	3300005983	Bacteria	1067
194	Ga0081539_10000283	3300005985	Bacteria	114603
195	Ga0081539_10004610	3300005985	Bacteria	15022
196	Ga0070717_10008262	3300006028	Bacteria	7770
197	Ga0070717_10079957	3300006028	Bacteria	2742
198	Ga0070717_10164089	3300006028	Bacteria	1929
199	Ga0070717_10239364	3300006028	Bacteria	1600
200	Ga0075365_10004362	3300006038	Bacteria	7479
201	Ga0075365_10010183	3300006038	Bacteria	5461
202	Ga0075365_10014622	3300006038	Bacteria	4727
203	Ga0075365_10015935	3300006038	Bacteria	4557
204	Ga0075365_10046670	3300006038	Bacteria	2846
205	Ga0075365_10123243	3300006038	Bacteria	1790
206	Ga0075365_10127504	3300006038	Bacteria	1759
207	Ga0075365_10132197	3300006038	Bacteria	1728
208	Ga0075365_10511732	3300006038	Bacteria	849
209	Ga0075368_10000657	3300006042	Bacteria	10513
210	Ga0075368_10000851	3300006042	Bacteria	9437
211	Ga0075368_10020587	3300006042	Bacteria	2500
212	Ga0075368_10040103	3300006042	Bacteria	1838
213	Ga0075363_100017741	3300006048	Bacteria	3534
214	Ga0075363_100362591	3300006048	Bacteria	848
215	Ga0075364_10022150	3300006051	Bacteria	4010
216	Ga0075364_10073061	3300006051	Bacteria	2261
217	Ga0075364_10074084	3300006051	Bacteria	2245
218	Ga0075364_10189053	3300006051	Bacteria	1394
219	Ga0075432_10005521	3300006058	Bacteria	4307
220	Ga0070715_10000498	3300006163	Bacteria	10238
221	Ga0070716_100008371	3300006173	Bacteria	5131
222	Ga0070716_100035949	3300006173	Bacteria	2727
223	Ga0070716_100469806	3300006173	Bacteria	921
224	Ga0070712_100016346	3300006175	Bacteria	4793
225	Ga0070712_100517279	3300006175	Bacteria	1002
226	Ga0075362_10010147	3300006177	Bacteria	3669
227	Ga0075362_10031551	3300006177	Bacteria	2294
228	Ga0075362_10034157	3300006177	Bacteria	2216
229	Ga0075362_10076678	3300006177	Bacteria	1535
230	Ga0075362_10089947	3300006177	Bacteria	1424
231	Ga0075362_10246206	3300006177	Bacteria	878
232	Ga0075367_10139928	3300006178	Bacteria	1499
233	Ga0075366_10003007	3300006195	Bacteria	8795
234	Ga0075366_10126967	3300006195	Bacteria	1538
235	Ga0075366_10160167	3300006195	Bacteria	1364
236	Ga0075370_10036446	3300006353	Bacteria	2763
237	Ga0075370_10064414	3300006353	Bacteria	2090
238	Ga0075370_10065139	3300006353	Bacteria	2078
239	Ga0075370_10106212	3300006353	Bacteria	1628
240	Ga0075370_10135145	3300006353	Bacteria	1440
241	Ga0075370_10161197	3300006353	Bacteria	1316
242	Ga0075370_10213960	3300006353	Bacteria	1138
243	Ga0068871_100161608	3300006358	Bacteria	1916
244	Ga0068871_100338322	3300006358	Bacteria	1329
245	Ga0075428_100037665	3300006844	Bacteria	5322
246	Ga0075428_100094240	3300006844	Bacteria	3264
247	Ga0075428_100141013	3300006844	Bacteria	2621
248	Ga0075428_100518749	3300006844	Bacteria	1275
249	Ga0075428_100757707	3300006844	Bacteria	1033
250	Ga0075430_100001336	3300006846	Bacteria	19919
251	Ga0075430_100298415	3300006846	Bacteria	1333
252	Ga0075431_100001111	3300006847	Bacteria	24100
253	Ga0075431_100014552	3300006847	Bacteria	7960
254	Ga0075431_100272790	3300006847	Bacteria	1714
255	Ga0075431_100334092	3300006847	Bacteria	1526
256	Ga0075433_10236616	3300006852	Bacteria	1621
257	Ga0075434_100013036	3300006871	Bacteria	7893
258	Ga0075434_100038869	3300006871	Bacteria	4715
259	Ga0075434_100048865	3300006871	Bacteria	4199
260	Ga0075434_100144026	3300006871	Bacteria	2403
261	Ga0075434_100163232	3300006871	Bacteria	2247
262	Ga0075434_100326257	3300006871	Bacteria	1556
263	Ga0075429_100012911	3300006880	Bacteria	7247
264	Ga0075429_100026632	3300006880	Bacteria	5021
265	Ga0068865_100093781	3300006881	Bacteria	2183
266	Ga0075436_100136063	3300006914	Bacteria	1725
267	Ga0075436_100360426	3300006914	Bacteria	1049
268	Ga0099824_1015712	3300006942	Bacteria	7077
269	Ga0079104_1000082	3300006946	Bacteria	137722
270	Ga0079104_1003665	3300006946	Bacteria	6988
271	Ga0099826_10029250	3300006948	Bacteria	4017
272	Ga0075435_100011612	3300007076	Bacteria	6490
273	Ga0075435_100014840	3300007076	Bacteria	5840
274	Ga0075435_100236532	3300007076	Bacteria	1552
275	Ga0075435_100308609	3300007076	Bacteria	1354
276	Ga0099794_10194793	3300007265	Bacteria	1037
277	Ga0099795_10028326	3300007788	Bacteria	1904
278	Ga0099795_10109524	3300007788	Bacteria	1093
279	Ga0105240_10000910	3300009093	Bacteria	52855
280	Ga0105240_10005052	3300009093	Bacteria	19785
281	Ga0105240_10163674	3300009093	Bacteria	2640
282	Ga0111539_10011199	3300009094	Bacteria	11272
283	Ga0111539_10172725	3300009094	Bacteria	2525
284	Ga0111539_10174720	3300009094	Bacteria	2509
285	Ga0105245_10241853	3300009098	Bacteria	1750
286	Ga0105245_10298123	3300009098	Bacteria	1581
287	Ga0105247_10058820	3300009101	Bacteria	2378
288	Ga0114129_10035302	3300009147	Bacteria	7063
289	Ga0114129_10177581	3300009147	Bacteria	2900
290	Ga0114129_10497722	3300009147	Bacteria	1592
291	Ga0114129_10915750	3300009147	Bacteria	1110
292	Ga0114129_11193145	3300009147	Bacteria	948
293	Ga0105243_10000092	3300009148	Bacteria	101739
294	Ga0105243_10088183	3300009148	Bacteria	2549
295	Ga0105243_10280679	3300009148	Bacteria	1500
296	Ga0105243_10326600	3300009148	Bacteria	1400
297	Ga0105241_10160321	3300009174	Bacteria	1848
298	Ga0105241_10389606	3300009174	Bacteria	1220
299	Ga0105241_10402783	3300009174	Bacteria	1200
300	Ga0105242_10124502	3300009176	Bacteria	2217
301	Ga0105248_10066837	3300009177	Bacteria	4036
302	Ga0105248_10107505	3300009177	Bacteria	3146
303	Ga0105248_10417244	3300009177	Bacteria	1511
304	Ga0105237_10000122	3300009545	Bacteria	108419
305	Ga0105237_10000946	3300009545	Bacteria	39011
306	Ga0105237_10001825	3300009545	Bacteria	27462
307	Ga0105237_10101400	3300009545	Bacteria	2871
308	Ga0105237_10136519	3300009545	Bacteria	2447
309	Ga0105237_10179061	3300009545	Bacteria	2120
310	Ga0105237_10496158	3300009545	Bacteria	1227
311	Ga0105238_10071049	3300009551	Bacteria	3478
312	Ga0105238_10302906	3300009551	Bacteria	1582
313	Ga0105238_10321038	3300009551	Bacteria	1534
314	Ga0105238_10390824	3300009551	Bacteria	1383
315	Ga0105238_10519406	3300009551	Bacteria	1193
316	Ga0105238_10709183	3300009551	Bacteria	1018
317	Ga0105249_10239989	3300009553	Bacteria	1791
318	Ga0123341_1000017	3300009765	Bacteria	82963
319	Ga0123341_1049419	3300009765	Bacteria	2420
320	Ga0123342_1022929	3300009766	Bacteria	4140
321	Ga0105239_10002962	3300010375	Bacteria	21169
322	Ga0105239_10386765	3300010375	Bacteria	1582
323	Ga0105239_10461127	3300010375	Bacteria	1442
324	Ga0105246_10056971	3300011119	Bacteria	2703
325	Ga0105246_10164597	3300011119	Bacteria	1693
326	Ga0157373_10014989	3300013100	Bacteria	5671
327	Ga0157373_10059727	3300013100	Bacteria	2702
328	Ga0157373_10403381	3300013100	Bacteria	980
329	Ga0157371_10000004	3300013102	Bacteria	512593
330	Ga0157371_10009477	3300013102	Bacteria	7660
331	Ga0157370_10000909	3300013104	Bacteria	37515
332	Ga0157370_10001019	3300013104	Bacteria	35264
333	Ga0157370_10191467	3300013104	Bacteria	1898
334	Ga0157369_10007331	3300013105	Bacteria	12696
335	Ga0157369_10152146	3300013105	Bacteria	2445
336	Ga0157369_10156435	3300013105	Bacteria	2408
337	Ga0157369_10981149	3300013105	Bacteria	865
338	Ga0171463_1013	3300013249	Bacteria	94945
339	Ga0157374_10040095	3300013296	Bacteria	4311
340	Ga0157378_10096362	3300013297	Bacteria	2696
341	Ga0157378_10189914	3300013297	Bacteria	1937
342	Ga0163162_10171796	3300013306	Bacteria	2292
343	Ga0163162_10172061	3300013306	Bacteria	2291
344	Ga0163162_10309198	3300013306	Bacteria	1713
345	Ga0163162_10425338	3300013306	Bacteria	1460
346	Ga0157375_10027437	3300013308	Bacteria	5322
347	Ga0157375_10114665	3300013308	Bacteria	2797
348	Ga0163163_10329917	3300014325	Bacteria	1580
349	Ga0157380_10115710	3300014326	Bacteria	2262
350	Ga0157380_10549735	3300014326	Bacteria	1132
351	Ga0182008_10029495	3300014497	Bacteria	2772
352	Ga0157377_10112335	3300014745	Bacteria	1639
353	Ga0157376_10023240	3300014969	Bacteria	4850
354	Ga0157376_10332437	3300014969	Bacteria	1448
355	Ga0182006_1111237	3300015261	Bacteria	961
356	Ga0182006_1115534	3300015261	Bacteria	938
357	Ga0182007_10001788	3300015262	Bacteria	11234
358	Ga0182007_10019513	3300015262	Bacteria	2436
359	Ga0183363_1141	3300015690	Bacteria	18493
360	Ga0163161_10046393	3300017792	Bacteria	3135
361	Ga0163161_10140956	3300017792	Bacteria	1826
362	Ga0214544_1000329	3300021320	Bacteria	82143
363	Ga0214542_1000084	3300021321	Bacteria	120499
364	Ga0214542_1022384	3300021321	Bacteria	4065
365	Ga0214543_1000025	3300021327	Bacteria	225351
366	Ga0214543_1000076	3300021327	Bacteria	120483
367	Ga0213872_10017171	3300021361	Bacteria	3349
368	Ga0213872_10030531	3300021361	Bacteria	2470
369	Ga0213872_10051095	3300021361	Bacteria	1876
370	Ga0213872_10132577	3300021361	Bacteria	1097
371	Ga0213874_10021462	3300021377	Bacteria	1781
372	Ga0213874_10046649	3300021377	Bacteria	1316
373	Ga0213874_10054294	3300021377	Bacteria	1238
374	Ga0213874_10054628	3300021377	Bacteria	1235
375	Ga0213876_10000961	3300021384	Bacteria	18959
376	Ga0213876_10148852	3300021384	Bacteria	1245
377	Ga0213876_10173912	3300021384	Bacteria	1146
378	Ga0213875_10002356	3300021388	Bacteria	11398
379	Ga0213875_10024123	3300021388	Bacteria	2902
380	Ga0213875_10098790	3300021388	Bacteria	1362
381	Ga0213871_10002537	3300021441	Bacteria	3368
382	Ga0228711_1000020	3300022739	Bacteria	108422
383	Ga0228710_1000012	3300022740	Bacteria	148650
384	Ga0209435_100044	3300025206	Bacteria	99051
385	Ga0209436_100208	3300025208	Bacteria	27108
386	Ga0209436_100645	3300025208	Bacteria	14856
387	Ga0207427_105416	3300025231	Bacteria	1804
388	Ga0209437_100050	3300025233	Bacteria	394010
389	Ga0209437_100205	3300025233	Bacteria	115669
390	Ga0207425_1000621	3300025245	Bacteria	20281
391	Ga0207425_1000822	3300025245	Bacteria	15523
392	Ga0207425_1007035	3300025245	Bacteria	3014
393	Ga0207425_1007558	3300025245	Bacteria	2855
394	Ga0207425_1020312	3300025245	Bacteria	1422
395	Ga0209646_1000151	3300025246	Bacteria	99050
396	Ga0209646_1022941	3300025246	Bacteria	887
397	Ga0209026_1000100	3300025250	Bacteria	156131
398	Ga0209026_1000170	3300025250	Bacteria	99050
399	Ga0209677_100810	3300025253	Bacteria	15627
400	Ga0209677_100959	3300025253	Bacteria	14035
401	Ga0209148_1000069	3300025254	Bacteria	334444
402	Ga0209148_1000216	3300025254	Bacteria	98209
403	Ga0209148_1003399	3300025254	Bacteria	4433
404	Ga0209148_1009017	3300025254	Bacteria	1970
405	Ga0209759_1000186	3300025256	Bacteria	100413
406	Ga0209759_1000899	3300025256	Bacteria	22224
407	Ga0209129_1000066	3300025258	Bacteria	226820
408	Ga0209129_1000141	3300025258	Bacteria	119150
409	Ga0209129_1000373	3300025258	Bacteria	36420
410	Ga0209129_1000963	3300025258	Bacteria	17298
411	Ga0209129_1002042	3300025258	Bacteria	10430
412	Ga0209129_1002881	3300025258	Bacteria	7920
413	Ga0209233_1000028	3300025261	Bacteria	642062
414	Ga0209233_1000037	3300025261	Bacteria	554620
415	Ga0209233_1000187	3300025261	Bacteria	133091
416	Ga0209233_1000232	3300025261	Bacteria	96361
417	Ga0209233_1000444	3300025261	Bacteria	28489
418	Ga0209233_1001353	3300025261	Bacteria	9774
419	Ga0209233_1002339	3300025261	Bacteria	7061
420	Ga0209233_1005270	3300025261	Bacteria	4307
421	Ga0209233_1015200	3300025261	Bacteria	2151
422	Ga0209455_1000135	3300025272	Bacteria	148007
423	Ga0209455_1001447	3300025272	Bacteria	10717
424	Ga0209455_1015779	3300025272	Bacteria	1645
425	Ga0209673_1000024	3300025273	Bacteria	409632
426	Ga0209673_1000358	3300025273	Bacteria	82232
427	Ga0209673_1000526	3300025273	Bacteria	62641
428	Ga0209673_1001893	3300025273	Bacteria	16802
429	Ga0209673_1003909	3300025273	Bacteria	8376
430	Ga0209673_1004620	3300025273	Bacteria	7291
431	Ga0209673_1010160	3300025273	Bacteria	3995
432	Ga0209673_1011882	3300025273	Bacteria	3552
433	Ga0209673_1023578	3300025273	Bacteria	2090
434	Ga0209673_1049094	3300025273	Bacteria	1131
435	Ga0209130_1000002	3300025284	Bacteria	722648
436	Ga0209130_1000010	3300025284	Bacteria	444920
437	Ga0209130_1000090	3300025284	Bacteria	151512
438	Ga0209130_1000093	3300025284	Bacteria	145707
439	Ga0209130_1004443	3300025284	Bacteria	5316
440	Ga0209675_1036206	3300025291	Bacteria	1119
441	Ga0209676_1008224	3300025292	Bacteria	4699
442	Ga0209676_1011207	3300025292	Bacteria	3641
443	Ga0209676_1015694	3300025292	Bacteria	2774
444	Ga0209676_1025828	3300025292	Bacteria	1876
445	Ga0209025_1000064	3300025294	Bacteria	301309
446	Ga0209025_1000144	3300025294	Bacteria	181446
447	Ga0209025_1000274	3300025294	Bacteria	119322
448	Ga0209025_1000275	3300025294	Bacteria	119220
449	Ga0209025_1000436	3300025294	Bacteria	82202
450	Ga0209025_1000534	3300025294	Bacteria	72165
451	Ga0209025_1001405	3300025294	Bacteria	31958
452	Ga0209025_1002564	3300025294	Bacteria	18916
453	Ga0209025_1008658	3300025294	Bacteria	7276
454	Ga0209025_1015207	3300025294	Bacteria	4662
455	Ga0209025_1037130	3300025294	Bacteria	2167
456	Ga0209025_1044973	3300025294	Bacteria	1837
457	Ga0209564_1000262	3300025295	Bacteria	112256
458	Ga0209564_1000473	3300025295	Bacteria	67272
459	Ga0209564_1000474	3300025295	Bacteria	67143
460	Ga0209564_1000486	3300025295	Bacteria	66011
461	Ga0209564_1001714	3300025295	Bacteria	20610
462	Ga0209564_1003062	3300025295	Bacteria	11873
463	Ga0209564_1004831	3300025295	Bacteria	8022
464	Ga0209564_1006881	3300025295	Bacteria	5995
465	Ga0209564_1020588	3300025295	Bacteria	2410
466	Ga0209758_1000015	3300025297	Bacteria	851943
467	Ga0209758_1000161	3300025297	Bacteria	154278
468	Ga0209758_1000229	3300025297	Bacteria	119657
469	Ga0209758_1000466	3300025297	Bacteria	66920
470	Ga0209758_1000699	3300025297	Bacteria	49788
471	Ga0209758_1000753	3300025297	Bacteria	46946
472	Ga0209758_1001169	3300025297	Bacteria	33363
473	Ga0209758_1001202	3300025297	Bacteria	32677
474	Ga0209758_1001234	3300025297	Bacteria	31965
475	Ga0209758_1001304	3300025297	Bacteria	30476
476	Ga0209758_1005257	3300025297	Bacteria	10127
477	Ga0209758_1009515	3300025297	Bacteria	6019
478	Ga0209758_1010265	3300025297	Bacteria	5638
479	Ga0209758_1035578	3300025297	Bacteria	1960
480	Ga0209758_1045552	3300025297	Bacteria	1591
481	Ga0209050_1005974	3300025298	Bacteria	7394
482	Ga0209050_1027082	3300025298	Bacteria	1900
483	Ga0209256_1000509	3300025299	Bacteria	57170
484	Ga0209256_1000756	3300025299	Bacteria	42072
485	Ga0209256_1001194	3300025299	Bacteria	29088
486	Ga0209256_1002059	3300025299	Bacteria	17769
487	Ga0209256_1003453	3300025299	Bacteria	11069
488	Ga0209256_1003874	3300025299	Bacteria	9932
489	Ga0209256_1010990	3300025299	Bacteria	3694
490	Ga0209256_1011550	3300025299	Bacteria	3512
491	Ga0209256_1016199	3300025299	Bacteria	2557
492	Ga0209256_1025178	3300025299	Bacteria	1739
493	Ga0207426_1000012	3300025302	Bacteria	730942
494	Ga0207426_1000013	3300025302	Bacteria	721897
495	Ga0207426_1000036	3300025302	Bacteria	444920
496	Ga0207426_1000113	3300025302	Bacteria	228304
497	Ga0207426_1000142	3300025302	Bacteria	194023
498	Ga0207426_1026207	3300025302	Bacteria	1955
499	Ga0207426_1030902	3300025302	Bacteria	1752
500	Ga0209051_1000170	3300025303	Bacteria	119026
501	Ga0209051_1000172	3300025303	Bacteria	117180
502	Ga0209051_1000178	3300025303	Bacteria	115109
503	Ga0209051_1000704	3300025303	Bacteria	36587
504	Ga0209051_1009663	3300025303	Bacteria	4949
505	Ga0209051_1012742	3300025303	Bacteria	4049
506	Ga0209257_1000015	3300025304	Bacteria	908141
507	Ga0209257_1000108	3300025304	Bacteria	240229
508	Ga0209257_1001648	3300025304	Bacteria	25481
509	Ga0209257_1004903	3300025304	Bacteria	9865
510	Ga0209257_1008334	3300025304	Bacteria	5929
511	Ga0209257_1024843	3300025304	Bacteria	2062
512	Ga0209257_1039453	3300025304	Bacteria	1419
513	Ga0207697_10057426	3300025315	Bacteria	1615
514	Ga0207653_10090373	3300025885	Bacteria	1072
515	Ga0207692_10003319	3300025898	Bacteria	6271
516	Ga0207692_10087626	3300025898	Bacteria	1680
517	Ga0207688_10149192	3300025901	Bacteria	1380
518	Ga0207647_10018254	3300025904	Bacteria	4751
519	Ga0207685_10088654	3300025905	Bacteria	1297
520	Ga0207685_10204504	3300025905	Bacteria	930
521	Ga0207699_10000845	3300025906	Bacteria	14564
522	Ga0207699_10011253	3300025906	Bacteria	4511
523	Ga0207699_10358906	3300025906	Bacteria	1030
524	Ga0207645_10034835	3300025907	Bacteria	3234
525	Ga0207643_10049829	3300025908	Bacteria	2374
526	Ga0207705_10030223	3300025909	Bacteria	3865
527	Ga0207654_10226293	3300025911	Bacteria	1243
528	Ga0207654_10228507	3300025911	Bacteria	1238
529	Ga0207695_10000006	3300025913	Bacteria	1135309
530	Ga0207695_10000427	3300025913	Bacteria	93089
531	Ga0207695_10049708	3300025913	Bacteria	4417
532	Ga0207695_10489800	3300025913	Bacteria	1112
533	Ga0207671_10000249	3300025914	Bacteria	80726
534	Ga0207671_10000288	3300025914	Bacteria	74500
535	Ga0207671_10005136	3300025914	Bacteria	12194
536	Ga0207671_10052926	3300025914	Bacteria	3009
537	Ga0207693_10002393	3300025915	Bacteria	16281
538	Ga0207693_10009277	3300025915	Bacteria	8031
539	Ga0207693_10024590	3300025915	Bacteria	4777
540	Ga0207693_10058071	3300025915	Bacteria	3031
541	Ga0207660_10038840	3300025917	Bacteria	3325
542	Ga0207660_10159155	3300025917	Bacteria	1741
543	Ga0207657_10096071	3300025919	Bacteria	2465
544	Ga0207657_10179314	3300025919	Bacteria	1713
545	Ga0207657_10325515	3300025919	Bacteria	1215
546	Ga0207646_10115616	3300025922	Bacteria	2410
547	Ga0207646_10394351	3300025922	Bacteria	1250
548	Ga0207681_10065702	3300025923	Bacteria	2509
549	Ga0207681_10193575	3300025923	Bacteria	1557
550	Ga0207681_10210349	3300025923	Bacteria	1499
551	Ga0207650_10000424	3300025925	Bacteria	37229
552	Ga0207687_10418781	3300025927	Bacteria	1105
553	Ga0207700_10015435	3300025928	Bacteria	5040
554	Ga0207700_10244764	3300025928	Bacteria	1530
555	Ga0207700_10394417	3300025928	Bacteria	1212
556	Ga0207664_10028091	3300025929	Bacteria	4272
557	Ga0207664_10045677	3300025929	Bacteria	3435
558	Ga0207664_10138422	3300025929	Bacteria	2056
559	Ga0207644_10081122	3300025931	Bacteria	2396
560	Ga0207644_10126672	3300025931	Bacteria	1950
561	Ga0207644_10134984	3300025931	Bacteria	1894
562	Ga0207644_10349329	3300025931	Bacteria	1200
563	Ga0207706_10090454	3300025933	Bacteria	2691
564	Ga0207706_10100573	3300025933	Bacteria	2543
565	Ga0207686_10100088	3300025934	Bacteria	1933
566	Ga0207709_10000085	3300025935	Bacteria	160514
567	Ga0207669_10012355	3300025937	Bacteria	4195
568	Ga0207669_10114126	3300025937	Bacteria	1818
569	Ga0207669_10168817	3300025937	Bacteria	1555
570	Ga0207704_10009681	3300025938	Bacteria	4663
571	Ga0207665_10003554	3300025939	Bacteria	10414
572	Ga0207665_10011708	3300025939	Bacteria	5764
573	Ga0207691_10234513	3300025940	Bacteria	1588
574	Ga0207711_10214945	3300025941	Bacteria	1757
575	Ga0207711_10251609	3300025941	Bacteria	1623
576	Ga0207711_10318885	3300025941	Bacteria	1436
577	Ga0207711_10334643	3300025941	Bacteria	1401
578	Ga0207689_10256435	3300025942	Bacteria	1447
579	Ga0207661_10000210	3300025944	Bacteria	37700
580	Ga0207661_10560734	3300025944	Bacteria	1047
581	Ga0207667_10156216	3300025949	Bacteria	2347
582	Ga0207667_10776278	3300025949	Bacteria	956
583	Ga0207668_10041514	3300025972	Bacteria	3110
584	Ga0207668_10101664	3300025972	Bacteria	2137
585	Ga0207640_10083717	3300025981	Bacteria	2188
586	Ga0207640_10261016	3300025981	Bacteria	1350
587	Ga0207640_10401561	3300025981	Bacteria	1116
588	Ga0207677_10069218	3300026023	Bacteria	2481
589	Ga0207677_10206308	3300026023	Bacteria	1566
590	Ga0207703_10052511	3300026035	Bacteria	3310
591	Ga0207703_10102858	3300026035	Bacteria	2424
592	Ga0207703_10283001	3300026035	Bacteria	1507
593	Ga0207639_10001845	3300026041	Bacteria	14263
594	Ga0207639_10021716	3300026041	Bacteria	4613
595	Ga0207639_10207710	3300026041	Bacteria	1684
596	Ga0207678_10028354	3300026067	Bacteria	4887
597	Ga0207678_10055975	3300026067	Bacteria	3397
598	Ga0207678_10161977	3300026067	Bacteria	1910
599	Ga0207678_10180904	3300026067	Bacteria	1800
600	Ga0207678_10321489	3300026067	Bacteria	1331
601	Ga0207708_10243715	3300026075	Bacteria	1446
602	Ga0207702_10105665	3300026078	Bacteria	2494
603	Ga0207702_10298467	3300026078	Bacteria	1528
604	Ga0207702_10534455	3300026078	Bacteria	1145
605	Ga0207648_10047581	3300026089	Bacteria	3759
606	Ga0207648_10329564	3300026089	Bacteria	1373
607	Ga0207648_10412913	3300026089	Bacteria	1224
608	Ga0207676_10200054	3300026095	Bacteria	1765
609	Ga0207674_10049280	3300026116	Bacteria	4308
610	Ga0207674_10175085	3300026116	Bacteria	2098
611	Ga0207674_10386878	3300026116	Bacteria	1352
612	Ga0207675_100026549	3300026118	Bacteria	5391
613	Ga0207675_100180964	3300026118	Bacteria	2018
614	Ga0207675_100350563	3300026118	Bacteria	1447
615	Ga0207683_10034882	3300026121	Bacteria	4375
616	Ga0207683_10249576	3300026121	Bacteria	1619
617	Ga0207683_10270476	3300026121	Bacteria	1552
618	Ga0207683_10626316	3300026121	Bacteria	996
619	Ga0207698_10054963	3300026142	Bacteria	3065
620	Ga0207698_10095223	3300026142	Bacteria	2450
621	Ga0209281_1000043	3300027111	Bacteria	341543
622	Ga0209281_1000138	3300027111	Bacteria	180979
623	Ga0209281_1000591	3300027111	Bacteria	41961
624	Ga0209389_1000062	3300027296	Bacteria	102842
625	Ga0209371_1000009	3300027312	Bacteria	963030
626	Ga0209371_1007211	3300027312	Bacteria	3925
627	Ga0209371_1011290	3300027312	Bacteria	2663
628	Ga0209371_1013700	3300027312	Bacteria	2259
629	Ga0209489_100160	3300027361	Bacteria	102842
630	Ga0209700_101128	3300027363	Bacteria	54168
631	Ga0209282_1000020	3300027666	Bacteria	180986
632	Ga0209282_1001362	3300027666	Bacteria	13351
633	Ga0209588_1000381	3300027671	Bacteria	11518
634	Ga0209813_10000141	3300027866	Bacteria	25054
635	Ga0209813_10008068	3300027866	Bacteria	2648
636	Ga0209813_10027826	3300027866	Bacteria	1644
637	Ga0209813_10058163	3300027866	Bacteria	1228
638	Ga0268266_10006046	3300028379	Bacteria	11157
639	Ga0268266_10019799	3300028379	Bacteria	5735
640	Ga0268266_10034996	3300028379	Bacteria	4272
641	Ga0268266_10037632	3300028379	Bacteria	4121
642	Ga0268266_10125895	3300028379	Bacteria	2286
643	Ga0268266_10135791	3300028379	Bacteria	2203
644	Ga0268266_10138330	3300028379	Bacteria	2183
645	Ga0268266_10145736	3300028379	Bacteria	2129
646	Ga0268266_10249760	3300028379	Bacteria	1640
647	Ga0268266_10592937	3300028379	Bacteria	1064
648	Ga0268265_10036930	3300028380	Bacteria	3582
649	Ga0268265_10084324	3300028380	Bacteria	2518
650	Ga0268265_10438155	3300028380	Bacteria	1217
651	Ga0268264_10000020	3300028381	Bacteria	483593
652	Ga0268264_10287523	3300028381	Bacteria	1543
653	Ga0265319_1004654	3300028563	Bacteria	6742
654	Ga0265334_10000614	3300028573	Bacteria	17940
655	Ga0265318_10010741	3300028577	Bacteria	3975
656	Ga0265318_10046139	3300028577	Bacteria	1645
657	Ga0265323_10000644	3300028653	Bacteria	19022
658	Ga0265336_10000259	3300028666	Bacteria	37606
659	Ga0307517_10103413	3300028786	Bacteria	2226
660	Ga0307515_10000034	3300028794	Bacteria	344640
661	Ga0307515_10000136	3300028794	Bacteria	174265
662	Ga0307515_10003222	3300028794	Bacteria	34542
663	Ga0307515_10012584	3300028794	Bacteria	15904
664	Ga0265338_10000013	3300028800	Bacteria	379065
665	Ga0265338_10034583	3300028800	Bacteria	4880
666	Ga0265324_10003265	3300029957	Bacteria	7804
667	Ga0268256_1000010	3300030500	Bacteria	963034
668	Ga0268256_1001297	3300030500	Bacteria	15456
669	Ga0268256_1011141	3300030500	Bacteria	2867
670	Ga0268256_1015182	3300030500	Bacteria	2259
671	Ga0307511_10122620	3300030521	Bacteria	1600
672	Ga0265330_10047357	3300031235	Bacteria	1892
673	Ga0265330_10050422	3300031235	Bacteria	1826
674	Ga0265332_10012314	3300031238	Bacteria	3795
675	Ga0265328_10046437	3300031239	Bacteria	1597
676	Ga0265325_10020621	3300031241	Bacteria	3631
677	Ga0265325_10033233	3300031241	Bacteria	2750
678	Ga0265325_10105167	3300031241	Bacteria	1378
679	Ga0265325_10142308	3300031241	Bacteria	1140
680	Ga0265340_10030737	3300031247	Bacteria	2690
681	Ga0265340_10065692	3300031247	Bacteria	1727
682	Ga0265339_10012260	3300031249	Bacteria	5241
683	Ga0265339_10013093	3300031249	Bacteria	5037
684	Ga0265331_10036354	3300031250	Bacteria	2418
685	Ga0265327_10012066	3300031251	Bacteria	5870
686	Ga0265327_10038398	3300031251	Bacteria	2612
687	Ga0265327_10067577	3300031251	Bacteria	1800
688	Ga0265316_10047416	3300031344	Bacteria	3400
689	Ga0265316_10144362	3300031344	Bacteria	1786
690	Ga0265316_10152096	3300031344	Bacteria	1733
691	Ga0265316_10311952	3300031344	Bacteria	1144
692	Ga0307513_10005749	3300031456	Bacteria	16317
693	Ga0307513_10100173	3300031456	Bacteria	2924
694	Ga0307509_10018864	3300031507	Bacteria	7892
695	Ga0307509_10040596	3300031507	Bacteria	5060
696	Ga0307509_10298000	3300031507	Bacteria	1362
697	Ga0307408_100125500	3300031548	Bacteria	1995
698	Ga0265313_10044495	3300031595	Bacteria	2167
699	Ga0307508_10000025	3300031616	Bacteria	174642
700	Ga0307508_10163915	3300031616	Bacteria	1826
701	Ga0307508_10285179	3300031616	Bacteria	1245
702	Ga0265314_10101684	3300031711	Bacteria	1846
703	Ga0265314_10192255	3300031711	Bacteria	1213
704	Ga0265314_10221319	3300031711	Bacteria	1104
705	Ga0265342_10024976	3300031712	Bacteria	3763
706	Ga0265342_10058609	3300031712	Bacteria	2276
707	Ga0265342_10091264	3300031712	Bacteria	1746
708	Ga0316576_10011297	3300031727	Bacteria	5846
709	Ga0307516_10001162	3300031730	Bacteria	36834
710	Ga0307516_10017995	3300031730	Bacteria	7352
711	Ga0307516_10165112	3300031730	Bacteria	1960
712	Ga0307405_10000258	3300031731	Bacteria	19401
713	Ga0307405_10246345	3300031731	Bacteria	1327
714	Ga0316577_10269908	3300031733	Bacteria	963
715	Ga0307413_10148077	3300031824	Bacteria	1632
716	Ga0307413_10161950	3300031824	Bacteria	1573
717	Ga0307410_10160746	3300031852	Bacteria	1683
718	Ga0307410_10237805	3300031852	Bacteria	1410
719	Ga0307406_10000348	3300031901	Bacteria	26954
720	Ga0307406_10004585	3300031901	Bacteria	7522
721	Ga0307407_10575481	3300031903	Bacteria	836
722	Ga0307412_10000690	3300031911	Bacteria	19480
723	Ga0307412_10043601	3300031911	Bacteria	2922
724	Ga0307412_10145249	3300031911	Bacteria	1742
725	Ga0307412_10454330	3300031911	Bacteria	1056
726	Ga0315914_1000031	3300031967	Bacteria	101407
727	Ga0307409_100128620	3300031995	Bacteria	2160
728	Ga0307409_100280395	3300031995	Bacteria	1540
729	Ga0307409_100345111	3300031995	Bacteria	1403
730	Ga0307409_100442770	3300031995	Bacteria	1252
731	Ga0307409_100563512	3300031995	Bacteria	1120
732	Ga0307416_100444347	3300032002	Bacteria	1348
733	Ga0307414_10100724	3300032004	Bacteria	2173
734	Ga0307414_10148743	3300032004	Bacteria	1844
735	Ga0307414_10480694	3300032004	Bacteria	1095
736	Ga0307414_10613577	3300032004	Bacteria	977
737	Ga0307411_10254080	3300032005	Bacteria	1384
738	Ga0307415_100265085	3300032126	Bacteria	1404
739	Ga0316583_10007448	3300032133	Bacteria	3939
740	Ga0307507_10208746	3300033179	Bacteria	1336
741	Ga0307510_10021408	3300033180	Bacteria	7533
742	Ga0315913_1000010	3300033430	Bacteria	140890
743	Ga0315915_1000006	3300033464	Bacteria	330709
744	Ga0373926_0069915	3300035083	Bacteria	1289
745	Ga0373934_0002451	3300035086	Bacteria	6821
746	Ga0373923_0002937	3300035111	Bacteria	5365
747	Ga0373923_0074972	3300035111	Bacteria	1459
748	Ga0373923_0153918	3300035111	Bacteria	1046
749	Ga0373936_0006163	3300035113	Bacteria	4520
750	Ga0373936_0016726	3300035113	Bacteria	2823
751	Ga0373936_0198218	3300035113	Bacteria	886
752	Ga0373945_0122893	3300035116	Bacteria	1033
753	Ga0373953_0021584	3300035117	Bacteria	2418
754	Ga0373954_0016562	3300035118	Bacteria	3301
755	Ga0373954_0055652	3300035118	Bacteria	1861
756	Ga0373956_0001024	3300035119	Bacteria	11548
757	Ga0373956_0015982	3300035119	Bacteria	3148
758	Ga0373956_0089256	3300035119	Bacteria	1421
759	Ga0373957_0029216	3300035120	Bacteria	2013
760	Ga0373957_0033244	3300035120	Bacteria	1904
761	Ga0373943_0086972	3300035170	Bacteria	1612
762	Ga0373946_0017582	3300035171	Bacteria	2737
763	Ga0373946_0018409	3300035171	Bacteria	2682
764	Ga0373955_0003604	3300035172	Bacteria	6808
765	Ga0373955_0035349	3300035172	Bacteria	2646
766	Ga0373955_0110989	3300035172	Bacteria	1585
767	Ga0373924_0049853	3300035410	Bacteria	1733
768	Ga0373935_0003185	3300035692	Bacteria	9467
769	Ga0373935_0031178	3300035692	Bacteria	3307
770	Ga0373935_0260490	3300035692	Bacteria	1216
771	Ga0373927_0000147	3300035695	Bacteria	55399
772	Ga0373927_0002909	3300035695	Bacteria	12452
773	Ga0373927_0028834	3300035695	Bacteria	3619
774	Ga0373927_0047377	3300035695	Bacteria	2781
775	Ga0373933_0013495	3300035724	Bacteria	4529
776	Ga0373933_0026586	3300035724	Bacteria	3325
777	Ga0373933_0088172	3300035724	Bacteria	1911
778	Ga0373933_0113379	3300035724	Bacteria	1693
779	Ga0373947_0189129	3300035725	Bacteria	1343
780	Ga0373947_0256291	3300035725	Bacteria	1158
781	Ga0373937_0002075	3300036401	Bacteria	16763
782	Ga0373937_0003671	3300036401	Bacteria	12957
783	Ga0373937_0032959	3300036401	Bacteria	4700
784	Ga0373937_0171775	3300036401	Bacteria	2034
785	Ga0316582_0035425	3300036647	Bacteria	3082
786	Ga0316582_0367394	3300036647	Bacteria	990
787	Ga0316584_0009951	3300036712	Bacteria	6624
788	Ga0373925_0004474	3300037068	Bacteria	10564
789	Ga0373925_0010579	3300037068	Bacteria	6691
790	Ga0373925_0115498	3300037068	Bacteria	2078
791	Ga0395899_0000470	3300037312	Bacteria	45611
792	Ga0395899_0107208	3300037312	Bacteria	2011
793	Ga0395899_0155947	3300037312	Bacteria	1616
794	Ga0395900_0019863	3300037418	Bacteria	6849
795	Ga0395900_0050630	3300037418	Bacteria	4278
796	Ga0395900_0167780	3300037418	Bacteria	2236
797	Ga0395900_0194460	3300037418	Bacteria	2056
798	Ga0395900_0650548	3300037418	Bacteria	991
799	Ga0395900_0816043	3300037418	Bacteria	860
800	Ga0395898_0012017	3300037466	Bacteria	8964
801	Ga0395898_0058642	3300037466	Bacteria	3747
802	Ga0395898_0143700	3300037466	Bacteria	2284
803	Ga0395898_0211482	3300037466	Bacteria	1850
804	Ga0395898_0576544	3300037466	Bacteria	1067
805	Ga0395905_0000710	3300037471	Bacteria	44148
806	Ga0395905_0000995	3300037471	Bacteria	36267
807	Ga0395905_0005062	3300037471	Bacteria	13565
808	Ga0395905_0005543	3300037471	Bacteria	12880
809	Ga0395905_0030688	3300037471	Bacteria	5062
810	Ga0395905_0034259	3300037471	Bacteria	4768
811	Ga0395905_0148494	3300037471	Bacteria	2205
812	Ga0395905_0264238	3300037471	Bacteria	1606
813	Ga0395905_0466324	3300037471	Bacteria	1162
814	Ga0436364_0173332	3300037853	Bacteria	20937
815	Ga0436364_0200520	3300037853	Bacteria	3438
816	Ga0436364_0416519	3300037853	Bacteria	115750
817	Ga0436364_0426400	3300037853	Bacteria	2204
818	Ga0436364_1131095	3300037853	Bacteria	3054
819	Ga0436364_1178098	3300037853	Bacteria	4331
820	Ga0436364_1323171	3300037853	Bacteria	3360
821	Ga0436364_1416803	3300037853	Bacteria	3815
822	Ga0436364_1491459	3300037853	Bacteria	1136
823	Ga0395901_0024350	3300038443	Bacteria	6212
824	Ga0395901_0118145	3300038443	Bacteria	2786
825	Ga0395901_0376253	3300038443	Bacteria	1462
826	Ga0395901_0420692	3300038443	Bacteria	1370
827	Ga0395901_0555193	3300038443	Bacteria	1163
828	Ga0395901_0798134	3300038443	Bacteria	933
829	Ga0400490_57702	3300038726	Bacteria	1411
830	Ga0400485_04517	3300038735	Bacteria	1132
831	Ga0400486_14829	3300038742	Bacteria	1577
832	Ga0400486_26521	3300038742	Bacteria	2904
833	Ga0400483_086271	3300039062	Bacteria	3562
834	Ga0400483_257403	3300039062	Bacteria	3206
835	Ga0400487_09229	3300039110	Bacteria	2280
836	Ga0436365_0006469	3300039437	Bacteria	12915
837	Ga0436365_0046378	3300039437	Bacteria	3247
838	Ga0436365_0424934	3300039437	Bacteria	1020
839	Ga0436365_0546735	3300039437	Bacteria	1082
840	Ga0436365_0912541	3300039437	Bacteria	1863
841	Ga0436365_1157517	3300039437	Bacteria	4628
842	Ga0436365_1484737	3300039437	Bacteria	1543
843	Ga0436365_1549357	3300039437	Bacteria	3331
844	Ga0436365_1599958	3300039437	Bacteria	1267
845	Ga0436365_1735852	3300039437	Bacteria	2630
846	Ga0436360_0714471	3300039438	Bacteria	1378
847	Ga0436360_1314457	3300039438	Bacteria	2542
848	Ga0436361_0017828	3300039447	Bacteria	3654
849	Ga0436361_0410430	3300039447	Bacteria	4156
850	Ga0436361_0915083	3300039447	Bacteria	2506
851	Ga0436361_1152524	3300039447	Bacteria	1632
852	Ga0436361_1217182	3300039447	Bacteria	15864
853	Ga0436363_0141246	3300039450	Bacteria	5125
854	Ga0436363_0249570	3300039450	Bacteria	1814
855	Ga0436363_0479463	3300039450	Bacteria	1459
856	Ga0436363_0619002	3300039450	Bacteria	1506
857	Ga0436363_0764206	3300039450	Bacteria	1571
858	Ga0439436_0015366	3300041404	Bacteria	2303
859	Ga0439438_033442	3300041405	Bacteria	1358
860	Ga0439453_0004388	3300041408	Bacteria	2095
861	Ga0439466_0073653	3300041411	Bacteria	1085
862	Ga0439465_0010782	3300041413	Bacteria	2867
863	Ga0451793_0016878	3300041452	Bacteria	1121
864	Ga0451793_0861834	3300041452	Bacteria	1153
865	Ga0451835_0126884	3300041492	Bacteria	2293
866	Ga0451839_1384225	3300041496	Bacteria	1408
867	Ga0451845_0183070	3300041501	Bacteria	1580
868	Ga0451847_0114050	3300041503	Bacteria	6503
869	Ga0451855_0285499	3300041511	Bacteria	923
870	Ga0451853_2967191	3300041512	Bacteria	3086
871	Ga0439449_0003781	3300042007	Bacteria	5861
872	Ga0439449_0037426	3300042007	Bacteria	1805
873	Ga0439449_0047503	3300042007	Bacteria	1589
874	Ga0439462_0010063	3300042015	Bacteria	2394
875	Ga0450907_016268	3300042146	Bacteria	1241
876	Ga0450893_0023476	3300042532	Bacteria	1073
877	Ga0451577_0051357	3300042876	Bacteria	3680
878	Ga0451577_0112006	3300042876	Bacteria	2442
879	Ga0466969_0020965	3300044656	Bacteria	3381
880	Ga0466972_0048391	3300044658	Bacteria	2054
881	Ga0466965_0143454	3300044683	Bacteria	1245
882	Ga0466966_0002418	3300044684	Bacteria	12199
883	Ga0466961_0000324	3300044693	Bacteria	31518
884	Ga0453684_0000142	3300044712	Bacteria	316405
885	Ga0453684_0391228	3300044712	Bacteria	1559
886	Ga0466968_0157453	3300044735	Bacteria	1047
887	Ga0466970_0016298	3300044765	Bacteria	3828
888	Ga0466970_0063269	3300044765	Bacteria	1984
889	Ga0466970_0145710	3300044765	Bacteria	1306
890	Ga0466957_0039262	3300044842	Bacteria	2856
891	Ga0466957_0108906	3300044842	Bacteria	1755
892	Ga0466957_0117167	3300044842	Bacteria	1695
893	Ga0466957_0211810	3300044842	Bacteria	1276
894	Ga0466960_0253357	3300044901	Bacteria	978
895	Ga0466959_0074977	3300045049	Bacteria	2445
896	Ga0466959_0174904	3300045049	Bacteria	1504
897	Ga0451576_0000743	3300045051	Bacteria	65029
898	Ga0466958_0307527	3300045836	Bacteria	1018
899	Ga0466967_0276289	3300045976	Bacteria	1611
900	Ga0495592_0009908	3300046454	Bacteria	7175
901	Ga0495592_0028770	3300046454	Bacteria	4206
902	Ga0495592_0033024	3300046454	Bacteria	3904
903	Ga0495592_0255148	3300046454	Bacteria	1157
904	Ga0495603_0023502	3300046455	Bacteria	3728
905	Ga0495603_0053286	3300046455	Bacteria	2400
906	Ga0495603_0127521	3300046455	Bacteria	1482
907	Ga0495603_0188872	3300046455	Bacteria	1191
908	Ga0495629_0001327	3300046459	Bacteria	19440
909	Ga0495629_0005186	3300046459	Bacteria	9752
910	Ga0495629_0008439	3300046459	Bacteria	7584
911	Ga0495629_0115165	3300046459	Bacteria	1873
912	Ga0495629_0226425	3300046459	Bacteria	1289
913	Ga0495638_0005323	3300046460	Bacteria	9597
914	Ga0495638_0005713	3300046460	Bacteria	9163
915	Ga0495638_0022077	3300046460	Bacteria	4181
916	Ga0495638_0025435	3300046460	Bacteria	3848
917	Ga0495638_0096418	3300046460	Bacteria	1775
918	Ga0495638_0149914	3300046460	Bacteria	1353
919	Ga0495638_0178435	3300046460	Bacteria	1214
920	Ga0495641_0009191	3300046461	Bacteria	5907
921	Ga0495651_0012145	3300046462	Bacteria	6629
922	Ga0495651_0098362	3300046462	Bacteria	2183
923	Ga0495651_0128387	3300046462	Bacteria	1854
924	Ga0495651_0156809	3300046462	Bacteria	1635
925	Ga0495653_0007074	3300046463	Bacteria	9202
926	Ga0495653_0120490	3300046463	Bacteria	1871
927	Ga0495650_0072830	3300046471	Bacteria	1343
928	Ga0495580_0009555	3300046472	Bacteria	7619
929	Ga0495582_0007766	3300046473	Bacteria	5931
930	Ga0495639_0023459	3300046475	Bacteria	2711
931	Ga0495639_0054037	3300046475	Bacteria	1830
932	Ga0495662_0001936	3300046476	Bacteria	10396
933	Ga0495662_0007671	3300046476	Bacteria	5318
934	Ga0495662_0085001	3300046476	Bacteria	1540
935	Ga0495664_0006672	3300046477	Bacteria	6382
936	Ga0495664_0009126	3300046477	Bacteria	5544
937	Ga0495664_0052402	3300046477	Bacteria	2425
938	Ga0495664_0165642	3300046477	Bacteria	1341
939	Ga0495584_0005130	3300046491	Bacteria	6953
940	Ga0495584_0172876	3300046491	Bacteria	1098
941	Ga0495585_0010208	3300046492	Bacteria	5606
942	Ga0495585_0089772	3300046492	Bacteria	1656
943	Ga0495594_0008915	3300046499	Bacteria	5173
944	Ga0495594_0230965	3300046499	Bacteria	1055
945	Ga0495607_0060226	3300046501	Bacteria	2162
946	Ga0495607_0156803	3300046501	Bacteria	1160
947	Ga0495583_0146721	3300046506	Bacteria	980
948	Ga0495606_0001266	3300046507	Bacteria	35143
949	Ga0495606_0014254	3300046507	Bacteria	6216
950	Ga0495606_0043075	3300046507	Bacteria	3014
951	Ga0495606_0074855	3300046507	Bacteria	2120
952	Ga0495606_0141385	3300046507	Bacteria	1421
953	Ga0495606_0173920	3300046507	Bacteria	1247
954	Ga0495608_0035675	3300046511	Bacteria	3352
955	Ga0495608_0138638	3300046511	Bacteria	1553
956	Ga0495610_0003928	3300046512	Bacteria	11263
957	Ga0495610_0038817	3300046512	Bacteria	2413
958	Ga0495610_0118213	3300046512	Bacteria	1165
959	Ga0495610_0133488	3300046512	Bacteria	1076
960	Ga0495616_0063713	3300046513	Bacteria	1801
961	Ga0495618_0147074	3300046514	Bacteria	1506
962	Ga0495620_0035038	3300046515	Bacteria	2262
963	Ga0495620_0156238	3300046515	Bacteria	887
964	Ga0495628_0026291	3300046516	Bacteria	4748
965	Ga0495628_0031380	3300046516	Bacteria	4298
966	Ga0495628_0042439	3300046516	Bacteria	3628
967	Ga0495630_0004453	3300046517	Bacteria	9826
968	Ga0495630_0105915	3300046517	Bacteria	2129
969	Ga0495630_0124304	3300046517	Bacteria	1958
970	Ga0495630_0147235	3300046517	Bacteria	1791
971	Ga0495630_0396186	3300046517	Bacteria	1058
972	Ga0495631_0013295	3300046518	Bacteria	3997
973	Ga0495631_0053326	3300046518	Bacteria	1765
974	Ga0495631_0083454	3300046518	Bacteria	1377
975	Ga0495632_0015926	3300046519	Bacteria	4197
976	Ga0495632_0059194	3300046519	Bacteria	1865
977	Ga0495632_0088115	3300046519	Bacteria	1475
978	Ga0495632_0092138	3300046519	Bacteria	1436
979	Ga0495643_0009282	3300046522	Bacteria	6125
980	Ga0495643_0071106	3300046522	Bacteria	1827
981	Ga0495648_0008452	3300046524	Bacteria	8099
982	Ga0495648_0019531	3300046524	Bacteria	4762
983	Ga0495648_0036669	3300046524	Bacteria	3159
984	Ga0495648_0152848	3300046524	Bacteria	1202
985	Ga0495666_0016516	3300046526	Bacteria	3678
986	Ga0495666_0045902	3300046526	Bacteria	2107
987	Ga0495652_0003976	3300046529	Bacteria	14326
988	Ga0495652_0038910	3300046529	Bacteria	4115
989	Ga0495654_0001076	3300046530	Bacteria	19900
990	Ga0495654_0050970	3300046530	Bacteria	2021
991	Ga0495654_0111414	3300046530	Bacteria	1248
992	Ga0495665_0024550	3300046531	Bacteria	3238
993	Ga0495665_0029157	3300046531	Bacteria	2957
994	Ga0495640_0007922	3300046533	Bacteria	8355
995	Ga0495640_0010067	3300046533	Bacteria	7329
996	Ga0495640_0011122	3300046533	Bacteria	6928
997	Ga0495640_0040211	3300046533	Bacteria	3275
998	Ga0495640_0220438	3300046533	Bacteria	1196
999	Ga0495586_0155491	3300046535	Bacteria	1288
1000	Ga0495587_0004748	3300046536	Bacteria	8921
1001	Ga0495587_0059733	3300046536	Bacteria	2237
1002	Ga0495587_0130397	3300046536	Bacteria	1437
1003	Ga0495598_0035367	3300046537	Bacteria	1430
1004	Ga0495598_0070471	3300046537	Bacteria	1100
1005	Ga0495609_0018128	3300046538	Bacteria	3265
1006	Ga0495597_0083463	3300046542	Bacteria	1364
1007	Ga0495645_0001529	3300046543	Bacteria	15618
1008	Ga0495645_0089484	3300046543	Bacteria	2201
1009	Ga0495622_0013858	3300046557	Bacteria	3741
1010	Ga0495622_0024050	3300046557	Bacteria	2843
1011	Ga0495622_0058632	3300046557	Bacteria	1783
1012	Ga0495633_0022355	3300046558	Bacteria	3149
1013	Ga0495633_0085671	3300046558	Bacteria	1465
1014	Ga0495667_0008395	3300046559	Bacteria	7007
1015	Ga0495667_0011515	3300046559	Bacteria	5987
1016	Ga0495667_0023719	3300046559	Bacteria	4133
1017	Ga0495667_0043164	3300046559	Bacteria	2988
1018	Ga0495656_0009550	3300046615	Bacteria	3491
1019	Ga0495668_0013606	3300046616	Bacteria	4792
1020	Ga0495668_0111277	3300046616	Bacteria	1498
1021	Ga0495668_0157528	3300046616	Bacteria	1244
1022	Ga0495668_0210021	3300046616	Bacteria	1066
1023	Ga0495634_0002499	3300046642	Bacteria	15239
1024	Ga0495634_0243599	3300046642	Bacteria	1102
1025	Ga0495634_0253159	3300046642	Bacteria	1076
1026	Ga0495625_0020617	3300046660	Bacteria	5085
1027	Ga0495625_0030497	3300046660	Bacteria	4022
1028	Ga0495625_0182791	3300046660	Bacteria	1393
1029	Ga0495625_0286839	3300046660	Bacteria	1057
1030	Ga0495635_0004879	3300046663	Bacteria	9334
1031	Ga0495635_0012056	3300046663	Bacteria	6059
1032	Ga0495635_0021664	3300046663	Bacteria	4480
1033	Ga0495635_0033742	3300046663	Bacteria	3550
1034	Ga0495635_0151048	3300046663	Bacteria	1581
1035	Ga0495635_0222110	3300046663	Bacteria	1278
1036	Ga0495659_0040863	3300046664	Bacteria	1655
1037	Ga0495661_0143424	3300046665	Bacteria	1297
1038	Ga0495588_0002693	3300046674	Bacteria	7609
1039	Ga0495588_0027120	3300046674	Bacteria	2862
1040	Ga0495588_0049690	3300046674	Bacteria	2157
1041	Ga0495657_0003208	3300046675	Bacteria	13463
1042	Ga0495657_0112915	3300046675	Bacteria	1719
1043	Ga0495657_0132017	3300046675	Bacteria	1563
1044	Ga0495599_0009089	3300046678	Bacteria	6057
1045	Ga0495599_0040946	3300046678	Bacteria	2909
1046	Ga0495623_0032015	3300046679	Bacteria	3381
1047	Ga0495623_0077871	3300046679	Bacteria	2055
1048	Ga0495646_0038625	3300046680	Bacteria	2946
1049	Ga0495646_0049233	3300046680	Bacteria	2558
1050	Ga0495646_0081889	3300046680	Bacteria	1879
1051	Ga0495646_0099812	3300046680	Bacteria	1666
1052	Ga0495646_0118953	3300046680	Bacteria	1496
1053	Ga0495658_0009116	3300046683	Bacteria	4933
1054	Ga0495658_0009935	3300046683	Bacteria	4748
1055	Ga0495669_0004055	3300046684	Bacteria	6024
1056	Ga0495613_0004290	3300046689	Bacteria	10684
1057	Ga0495613_0030188	3300046689	Bacteria	4027
1058	Ga0495613_0044560	3300046689	Bacteria	3282
1059	Ga0495624_0011028	3300046690	Bacteria	6221
1060	Ga0495624_0085515	3300046690	Bacteria	1948
1061	Ga0495624_0102866	3300046690	Bacteria	1758
1062	Ga0495624_0159925	3300046690	Bacteria	1376
1063	Ga0495624_0245141	3300046690	Bacteria	1084
1064	Ga0495670_0047295	3300046691	Bacteria	2150
1065	Ga0495670_0077865	3300046691	Bacteria	1686
1066	Ga0495670_0117013	3300046691	Bacteria	1383
1067	Ga0495671_0083248	3300046692	Bacteria	1568
1068	Ga0495671_0229599	3300046692	Bacteria	898
1069	Ga0495671_0238919	3300046692	Bacteria	878
1070	Ga0495649_0055578	3300046694	Bacteria	2138
1071	Ga0495649_0249179	3300046694	Bacteria	913
1072	Ga0495600_0015897	3300046809	Bacteria	4767
1073	Ga0495600_0052281	3300046809	Bacteria	2668
1074	Ga0495600_0073022	3300046809	Bacteria	2240
1075	Ga0495600_0091975	3300046809	Bacteria	1978
1076	Ga0495660_0053995	3300046810	Bacteria	2178
1077	Ga0495581_0003922	3300047315	Bacteria	8564
1078	Ga0495581_0067870	3300047315	Bacteria	2062
1079	Ga0495581_0240185	3300047315	Bacteria	1059
1080	Ga0495604_0002083	3300047317	Bacteria	16121
1081	Ga0495604_0012085	3300047317	Bacteria	6865
1082	Ga0495604_0113916	3300047317	Bacteria	1967
1083	Ga0495674_0010440	3300047319	Bacteria	8792
1084	Ga0495674_0026570	3300047319	Bacteria	5296
1085	Ga0495674_0027898	3300047319	Bacteria	5156
1086	Ga0495674_0225585	3300047319	Bacteria	1548
1087	Ga0495674_0258543	3300047319	Bacteria	1431
1088	Ga0495674_0263152	3300047319	Bacteria	1417
1089	Ga0495672_0073959	3300047320	Bacteria	1920
1090	Ga0495672_0105178	3300047320	Bacteria	1524
1091	Ga0495672_0116562	3300047320	Bacteria	1426
1092	Ga0495676_0056387	3300047321	Bacteria	3107
1093	Ga0495676_0135161	3300047321	Bacteria	1774
1094	Ga0495676_0234244	3300047321	Bacteria	1260
1095	Ga0495680_0032208	3300047322	Bacteria	4259
1096	Ga0495680_0079547	3300047322	Bacteria	2478
1097	Ga0495680_0130160	3300047322	Bacteria	1850
1098	Ga0495683_0084622	3300047323	Bacteria	1543
1099	Ga0495687_054832	3300047443	Bacteria	1670
1100	Ga0495675_0007148	3300047444	Bacteria	6873
1101	Ga0495675_0026805	3300047444	Bacteria	3673
1102	Ga0495675_0176306	3300047444	Bacteria	1311
1103	Ga0495677_0071752	3300047445	Bacteria	1291
1104	Ga0495673_0078121	3300047469	Bacteria	1377
1105	Ga0495673_0079319	3300047469	Bacteria	1363
1106	Ga0495681_0013164	3300047470	Bacteria	4818
1107	Ga0495684_0003716	3300047471	Bacteria	11899
1108	Ga0495684_0032067	3300047471	Bacteria	4033
1109	Ga0495686_0006759	3300047472	Bacteria	8713
1110	Ga0495686_0144506	3300047472	Bacteria	1401
1111	Ga0495686_0164594	3300047472	Bacteria	1293
1112	Ga0495686_0211647	3300047472	Bacteria	1107
1113	Ga0495593_0001221	3300047673	Bacteria	15023
1114	Ga0495593_0001881	3300047673	Bacteria	12503
1115	Ga0495593_0029270	3300047673	Bacteria	3021
1116	Ga0495593_0045849	3300047673	Bacteria	2331
1117	Ga0495602_0031559	3300048088	Bacteria	5007
1118	Ga0495602_0081589	3300048088	Bacteria	2718
1119	Ga0495602_0235559	3300048088	Bacteria	1372
1120	Ga0495614_0156968	3300048089	Bacteria	1017
1121	Ga0495615_0030412	3300048090	Bacteria	1289
1122	Ga0495626_0055884	3300048091	Bacteria	1808
1123	Ga0496100_0046217	3300048903	Bacteria	2798
1124	Ga0496100_0066241	3300048903	Bacteria	2395
1125	Ga0496100_0089191	3300048903	Bacteria	2100
1126	Ga0496100_0113769	3300048903	Bacteria	1884
1127	Ga0496100_0144076	3300048903	Bacteria	1692
1128	Ga0496100_0584713	3300048903	Bacteria	866
1129	Ga0496101_0189665	3300048904	Bacteria	1586
1130	Ga0496101_0250867	3300048904	Bacteria	1379
1131	Ga0496102_0001499	3300048905	Bacteria	20618
1132	Ga0496102_0036415	3300048905	Bacteria	4432
1133	Ga0496102_0102854	3300048905	Bacteria	2656
1134	Ga0496102_0107836	3300048905	Bacteria	2594
1135	Ga0496102_0163250	3300048905	Bacteria	2096
1136	Ga0496102_0249700	3300048905	Bacteria	1673
1137	Ga0496103_0008315	3300048906	Bacteria	6166
1138	Ga0496103_0134568	3300048906	Bacteria	1579
1139	Ga0496104_0006502	3300048907	Bacteria	10279
1140	Ga0496104_0010401	3300048907	Bacteria	8310
1141	Ga0496104_0161426	3300048907	Bacteria	2150
1142	Ga0496104_0484446	3300048907	Bacteria	1148
1143	Ga0496105_0017494	3300048908	Bacteria	5749
1144	Ga0496105_0043793	3300048908	Bacteria	3691
1145	Ga0496106_0012833	3300048909	Bacteria	6185
1146	Ga0496106_0055923	3300048909	Bacteria	2983
1147	Ga0496106_0083434	3300048909	Bacteria	2458
1148	Ga0496106_0579890	3300048909	Bacteria	899
1149	Ga0496107_0013894	3300048910	Bacteria	5629
1150	Ga0496107_0126626	3300048910	Bacteria	1884
1151	Ga0496107_0448945	3300048910	Bacteria	958
1152	Ga0496108_0278438	3300048911	Bacteria	1456
1153	Ga0496108_0470267	3300048911	Bacteria	1098
1154	Ga0496109_0023208	3300048912	Bacteria	5504
1155	Ga0496109_0472414	3300048912	Bacteria	1184
1156	Ga0496109_0787302	3300048912	Bacteria	889
1157	Ga0496110_0117802	3300048913	Bacteria	2392
1158	Ga0496110_0205008	3300048913	Bacteria	1792
1159	Ga0496111_0023916	3300048914	Bacteria	4294
1160	Ga0496111_0125845	3300048914	Bacteria	1894
1161	Ga0496111_0256592	3300048914	Bacteria	1297
1162	Ga0496112_0083094	3300048915	Bacteria	3167
1163	Ga0496112_0116881	3300048915	Bacteria	2637
1164	Ga0496112_0134592	3300048915	Bacteria	2442
1165	Ga0496112_0587544	3300048915	Bacteria	1046
1166	Ga0496113_0090322	3300048916	Bacteria	2359
1167	Ga0496113_0138135	3300048916	Bacteria	1916
1168	Ga0496113_0241523	3300048916	Bacteria	1441
1169	Ga0496113_0445929	3300048916	Bacteria	1040
1170	Ga0496115_0000715	3300048918	Bacteria	24587
1171	Ga0496115_0052515	3300048918	Bacteria	3270
1172	Ga0496116_0000395	3300048919	Bacteria	63403
1173	Ga0496116_0007150	3300048919	Bacteria	9980
1174	Ga0496116_0014338	3300048919	Bacteria	6335
1175	Ga0496116_0147761	3300048919	Bacteria	1311
1176	Ga0496117_0000002	3300048920	Bacteria	2483758
1177	Ga0496117_0011279	3300048920	Bacteria	8014
1178	Ga0496117_0015179	3300048920	Bacteria	6588
1179	Ga0496117_0026801	3300048920	Bacteria	4502
1180	Ga0496117_0035259	3300048920	Bacteria	3757
1181	Ga0496117_0045985	3300048920	Bacteria	3145
1182	Ga0496117_0051942	3300048920	Bacteria	2892
1183	Ga0496117_0056732	3300048920	Bacteria	2725
1184	Ga0496117_0112054	3300048920	Bacteria	1697
1185	Ga0496118_0001046	3300048921	Bacteria	43179
1186	Ga0496118_0013854	3300048921	Bacteria	7589
1187	Ga0496118_0019301	3300048921	Bacteria	6099
1188	Ga0496118_0024196	3300048921	Bacteria	5250
1189	Ga0496118_0024434	3300048921	Bacteria	5213
1190	Ga0496118_0040959	3300048921	Bacteria	3675
1191	Ga0496118_0058464	3300048921	Bacteria	2881
1192	Ga0496118_0070872	3300048921	Bacteria	2513
1193	Ga0496118_0095470	3300048921	Bacteria	2029
1194	Ga0496118_0099618	3300048921	Bacteria	1969
1195	Ga0496118_0118899	3300048921	Bacteria	1729
1196	Ga0496118_0124651	3300048921	Bacteria	1670
1197	Ga0496118_0232575	3300048921	Bacteria	1062
1198	Ga0496119_0001582	3300048922	Bacteria	27081
1199	Ga0496119_0029337	3300048922	Bacteria	3733
1200	Ga0496119_0034618	3300048922	Bacteria	3322
1201	Ga0496119_0044694	3300048922	Bacteria	2785
1202	Ga0496119_0048490	3300048922	Bacteria	2633
1203	Ga0496119_0056508	3300048922	Bacteria	2378
1204	Ga0496119_0071234	3300048922	Bacteria	2036
1205	Ga0496119_0102423	3300048922	Bacteria	1605
1206	Ga0496119_0116149	3300048922	Bacteria	1477
1207	Ga0496119_0121880	3300048922	Bacteria	1432
1208	Ga0496119_0257985	3300048922	Bacteria	876
1209	Ga0496120_0000498	3300048923	Bacteria	61391
1210	Ga0496120_0011542	3300048923	Bacteria	6067
1211	Ga0496120_0012942	3300048923	Bacteria	5647
1212	Ga0496120_0013372	3300048923	Bacteria	5530
1213	Ga0496120_0015046	3300048923	Bacteria	5120
1214	Ga0496120_0054792	3300048923	Bacteria	2258
1215	Ga0496120_0072192	3300048923	Bacteria	1892
1216	Ga0496120_0077410	3300048923	Bacteria	1810
1217	Ga0496121_0000001	3300048924	Bacteria	1830318
1218	Ga0496121_0001611	3300048924	Bacteria	37466
1219	Ga0496121_0005996	3300048924	Bacteria	15351
1220	Ga0496121_0020050	3300048924	Bacteria	6645
1221	Ga0496121_0024199	3300048924	Bacteria	5817
1222	Ga0496121_0025848	3300048924	Bacteria	5554
1223	Ga0496121_0027236	3300048924	Bacteria	5354
1224	Ga0496121_0030421	3300048924	Bacteria	4958
1225	Ga0496121_0031877	3300048924	Bacteria	4806
1226	Ga0496121_0039433	3300048924	Bacteria	4163
1227	Ga0496121_0040663	3300048924	Bacteria	4075
1228	Ga0496121_0047024	3300048924	Bacteria	3685
1229	Ga0496121_0051851	3300048924	Bacteria	3452
1230	Ga0496121_0058438	3300048924	Bacteria	3189
1231	Ga0496121_0081652	3300048924	Bacteria	2558
1232	Ga0496121_0129294	3300048924	Bacteria	1893
1233	Ga0496121_0135857	3300048924	Bacteria	1832
1234	Ga0496121_0136293	3300048924	Bacteria	1828
1235	Ga0496121_0202569	3300048924	Bacteria	1413
1236	Ga0496121_0229820	3300048924	Bacteria	1300
1237	Ga0496121_0307497	3300048924	Bacteria	1073
1238	Ga0496121_0366775	3300048924	Bacteria	954
1239	Ga0496122_0000001	3300048925	Bacteria	1827766
1240	Ga0496122_0000018	3300048925	Bacteria	426350
1241	Ga0496122_0000494	3300048925	Bacteria	81969
1242	Ga0496122_0001551	3300048925	Bacteria	36439
1243	Ga0496122_0010126	3300048925	Bacteria	9777
1244	Ga0496122_0022343	3300048925	Bacteria	5626
1245	Ga0496122_0044192	3300048925	Bacteria	3480
1246	Ga0496122_0064012	3300048925	Bacteria	2678
1247	Ga0496122_0113469	3300048925	Bacteria	1770
1248	Ga0496122_0116244	3300048925	Bacteria	1740
1249	Ga0496122_0179498	3300048925	Bacteria	1265
1250	Ga0496122_0264093	3300048925	Bacteria	953
1251	Ga0496123_0000001	3300048926	Bacteria	1831497
1252	Ga0496123_0000015	3300048926	Bacteria	426088
1253	Ga0496123_0000442	3300048926	Bacteria	74540
1254	Ga0496123_0000831	3300048926	Bacteria	49501
1255	Ga0496123_0004140	3300048926	Bacteria	15514
1256	Ga0496123_0006536	3300048926	Bacteria	11259
1257	Ga0496123_0011290	3300048926	Bacteria	7763
1258	Ga0496123_0034709	3300048926	Bacteria	3607
1259	Ga0496123_0049116	3300048926	Bacteria	2832
1260	Ga0496123_0053394	3300048926	Bacteria	2671
1261	Ga0496123_0066461	3300048926	Bacteria	2283
1262	Ga0496123_0082638	3300048926	Bacteria	1946
1263	Ga0496123_0112316	3300048926	Bacteria	1554
1264	Ga0496124_0000004	3300048927	Bacteria	976131
1265	Ga0496124_0000178	3300048927	Bacteria	126118
1266	Ga0496124_0002412	3300048927	Bacteria	24535
1267	Ga0496124_0003101	3300048927	Bacteria	20649
1268	Ga0496124_0004061	3300048927	Bacteria	17351
1269	Ga0496124_0008893	3300048927	Bacteria	10415
1270	Ga0496124_0010624	3300048927	Bacteria	9301
1271	Ga0496124_0080323	3300048927	Bacteria	2684
1272	Ga0496124_0135069	3300048927	Bacteria	1954
1273	Ga0496124_0170814	3300048927	Bacteria	1684
1274	Ga0496124_0250828	3300048927	Bacteria	1309
1275	Ga0496124_0259410	3300048927	Bacteria	1280
1276	Ga0496124_0280041	3300048927	Bacteria	1216
1277	Ga0496124_0303502	3300048927	Bacteria	1152
1278	Ga0496124_0373695	3300048927	Bacteria	999
1279	Ga0496124_0374313	3300048927	Bacteria	998
1280	Ga0496125_0000001	3300048928	Bacteria	1766138
1281	Ga0496125_0000306	3300048928	Bacteria	96360
1282	Ga0496125_0000422	3300048928	Bacteria	78615
1283	Ga0496125_0000446	3300048928	Bacteria	75321
1284	Ga0496125_0001702	3300048928	Bacteria	30686
1285	Ga0496125_0003425	3300048928	Bacteria	19234
1286	Ga0496125_0006203	3300048928	Bacteria	13023
1287	Ga0496125_0009867	3300048928	Bacteria	9715
1288	Ga0496125_0097325	3300048928	Bacteria	2181
1289	Ga0496125_0120478	3300048928	Bacteria	1873
1290	Ga0496125_0127686	3300048928	Bacteria	1798
1291	Ga0496125_0218919	3300048928	Bacteria	1229
1292	Ga0496126_0000212	3300048929	Bacteria	128871
1293	Ga0496126_0001402	3300048929	Bacteria	38138
1294	Ga0496126_0001831	3300048929	Bacteria	31033
1295	Ga0496126_0011325	3300048929	Bacteria	9248
1296	Ga0496126_0033777	3300048929	Bacteria	4812
1297	Ga0496126_0035472	3300048929	Bacteria	4675
1298	Ga0496126_0036157	3300048929	Bacteria	4620
1299	Ga0496126_0064481	3300048929	Bacteria	3281
1300	Ga0496126_0071154	3300048929	Bacteria	3097
1301	Ga0496126_0101569	3300048929	Bacteria	2515
1302	Ga0496126_0116808	3300048929	Bacteria	2318
1303	Ga0496126_0125103	3300048929	Bacteria	2226
1304	Ga0496126_0200641	3300048929	Bacteria	1685
1305	Ga0496126_0315586	3300048929	Bacteria	1286
1306	Ga0496126_0370793	3300048929	Bacteria	1167
1307	Ga0496126_0382415	3300048929	Bacteria	1145
1308	Ga0496126_0402189	3300048929	Bacteria	1110
1309	Ga0495682_0006772	3300049460	Bacteria	4620
1310	Ga0501031_0118919	3300049568	Bacteria	1726
1311	Ga0501032_0050458	3300049569	Bacteria	2806
1312	Ga0501032_0265028	3300049569	Bacteria	1114
1313	Ga0501033_0000204	3300049570	Bacteria	56743
1314	Ga0501033_0020873	3300049570	Bacteria	4944
1315	Ga0501033_0085487	3300049570	Bacteria	2310
1316	Ga0501033_0109304	3300049570	Bacteria	2013
1317	Ga0501033_0158450	3300049570	Bacteria	1630
1318	Ga0501034_0020745	3300049571	Bacteria	6707
1319	Ga0501034_0023398	3300049571	Bacteria	6296
1320	Ga0501034_0073934	3300049571	Bacteria	3417
1321	Ga0501034_0157093	3300049571	Bacteria	2247
1322	Ga0501034_0280820	3300049571	Bacteria	1604
1323	Ga0501034_0288844	3300049571	Bacteria	1578
1324	Ga0501034_0375599	3300049571	Bacteria	1347
1325	Ga0501037_0040272	3300049573	Bacteria	3438
1326	Ga0501038_0059138	3300049574	Bacteria	3284
1327	Ga0501038_0306922	3300049574	Bacteria	1244
1328	Ga0501039_0082770	3300049575	Bacteria	2499
1329	Ga0501042_0154684	3300049578	Bacteria	1654
1330	Ga0501042_0411611	3300049578	Bacteria	980
1331	Ga0501043_0059261	3300049579	Bacteria	3004
1332	Ga0501043_0228376	3300049579	Bacteria	1438
1333	Ga0501043_0242195	3300049579	Bacteria	1391
1334	Ga0501043_0332480	3300049579	Bacteria	1157
1335	Ga0501046_0037974	3300049580	Bacteria	3868
1336	Ga0501046_0427692	3300049580	Bacteria	954
1337	Ga0501047_0083954	3300049581	Bacteria	3061
1338	Ga0501047_0241327	3300049581	Bacteria	1658
1339	Ga0501047_0344760	3300049581	Bacteria	1327
1340	Ga0501048_0446510	3300049582	Bacteria	926
1341	Ga0501067_0151489	3300049583	Bacteria	1292
1342	Ga0501068_0183717	3300049584	Bacteria	1323
1343	Ga0501070_0150305	3300049586	Bacteria	1922
1344	Ga0501071_0342935	3300049587	Bacteria	1136
1345	Ga0501074_0132832	3300049590	Bacteria	1780
1346	Ga0501075_0503938	3300049591	Bacteria	924
1347	Ga0501076_0307203	3300049592	Bacteria	1301
1348	Ga0501077_0112045	3300049593	Bacteria	1729
1349	Ga0501077_0198108	3300049593	Bacteria	1276
1350	Ga0501077_0347926	3300049593	Bacteria	946
1351	Ga0501079_0147929	3300049741	Bacteria	1831
1352	Ga0501080_0003595	3300049742	Bacteria	13649
1353	Ga0501080_0133008	3300049742	Bacteria	2303
1354	Ga0501081_0500115	3300049743	Bacteria	906
1355	Ga0501083_0009239	3300049744	Bacteria	6961
1356	Ga0501083_0113429	3300049744	Bacteria	1781
1357	Ga0501035_0000181	3300049822	Bacteria	76816
1358	Ga0501035_0002632	3300049822	Bacteria	17501
1359	Ga0501035_0026310	3300049822	Bacteria	5324
1360	Ga0501035_0194728	3300049822	Bacteria	1741
1361	Ga0501044_0027833	3300049823	Bacteria	5967
1362	Ga0501044_0047516	3300049823	Bacteria	4439
1363	Ga0501044_0111714	3300049823	Bacteria	2740
1364	Ga0501044_0140360	3300049823	Bacteria	2405
1365	Ga0501044_0151234	3300049823	Bacteria	2303
1366	Ga0501044_0296666	3300049823	Bacteria	1546
1367	Ga0501044_0312521	3300049823	Bacteria	1497
1368	Ga0501044_0395239	3300049823	Bacteria	1296
1369	nmdc:mga03683_28692_c1	3300050489	Bacteria	2215
1370	nmdc:mga03683_29887_c1	3300050489	Bacteria	2176
1371	nmdc:mga03683_50641_c1	3300050489	Bacteria	1731
1372	nmdc:mga03683_68014_c1	3300050489	Bacteria	1517
1373	nmdc:mga03n38_157058_c1	3300050490	Bacteria	1149
1374	nmdc:mga03n38_29805_c1	3300050490	Bacteria	2287
1375	nmdc:mga03n38_6230_c1	3300050490	Bacteria	4128
1376	nmdc:mga00v17_26242_c1	3300050491	Bacteria	3393
1377	nmdc:mga00v17_3730_c1	3300050491	Bacteria	7864
1378	nmdc:mga00v17_38022_c1	3300050491	Bacteria	2876
1379	nmdc:mga00v17_402_c1	3300050491	Bacteria	23341
1380	nmdc:mga00v17_86817_c1	3300050491	Bacteria	1961
1381	nmdc:mga0yw44_111233_c1	3300050492	Bacteria	1755
1382	nmdc:mga0yw44_1582_c1	3300050492	Bacteria	9139
1383	nmdc:mga0yw44_17515_c1	3300050492	Bacteria	3901
1384	nmdc:mga0yw44_3323_c1	3300050492	Bacteria	7118
1385	nmdc:mga0yw44_336127_c1	3300050492	Bacteria	1015
1386	nmdc:mga0yw44_70854_c1	3300050492	Bacteria	2163
1387	nmdc:mga0yw44_7487_c1	3300050492	Bacteria	5376
1388	nmdc:mga0yw44_84204_c1	3300050492	Bacteria	1999
1389	nmdc:mga0yw44_9373_c1	3300050492	Bacteria	4945
1390	nmdc:mga0k408_131217_c1	3300050493	Bacteria	1487
1391	nmdc:mga0k408_139186_c1	3300050493	Bacteria	1443
1392	nmdc:mga0k408_170664_c1	3300050493	Bacteria	1297
1393	nmdc:mga0k408_83128_c1	3300050493	Bacteria	1877
1394	nmdc:mga06z11_138_c1	3300050494	Bacteria	28781
1395	nmdc:mga06z11_15467_c1	3300050494	Bacteria	3407
1396	nmdc:mga06z11_173153_c1	3300050494	Bacteria	1240
1397	nmdc:mga06z11_213518_c1	3300050494	Bacteria	1125
1398	nmdc:mga06z11_216399_c1	3300050494	Bacteria	1118
1399	nmdc:mga06z11_247277_c1	3300050494	Bacteria	1049
1400	nmdc:mga04h51_215_c1	3300050495	Bacteria	15530
1401	nmdc:mga07m45_31297_c1	3300050496	Bacteria	2949
1402	nmdc:mga05p37_139417_c1	3300050507	Bacteria	2972
1403	nmdc:mga05p37_150581_c1	3300050507	Bacteria	2846
1404	nmdc:mga05p37_482685_c1	3300050507	Bacteria	1427
1405	nmdc:mga05p37_500663_c1	3300050507	Bacteria	1394
1406	nmdc:mga09592_11254_c1	3300050508	Bacteria	7278
1407	nmdc:mga09592_326396_c1	3300050508	Bacteria	1329
1408	nmdc:mga09592_657682_c1	3300050508	Bacteria	894
1409	nmdc:mga09592_89881_c1	3300050508	Bacteria	2624
1410	nmdc:mga0qj67_37819_c1	3300050509	Bacteria	3783
1411	nmdc:mga0qj67_532509_c1	3300050509	Bacteria	943
1412	nmdc:mga0qj67_97487_c1	3300050509	Bacteria	2368
1413	nmdc:mga06r32_167927_c1	3300050510	Bacteria	2177
1414	nmdc:mga06r32_29168_c1	3300050510	Bacteria	5169
1415	nmdc:mga06r32_45817_c1	3300050510	Bacteria	4171
1416	nmdc:mga06r32_563290_c1	3300050510	Bacteria	1112
1417	nmdc:mga08y16_178442_c1	3300050511	Bacteria	2206
1418	nmdc:mga08y16_68767_c1	3300050511	Bacteria	3692
1419	nmdc:mga0n895_140271_c1	3300050512	Bacteria	2445
1420	nmdc:mga0n895_14886_c1	3300050512	Bacteria	7081
1421	nmdc:mga0n895_17037_c1	3300050512	Bacteria	6688
1422	nmdc:mga0n895_191293_c1	3300050512	Bacteria	2077
1423	nmdc:mga0n895_34517_c1	3300050512	Bacteria	4870
1424	nmdc:mga0n895_371893_c1	3300050512	Bacteria	1447
1425	nmdc:mga0rr50_14231_c1	3300050513	Bacteria	5211
1426	nmdc:mga0rr50_96277_c1	3300050513	Bacteria	2316
1427	nmdc:mga0a205_206046_c1	3300050515	Bacteria	1856
1428	nmdc:mga0a205_27552_c1	3300050515	Bacteria	5426
1429	nmdc:mga0a205_32189_c1	3300050515	Bacteria	5028
1430	nmdc:mga0sz30_11707_c1	3300050516	Bacteria	3395
1431	nmdc:mga0sz30_11773_c1	3300050516	Bacteria	3387
1432	nmdc:mga0sz30_1939_c2	3300050516	Bacteria	7086
1433	Ga0495601_0225450	3300053077	Bacteria	1224
1434	Ga0495601_0343281	3300053077	Bacteria	971
1435	Ga0500610_0068762	3300053079	Bacteria	1847
1436	Ga0500610_0160476	3300053079	Bacteria	1119
1437	Ga0500635_0003801	3300053080	Bacteria	3826
1438	Ga0495595_0003580	3300053084	Bacteria	6167
1439	Ga0495619_0021971	3300053085	Bacteria	4078
1440	Ga0495619_0034219	3300053085	Bacteria	3303
1441	Ga0495619_0082670	3300053085	Bacteria	2165
1442	Ga0495619_0242569	3300053085	Bacteria	1249
1443	Ga0495619_0279969	3300053085	Bacteria	1156
1444	Ga0495619_0317166	3300053085	Bacteria	1079
1445	Ga0495619_0335929	3300053085	Bacteria	1046
1446	Ga0500643_000111	3300053087	Bacteria	85038
1447	Ga0500643_038213	3300053087	Bacteria	1424
1448	Ga0500644_0003969	3300053088	Bacteria	3682
1449	Ga0500581_007747	3300053089	Bacteria	5135
1450	Ga0500583_0083708	3300053092	Bacteria	1544
1451	Ga0500566_0000384	3300053094	Bacteria	24438
1452	Ga0500566_0000737	3300053094	Bacteria	18368
1453	Ga0500566_0002635	3300053094	Bacteria	10685
1454	Ga0500566_0082170	3300053094	Bacteria	1791
1455	Ga0500640_000112	3300053095	Bacteria	14867
1456	Ga0500641_0014952	3300053096	Bacteria	2872
1457	Ga0500641_0045629	3300053096	Bacteria	1786
1458	Ga0500650_0017044	3300053098	Bacteria	3128
1459	Ga0500554_002199	3300053102	Bacteria	3797
1460	Ga0500555_001805	3300053103	Bacteria	6389
1461	Ga0500555_066011	3300053103	Bacteria	963
1462	Ga0500555_068498	3300053103	Bacteria	941
1463	Ga0500556_0000003	3300053104	Bacteria	679379
1464	Ga0500556_0000034	3300053104	Bacteria	145623
1465	Ga0500556_0000120	3300053104	Bacteria	68449
1466	Ga0500560_001158	3300053107	Bacteria	4364
1467	Ga0500569_002182	3300053109	Bacteria	3819
1468	Ga0500569_007518	3300053109	Bacteria	2450
1469	Ga0500569_009642	3300053109	Bacteria	2250
1470	Ga0500572_000043	3300053111	Bacteria	38357
1471	Ga0500572_001174	3300053111	Bacteria	7502
1472	Ga0500572_017574	3300053111	Bacteria	1839
1473	Ga0500592_002793	3300053116	Bacteria	2811
1474	Ga0500593_000509	3300053117	Bacteria	15242
1475	Ga0500595_031531	3300053119	Bacteria	1778
1476	Ga0500595_033867	3300053119	Bacteria	1692
1477	Ga0500607_024986	3300053121	Bacteria	3330
1478	Ga0500608_018511	3300053122	Bacteria	3178
1479	Ga0500614_000928	3300053123	Bacteria	7319
1480	Ga0500618_000459	3300053125	Bacteria	26538
1481	Ga0500618_004150	3300053125	Bacteria	4733
1482	Ga0500618_006208	3300053125	Bacteria	3530
1483	Ga0500642_0000015	3300053130	Bacteria	181424
1484	Ga0500642_0006832	3300053130	Bacteria	3791
1485	Ga0500652_000004	3300053131	Bacteria	173428
1486	Ga0500652_001789	3300053131	Bacteria	6518
1487	Ga0500658_0008295	3300053134	Bacteria	3838
1488	Ga0500658_0059034	3300053134	Bacteria	1590
1489	Ga0500559_0000082	3300053136	Bacteria	75166
1490	Ga0500559_0002162	3300053136	Bacteria	10440
1491	Ga0500559_0006112	3300053136	Bacteria	5452
1492	Ga0500559_0018688	3300053136	Bacteria	2926
1493	Ga0500559_0046075	3300053136	Bacteria	1911
1494	Ga0500568_0000234	3300053139	Bacteria	47531
1495	Ga0500568_0020409	3300053139	Bacteria	2866
1496	Ga0500568_0027627	3300053139	Bacteria	2371
1497	Ga0500568_0055377	3300053139	Bacteria	1548
1498	Ga0500568_0062652	3300053139	Bacteria	1436
1499	Ga0500588_0025498	3300053146	Bacteria	1644
1500	Ga0500590_025852	3300053148	Bacteria	3048
1501	Ga0500603_000820	3300053150	Bacteria	7420
1502	Ga0500603_000845	3300053150	Bacteria	7305
1503	Ga0500604_0001913	3300053151	Bacteria	5778
1504	Ga0500604_0062483	3300053151	Bacteria	1172
1505	Ga0500604_0080385	3300053151	Bacteria	1052
1506	Ga0500616_0000114	3300053153	Bacteria	148574
1507	Ga0500616_0000437	3300053153	Bacteria	55094
1508	Ga0500616_0004031	3300053153	Bacteria	10688
1509	Ga0500616_0008067	3300053153	Bacteria	6591
1510	Ga0500616_0036694	3300053153	Bacteria	2659
1511	Ga0500616_0051123	3300053153	Bacteria	2179
1512	Ga0500616_0080256	3300053153	Bacteria	1641
1513	Ga0500622_0004832	3300053156	Bacteria	8267
1514	Ga0500622_0025373	3300053156	Bacteria	3131
1515	Ga0500622_0030531	3300053156	Bacteria	2829
1516	Ga0500624_001395	3300053157	Bacteria	4019
1517	Ga0500624_003921	3300053157	Bacteria	1952
1518	Ga0500627_0031755	3300053158	Bacteria	2221
1519	Ga0500627_0146109	3300053158	Bacteria	1068
1520	Ga0500627_0148049	3300053158	Bacteria	1061
1521	Ga0500627_0166068	3300053158	Bacteria	995
1522	Ga0500627_0202969	3300053158	Bacteria	888
1523	Ga0500630_004192	3300053159	Bacteria	7001
1524	Ga0500634_0000008	3300053161	Bacteria	152203
1525	Ga0500634_0020268	3300053161	Bacteria	3594
1526	Ga0500634_0063823	3300053161	Bacteria	1947
1527	Ga0500639_000136	3300053163	Bacteria	35338
1528	Ga0500639_030649	3300053163	Bacteria	2843
1529	Ga0500636_0000057	3300053177	Bacteria	53579
1530	Ga0500636_0000158	3300053177	Bacteria	35449
1531	Ga0500636_0031456	3300053177	Bacteria	3141
1532	Ga0500636_0036850	3300053177	Bacteria	2894
1533	Ga0500636_0076488	3300053177	Bacteria	1935
1534	Ga0500636_0082016	3300053177	Bacteria	1857
1535	Ga0500637_0003803	3300053178	Bacteria	7022
1536	Ga0500645_006846	3300053730	Bacteria	4027
1537	Ga0500645_037385	3300053730	Bacteria	1442
1538	Ga0500645_039396	3300053730	Bacteria	1400
1539	Ga0500645_040644	3300053730	Bacteria	1375
1540	Ga0500596_001597	3300053735	Bacteria	4591
1541	Ga0500596_007340	3300053735	Bacteria	1811
1542	Ga0500601_000010	3300053737	Bacteria	45442
1543	Ga0501082_0689397	3300060353	Bacteria	894
1544	Ga0466962_0216899	3300061719	Bacteria	936
1545	Ga0530510_0030919	3300061734	Bacteria	3847

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300031241	Ga0265325_10033233	Ga0265325_100332333	219
2	3300042532	Ga0450893_0023476	Ga0450893_0023476_12_704	225
3	3300049573	Ga0501037_0040272	Ga0501037_0040272_2567_3379	232
4	3300049574	Ga0501038_0059138	Ga0501038_0059138_1865_2677	232
5	3300046460	Ga0495638_0149914	Ga0495638_0149914_484_1257	233
6	3300006942	Ga0099824_1015712	Ga0099824_10157124	234
7	3300036647	Ga0316582_0367394	Ga0316582_0367394_21_725	234
8	3300046506	Ga0495583_0146721	Ga0495583_0146721_92_796	234
9	3300046515	Ga0495620_0035038	Ga0495620_0035038_92_796	234
10	3300046518	Ga0495631_0083454	Ga0495631_0083454_647_1351	234
11	3300046660	Ga0495625_0182791	Ga0495625_0182791_672_1376	234
12	3300048906	Ga0496103_0134568	Ga0496103_0134568_862_1566	234
13	3300049578	Ga0501042_0154684	Ga0501042_0154684_559_1263	234
14	3300049741	Ga0501079_0147929	Ga0501079_0147929_277_981	234
15	3300053089	Ga0500581_007747	Ga0500581_007747_3393_4097	234
16	3300053151	Ga0500604_0062483	Ga0500604_0062483_31_735	234
17	3300053158	Ga0500627_0166068	Ga0500627_0166068_24_728	234
18	3300061734	Ga0530510_0030919	Ga0530510_0030919_1600_2304	234
19	3300049569	Ga0501032_0050458	Ga0501032_0050458_325_1137	235
20	3300049570	Ga0501033_0109304	Ga0501033_0109304_212_1030	235
21	3300049578	Ga0501042_0411611	Ga0501042_0411611_10_822	235
22	3300049584	Ga0501068_0183717	Ga0501068_0183717_351_1163	235
23	3300049823	Ga0501044_0312521	Ga0501044_0312521_227_1045	235
24	3300053104	Ga0500556_0000034	Ga0500556_0000034_110929_111792	235
25	iso_pu_bacteria	2551306087	2551701837	237
26	3300047469	Ga0495673_0079319	Ga0495673_0079319_357_1181	238
27	iso_pu_bacteria	2987645492	2987652085	238
28	3300053085	Ga0495619_0317166	Ga0495619_0317166_342_1061	239
29	3300053103	Ga0500555_068498	Ga0500555_068498_10_732	240
30	3300021388	Ga0213875_10002356	Ga0213875_1000235611	242
31	3300037312	Ga0395899_0155947	Ga0395899_0155947_163_939	242
32	3300037853	Ga0436364_0173332	Ga0436364_0173332_5333_6106	242
33	3300038443	Ga0395901_0420692	Ga0395901_0420692_354_1130	242
34	iso_pu_bacteria	2869242130	2869246757	242
35	3300039437	Ga0436365_0424934	Ga0436365_0424934_149_925	244
36	3300005456	Ga0070678_100167262	Ga0070678_1001672622	245
37	3300026121	Ga0207683_10034882	Ga0207683_100348822	245
38	3300028379	Ga0268266_10592937	Ga0268266_105929372	245
39	3300035725	Ga0373947_0256291	Ga0373947_0256291_61_837	245
40	3300046517	Ga0495630_0124304	Ga0495630_0124304_586_1362	245
41	3300047319	Ga0495674_0263152	Ga0495674_0263152_541_1317	245
42	3300053085	Ga0495619_0335929	Ga0495619_0335929_36_812	245
43	3300053103	Ga0500555_066011	Ga0500555_066011_59_883	245
44	3300005530	Ga0070679_100079942	Ga0070679_1000799424	247
45	3300006028	Ga0070717_10079957	Ga0070717_100799572	247
46	3300035111	Ga0373923_0074972	Ga0373923_0074972_47_823	247
47	3300035117	Ga0373953_0021584	Ga0373953_0021584_826_1602	247
48	3300035118	Ga0373954_0055652	Ga0373954_0055652_220_996	247
49	3300035119	Ga0373956_0015982	Ga0373956_0015982_1846_2622	247
50	3300035172	Ga0373955_0035349	Ga0373955_0035349_915_1691	247
51	3300035410	Ga0373924_0049853	Ga0373924_0049853_244_1020	247
52	3300036401	Ga0373937_0003671	Ga0373937_0003671_1952_2728	247
53	3300046454	Ga0495592_0255148	Ga0495592_0255148_178_954	247
54	3300046499	Ga0495594_0230965	Ga0495594_0230965_240_1016	247
55	3300046559	Ga0495667_0023719	Ga0495667_0023719_2456_3232	247
56	3300048915	Ga0496112_0587544	Ga0496112_0587544_174_971	247
57	3300050494	nmdc:mga06z11_173153_c1	nmdc:mga06z11_173153_c1_487_1230	247
58	3300050511	nmdc:mga08y16_178442_c1	nmdc:mga08y16_178442_c1_1317_2060	247
59	3300050515	nmdc:mga0a205_27552_c1	nmdc:mga0a205_27552_c1_2844_3587	247
60	3300053077	Ga0495601_0343281	Ga0495601_0343281_205_948	247
61	3300053085	Ga0495619_0082670	Ga0495619_0082670_510_1286	247
62	3300053153	Ga0500616_0000114	Ga0500616_0000114_144073_144816	247
63	3300005329	Ga0070683_100070049	Ga0070683_1000700492	248
64	3300005535	Ga0070684_100006610	Ga0070684_1000066105	248
65	3300021384	Ga0213876_10173912	Ga0213876_101739122	248
66	3300025944	Ga0207661_10000210	Ga0207661_100002103	248
67	3300039437	Ga0436365_1484737	Ga0436365_1484737_166_942	248
68	3300044842	Ga0466957_0211810	Ga0466957_0211810_76_870	248
69	3300049583	Ga0501067_0151489	Ga0501067_0151489_405_1187	248
70	3300049823	Ga0501044_0151234	Ga0501044_0151234_465_1214	249
71	3300028800	Ga0265338_10034583	Ga0265338_100345833	250
72	3300049569	Ga0501032_0265028	Ga0501032_0265028_208_999	251
73	iso_pu_bacteria	2551306089	2551712836	251
74	3300006847	Ga0075431_100334092	Ga0075431_1003340922	252
75	iso_pu_bacteria	2513237165	2514044906	252
76	iso_pu_bacteria	2643221621	2644121843	252
77	iso_pu_bacteria	2643221637	2644209544	252
78	iso_pu_bacteria	2643221718	2644653072	252
79	iso_pu_bacteria	2738541281	2738747351	252
80	iso_pu_bacteria	2738543032	2739356580	252
81	iso_pu_bacteria	2857537821	2857541524	252
82	iso_pu_bacteria	2858950400	2858953021	252
83	iso_pu_bacteria	2904434214	2904437148	252
84	iso_pu_bacteria	2937861824	2937864285	252
85	iso_pu_bacteria	643348564	643601863	252
86	3300048903	Ga0496100_0113769	Ga0496100_0113769_316_1095	253
87	3300048903	Ga0496100_0584713	Ga0496100_0584713_17_778	253
88	3300048904	Ga0496101_0250867	Ga0496101_0250867_396_1184	253
89	iso_pu_bacteria	2545555834	2545678542	253
90	iso_pu_bacteria	2599185156	2599332592	253
91	iso_pu_bacteria	2643221629	2644169498	253
92	iso_pu_bacteria	2842922631	2842922865	253
93	iso_pu_bacteria	2857542790	2857546076	253
94	iso_pu_bacteria	2876386047	2876391557	253
95	iso_pu_bacteria	2902330777	2902334974	253
96	iso_pu_bacteria	3003665799	3003671384	253
97	iso_pu_bacteria	641522639	641643104	253
98	iso_pu_bacteria	8054460903	8054464695	253
99	3300003659	JGI25404J52841_10032380	JGI25404J52841_100323802	254
100	3300005468	Ga0070707_100133288	Ga0070707_1001332882	254
101	3300005616	Ga0068852_100349959	Ga0068852_1003499592	254
102	3300031251	Ga0265327_10012066	Ga0265327_100120663	254
103	3300037312	Ga0395899_0000470	Ga0395899_0000470_19649_20425	254
104	3300037418	Ga0395900_0019863	Ga0395900_0019863_151_927	254
105	3300037471	Ga0395905_0005543	Ga0395905_0005543_6385_7167	254
106	3300044712	Ga0453684_0000142	Ga0453684_0000142_158781_159548	254
107	iso_pu_bacteria	2503198000	2503199743	254
108	iso_pu_bacteria	2508501114	2509076942	254
109	iso_pu_bacteria	2508501122	2509112425	254
110	iso_pu_bacteria	2508501123	2509116684	254
111	iso_pu_bacteria	2508501127	2509142439	254
112	iso_pu_bacteria	2509276018	2509372028	254
113	iso_pu_bacteria	2509276019	2509379902	254
114	iso_pu_bacteria	2509276021	2509389022	254
115	iso_pu_bacteria	2509276022	2509394670	254
116	iso_pu_bacteria	2509276033	2509444613	254
117	iso_pu_bacteria	2510065019	2510135640	254
118	iso_pu_bacteria	2510065057	2510305766	254
119	iso_pu_bacteria	2510065059	2510318748	254
120	iso_pu_bacteria	2510461069	2510838902	254
121	iso_pu_bacteria	2510461076	2510897109	254
122	iso_pu_bacteria	2510917022	2511137200	254
123	iso_pu_bacteria	2510917026	2511170672	254
124	iso_pu_bacteria	2510917028	2511185362	254
125	iso_pu_bacteria	2510917030	2511194304	254
126	iso_pu_bacteria	2511231027	2511389656	254
127	iso_pu_bacteria	2511231052	2511497480	254
128	iso_pu_bacteria	2512047086	2512529930	254
129	iso_pu_bacteria	2512875016	2512932839	254
130	iso_pu_bacteria	2512875024	2512960860	254
131	iso_pu_bacteria	2512875026	2512969843	254
132	iso_pu_bacteria	2513237084	2513570802	254
133	iso_pu_bacteria	2513237085	2513574985	254
134	iso_pu_bacteria	2513237086	2513581916	254
135	iso_pu_bacteria	2513237088	2513595582	254
136	iso_pu_bacteria	2513237089	2513602999	254
137	iso_pu_bacteria	2513237090	2513608950	254
138	iso_pu_bacteria	2513237091	2513615272	254
139	iso_pu_bacteria	2513237093	2513633768	254
140	iso_pu_bacteria	2513237103	2513707616	254
141	iso_pu_bacteria	2513237138	2513865407	254
142	iso_pu_bacteria	2513237140	2513884646	254
143	iso_pu_bacteria	2513237143	2513901358	254
144	iso_pu_bacteria	2513237144	2513910966	254
145	iso_pu_bacteria	2513237146	2513924276	254
146	iso_pu_bacteria	2513237156	2513984345	254
147	iso_pu_bacteria	2513237159	2513998380	254
148	iso_pu_bacteria	2513237160	2514004630	254
149	iso_pu_bacteria	2513237162	2514023648	254
150	iso_pu_bacteria	2513237164	2514036631	254
151	iso_pu_bacteria	2513237305	2514417442	254
152	iso_pu_bacteria	2513237351	2514586899	254
153	iso_pu_bacteria	2515075009	2515114803	254
154	iso_pu_bacteria	2515154107	2515609760	254
155	iso_pu_bacteria	2515154113	2515635843	254
156	iso_pu_bacteria	2515154114	2515641457	254
157	iso_pu_bacteria	2515154116	2515659346	254
158	iso_pu_bacteria	2515154134	2515741212	254
159	iso_pu_bacteria	2516143018	2516207822	254
160	iso_pu_bacteria	2516653046	2516896865	254
161	iso_pu_bacteria	2516653077	2517038419	254
162	iso_pu_bacteria	2516653085	2517078697	254
163	iso_pu_bacteria	2517093000	2517097439	254
164	iso_pu_bacteria	2517287029	2517408893	254
165	iso_pu_bacteria	2517487022	2517565277	254
166	iso_pu_bacteria	2519899620	2520379209	254
167	iso_pu_bacteria	2523231067	2523467403	254
168	iso_pu_bacteria	2524023207	2524451350	254
169	iso_pu_bacteria	2524023209	2524461910	254
170	iso_pu_bacteria	2529292951	2530648373	254
171	iso_pu_bacteria	2534681796	2535514604	254
172	iso_pu_bacteria	2537561587	2537877316	254
173	iso_pu_bacteria	2551306084	2551675459	254
174	iso_pu_bacteria	2551306085	2551688467	254
175	iso_pu_bacteria	2551306090	2551721014	254
176	iso_pu_bacteria	2554235003	2554246213	254
177	iso_pu_bacteria	2558860100	2558861582	254
178	iso_pu_bacteria	2558860242	2559293436	254
179	iso_pu_bacteria	2582581283	2585166629	254
180	iso_pu_bacteria	2582581294	2585201249	254
181	iso_pu_bacteria	2582581298	2585223219	254
182	iso_pu_bacteria	2582581299	2585230922	254
183	iso_pu_bacteria	2582581304	2585256386	254
184	iso_pu_bacteria	2582581306	2585267035	254
185	iso_pu_bacteria	2582581307	2585273412	254
186	iso_pu_bacteria	2582581308	2585283136	254
187	iso_pu_bacteria	2582581315	2585328248	254
188	iso_pu_bacteria	2582581316	2585330662	254
189	iso_pu_bacteria	2582581865	2585388076	254
190	iso_pu_bacteria	2582581866	2585396567	254
191	iso_pu_bacteria	2582581867	2585399055	254
192	iso_pu_bacteria	2585427526	2585523988	254
193	iso_pu_bacteria	2585427527	2585535963	254
194	iso_pu_bacteria	2585427528	2585542146	254
195	iso_pu_bacteria	2585427529	2585546185	254
196	iso_pu_bacteria	2585427530	2585556688	254
197	iso_pu_bacteria	2585427531	2585564059	254
198	iso_pu_bacteria	2585427590	2585818824	254
199	iso_pu_bacteria	2585427593	2585840658	254
200	iso_pu_bacteria	2585427594	2585843729	254
201	iso_pu_bacteria	2585427608	2585900260	254
202	iso_pu_bacteria	2585427609	2585909214	254
203	iso_pu_bacteria	2585427633	2585998391	254
204	iso_pu_bacteria	2585427634	2586002953	254
205	iso_pu_bacteria	2585428125	2587984684	254
206	iso_pu_bacteria	2597489875	2597811051	254
207	iso_pu_bacteria	2599185170	2599419768	254
208	iso_pu_bacteria	2599185210	2599604319	254
209	iso_pu_bacteria	2599185236	2599718627	254
210	iso_pu_bacteria	2599185301	2599939830	254
211	iso_pu_bacteria	2599185352	2600196773	254
212	iso_pu_bacteria	2600254933	2600376771	254
213	iso_pu_bacteria	2600255279	2601609545	254
214	iso_pu_bacteria	2600255308	2601746320	254
215	iso_pu_bacteria	2615840624	2616293989	254
216	iso_pu_bacteria	2615840626	2616311222	254
217	iso_pu_bacteria	2615840698	2616556025	254
218	iso_pu_bacteria	2617270742	2617380767	254
219	iso_pu_bacteria	2643221557	2643806424	254
220	iso_pu_bacteria	2643221558	2643814331	254
221	iso_pu_bacteria	2643221568	2643857572	254
222	iso_pu_bacteria	2643221580	2643909558	254
223	iso_pu_bacteria	2643221582	2643920592	254
224	iso_pu_bacteria	2643221591	2643964814	254
225	iso_pu_bacteria	2643221595	2643987581	254
226	iso_pu_bacteria	2643221599	2644004444	254
227	iso_pu_bacteria	2643221603	2644026788	254
228	iso_pu_bacteria	2643221607	2644052315	254
229	iso_pu_bacteria	2643221610	2644067321	254
230	iso_pu_bacteria	2643221618	2644110379	254
231	iso_pu_bacteria	2643221623	2644131828	254
232	iso_pu_bacteria	2643221626	2644144923	254
233	iso_pu_bacteria	2643221627	2644157898	254
234	iso_pu_bacteria	2643221634	2644191243	254
235	iso_pu_bacteria	2643221636	2644201302	254
236	iso_pu_bacteria	2643221643	2644237629	254
237	iso_pu_bacteria	2643221655	2644307131	254
238	iso_pu_bacteria	2643221659	2644337017	254
239	iso_pu_bacteria	2643221668	2644380092	254
240	iso_pu_bacteria	2643221674	2644411135	254
241	iso_pu_bacteria	2643221675	2644418409	254
242	iso_pu_bacteria	2643221680	2644451776	254
243	iso_pu_bacteria	2643221686	2644484593	254
244	iso_pu_bacteria	2643221688	2644494997	254
245	iso_pu_bacteria	2643221689	2644499381	254
246	iso_pu_bacteria	2643221693	2644519598	254
247	iso_pu_bacteria	2643221698	2644540657	254
248	iso_pu_bacteria	2643221712	2644613211	254
249	iso_pu_bacteria	2643221723	2644674673	254
250	iso_pu_bacteria	2643221726	2644687203	254
251	iso_pu_bacteria	2657244999	2657683594	254
252	iso_pu_bacteria	2667528174	2671115888	254
253	iso_pu_bacteria	2687453392	2688596994	254
254	iso_pu_bacteria	2690316117	2692319357	254
255	iso_pu_bacteria	2693429783	2694630257	254
256	iso_pu_bacteria	2693429784	2694635591	254
257	iso_pu_bacteria	2718217882	2719183304	254
258	iso_pu_bacteria	2718217927	2719388062	254
259	iso_pu_bacteria	2718217997	2719667685	254
260	iso_pu_bacteria	2718218009	2719734021	254
261	iso_pu_bacteria	2718218199	2720494105	254
262	iso_pu_bacteria	2718218232	2720615569	254
263	iso_pu_bacteria	2718218233	2720622352	254
264	iso_pu_bacteria	2718218235	2720633706	254
265	iso_pu_bacteria	2718218269	2720777406	254
266	iso_pu_bacteria	2718218363	2721149416	254
267	iso_pu_bacteria	2718218365	2721160819	254
268	iso_pu_bacteria	2718218366	2721166253	254
269	iso_pu_bacteria	2718218423	2721401695	254
270	iso_pu_bacteria	2721755514	2722842423	254
271	iso_pu_bacteria	2721755556	2723029003	254
272	iso_pu_bacteria	2721755684	2723562619	254
273	iso_pu_bacteria	2721755685	2723569313	254
274	iso_pu_bacteria	2721755686	2723574147	254
275	iso_pu_bacteria	2721755809	2724040509	254
276	iso_pu_bacteria	2721755810	2724046777	254
277	iso_pu_bacteria	2721755819	2724092013	254
278	iso_pu_bacteria	2721755822	2724106578	254
279	iso_pu_bacteria	2721755823	2724112385	254
280	iso_pu_bacteria	2724679232	2725949729	254
281	iso_pu_bacteria	2728369352	2730109939	254
282	iso_pu_bacteria	2728369365	2730166539	254
283	iso_pu_bacteria	2728369397	2730300451	254
284	iso_pu_bacteria	2738541293	2738800804	254
285	iso_pu_bacteria	2738541317	2738946730	254
286	iso_pu_bacteria	2738541333	2739037381	254
287	iso_pu_bacteria	2738543024	2739307375	254
288	iso_pu_bacteria	2738543031	2739347846	254
289	iso_pu_bacteria	2751185821	2753463181	254
290	iso_pu_bacteria	2756170246	2756670962	254
291	iso_pu_bacteria	2758568016	2758641702	254
292	iso_pu_bacteria	2765235802	2765464831	254
293	iso_pu_bacteria	2765235942	2766067191	254
294	iso_pu_bacteria	2767802442	2770195244	254
295	iso_pu_bacteria	2775506902	2776270811	254
296	iso_pu_bacteria	2775506904	2776280366	254
297	iso_pu_bacteria	2775507049	2776915937	254
298	iso_pu_bacteria	2775507266	2778179445	254
299	iso_pu_bacteria	2791355082	2792584635	254
300	iso_pu_bacteria	2791355091	2792621436	254
301	iso_pu_bacteria	2791355092	2792627876	254
302	iso_pu_bacteria	2791355094	2792643661	254
303	iso_pu_bacteria	2791355123	2792748252	254
304	iso_pu_bacteria	2791355256	2793298430	254
305	iso_pu_bacteria	2791355259	2793315729	254
306	iso_pu_bacteria	2791355260	2793323512	254
307	iso_pu_bacteria	2791355261	2793327541	254
308	iso_pu_bacteria	2791355262	2793335612	254
309	iso_pu_bacteria	2791355263	2793341006	254
310	iso_pu_bacteria	2791355264	2793350315	254
311	iso_pu_bacteria	2791355265	2793354741	254
312	iso_pu_bacteria	2791355266	2793358563	254
313	iso_pu_bacteria	2791355267	2793369014	254
314	iso_pu_bacteria	2802428858	2802716271	254
315	iso_pu_bacteria	2802428859	2802722691	254
316	iso_pu_bacteria	2802428860	2802729166	254
317	iso_pu_bacteria	2802428861	2802735559	254
318	iso_pu_bacteria	2802428862	2802741866	254
319	iso_pu_bacteria	2802428863	2802748316	254
320	iso_pu_bacteria	2802429268	2804754463	254
321	iso_pu_bacteria	2802429605	2805928939	254
322	iso_pu_bacteria	2802429606	2805934560	254
323	iso_pu_bacteria	2802429633	2806047108	254
324	iso_pu_bacteria	2802429634	2806054893	254
325	iso_pu_bacteria	2802429635	2806061879	254
326	iso_pu_bacteria	2802429636	2806069598	254
327	iso_pu_bacteria	2802429637	2806076031	254
328	iso_pu_bacteria	2808606387	2808986794	254
329	iso_pu_bacteria	2818991272	2819244849	254
330	iso_pu_bacteria	2818991439	2819556867	254
331	iso_pu_bacteria	2818991448	2819612505	254
332	iso_pu_bacteria	2818991453	2819643340	254
333	iso_pu_bacteria	2818991461	2819685790	254
334	iso_pu_bacteria	2821123053	2821123180	254
335	iso_pu_bacteria	2837678835	2837680509	254
336	iso_pu_bacteria	2838016132	2838020912	254
337	iso_pu_bacteria	2838022645	2838026817	254
338	iso_pu_bacteria	2838029111	2838033909	254
339	iso_pu_bacteria	2838035591	2838039701	254
340	iso_pu_bacteria	2838042994	2838044886	254
341	iso_pu_bacteria	2838048938	2838052939	254
342	iso_pu_bacteria	2838061910	2838064732	254
343	iso_pu_bacteria	2838068647	2838070492	254
344	iso_pu_bacteria	2838074704	2838075868	254
345	iso_pu_bacteria	2838661181	2838663977	254
346	iso_pu_bacteria	2838668709	2838672564	254
347	iso_pu_bacteria	2838675328	2838677604	254
348	iso_pu_bacteria	2838680041	2838685555	254
349	iso_pu_bacteria	2838686498	2838689870	254
350	iso_pu_bacteria	2838694306	2838695989	254
351	iso_pu_bacteria	2838701080	2838705113	254
352	iso_pu_bacteria	2838707686	2838713388	254
353	iso_pu_bacteria	2838714209	2838716493	254
354	iso_pu_bacteria	2838719591	2838719707	254
355	iso_pu_bacteria	2838724970	2838727244	254
356	iso_pu_bacteria	2838729681	2838731434	254
357	iso_pu_bacteria	2838736955	2838739796	254
358	iso_pu_bacteria	2838742623	2838744375	254
359	iso_pu_bacteria	2839993093	2839994753	254
360	iso_pu_bacteria	2840764183	2840767612	254
361	iso_pu_bacteria	2841734538	2841737492	254
362	iso_pu_bacteria	2841840854	2841844080	254
363	iso_pu_bacteria	2841846520	2841846638	254
364	iso_pu_bacteria	2841851746	2841852915	254
365	iso_pu_bacteria	2841859092	2841860832	254
366	iso_pu_bacteria	2841864319	2841870239	254
367	iso_pu_bacteria	2842077413	2842082622	254
368	iso_pu_bacteria	2842110456	2842112778	254
369	iso_pu_bacteria	2842118031	2842123819	254
370	iso_pu_bacteria	2842124991	2842127333	254
371	iso_pu_bacteria	2842130223	2842132497	254
372	iso_pu_bacteria	2842140634	2842143801	254
373	iso_pu_bacteria	2842146304	2842150107	254
374	iso_pu_bacteria	2842152218	2842152334	254
375	iso_pu_bacteria	2842156927	2842160242	254
376	iso_pu_bacteria	2842163707	2842165780	254
377	iso_pu_bacteria	2842170452	2842172738	254
378	iso_pu_bacteria	2842175837	2842175953	254
379	iso_pu_bacteria	2842180545	2842184092	254
380	iso_pu_bacteria	2842187318	2842189600	254
381	iso_pu_bacteria	2842192696	2842196397	254
382	iso_pu_bacteria	2842198810	2842202466	254
383	iso_pu_bacteria	2842205361	2842208878	254
384	iso_pu_bacteria	2842211629	2842213914	254
385	iso_pu_bacteria	2842217011	2842219456	254
386	iso_pu_bacteria	2842224351	2842224468	254
387	iso_pu_bacteria	2842229732	2842231674	254
388	iso_pu_bacteria	2842237096	2842242874	254
389	iso_pu_bacteria	2842243621	2842245857	254
390	iso_pu_bacteria	2842250916	2842254793	254
391	iso_pu_bacteria	2842257432	2842260235	254
392	iso_pu_bacteria	2842264693	2842267122	254
393	iso_pu_bacteria	2842271015	2842273646	254
394	iso_pu_bacteria	2842278818	2842282432	254
395	iso_pu_bacteria	2842285085	2842290030	254
396	iso_pu_bacteria	2842291075	2842296947	254
397	iso_pu_bacteria	2842298080	2842299977	254
398	iso_pu_bacteria	2842304105	2842308502	254
399	iso_pu_bacteria	2842311132	2842312194	254
400	iso_pu_bacteria	2842317721	2842321787	254
401	iso_pu_bacteria	2842341865	2842344685	254
402	iso_pu_bacteria	2842357229	2842362629	254
403	iso_pu_bacteria	2842363717	2842367740	254
404	iso_pu_bacteria	2842370503	2842376059	254
405	iso_pu_bacteria	2842377471	2842383269	254
406	iso_pu_bacteria	2842384541	2842390402	254
407	iso_pu_bacteria	2842395702	2842397871	254
408	iso_pu_bacteria	2842402390	2842407639	254
409	iso_pu_bacteria	2842409023	2842414270	254
410	iso_pu_bacteria	2842415677	2842420870	254
411	iso_pu_bacteria	2842422224	2842424106	254
412	iso_pu_bacteria	2842428310	2842431182	254
413	iso_pu_bacteria	2842434925	2842437517	254
414	iso_pu_bacteria	2842441272	2842444332	254
415	iso_pu_bacteria	2842447887	2842451242	254
416	iso_pu_bacteria	2842462802	2842465325	254
417	iso_pu_bacteria	2842469257	2842472206	254
418	iso_pu_bacteria	2842475841	2842480655	254
419	iso_pu_bacteria	2842482326	2842487306	254
420	iso_pu_bacteria	2842489311	2842494075	254
421	iso_pu_bacteria	2842495871	2842501278	254
422	iso_pu_bacteria	2842502639	2842507302	254
423	iso_pu_bacteria	2842509118	2842514571	254
424	iso_pu_bacteria	2842515876	2842517617	254
425	iso_pu_bacteria	2842521101	2842524592	254
426	iso_pu_bacteria	2842871566	2842871751	254
427	iso_pu_bacteria	2844002411	2844008946	254
428	iso_pu_bacteria	2844009547	2844012339	254
429	iso_pu_bacteria	2844163670	2844167929	254
430	iso_pu_bacteria	2844454524	2844456618	254
431	iso_pu_bacteria	2844533157	2844536397	254
432	iso_pu_bacteria	2847417321	2847422137	254
433	iso_pu_bacteria	2848992105	2848998367	254
434	iso_pu_bacteria	2850079185	2850084452	254
435	iso_pu_bacteria	2852387548	2852387817	254
436	iso_pu_bacteria	2854896431	2854900894	254
437	iso_pu_bacteria	2854911287	2854911934	254
438	iso_pu_bacteria	2854916844	2854918919	254
439	iso_pu_bacteria	2855825444	2855828312	254
440	iso_pu_bacteria	2855839649	2855843422	254
441	iso_pu_bacteria	2855872281	2855875580	254
442	iso_pu_bacteria	2856320880	2856322836	254
443	iso_pu_bacteria	2856328259	2856334612	254
444	iso_pu_bacteria	2856334872	2856341697	254
445	iso_pu_bacteria	2856342000	2856349126	254
446	iso_pu_bacteria	2856349417	2856349786	254
447	iso_pu_bacteria	2856356410	2856363218	254
448	iso_pu_bacteria	2856364286	2856366884	254
449	iso_pu_bacteria	2857349434	2857352227	254
450	iso_pu_bacteria	2857367948	2857370185	254
451	iso_pu_bacteria	2857516855	2857520914	254
452	iso_pu_bacteria	2857531043	2857533868	254
453	iso_pu_bacteria	2858800743	2858806310	254
454	iso_pu_bacteria	2869162929	2869169035	254
455	iso_pu_bacteria	2869169390	2869172519	254
456	iso_pu_bacteria	2869234852	2869239913	254
457	iso_pu_bacteria	2869249662	2869250162	254
458	iso_pu_bacteria	2869256925	2869262941	254
459	iso_pu_bacteria	2869264136	2869270021	254
460	iso_pu_bacteria	2869271264	2869272041	254
461	iso_pu_bacteria	2869278585	2869285621	254
462	iso_pu_bacteria	2869285874	2869287704	254
463	iso_pu_bacteria	2871429161	2871435652	254
464	iso_pu_bacteria	2871435913	2871436826	254
465	iso_pu_bacteria	2871451962	2871452681	254
466	iso_pu_bacteria	2871459585	2871462123	254
467	iso_pu_bacteria	2871466892	2871472719	254
468	iso_pu_bacteria	2871474448	2871476975	254
469	iso_pu_bacteria	2871481445	2871485528	254
470	iso_pu_bacteria	2871488783	2871493488	254
471	iso_pu_bacteria	2871495908	2871496514	254
472	iso_pu_bacteria	2874109183	2874110930	254
473	iso_pu_bacteria	2874116593	2874122742	254
474	iso_pu_bacteria	2874139085	2874142041	254
475	iso_pu_bacteria	2874146452	2874151335	254
476	iso_pu_bacteria	2874155637	2874158969	254
477	iso_pu_bacteria	2874162495	2874163063	254
478	iso_pu_bacteria	2874168670	2874175043	254
479	iso_pu_bacteria	2876363079	2876364911	254
480	iso_pu_bacteria	2876392853	2876397738	254
481	iso_pu_bacteria	2876399893	2876405621	254
482	iso_pu_bacteria	2876406927	2876412288	254
483	iso_pu_bacteria	2876413966	2876417388	254
484	iso_pu_bacteria	2876420981	2876421619	254
485	iso_pu_bacteria	2878730984	2878735119	254
486	iso_pu_bacteria	2878738818	2878744776	254
487	iso_pu_bacteria	2878745973	2878749215	254
488	iso_pu_bacteria	2878753008	2878757531	254
489	iso_pu_bacteria	2878760144	2878760742	254
490	iso_pu_bacteria	2878767105	2878767633	254
491	iso_pu_bacteria	2878774303	2878777510	254
492	iso_pu_bacteria	2878781027	2878784804	254
493	iso_pu_bacteria	2881147464	2881149620	254
494	iso_pu_bacteria	2881155292	2881160803	254
495	iso_pu_bacteria	2881161766	2881166498	254
496	iso_pu_bacteria	2881845957	2881851498	254
497	iso_pu_bacteria	2881853255	2881853806	254
498	iso_pu_bacteria	2881861095	2881863184	254
499	iso_pu_bacteria	2882632389	2882639415	254
500	iso_pu_bacteria	2882912400	2882915686	254
501	iso_pu_bacteria	2885305155	2885307982	254
502	iso_pu_bacteria	2885312484	2885313101	254
503	iso_pu_bacteria	2885318864	2885325743	254
504	iso_pu_bacteria	2885326080	2885331719	254
505	iso_pu_bacteria	2885334103	2885342122	254
506	iso_pu_bacteria	2885342637	2885344701	254
507	iso_pu_bacteria	2885350715	2885357917	254
508	iso_pu_bacteria	2888337043	2888338059	254
509	iso_pu_bacteria	2888343758	2888345405	254
510	iso_pu_bacteria	2888350351	2888354724	254
511	iso_pu_bacteria	2889010040	2889016339	254
512	iso_pu_bacteria	2889016732	2889018638	254
513	iso_pu_bacteria	2891373044	2891375606	254
514	iso_pu_bacteria	2894232714	2894234803	254
515	iso_pu_bacteria	2894232714	2894239196	254
516	iso_pu_bacteria	2894652903	2894656187	254
517	iso_pu_bacteria	2896384573	2896388322	254
518	iso_pu_bacteria	2899792073	2899794342	254
519	iso_pu_bacteria	2899803654	2899808269	254
520	iso_pu_bacteria	2899845264	2899845724	254
521	iso_pu_bacteria	2903448605	2903449627	254
522	iso_pu_bacteria	2903492973	2903498679	254
523	iso_pu_bacteria	2903492973	2903501260	254
524	iso_pu_bacteria	2903521522	2903522353	254
525	iso_pu_bacteria	2903528002	2903528732	254
526	iso_pu_bacteria	2903540706	2903541308	254
527	iso_pu_bacteria	2904578770	2904580822	254
528	iso_pu_bacteria	2904659560	2904664389	254
529	iso_pu_bacteria	2906308376	2906310253	254
530	iso_pu_bacteria	2906321335	2906324318	254
531	iso_pu_bacteria	2906354277	2906358115	254
532	iso_pu_bacteria	2906363423	2906368738	254
533	iso_pu_bacteria	2906370794	2906374162	254
534	iso_pu_bacteria	2906401398	2906403212	254
535	iso_pu_bacteria	2906408224	2906409132	254
536	iso_pu_bacteria	2913295892	2913296554	254
537	iso_pu_bacteria	2913308742	2913311912	254
538	iso_pu_bacteria	2915650412	2915653850	254
539	iso_pu_bacteria	2915980308	2915984527	254
540	iso_pu_bacteria	2915986958	2915987856	254
541	iso_pu_bacteria	2915993759	2916000053	254
542	iso_pu_bacteria	2916000859	2916006048	254
543	iso_pu_bacteria	2916007675	2916013044	254
544	iso_pu_bacteria	2916014648	2916018603	254
545	iso_pu_bacteria	2916021584	2916024841	254
546	iso_pu_bacteria	2916028427	2916029748	254
547	iso_pu_bacteria	2916035215	2916037190	254
548	iso_pu_bacteria	2916041962	2916045782	254
549	iso_pu_bacteria	2916048683	2916050113	254
550	iso_pu_bacteria	2916055098	2916059122	254
551	iso_pu_bacteria	2916061851	2916061996	254
552	iso_pu_bacteria	2916068649	2916070294	254
553	iso_pu_bacteria	2916076590	2916080543	254
554	iso_pu_bacteria	2919100787	2919101902	254
555	iso_pu_bacteria	2919114240	2919116710	254
556	iso_pu_bacteria	2919119836	2919121464	254
557	iso_pu_bacteria	2919166419	2919166442	254
558	iso_pu_bacteria	2919171160	2919172516	254
559	iso_pu_bacteria	2919408235	2919408280	254
560	iso_pu_bacteria	2920760137	2920764430	254
561	iso_pu_bacteria	2920822456	2920828072	254
562	iso_pu_bacteria	2921201388	2921202733	254
563	iso_pu_bacteria	2921208531	2921211071	254
564	iso_pu_bacteria	2921237296	2921237798	254
565	iso_pu_bacteria	2921244191	2921244481	254
566	iso_pu_bacteria	2921250672	2921253433	254
567	iso_pu_bacteria	2921257292	2921259811	254
568	iso_pu_bacteria	2921263974	2921267141	254
569	iso_pu_bacteria	2921282425	2921282579	254
570	iso_pu_bacteria	2921289301	2921291360	254
571	iso_pu_bacteria	2921296804	2921298844	254
572	iso_pu_bacteria	2922130491	2922134576	254
573	iso_pu_bacteria	2922151315	2922156170	254
574	iso_pu_bacteria	2922172374	2922178387	254
575	iso_pu_bacteria	2922178524	2922185685	254
576	iso_pu_bacteria	2922185730	2922186564	254
577	iso_pu_bacteria	2923556063	2923556218	254
578	iso_pu_bacteria	2924144063	2924148188	254
579	iso_pu_bacteria	2924150972	2924155298	254
580	iso_pu_bacteria	2924158325	2924158550	254
581	iso_pu_bacteria	2924165586	2924168924	254
582	iso_pu_bacteria	2924172951	2924173139	254
583	iso_pu_bacteria	2924179722	2924179732	254
584	iso_pu_bacteria	2924186466	2924188365	254
585	iso_pu_bacteria	2924193448	2924198433	254
586	iso_pu_bacteria	2924200457	2924204117	254
587	iso_pu_bacteria	2924207177	2924210130	254
588	iso_pu_bacteria	2924221636	2924226026	254
589	iso_pu_bacteria	2924228884	2924230715	254
590	iso_pu_bacteria	2924733363	2924739017	254
591	iso_pu_bacteria	2924741084	2924744869	254
592	iso_pu_bacteria	2924748358	2924753814	254
593	iso_pu_bacteria	2924754689	2924760152	254
594	iso_pu_bacteria	2924762789	2924768457	254
595	iso_pu_bacteria	2924776078	2924782807	254
596	iso_pu_bacteria	2924784321	2924786826	254
597	iso_pu_bacteria	2926754445	2926754719	254
598	iso_pu_bacteria	2926760298	2926761886	254
599	iso_pu_bacteria	2928521798	2928523687	254
600	iso_pu_bacteria	2932401849	2932404285	254
601	iso_pu_bacteria	2933006813	2933006981	254
602	iso_pu_bacteria	2933011516	2933015428	254
603	iso_pu_bacteria	2933016740	2933022804	254
604	iso_pu_bacteria	2933570622	2933574951	254
605	iso_pu_bacteria	2933586486	2933588333	254
606	iso_pu_bacteria	2933594066	2933594184	254
607	iso_pu_bacteria	2933599457	2933601297	254
608	iso_pu_bacteria	2935894831	2935900007	254
609	iso_pu_bacteria	2935901341	2935902295	254
610	iso_pu_bacteria	2936367885	2936369571	254
611	iso_pu_bacteria	2936375103	2936380311	254
612	iso_pu_bacteria	2936381700	2936385230	254
613	iso_pu_bacteria	2936996657	2936996775	254
614	iso_pu_bacteria	2937002841	2937004788	254
615	iso_pu_bacteria	2937009748	2937013520	254
616	iso_pu_bacteria	2937016420	2937016702	254
617	iso_pu_bacteria	2937023124	2937026561	254
618	iso_pu_bacteria	2937029754	2937030947	254
619	iso_pu_bacteria	2937036028	2937039629	254
620	iso_pu_bacteria	2937042894	2937044425	254
621	iso_pu_bacteria	2937049772	2937052540	254
622	iso_pu_bacteria	2937056579	2937061445	254
623	iso_pu_bacteria	2937063883	2937068598	254
624	iso_pu_bacteria	2937071275	2937074231	254
625	iso_pu_bacteria	2937078374	2937081259	254
626	iso_pu_bacteria	2937084907	2937089515	254
627	iso_pu_bacteria	2937091812	2937098539	254
628	iso_pu_bacteria	2937098957	2937099070	254
629	iso_pu_bacteria	2937106411	2937108898	254
630	iso_pu_bacteria	2937113482	2937119235	254
631	iso_pu_bacteria	2937119839	2937122495	254
632	iso_pu_bacteria	2937126314	2937127284	254
633	iso_pu_bacteria	2937813078	2937817077	254
634	iso_pu_bacteria	2937822353	2937822518	254
635	iso_pu_bacteria	2937836603	2937840272	254
636	iso_pu_bacteria	2937848649	2937852456	254
637	iso_pu_bacteria	2937877337	2937881542	254
638	iso_pu_bacteria	2937972304	2937977538	254
639	iso_pu_bacteria	2937994558	2937995164	254
640	iso_pu_bacteria	2938014810	2938018245	254
641	iso_pu_bacteria	2941499720	2941502996	254
642	iso_pu_bacteria	2954011201	2954015970	254
643	iso_pu_bacteria	2957375807	2957377000	254
644	iso_pu_bacteria	2957382221	2957388306	254
645	iso_pu_bacteria	2957388812	2957392234	254
646	iso_pu_bacteria	2957395598	2957395789	254
647	iso_pu_bacteria	2957402308	2957402587	254
648	iso_pu_bacteria	2957408893	2957411067	254
649	iso_pu_bacteria	2957415311	2957422228	254
650	iso_pu_bacteria	2957422303	2957424772	254
651	iso_pu_bacteria	2957430029	2957434184	254
652	iso_pu_bacteria	2957437181	2957440386	254
653	iso_pu_bacteria	2957443900	2957444167	254
654	iso_pu_bacteria	2957450854	2957456211	254
655	iso_pu_bacteria	2957457609	2957461833	254
656	iso_pu_bacteria	2957464669	2957466993	254
657	iso_pu_bacteria	2957471148	2957471309	254
658	iso_pu_bacteria	2957478035	2957482764	254
659	iso_pu_bacteria	2957484790	2957489684	254
660	iso_pu_bacteria	2957491536	2957493280	254
661	iso_pu_bacteria	2957498199	2957502778	254
662	iso_pu_bacteria	2957505466	2957510017	254
663	iso_pu_bacteria	2958034702	2958041636	254
664	iso_pu_bacteria	2958041894	2958047982	254
665	iso_pu_bacteria	2958064165	2958070381	254
666	iso_pu_bacteria	2958071322	2958071481	254
667	iso_pu_bacteria	2958084443	2958087901	254
668	iso_pu_bacteria	2958092219	2958095598	254
669	iso_pu_bacteria	2958100919	2958101290	254
670	iso_pu_bacteria	2958108152	2958113632	254
671	iso_pu_bacteria	2958122699	2958128952	254
672	iso_pu_bacteria	2958130278	2958132106	254
673	iso_pu_bacteria	2958165035	2958165571	254
674	iso_pu_bacteria	2958172287	2958177553	254
675	iso_pu_bacteria	2958179912	2958181920	254
676	iso_pu_bacteria	2960584000	2960588426	254
677	iso_pu_bacteria	2960591022	2960595380	254
678	iso_pu_bacteria	2960597568	2960599572	254
679	iso_pu_bacteria	2960603979	2960606990	254
680	iso_pu_bacteria	2960610863	2960614478	254
681	iso_pu_bacteria	2960617483	2960619332	254
682	iso_pu_bacteria	2960624210	2960625096	254
683	iso_pu_bacteria	2960631154	2960631447	254
684	iso_pu_bacteria	2960637947	2960638232	254
685	iso_pu_bacteria	2960645483	2960648633	254
686	iso_pu_bacteria	2960652885	2960652926	254
687	iso_pu_bacteria	2960660292	2960662512	254
688	iso_pu_bacteria	2960667422	2960669242	254
689	iso_pu_bacteria	2960674078	2960678723	254
690	iso_pu_bacteria	2960680706	2960682731	254
691	iso_pu_bacteria	2960687367	2960688998	254
692	iso_pu_bacteria	2960693952	2960699383	254
693	iso_pu_bacteria	2961077736	2961079764	254
694	iso_pu_bacteria	2961114664	2961119388	254
695	iso_pu_bacteria	2961127735	2961134857	254
696	iso_pu_bacteria	2961163497	2961164030	254
697	iso_pu_bacteria	2961170736	2961175142	254
698	iso_pu_bacteria	2961183825	2961184009	254
699	iso_pu_bacteria	2963644680	2963646367	254
700	iso_pu_bacteria	2964607997	2964612826	254
701	iso_pu_bacteria	2964615318	2964617305	254
702	iso_pu_bacteria	2964621998	2964622160	254
703	iso_pu_bacteria	2964628898	2964630289	254
704	iso_pu_bacteria	2964636051	2964640380	254
705	iso_pu_bacteria	2964643177	2964648666	254
706	iso_pu_bacteria	2964649959	2964651986	254
707	iso_pu_bacteria	2964656573	2964662925	254
708	iso_pu_bacteria	2964663802	2964668728	254
709	iso_pu_bacteria	2964670856	2964676323	254
710	iso_pu_bacteria	2964678106	2964680088	254
711	iso_pu_bacteria	2964685014	2964687487	254
712	iso_pu_bacteria	2964691889	2964693451	254
713	iso_pu_bacteria	2964698721	2964703812	254
714	iso_pu_bacteria	2964705432	2964707329	254
715	iso_pu_bacteria	2964712639	2964714913	254
716	iso_pu_bacteria	2964719344	2964719758	254
717	iso_pu_bacteria	2965018300	2965018904	254
718	iso_pu_bacteria	2965025482	2965027064	254
719	iso_pu_bacteria	2965032056	2965035978	254
720	iso_pu_bacteria	2965047637	2965052026	254
721	iso_pu_bacteria	2965062239	2965068064	254
722	iso_pu_bacteria	2965089291	2965091327	254
723	iso_pu_bacteria	2965102966	2965109578	254
724	iso_pu_bacteria	2965119406	2965126883	254
725	iso_pu_bacteria	2967664464	2967666516	254
726	iso_pu_bacteria	2967671571	2967674155	254
727	iso_pu_bacteria	2967678726	2967682359	254
728	iso_pu_bacteria	2967686174	2967689038	254
729	iso_pu_bacteria	2967693043	2967694705	254
730	iso_pu_bacteria	2967699805	2967703309	254
731	iso_pu_bacteria	2967706974	2967707148	254
732	iso_pu_bacteria	2967714385	2967718131	254
733	iso_pu_bacteria	2967721400	2967723917	254
734	iso_pu_bacteria	2967728569	2967731694	254
735	iso_pu_bacteria	2967735183	2967739591	254
736	iso_pu_bacteria	2967742019	2967747202	254
737	iso_pu_bacteria	2967748971	2967753084	254
738	iso_pu_bacteria	2967755722	2967762197	254
739	iso_pu_bacteria	2967762386	2967768404	254
740	iso_pu_bacteria	2967769361	2967773416	254
741	iso_pu_bacteria	2967775926	2967781392	254
742	iso_pu_bacteria	2967996073	2967999856	254
743	iso_pu_bacteria	2968003550	2968008215	254
744	iso_pu_bacteria	2968016561	2968020492	254
745	iso_pu_bacteria	2968083720	2968087107	254
746	iso_pu_bacteria	2968110612	2968115643	254
747	iso_pu_bacteria	2968117919	2968119013	254
748	iso_pu_bacteria	2968128360	2968134597	254
749	iso_pu_bacteria	2968171901	2968172433	254
750	iso_pu_bacteria	2970019648	2970023224	254
751	iso_pu_bacteria	2970026789	2970026811	254
752	iso_pu_bacteria	2970033650	2970034815	254
753	iso_pu_bacteria	2970040964	2970043913	254
754	iso_pu_bacteria	2970047711	2970048033	254
755	iso_pu_bacteria	2970054988	2970055180	254
756	iso_pu_bacteria	2970061556	2970064092	254
757	iso_pu_bacteria	2970068827	2970070102	254
758	iso_pu_bacteria	2970076120	2970076149	254
759	iso_pu_bacteria	2970082768	2970083006	254
760	iso_pu_bacteria	2970088815	2970090977	254
761	iso_pu_bacteria	2970095765	2970099591	254
762	iso_pu_bacteria	2970102677	2970104914	254
763	iso_pu_bacteria	2970109326	2970109551	254
764	iso_pu_bacteria	2970116247	2970118731	254
765	iso_pu_bacteria	2970122695	2970124744	254
766	iso_pu_bacteria	2970129317	2970132614	254
767	iso_pu_bacteria	2970136068	2970140284	254
768	iso_pu_bacteria	2970143518	2970144669	254
769	iso_pu_bacteria	2970149975	2970150060	254
770	iso_pu_bacteria	2970156795	2970158427	254
771	iso_pu_bacteria	2970164137	2970166172	254
772	iso_pu_bacteria	2970170962	2970176603	254
773	iso_pu_bacteria	2970177841	2970183997	254
774	iso_pu_bacteria	2970184632	2970184834	254
775	iso_pu_bacteria	2970191845	2970195189	254
776	iso_pu_bacteria	2970469710	2970473789	254
777	iso_pu_bacteria	2970489779	2970490400	254
778	iso_pu_bacteria	2970503327	2970507730	254
779	iso_pu_bacteria	2970510686	2970518114	254
780	iso_pu_bacteria	2970524798	2970527123	254
781	iso_pu_bacteria	2970532167	2970534005	254
782	iso_pu_bacteria	2970540015	2970546169	254
783	iso_pu_bacteria	2970547951	2970554518	254
784	iso_pu_bacteria	2970554993	2970555595	254
785	iso_pu_bacteria	2970593180	2970600237	254
786	iso_pu_bacteria	2970627176	2970630834	254
787	iso_pu_bacteria	2977516862	2977522045	254
788	iso_pu_bacteria	2977523885	2977526930	254
789	iso_pu_bacteria	2977530762	2977533068	254
790	iso_pu_bacteria	2977537788	2977538249	254
791	iso_pu_bacteria	2977544691	2977544991	254
792	iso_pu_bacteria	2977551784	2977554037	254
793	iso_pu_bacteria	2977558990	2977564863	254
794	iso_pu_bacteria	2977565890	2977568032	254
795	iso_pu_bacteria	2977572785	2977572862	254
796	iso_pu_bacteria	2977579622	2977581822	254
797	iso_pu_bacteria	2977821940	2977826688	254
798	iso_pu_bacteria	2977828996	2977832156	254
799	iso_pu_bacteria	2977843712	2977847368	254
800	iso_pu_bacteria	2977851361	2977854188	254
801	iso_pu_bacteria	2977864932	2977870131	254
802	iso_pu_bacteria	2977872689	2977880189	254
803	iso_pu_bacteria	2977907340	2977908511	254
804	iso_pu_bacteria	2977922695	2977925305	254
805	iso_pu_bacteria	2977935797	2977940674	254
806	iso_pu_bacteria	2977942078	2977945186	254
807	iso_pu_bacteria	2977950692	2977956370	254
808	iso_pu_bacteria	2977957713	2977963519	254
809	iso_pu_bacteria	2977971508	2977974747	254
810	iso_pu_bacteria	2977986579	2977991319	254
811	iso_pu_bacteria	2978969890	2978972834	254
812	iso_pu_bacteria	2979089926	2979092847	254
813	iso_pu_bacteria	2979095461	2979099764	254
814	iso_pu_bacteria	2979100975	2979104818	254
815	iso_pu_bacteria	2979710463	2979711331	254
816	iso_pu_bacteria	2979742915	2979747286	254
817	iso_pu_bacteria	2979764755	2979768172	254
818	iso_pu_bacteria	2979772303	2979774140	254
819	iso_pu_bacteria	2979793036	2979796989	254
820	iso_pu_bacteria	2979808191	2979812914	254
821	iso_pu_bacteria	2984509177	2984513382	254
822	iso_pu_bacteria	2984518228	2984520249	254
823	iso_pu_bacteria	2984537506	2984539545	254
824	iso_pu_bacteria	2984601300	2984601773	254
825	iso_pu_bacteria	2987636660	2987639411	254
826	iso_pu_bacteria	2987652177	2987659004	254
827	iso_pu_bacteria	2987659509	2987660038	254
828	iso_pu_bacteria	2987666974	2987672355	254
829	iso_pu_bacteria	2987673487	2987680340	254
830	iso_pu_bacteria	2989349275	2989353852	254
831	iso_pu_bacteria	2989771324	2989772824	254
832	iso_pu_bacteria	2989776772	2989780874	254
833	iso_pu_bacteria	2996310559	2996316533	254
834	iso_pu_bacteria	2996336353	2996337067	254
835	iso_pu_bacteria	2996348954	2996352888	254
836	iso_pu_bacteria	2996386984	2996387202	254
837	iso_pu_bacteria	2996887358	2996888006	254
838	iso_pu_bacteria	2996893221	2996897570	254
839	iso_pu_bacteria	3000135777	3000139343	254
840	iso_pu_bacteria	3003930520	3003932004	254
841	iso_pu_bacteria	3004167301	3004167384	254
842	iso_pu_bacteria	3004188549	3004189086	254
843	iso_pu_bacteria	3004203850	3004204345	254
844	iso_pu_bacteria	3004211236	3004217803	254
845	iso_pu_bacteria	3004218560	3004221149	254
846	iso_pu_bacteria	3004232784	3004239631	254
847	iso_pu_bacteria	3004268573	3004275085	254
848	iso_pu_bacteria	3004275668	3004279570	254
849	iso_pu_bacteria	3004289098	3004289428	254
850	iso_pu_bacteria	3004334049	3004336028	254
851	iso_pu_bacteria	3005409236	3005410600	254
852	iso_pu_bacteria	3005416602	3005419685	254
853	iso_pu_bacteria	3005445848	3005450031	254
854	iso_pu_bacteria	3005452660	3005456390	254
855	iso_pu_bacteria	637000159	637075920	254
856	iso_pu_bacteria	639633055	639646039	254
857	iso_pu_bacteria	643692032	643823956	254
858	iso_pu_bacteria	648276728	648741878	254
859	iso_pu_bacteria	649633066	649871551	254
860	iso_pu_bacteria	650716007	650738672	254
861	iso_pu_bacteria	8002285264	8002289467	254
862	iso_pu_bacteria	8003570095	8003572217	254
863	iso_pu_bacteria	8003992118	8003996001	254
864	iso_pu_bacteria	8003999396	8004003758	254
865	iso_pu_bacteria	8004300914	8004307106	254
866	iso_pu_bacteria	8004312739	8004316888	254
867	iso_pu_bacteria	8004361976	8004366502	254
868	iso_pu_bacteria	8004374579	8004379104	254
869	iso_pu_bacteria	8004387939	8004389489	254
870	iso_pu_bacteria	8004395343	8004402993	254
871	iso_pu_bacteria	8004633249	8004637436	254
872	iso_pu_bacteria	8004640170	8004643310	254
873	iso_pu_bacteria	8004714634	8004717887	254
874	iso_pu_bacteria	8005246636	8005250557	254
875	iso_pu_bacteria	8005258706	8005261429	254
876	iso_pu_bacteria	8005275841	8005278264	254
877	iso_pu_bacteria	8005282627	8005282701	254
878	iso_pu_bacteria	8005289223	8005291677	254
879	iso_pu_bacteria	8005301065	8005305451	254
880	iso_pu_bacteria	8005307578	8005310225	254
881	iso_pu_bacteria	8005314921	8005317739	254
882	iso_pu_bacteria	8005321885	8005322533	254
883	iso_pu_bacteria	8005376324	8005378128	254
884	iso_pu_bacteria	8005382845	8005384136	254
885	iso_pu_bacteria	8005395548	8005399586	254
886	iso_pu_bacteria	8005430974	8005433823	254
887	iso_pu_bacteria	8005460587	8005465499	254
888	iso_pu_bacteria	8005484373	8005484416	254
889	iso_pu_bacteria	8005497431	8005498082	254
890	iso_pu_bacteria	8005542996	8005543265	254
891	iso_pu_bacteria	8005556819	8005559947	254
892	iso_pu_bacteria	8005563573	8005564557	254
893	iso_pu_bacteria	8005570704	8005571243	254
894	iso_pu_bacteria	8005619151	8005619291	254
895	iso_pu_bacteria	8005626139	8005627856	254
896	iso_pu_bacteria	8005645114	8005647343	254
897	iso_pu_bacteria	8005658619	8005661554	254
898	iso_pu_bacteria	8005668836	8005669490	254
899	iso_pu_bacteria	8005682033	8005687513	254
900	iso_pu_bacteria	8005688590	8005692797	254
901	iso_pu_bacteria	8005695170	8005701499	254
902	iso_pu_bacteria	8018127388	8018132509	254
903	iso_pu_bacteria	8018150411	8018153646	254
904	iso_pu_bacteria	8018163183	8018167635	254
905	iso_pu_bacteria	8018176218	8018176648	254
906	iso_pu_bacteria	8023680758	8023681299	254
907	iso_pu_bacteria	8024479707	8024481870	254
908	iso_pu_bacteria	8024486573	8024488622	254
909	iso_pu_bacteria	8024501048	8024506306	254
910	iso_pu_bacteria	8046767195	8046768725	254
911	iso_pu_bacteria	8049293176	8049296870	254
912	iso_pu_bacteria	8054558443	8054561184	254
913	iso_pu_bacteria	8055431914	8055433708	254
914	iso_pu_bacteria	8055617313	8055619209	254
915	iso_pu_bacteria	8056375014	8056381217	254
916	iso_pu_bacteria	8056382006	8056382709	254
917	iso_pu_bacteria	8056875544	8056878623	254
918	iso_pu_bacteria	8057575449	8057582511	254
919	iso_pu_bacteria	8057874678	8057877147	254
920	3300035116	Ga0373945_0122893	Ga0373945_0122893_119_904	255
921	3300038726	Ga0400490_57702	Ga0400490_57702_58_834	255
922	3300038735	Ga0400485_04517	Ga0400485_04517_264_1040	255
923	3300038742	Ga0400486_14829	Ga0400486_14829_130_906	255
924	3300038742	Ga0400486_26521	Ga0400486_26521_573_1349	255
925	3300039110	Ga0400487_09229	Ga0400487_09229_1393_2169	255
926	3300042876	Ga0451577_0051357	Ga0451577_0051357_883_1671	255
927	3300044712	Ga0453684_0391228	Ga0453684_0391228_123_911	255
928	3300045051	Ga0451576_0000743	Ga0451576_0000743_16445_17233	255
929	3300049581	Ga0501047_0241327	Ga0501047_0241327_816_1583	255
930	3300049582	Ga0501048_0446510	Ga0501048_0446510_79_846	255
931	iso_pu_bacteria	2512047086	2512531036	255
932	iso_pu_bacteria	2513237087	2513591546	255
933	iso_pu_bacteria	2791355253	2793283573	255
934	iso_pu_bacteria	2874123672	2874128974	255
935	iso_pu_bacteria	2929138655	2929138788	255
936	3300003187	JGI25151J46595_10000369	JGI25151J46595_1000036921	256
937	3300003203	JGI25406J46586_10001163	JGI25406J46586_1000116312	256
938	3300005985	Ga0081539_10000283	Ga0081539_1000028311	256
939	3300006847	Ga0075431_100001111	Ga0075431_1000011119	256
940	3300009094	Ga0111539_10172725	Ga0111539_101727253	256
941	3300025294	Ga0209025_1000064	Ga0209025_100006422	256
942	3300027312	Ga0209371_1013700	Ga0209371_10137002	256
943	3300030500	Ga0268256_1015182	Ga0268256_10151822	256
944	3300031344	Ga0265316_10047416	Ga0265316_100474163	256
945	3300039437	Ga0436365_1157517	Ga0436365_1157517_3268_4044	256
946	3300046535	Ga0495586_0155491	Ga0495586_0155491_481_1269	256
947	3300048912	Ga0496109_0787302	Ga0496109_0787302_21_800	256
948	3300048921	Ga0496118_0019301	Ga0496118_0019301_1926_2702	256
949	3300048922	Ga0496119_0034618	Ga0496119_0034618_438_1214	256
950	3300048924	Ga0496121_0027236	Ga0496121_0027236_3330_4109	256
951	3300048924	Ga0496121_0040663	Ga0496121_0040663_2226_3005	256
952	3300048924	Ga0496121_0081652	Ga0496121_0081652_1666_2436	256
953	3300048927	Ga0496124_0000004	Ga0496124_0000004_547583_548362	256
954	3300050508	nmdc:mga09592_326396_c1	nmdc:mga09592_326396_c1_172_957	256
955	3300050509	nmdc:mga0qj67_37819_c1	nmdc:mga0qj67_37819_c1_1993_2778	256
956	3300053117	Ga0500593_000509	Ga0500593_000509_10583_11353	256
957	3300053125	Ga0500618_004150	Ga0500618_004150_103_879	256
958	iso_pu_bacteria	2855767633	2855770530	256
959	iso_pu_bacteria	2881412998	2881413028	256
960	iso_pu_bacteria	2885192300	2885194556	256
961	iso_pu_bacteria	2909042592	2909043118	256
962	iso_pu_bacteria	2958064165	2958070698	256
963	iso_pu_bacteria	3002141150	3002144556	256
964	iso_pu_bacteria	8002745576	8002749400	256
965	3300003187	JGI25151J46595_10002371	JGI25151J46595_100023713	257
966	3300003354	JGI25160J50197_1004671	JGI25160J50197_10046713	257
967	3300005334	Ga0068869_100231468	Ga0068869_1002314682	257
968	3300005336	Ga0070680_100046852	Ga0070680_1000468522	257
969	3300005338	Ga0068868_100387470	Ga0068868_1003874701	257
970	3300005434	Ga0070709_10000484	Ga0070709_1000048415	257
971	3300005435	Ga0070714_100051804	Ga0070714_1000518042	257
972	3300005436	Ga0070713_100207698	Ga0070713_1002076982	257
973	3300005436	Ga0070713_100282618	Ga0070713_1002826182	257
974	3300005437	Ga0070710_10025475	Ga0070710_100254753	257
975	3300005439	Ga0070711_100010198	Ga0070711_1000101988	257
976	3300005456	Ga0070678_100466625	Ga0070678_1004666251	257
977	3300005467	Ga0070706_100746756	Ga0070706_1007467561	257
978	3300005468	Ga0070707_100344816	Ga0070707_1003448162	257
979	3300005471	Ga0070698_100128567	Ga0070698_1001285673	257
980	3300005471	Ga0070698_100510145	Ga0070698_1005101452	257
981	3300005539	Ga0068853_100433862	Ga0068853_1004338622	257
982	3300005548	Ga0070665_100476049	Ga0070665_1004760491	257
983	3300005563	Ga0068855_100035950	Ga0068855_1000359507	257
984	3300005563	Ga0068855_100048524	Ga0068855_1000485245	257
985	3300005577	Ga0068857_100090103	Ga0068857_1000901032	257
986	3300005614	Ga0068856_100121036	Ga0068856_1001210363	257
987	3300005719	Ga0068861_100046188	Ga0068861_1000461883	257
988	3300005841	Ga0068863_100270561	Ga0068863_1002705612	257
989	3300005843	Ga0068860_100275397	Ga0068860_1002753972	257
990	3300005844	Ga0068862_100289556	Ga0068862_1002895562	257
991	3300005844	Ga0068862_100380466	Ga0068862_1003804662	257
992	3300005844	Ga0068862_100543480	Ga0068862_1005434802	257
993	3300005937	Ga0081455_10000041	Ga0081455_1000004122	257
994	3300005937	Ga0081455_10015792	Ga0081455_100157929	257
995	3300005983	Ga0081540_1000090	Ga0081540_100009067	257
996	3300005983	Ga0081540_1002060	Ga0081540_10020607	257
997	3300005983	Ga0081540_1006026	Ga0081540_100602610	257
998	3300005983	Ga0081540_1067986	Ga0081540_10679862	257
999	3300006038	Ga0075365_10123243	Ga0075365_101232433	257
1000	3300006038	Ga0075365_10132197	Ga0075365_101321972	257
1001	3300006051	Ga0075364_10022150	Ga0075364_100221505	257
1002	3300006173	Ga0070716_100008371	Ga0070716_1000083713	257
1003	3300006175	Ga0070712_100016346	Ga0070712_1000163462	257
1004	3300006175	Ga0070712_100517279	Ga0070712_1005172792	257
1005	3300006177	Ga0075362_10034157	Ga0075362_100341572	257
1006	3300006177	Ga0075362_10076678	Ga0075362_100766782	257
1007	3300006195	Ga0075366_10126967	Ga0075366_101269672	257
1008	3300006195	Ga0075366_10160167	Ga0075366_101601672	257
1009	3300006353	Ga0075370_10036446	Ga0075370_100364463	257
1010	3300006353	Ga0075370_10065139	Ga0075370_100651392	257
1011	3300006358	Ga0068871_100161608	Ga0068871_1001616082	257
1012	3300006844	Ga0075428_100037665	Ga0075428_1000376657	257
1013	3300006844	Ga0075428_100094240	Ga0075428_1000942404	257
1014	3300006844	Ga0075428_100141013	Ga0075428_1001410131	257
1015	3300006846	Ga0075430_100298415	Ga0075430_1002984152	257
1016	3300006847	Ga0075431_100014552	Ga0075431_1000145525	257
1017	3300006880	Ga0075429_100012911	Ga0075429_1000129111	257
1018	3300007788	Ga0099795_10109524	Ga0099795_101095241	257
1019	3300009093	Ga0105240_10163674	Ga0105240_101636743	257
1020	3300009098	Ga0105245_10298123	Ga0105245_102981232	257
1021	3300009101	Ga0105247_10058820	Ga0105247_100588202	257
1022	3300009147	Ga0114129_11193145	Ga0114129_111931451	257
1023	3300009148	Ga0105243_10280679	Ga0105243_102806792	257
1024	3300009174	Ga0105241_10160321	Ga0105241_101603212	257
1025	3300009177	Ga0105248_10066837	Ga0105248_100668375	257
1026	3300009545	Ga0105237_10101400	Ga0105237_101014003	257
1027	3300009545	Ga0105237_10136519	Ga0105237_101365193	257
1028	3300009551	Ga0105238_10321038	Ga0105238_103210382	257
1029	3300009551	Ga0105238_10519406	Ga0105238_105194062	257
1030	3300010375	Ga0105239_10461127	Ga0105239_104611272	257
1031	3300011119	Ga0105246_10056971	Ga0105246_100569712	257
1032	3300013104	Ga0157370_10191467	Ga0157370_101914672	257
1033	3300013105	Ga0157369_10007331	Ga0157369_100073312	257
1034	3300013105	Ga0157369_10156435	Ga0157369_101564353	257
1035	3300013105	Ga0157369_10981149	Ga0157369_109811491	257
1036	3300013296	Ga0157374_10040095	Ga0157374_100400953	257
1037	3300013306	Ga0163162_10171796	Ga0163162_101717962	257
1038	3300013306	Ga0163162_10309198	Ga0163162_103091982	257
1039	3300013308	Ga0157375_10027437	Ga0157375_100274373	257
1040	3300014745	Ga0157377_10112335	Ga0157377_101123352	257
1041	3300014969	Ga0157376_10023240	Ga0157376_100232402	257
1042	3300021361	Ga0213872_10132577	Ga0213872_101325772	257
1043	3300021377	Ga0213874_10054294	Ga0213874_100542942	257
1044	3300021384	Ga0213876_10000961	Ga0213876_1000096121	257
1045	3300021384	Ga0213876_10148852	Ga0213876_101488522	257
1046	3300021388	Ga0213875_10024123	Ga0213875_100241233	257
1047	3300025253	Ga0209677_100810	Ga0209677_10081012	257
1048	3300025254	Ga0209148_1009017	Ga0209148_10090172	257
1049	3300025261	Ga0209233_1001353	Ga0209233_100135311	257
1050	3300025272	Ga0209455_1015779	Ga0209455_10157792	257
1051	3300025284	Ga0209130_1000090	Ga0209130_1000090134	257
1052	3300025294	Ga0209025_1002564	Ga0209025_100256417	257
1053	3300025297	Ga0209758_1005257	Ga0209758_10052579	257
1054	3300025302	Ga0207426_1000113	Ga0207426_1000113134	257
1055	3300025315	Ga0207697_10057426	Ga0207697_100574262	257
1056	3300025885	Ga0207653_10090373	Ga0207653_100903732	257
1057	3300025898	Ga0207692_10003319	Ga0207692_100033197	257
1058	3300025906	Ga0207699_10000845	Ga0207699_100008454	257
1059	3300025906	Ga0207699_10358906	Ga0207699_103589062	257
1060	3300025908	Ga0207643_10049829	Ga0207643_100498293	257
1061	3300025913	Ga0207695_10049708	Ga0207695_100497083	257
1062	3300025915	Ga0207693_10002393	Ga0207693_100023933	257
1063	3300025917	Ga0207660_10038840	Ga0207660_100388403	257
1064	3300025922	Ga0207646_10115616	Ga0207646_101156162	257
1065	3300025922	Ga0207646_10394351	Ga0207646_103943512	257
1066	3300025928	Ga0207700_10244764	Ga0207700_102447642	257
1067	3300025929	Ga0207664_10045677	Ga0207664_100456772	257
1068	3300025931	Ga0207644_10126672	Ga0207644_101266722	257
1069	3300025931	Ga0207644_10134984	Ga0207644_101349842	257
1070	3300025937	Ga0207669_10114126	Ga0207669_101141262	257
1071	3300025939	Ga0207665_10011708	Ga0207665_100117083	257
1072	3300025941	Ga0207711_10251609	Ga0207711_102516092	257
1073	3300025981	Ga0207640_10401561	Ga0207640_104015612	257
1074	3300026023	Ga0207677_10206308	Ga0207677_102063082	257
1075	3300026035	Ga0207703_10052511	Ga0207703_100525113	257
1076	3300026035	Ga0207703_10102858	Ga0207703_101028582	257
1077	3300026035	Ga0207703_10283001	Ga0207703_102830012	257
1078	3300026041	Ga0207639_10021716	Ga0207639_100217163	257
1079	3300026067	Ga0207678_10161977	Ga0207678_101619772	257
1080	3300026067	Ga0207678_10321489	Ga0207678_103214891	257
1081	3300026078	Ga0207702_10298467	Ga0207702_102984672	257
1082	3300026121	Ga0207683_10249576	Ga0207683_102495762	257
1083	3300026142	Ga0207698_10095223	Ga0207698_100952233	257
1084	3300028379	Ga0268266_10034996	Ga0268266_100349962	257
1085	3300028379	Ga0268266_10125895	Ga0268266_101258953	257
1086	3300028380	Ga0268265_10084324	Ga0268265_100843243	257
1087	3300028563	Ga0265319_1004654	Ga0265319_10046546	257
1088	3300028573	Ga0265334_10000614	Ga0265334_1000061411	257
1089	3300028653	Ga0265323_10000644	Ga0265323_100006445	257
1090	3300028666	Ga0265336_10000259	Ga0265336_1000025917	257
1091	3300028800	Ga0265338_10000013	Ga0265338_10000013113	257
1092	3300029957	Ga0265324_10003265	Ga0265324_100032655	257
1093	3300031235	Ga0265330_10047357	Ga0265330_100473573	257
1094	3300031239	Ga0265328_10046437	Ga0265328_100464372	257
1095	3300031251	Ga0265327_10038398	Ga0265327_100383981	257
1096	3300031344	Ga0265316_10144362	Ga0265316_101443622	257
1097	3300031507	Ga0307509_10040596	Ga0307509_100405963	257
1098	3300031711	Ga0265314_10192255	Ga0265314_101922552	257
1099	3300031730	Ga0307516_10165112	Ga0307516_101651123	257
1100	3300031824	Ga0307413_10161950	Ga0307413_101619502	257
1101	3300031852	Ga0307410_10237805	Ga0307410_102378051	257
1102	3300031995	Ga0307409_100128620	Ga0307409_1001286202	257
1103	3300031995	Ga0307409_100280395	Ga0307409_1002803952	257
1104	3300032004	Ga0307414_10480694	Ga0307414_104806943	257
1105	3300032126	Ga0307415_100265085	Ga0307415_1002650852	257
1106	3300035113	Ga0373936_0016726	Ga0373936_0016726_1583_2383	257
1107	3300037466	Ga0395898_0058642	Ga0395898_0058642_12_794	257
1108	3300037471	Ga0395905_0466324	Ga0395905_0466324_52_852	257
1109	3300037853	Ga0436364_0200520	Ga0436364_0200520_1249_2031	257
1110	3300037853	Ga0436364_0416519	Ga0436364_0416519_19374_20183	257
1111	3300037853	Ga0436364_1131095	Ga0436364_1131095_380_1162	257
1112	3300037853	Ga0436364_1178098	Ga0436364_1178098_1590_2369	257
1113	3300038443	Ga0395901_0376253	Ga0395901_0376253_238_1020	257
1114	3300039437	Ga0436365_0006469	Ga0436365_0006469_4368_5147	257
1115	3300039437	Ga0436365_1549357	Ga0436365_1549357_1403_2197	257
1116	3300039447	Ga0436361_0410430	Ga0436361_0410430_1523_2296	257
1117	3300039450	Ga0436363_0249570	Ga0436363_0249570_325_1104	257
1118	3300041408	Ga0439453_0004388	Ga0439453_0004388_76_858	257
1119	3300042146	Ga0450907_016268	Ga0450907_016268_81_860	257
1120	3300044842	Ga0466957_0108906	Ga0466957_0108906_170_964	257
1121	3300044842	Ga0466957_0117167	Ga0466957_0117167_205_981	257
1122	3300045049	Ga0466959_0074977	Ga0466959_0074977_119_913	257
1123	3300045976	Ga0466967_0276289	Ga0466967_0276289_58_852	257
1124	3300046455	Ga0495603_0053286	Ga0495603_0053286_1142_1942	257
1125	3300046459	Ga0495629_0226425	Ga0495629_0226425_79_879	257
1126	3300046460	Ga0495638_0005713	Ga0495638_0005713_2308_3108	257
1127	3300046491	Ga0495584_0172876	Ga0495584_0172876_243_1043	257
1128	3300046512	Ga0495610_0118213	Ga0495610_0118213_184_963	257
1129	3300046519	Ga0495632_0015926	Ga0495632_0015926_1612_2412	257
1130	3300046537	Ga0495598_0035367	Ga0495598_0035367_515_1315	257
1131	3300046538	Ga0495609_0018128	Ga0495609_0018128_1728_2528	257
1132	3300046615	Ga0495656_0009550	Ga0495656_0009550_2131_2931	257
1133	3300046616	Ga0495668_0013606	Ga0495668_0013606_1097_1897	257
1134	3300046616	Ga0495668_0210021	Ga0495668_0210021_46_846	257
1135	3300046664	Ga0495659_0040863	Ga0495659_0040863_551_1351	257
1136	3300046674	Ga0495588_0027120	Ga0495588_0027120_1158_1958	257
1137	3300046691	Ga0495670_0117013	Ga0495670_0117013_544_1344	257
1138	3300046694	Ga0495649_0249179	Ga0495649_0249179_45_845	257
1139	3300047320	Ga0495672_0105178	Ga0495672_0105178_232_1032	257
1140	3300047321	Ga0495676_0135161	Ga0495676_0135161_573_1373	257
1141	3300048089	Ga0495614_0156968	Ga0495614_0156968_96_896	257
1142	3300048090	Ga0495615_0030412	Ga0495615_0030412_21_800	257
1143	3300048903	Ga0496100_0066241	Ga0496100_0066241_1053_1853	257
1144	3300048905	Ga0496102_0001499	Ga0496102_0001499_15988_16788	257
1145	3300048905	Ga0496102_0102854	Ga0496102_0102854_735_1535	257
1146	3300048906	Ga0496103_0008315	Ga0496103_0008315_2648_3448	257
1147	3300048907	Ga0496104_0006502	Ga0496104_0006502_901_1701	257
1148	3300048908	Ga0496105_0043793	Ga0496105_0043793_55_855	257
1149	3300048909	Ga0496106_0012833	Ga0496106_0012833_4114_4914	257
1150	3300048910	Ga0496107_0013894	Ga0496107_0013894_4319_5119	257
1151	3300048910	Ga0496107_0448945	Ga0496107_0448945_128_910	257
1152	3300048911	Ga0496108_0278438	Ga0496108_0278438_186_986	257
1153	3300048911	Ga0496108_0470267	Ga0496108_0470267_43_843	257
1154	3300048912	Ga0496109_0023208	Ga0496109_0023208_535_1335	257
1155	3300048914	Ga0496111_0125845	Ga0496111_0125845_247_1047	257
1156	3300048914	Ga0496111_0256592	Ga0496111_0256592_471_1271	257
1157	3300048915	Ga0496112_0083094	Ga0496112_0083094_1505_2305	257
1158	3300048916	Ga0496113_0090322	Ga0496113_0090322_1239_2039	257
1159	3300048918	Ga0496115_0000715	Ga0496115_0000715_19523_20323	257
1160	3300048921	Ga0496118_0024434	Ga0496118_0024434_2548_3342	257
1161	3300048924	Ga0496121_0001611	Ga0496121_0001611_21278_22051	257
1162	3300048924	Ga0496121_0025848	Ga0496121_0025848_3793_4587	257
1163	3300048924	Ga0496121_0135857	Ga0496121_0135857_306_1100	257
1164	3300048924	Ga0496121_0136293	Ga0496121_0136293_441_1241	257
1165	3300048929	Ga0496126_0001402	Ga0496126_0001402_34083_34883	257
1166	3300048929	Ga0496126_0200641	Ga0496126_0200641_292_1092	257
1167	3300048929	Ga0496126_0402189	Ga0496126_0402189_178_972	257
1168	3300050489	nmdc:mga03683_68014_c1	nmdc:mga03683_68014_c1_205_1005	257
1169	3300050491	nmdc:mga00v17_402_c1	nmdc:mga00v17_402_c1_8623_9396	257
1170	3300050492	nmdc:mga0yw44_1582_c1	nmdc:mga0yw44_1582_c1_2275_3054	257
1171	3300050492	nmdc:mga0yw44_17515_c1	nmdc:mga0yw44_17515_c1_325_1125	257
1172	3300050493	nmdc:mga0k408_139186_c1	nmdc:mga0k408_139186_c1_109_909	257
1173	3300050493	nmdc:mga0k408_83128_c1	nmdc:mga0k408_83128_c1_805_1605	257
1174	3300050494	nmdc:mga06z11_216399_c1	nmdc:mga06z11_216399_c1_116_916	257
1175	3300050507	nmdc:mga05p37_500663_c1	nmdc:mga05p37_500663_c1_376_1158	257
1176	3300050508	nmdc:mga09592_11254_c1	nmdc:mga09592_11254_c1_6320_7102	257
1177	3300050508	nmdc:mga09592_657682_c1	nmdc:mga09592_657682_c1_55_834	257
1178	3300050509	nmdc:mga0qj67_532509_c1	nmdc:mga0qj67_532509_c1_61_840	257
1179	3300050510	nmdc:mga06r32_45817_c1	nmdc:mga06r32_45817_c1_380_1162	257
1180	3300050512	nmdc:mga0n895_191293_c1	nmdc:mga0n895_191293_c1_781_1581	257
1181	3300053094	Ga0500566_0000384	Ga0500566_0000384_6120_6920	257
1182	3300053095	Ga0500640_000112	Ga0500640_000112_4820_5620	257
1183	3300053111	Ga0500572_001174	Ga0500572_001174_547_1347	257
1184	3300053119	Ga0500595_033867	Ga0500595_033867_519_1319	257
1185	3300053122	Ga0500608_018511	Ga0500608_018511_1822_2652	257
1186	3300053123	Ga0500614_000928	Ga0500614_000928_362_1162	257
1187	3300053136	Ga0500559_0000082	Ga0500559_0000082_9153_9983	257
1188	3300053136	Ga0500559_0006112	Ga0500559_0006112_3894_4694	257
1189	3300053146	Ga0500588_0025498	Ga0500588_0025498_213_1013	257
1190	3300053150	Ga0500603_000820	Ga0500603_000820_446_1246	257
1191	3300053157	Ga0500624_003921	Ga0500624_003921_297_1127	257
1192	3300053158	Ga0500627_0148049	Ga0500627_0148049_210_1010	257
1193	3300053159	Ga0500630_004192	Ga0500630_004192_4667_5467	257
1194	3300053163	Ga0500639_000136	Ga0500639_000136_17518_18318	257
1195	3300053177	Ga0500636_0076488	Ga0500636_0076488_691_1485	257
1196	3300053730	Ga0500645_037385	Ga0500645_037385_301_1101	257
1197	3300053735	Ga0500596_007340	Ga0500596_007340_250_1050	257
1198	iso_pu_bacteria	2643221547	2643758345	257
1199	iso_pu_bacteria	2791355199	2793076390	257
1200	iso_pu_bacteria	2876808645	2876810539	257
1201	iso_pu_bacteria	2879110137	2879114397	257
1202	iso_pu_bacteria	2889033259	2889038354	257
1203	iso_pu_bacteria	8006964411	8006969037	257
1204	iso_pu_bacteria	8006984368	8006987516	257
1205	iso_pu_bacteria	8006994254	8006995017	257
1206	3300001979	JGI24740J21852_10000714	JGI24740J21852_1000071413	258
1207	3300001979	JGI24740J21852_10015548	JGI24740J21852_100155482	258
1208	3300002704	JGI25155J39150_1000075	JGI25155J39150_100007534	258
1209	3300002705	JGI25156J39149_1000103	JGI25156J39149_100010325	258
1210	3300002737	JGI25162J39368_1001664	JGI25162J39368_100166412	258
1211	3300002738	JGI25154J39366_1000018	JGI25154J39366_1000018209	258
1212	3300002739	JGI25158J39367_1000444	JGI25158J39367_10004449	258
1213	3300002739	JGI25158J39367_1000860	JGI25158J39367_10008604	258
1214	3300002741	JGI25157J39369_1000074	JGI25157J39369_100007435	258
1215	3300002741	JGI25157J39369_1001580	JGI25157J39369_10015806	258
1216	3300002773	JGI25152J39213_1001744	JGI25152J39213_10017448	258
1217	3300002773	JGI25152J39213_1004252	JGI25152J39213_10042525	258
1218	3300002773	JGI25152J39213_1005493	JGI25152J39213_10054934	258
1219	3300002773	JGI25152J39213_1008225	JGI25152J39213_10082253	258
1220	3300002774	JGI25150J39212_1000403	JGI25150J39212_100040323	258
1221	3300002774	JGI25150J39212_1001783	JGI25150J39212_10017834	258
1222	3300002987	JGI25159J45721_1002297	JGI25159J45721_10022975	258
1223	3300002987	JGI25159J45721_1003043	JGI25159J45721_10030437	258
1224	3300003187	JGI25151J46595_10000359	JGI25151J46595_1000035932	258
1225	3300003187	JGI25151J46595_10001468	JGI25151J46595_100014681	258
1226	3300003187	JGI25151J46595_10002402	JGI25151J46595_1000240212	258
1227	3300003187	JGI25151J46595_10004694	JGI25151J46595_100046941	258
1228	3300003187	JGI25151J46595_10018684	JGI25151J46595_100186843	258
1229	3300003187	JGI25151J46595_10057965	JGI25151J46595_100579652	258
1230	3300003203	JGI25406J46586_10007755	JGI25406J46586_100077555	258
1231	3300003214	JGI25165J46597_1000034	JGI25165J46597_1000034112	258
1232	3300003214	JGI25165J46597_1000431	JGI25165J46597_100043117	258
1233	3300003214	JGI25165J46597_1000533	JGI25165J46597_100053315	258
1234	3300003214	JGI25165J46597_1005326	JGI25165J46597_10053262	258
1235	3300003214	JGI25165J46597_1011581	JGI25165J46597_10115812	258
1236	3300003215	JGI25153J46596_10001090	JGI25153J46596_1000109014	258
1237	3300003215	JGI25153J46596_10001143	JGI25153J46596_100011439	258
1238	3300003215	JGI25153J46596_10010548	JGI25153J46596_100105485	258
1239	3300003215	JGI25153J46596_10011153	JGI25153J46596_100111532	258
1240	3300003215	JGI25153J46596_10011180	JGI25153J46596_100111804	258
1241	3300003215	JGI25153J46596_10032632	JGI25153J46596_100326323	258
1242	3300003215	JGI25153J46596_10057916	JGI25153J46596_100579161	258
1243	3300003354	JGI25160J50197_1000044	JGI25160J50197_100004459	258
1244	3300003354	JGI25160J50197_1000419	JGI25160J50197_100041925	258
1245	3300003354	JGI25160J50197_1012233	JGI25160J50197_10122332	258
1246	3300003354	JGI25160J50197_1012556	JGI25160J50197_10125563	258
1247	3300003374	JGI25161J50226_1000028	JGI25161J50226_100002880	258
1248	3300003374	JGI25161J50226_1000078	JGI25161J50226_10000785	258
1249	3300003374	JGI25161J50226_1000220	JGI25161J50226_10002203	258
1250	3300003374	JGI25161J50226_1001317	JGI25161J50226_10013177	258
1251	3300003578	Ga0006562J51391_1104273	Ga0006562J51391_11042732	258
1252	3300003578	Ga0006562J51391_1104274	Ga0006562J51391_11042742	258
1253	3300003762	Ga0055542_1007075	Ga0055542_10070752	258
1254	3300003771	Ga0055526_1002069	Ga0055526_10020693	258
1255	3300003771	Ga0055526_1011751	Ga0055526_10117513	258
1256	3300003771	Ga0055526_1014578	Ga0055526_10145784	258
1257	3300003771	Ga0055526_1015633	Ga0055526_10156333	258
1258	3300003771	Ga0055526_1026448	Ga0055526_10264482	258
1259	3300003771	Ga0055526_1032633	Ga0055526_10326332	258
1260	3300003775	Ga0055524_1003742	Ga0055524_10037423	258
1261	3300003775	Ga0055524_1005816	Ga0055524_10058167	258
1262	3300003775	Ga0055524_1009459	Ga0055524_10094593	258
1263	3300003775	Ga0055524_1010135	Ga0055524_10101354	258
1264	3300003775	Ga0055524_1010584	Ga0055524_10105843	258
1265	3300003775	Ga0055524_1022051	Ga0055524_10220512	258
1266	3300003781	Ga0055536_1014259	Ga0055536_10142592	258
1267	3300003781	Ga0055536_1022098	Ga0055536_10220982	258
1268	3300003790	Ga0055528_1000113	Ga0055528_100011316	258
1269	3300003790	Ga0055528_1000734	Ga0055528_100073423	258
1270	3300003790	Ga0055528_1004792	Ga0055528_10047926	258
1271	3300003790	Ga0055528_1004934	Ga0055528_10049343	258
1272	3300003790	Ga0055528_1008122	Ga0055528_10081224	258
1273	3300003791	Ga0055530_10014753	Ga0055530_100147534	258
1274	3300003792	Ga0055540_1000305	Ga0055540_100030518	258
1275	3300003792	Ga0055540_1000495	Ga0055540_100049529	258
1276	3300003792	Ga0055540_1004656	Ga0055540_10046568	258
1277	3300003792	Ga0055540_1005461	Ga0055540_10054613	258
1278	3300003794	Ga0055531_10000281	Ga0055531_1000028159	258
1279	3300003794	Ga0055531_10003992	Ga0055531_100039926	258
1280	3300003794	Ga0055531_10012777	Ga0055531_100127774	258
1281	3300003794	Ga0055531_10019620	Ga0055531_100196204	258
1282	3300003856	Ga0058692_1011904	Ga0058692_10119042	258
1283	3300004625	Ga0055543_1000054	Ga0055543_100005475	258
1284	3300004625	Ga0055543_1000069	Ga0055543_100006951	258
1285	3300004625	Ga0055543_1000921	Ga0055543_100092114	258
1286	3300004625	Ga0055543_1001068	Ga0055543_10010689	258
1287	3300005262	Ga0065165_1000002	Ga0065165_1000002394	258
1288	3300005262	Ga0065165_1000318	Ga0065165_100031874	258
1289	3300005262	Ga0065165_1006145	Ga0065165_10061453	258
1290	3300005262	Ga0065165_1006328	Ga0065165_10063284	258
1291	3300005262	Ga0065165_1018137	Ga0065165_10181372	258
1292	3300005289	Ga0065704_10125547	Ga0065704_101255472	258
1293	3300005327	Ga0070658_10182399	Ga0070658_101823992	258
1294	3300005328	Ga0070676_10070205	Ga0070676_100702053	258
1295	3300005331	Ga0070670_100000200	Ga0070670_10000020024	258
1296	3300005336	Ga0070680_100172792	Ga0070680_1001727922	258
1297	3300005339	Ga0070660_100391876	Ga0070660_1003918762	258
1298	3300005345	Ga0070692_10062320	Ga0070692_100623202	258
1299	3300005347	Ga0070668_100093299	Ga0070668_1000932992	258
1300	3300005353	Ga0070669_100463173	Ga0070669_1004631732	258
1301	3300005355	Ga0070671_100017305	Ga0070671_1000173053	258
1302	3300005356	Ga0070674_100130097	Ga0070674_1001300972	258
1303	3300005356	Ga0070674_100206748	Ga0070674_1002067481	258
1304	3300005367	Ga0070667_100303963	Ga0070667_1003039632	258
1305	3300005434	Ga0070709_10083139	Ga0070709_100831391	258
1306	3300005435	Ga0070714_100040671	Ga0070714_1000406715	258
1307	3300005436	Ga0070713_100144784	Ga0070713_1001447843	258
1308	3300005437	Ga0070710_10371338	Ga0070710_103713381	258
1309	3300005441	Ga0070700_100191035	Ga0070700_1001910352	258
1310	3300005441	Ga0070700_100414817	Ga0070700_1004148172	258
1311	3300005445	Ga0070708_100011012	Ga0070708_1000110126	258
1312	3300005455	Ga0070663_100156237	Ga0070663_1001562372	258
1313	3300005456	Ga0070678_100535597	Ga0070678_1005355971	258
1314	3300005458	Ga0070681_10066058	Ga0070681_100660582	258
1315	3300005467	Ga0070706_100107476	Ga0070706_1001074763	258
1316	3300005468	Ga0070707_100784964	Ga0070707_1007849641	258
1317	3300005518	Ga0070699_100016359	Ga0070699_1000163593	258
1318	3300005518	Ga0070699_100161043	Ga0070699_1001610432	258
1319	3300005530	Ga0070679_100015435	Ga0070679_10001543511	258
1320	3300005536	Ga0070697_100179801	Ga0070697_1001798012	258
1321	3300005539	Ga0068853_100144679	Ga0068853_1001446793	258
1322	3300005539	Ga0068853_100343390	Ga0068853_1003433902	258
1323	3300005543	Ga0070672_100263577	Ga0070672_1002635772	258
1324	3300005546	Ga0070696_100089256	Ga0070696_1000892562	258
1325	3300005548	Ga0070665_100019862	Ga0070665_1000198627	258
1326	3300005548	Ga0070665_100026486	Ga0070665_1000264862	258
1327	3300005548	Ga0070665_100051436	Ga0070665_1000514364	258
1328	3300005548	Ga0070665_100122328	Ga0070665_1001223282	258
1329	3300005548	Ga0070665_100261582	Ga0070665_1002615822	258
1330	3300005548	Ga0070665_100381117	Ga0070665_1003811172	258
1331	3300005548	Ga0070665_100396515	Ga0070665_1003965152	258
1332	3300005549	Ga0070704_100254097	Ga0070704_1002540972	258
1333	3300005563	Ga0068855_100288503	Ga0068855_1002885032	258
1334	3300005577	Ga0068857_100258785	Ga0068857_1002587852	258
1335	3300005578	Ga0068854_100322424	Ga0068854_1003224241	258
1336	3300005578	Ga0068854_100513871	Ga0068854_1005138712	258
1337	3300005614	Ga0068856_100383590	Ga0068856_1003835902	258
1338	3300005616	Ga0068852_100005223	Ga0068852_1000052232	258
1339	3300005616	Ga0068852_100664760	Ga0068852_1006647602	258
1340	3300005718	Ga0068866_10043328	Ga0068866_100433282	258
1341	3300005843	Ga0068860_100124202	Ga0068860_1001242022	258
1342	3300005843	Ga0068860_100195863	Ga0068860_1001958632	258
1343	3300005844	Ga0068862_100180632	Ga0068862_1001806323	258
1344	3300005844	Ga0068862_100509329	Ga0068862_1005093292	258
1345	3300005937	Ga0081455_10000015	Ga0081455_10000015115	258
1346	3300005937	Ga0081455_10014229	Ga0081455_100142299	258
1347	3300005937	Ga0081455_10055358	Ga0081455_100553584	258
1348	3300005937	Ga0081455_10080287	Ga0081455_100802872	258
1349	3300005981	Ga0081538_10068108	Ga0081538_100681082	258
1350	3300005983	Ga0081540_1006827	Ga0081540_10068277	258
1351	3300005983	Ga0081540_1012569	Ga0081540_10125693	258
1352	3300005983	Ga0081540_1013103	Ga0081540_10131038	258
1353	3300005983	Ga0081540_1013684	Ga0081540_10136843	258
1354	3300005983	Ga0081540_1014281	Ga0081540_10142815	258
1355	3300005983	Ga0081540_1123962	Ga0081540_11239622	258
1356	3300005985	Ga0081539_10004610	Ga0081539_1000461011	258
1357	3300006028	Ga0070717_10008262	Ga0070717_100082622	258
1358	3300006028	Ga0070717_10164089	Ga0070717_101640892	258
1359	3300006028	Ga0070717_10239364	Ga0070717_102393642	258
1360	3300006038	Ga0075365_10004362	Ga0075365_100043625	258
1361	3300006038	Ga0075365_10010183	Ga0075365_100101837	258
1362	3300006038	Ga0075365_10014622	Ga0075365_100146226	258
1363	3300006038	Ga0075365_10015935	Ga0075365_100159355	258
1364	3300006038	Ga0075365_10046670	Ga0075365_100466702	258
1365	3300006038	Ga0075365_10127504	Ga0075365_101275042	258
1366	3300006038	Ga0075365_10511732	Ga0075365_105117321	258
1367	3300006042	Ga0075368_10000657	Ga0075368_100006578	258
1368	3300006042	Ga0075368_10000851	Ga0075368_100008519	258
1369	3300006042	Ga0075368_10020587	Ga0075368_100205873	258
1370	3300006042	Ga0075368_10040103	Ga0075368_100401032	258
1371	3300006048	Ga0075363_100017741	Ga0075363_1000177415	258
1372	3300006048	Ga0075363_100362591	Ga0075363_1003625911	258
1373	3300006051	Ga0075364_10073061	Ga0075364_100730612	258
1374	3300006051	Ga0075364_10074084	Ga0075364_100740842	258
1375	3300006051	Ga0075364_10189053	Ga0075364_101890532	258
1376	3300006058	Ga0075432_10005521	Ga0075432_100055213	258
1377	3300006163	Ga0070715_10000498	Ga0070715_100004985	258
1378	3300006173	Ga0070716_100035949	Ga0070716_1000359492	258
1379	3300006173	Ga0070716_100469806	Ga0070716_1004698061	258
1380	3300006177	Ga0075362_10010147	Ga0075362_100101474	258
1381	3300006177	Ga0075362_10031551	Ga0075362_100315513	258
1382	3300006177	Ga0075362_10089947	Ga0075362_100899472	258
1383	3300006177	Ga0075362_10246206	Ga0075362_102462061	258
1384	3300006178	Ga0075367_10139928	Ga0075367_101399282	258
1385	3300006195	Ga0075366_10003007	Ga0075366_100030077	258
1386	3300006353	Ga0075370_10064414	Ga0075370_100644141	258
1387	3300006353	Ga0075370_10106212	Ga0075370_101062122	258
1388	3300006353	Ga0075370_10135145	Ga0075370_101351452	258
1389	3300006353	Ga0075370_10161197	Ga0075370_101611971	258
1390	3300006353	Ga0075370_10213960	Ga0075370_102139602	258
1391	3300006358	Ga0068871_100338322	Ga0068871_1003383222	258
1392	3300006844	Ga0075428_100518749	Ga0075428_1005187492	258
1393	3300006844	Ga0075428_100757707	Ga0075428_1007577072	258
1394	3300006846	Ga0075430_100001336	Ga0075430_10000133621	258
1395	3300006847	Ga0075431_100272790	Ga0075431_1002727902	258
1396	3300006852	Ga0075433_10236616	Ga0075433_102366162	258
1397	3300006871	Ga0075434_100013036	Ga0075434_1000130368	258
1398	3300006871	Ga0075434_100038869	Ga0075434_1000388692	258
1399	3300006871	Ga0075434_100048865	Ga0075434_1000488653	258
1400	3300006871	Ga0075434_100144026	Ga0075434_1001440263	258
1401	3300006871	Ga0075434_100163232	Ga0075434_1001632322	258
1402	3300006871	Ga0075434_100326257	Ga0075434_1003262572	258
1403	3300006880	Ga0075429_100026632	Ga0075429_1000266324	258
1404	3300006881	Ga0068865_100093781	Ga0068865_1000937813	258
1405	3300006914	Ga0075436_100136063	Ga0075436_1001360632	258
1406	3300006914	Ga0075436_100360426	Ga0075436_1003604262	258
1407	3300006946	Ga0079104_1000082	Ga0079104_100008242	258
1408	3300006946	Ga0079104_1003665	Ga0079104_10036654	258
1409	3300006948	Ga0099826_10029250	Ga0099826_100292504	258
1410	3300007076	Ga0075435_100011612	Ga0075435_1000116125	258
1411	3300007076	Ga0075435_100014840	Ga0075435_1000148405	258
1412	3300007076	Ga0075435_100236532	Ga0075435_1002365322	258
1413	3300007076	Ga0075435_100308609	Ga0075435_1003086092	258
1414	3300007265	Ga0099794_10194793	Ga0099794_101947931	258
1415	3300007788	Ga0099795_10028326	Ga0099795_100283262	258
1416	3300009093	Ga0105240_10000910	Ga0105240_1000091048	258
1417	3300009093	Ga0105240_10005052	Ga0105240_100050524	258
1418	3300009094	Ga0111539_10011199	Ga0111539_1001119911	258
1419	3300009094	Ga0111539_10174720	Ga0111539_101747203	258
1420	3300009098	Ga0105245_10241853	Ga0105245_102418532	258
1421	3300009147	Ga0114129_10035302	Ga0114129_100353024	258
1422	3300009147	Ga0114129_10177581	Ga0114129_101775813	258
1423	3300009147	Ga0114129_10497722	Ga0114129_104977222	258
1424	3300009147	Ga0114129_10915750	Ga0114129_109157502	258
1425	3300009148	Ga0105243_10000092	Ga0105243_1000009245	258
1426	3300009148	Ga0105243_10088183	Ga0105243_100881833	258
1427	3300009148	Ga0105243_10326600	Ga0105243_103266002	258
1428	3300009174	Ga0105241_10389606	Ga0105241_103896062	258
1429	3300009174	Ga0105241_10402783	Ga0105241_104027832	258
1430	3300009176	Ga0105242_10124502	Ga0105242_101245023	258
1431	3300009177	Ga0105248_10107505	Ga0105248_101075053	258
1432	3300009177	Ga0105248_10417244	Ga0105248_104172441	258
1433	3300009545	Ga0105237_10000122	Ga0105237_100001224	258
1434	3300009545	Ga0105237_10000946	Ga0105237_1000094622	258
1435	3300009545	Ga0105237_10001825	Ga0105237_1000182511	258
1436	3300009545	Ga0105237_10179061	Ga0105237_101790613	258
1437	3300009545	Ga0105237_10496158	Ga0105237_104961582	258
1438	3300009551	Ga0105238_10071049	Ga0105238_100710492	258
1439	3300009551	Ga0105238_10302906	Ga0105238_103029062	258
1440	3300009551	Ga0105238_10390824	Ga0105238_103908242	258
1441	3300009551	Ga0105238_10709183	Ga0105238_107091832	258
1442	3300009553	Ga0105249_10239989	Ga0105249_102399892	258
1443	3300009765	Ga0123341_1000017	Ga0123341_100001726	258
1444	3300009765	Ga0123341_1049419	Ga0123341_10494192	258
1445	3300009766	Ga0123342_1022929	Ga0123342_10229293	258
1446	3300010375	Ga0105239_10002962	Ga0105239_1000296217	258
1447	3300010375	Ga0105239_10386765	Ga0105239_103867651	258
1448	3300011119	Ga0105246_10164597	Ga0105246_101645972	258
1449	3300013100	Ga0157373_10014989	Ga0157373_100149897	258
1450	3300013100	Ga0157373_10059727	Ga0157373_100597273	258
1451	3300013100	Ga0157373_10403381	Ga0157373_104033811	258
1452	3300013102	Ga0157371_10000004	Ga0157371_10000004114	258
1453	3300013102	Ga0157371_10009477	Ga0157371_100094777	258
1454	3300013104	Ga0157370_10000909	Ga0157370_100009099	258
1455	3300013104	Ga0157370_10001019	Ga0157370_1000101920	258
1456	3300013105	Ga0157369_10152146	Ga0157369_101521462	258
1457	3300013249	Ga0171463_1013	Ga0171463_101324	258
1458	3300013297	Ga0157378_10096362	Ga0157378_100963623	258
1459	3300013297	Ga0157378_10189914	Ga0157378_101899142	258
1460	3300013306	Ga0163162_10172061	Ga0163162_101720612	258
1461	3300013306	Ga0163162_10425338	Ga0163162_104253382	258
1462	3300013308	Ga0157375_10114665	Ga0157375_101146652	258
1463	3300014325	Ga0163163_10329917	Ga0163163_103299172	258
1464	3300014326	Ga0157380_10115710	Ga0157380_101157103	258
1465	3300014326	Ga0157380_10549735	Ga0157380_105497352	258
1466	3300014497	Ga0182008_10029495	Ga0182008_100294953	258
1467	3300014969	Ga0157376_10332437	Ga0157376_103324372	258
1468	3300015261	Ga0182006_1111237	Ga0182006_11112372	258
1469	3300015261	Ga0182006_1115534	Ga0182006_11155342	258
1470	3300015262	Ga0182007_10001788	Ga0182007_100017889	258
1471	3300015262	Ga0182007_10019513	Ga0182007_100195132	258
1472	3300015690	Ga0183363_1141	Ga0183363_114114	258
1473	3300017792	Ga0163161_10046393	Ga0163161_100463933	258
1474	3300017792	Ga0163161_10140956	Ga0163161_101409562	258
1475	3300021320	Ga0214544_1000329	Ga0214544_100032963	258
1476	3300021321	Ga0214542_1000084	Ga0214542_100008463	258
1477	3300021321	Ga0214542_1022384	Ga0214542_10223844	258
1478	3300021327	Ga0214543_1000025	Ga0214543_100002520	258
1479	3300021327	Ga0214543_1000076	Ga0214543_100007663	258
1480	3300021361	Ga0213872_10017171	Ga0213872_100171713	258
1481	3300021361	Ga0213872_10030531	Ga0213872_100305312	258
1482	3300021361	Ga0213872_10051095	Ga0213872_100510952	258
1483	3300021377	Ga0213874_10021462	Ga0213874_100214622	258
1484	3300021377	Ga0213874_10046649	Ga0213874_100466492	258
1485	3300021377	Ga0213874_10054628	Ga0213874_100546282	258
1486	3300021388	Ga0213875_10098790	Ga0213875_100987902	258
1487	3300021441	Ga0213871_10002537	Ga0213871_100025373	258
1488	3300022739	Ga0228711_1000020	Ga0228711_100002033	258
1489	3300022740	Ga0228710_1000012	Ga0228710_100001261	258
1490	3300025206	Ga0209435_100044	Ga0209435_10004445	258
1491	3300025208	Ga0209436_100208	Ga0209436_1002089	258
1492	3300025208	Ga0209436_100645	Ga0209436_10064517	258
1493	3300025231	Ga0207427_105416	Ga0207427_1054161	258
1494	3300025233	Ga0209437_100050	Ga0209437_10005025	258
1495	3300025233	Ga0209437_100205	Ga0209437_10020528	258
1496	3300025245	Ga0207425_1000621	Ga0207425_10006211	258
1497	3300025245	Ga0207425_1000822	Ga0207425_10008227	258
1498	3300025245	Ga0207425_1007035	Ga0207425_10070352	258
1499	3300025245	Ga0207425_1007558	Ga0207425_10075583	258
1500	3300025245	Ga0207425_1020312	Ga0207425_10203122	258
1501	3300025246	Ga0209646_1000151	Ga0209646_100015145	258
1502	3300025246	Ga0209646_1022941	Ga0209646_10229411	258
1503	3300025250	Ga0209026_1000100	Ga0209026_100010048	258
1504	3300025250	Ga0209026_1000170	Ga0209026_100017045	258
1505	3300025253	Ga0209677_100959	Ga0209677_10095912	258
1506	3300025254	Ga0209148_1000069	Ga0209148_1000069133	258
1507	3300025254	Ga0209148_1000216	Ga0209148_100021645	258
1508	3300025254	Ga0209148_1003399	Ga0209148_10033993	258
1509	3300025256	Ga0209759_1000186	Ga0209759_100018647	258
1510	3300025256	Ga0209759_1000899	Ga0209759_100089916	258
1511	3300025258	Ga0209129_1000066	Ga0209129_1000066194	258
1512	3300025258	Ga0209129_1000141	Ga0209129_1000141104	258
1513	3300025258	Ga0209129_1000373	Ga0209129_100037319	258
1514	3300025258	Ga0209129_1000963	Ga0209129_100096310	258
1515	3300025258	Ga0209129_1002042	Ga0209129_10020429	258
1516	3300025258	Ga0209129_1002881	Ga0209129_10028817	258
1517	3300025261	Ga0209233_1000028	Ga0209233_1000028116	258
1518	3300025261	Ga0209233_1000037	Ga0209233_100003767	258
1519	3300025261	Ga0209233_1000187	Ga0209233_100018748	258
1520	3300025261	Ga0209233_1000232	Ga0209233_100023222	258
1521	3300025261	Ga0209233_1000444	Ga0209233_10004445	258
1522	3300025261	Ga0209233_1002339	Ga0209233_10023399	258
1523	3300025261	Ga0209233_1005270	Ga0209233_10052703	258
1524	3300025261	Ga0209233_1015200	Ga0209233_10152002	258
1525	3300025272	Ga0209455_1000135	Ga0209455_100013554	258
1526	3300025272	Ga0209455_1001447	Ga0209455_10014472	258
1527	3300025273	Ga0209673_1000024	Ga0209673_100002470	258
1528	3300025273	Ga0209673_1000358	Ga0209673_100035855	258
1529	3300025273	Ga0209673_1000526	Ga0209673_100052654	258
1530	3300025273	Ga0209673_1001893	Ga0209673_10018932	258
1531	3300025273	Ga0209673_1003909	Ga0209673_10039094	258
1532	3300025273	Ga0209673_1004620	Ga0209673_10046202	258
1533	3300025273	Ga0209673_1010160	Ga0209673_10101602	258
1534	3300025273	Ga0209673_1011882	Ga0209673_10118824	258
1535	3300025273	Ga0209673_1023578	Ga0209673_10235783	258
1536	3300025273	Ga0209673_1049094	Ga0209673_10490942	258
1537	3300025284	Ga0209130_1000002	Ga0209130_1000002618	258
1538	3300025284	Ga0209130_1000010	Ga0209130_1000010390	258
1539	3300025284	Ga0209130_1000093	Ga0209130_100009359	258
1540	3300025284	Ga0209130_1004443	Ga0209130_10044435	258
1541	3300025291	Ga0209675_1036206	Ga0209675_10362062	258
1542	3300025292	Ga0209676_1008224	Ga0209676_10082243	258
1543	3300025292	Ga0209676_1011207	Ga0209676_10112071	258
1544	3300025292	Ga0209676_1015694	Ga0209676_10156942	258
1545	3300025292	Ga0209676_1025828	Ga0209676_10258282	258
1546	3300025294	Ga0209025_1000144	Ga0209025_100014422	258
1547	3300025294	Ga0209025_1000274	Ga0209025_100027464	258
1548	3300025294	Ga0209025_1000275	Ga0209025_100027597	258
1549	3300025294	Ga0209025_1000436	Ga0209025_100043630	258
1550	3300025294	Ga0209025_1000534	Ga0209025_100053446	258
1551	3300025294	Ga0209025_1001405	Ga0209025_100140512	258
1552	3300025294	Ga0209025_1008658	Ga0209025_10086588	258
1553	3300025294	Ga0209025_1015207	Ga0209025_10152074	258
1554	3300025294	Ga0209025_1037130	Ga0209025_10371302	258
1555	3300025294	Ga0209025_1044973	Ga0209025_10449733	258
1556	3300025295	Ga0209564_1000262	Ga0209564_1000262117	258
1557	3300025295	Ga0209564_1000473	Ga0209564_100047325	258
1558	3300025295	Ga0209564_1000474	Ga0209564_100047424	258
1559	3300025295	Ga0209564_1000486	Ga0209564_100048647	258
1560	3300025295	Ga0209564_1001714	Ga0209564_100171423	258
1561	3300025295	Ga0209564_1003062	Ga0209564_100306213	258
1562	3300025295	Ga0209564_1004831	Ga0209564_10048315	258
1563	3300025295	Ga0209564_1006881	Ga0209564_10068815	258
1564	3300025295	Ga0209564_1020588	Ga0209564_10205883	258
1565	3300025297	Ga0209758_1000015	Ga0209758_1000015589	258
1566	3300025297	Ga0209758_1000161	Ga0209758_100016177	258
1567	3300025297	Ga0209758_1000229	Ga0209758_100022922	258
1568	3300025297	Ga0209758_1000466	Ga0209758_100046648	258
1569	3300025297	Ga0209758_1000699	Ga0209758_100069930	258
1570	3300025297	Ga0209758_1000753	Ga0209758_10007537	258
1571	3300025297	Ga0209758_1001169	Ga0209758_10011696	258
1572	3300025297	Ga0209758_1001202	Ga0209758_100120226	258
1573	3300025297	Ga0209758_1001234	Ga0209758_100123414	258
1574	3300025297	Ga0209758_1001304	Ga0209758_100130414	258
1575	3300025297	Ga0209758_1009515	Ga0209758_10095155	258
1576	3300025297	Ga0209758_1010265	Ga0209758_10102653	258
1577	3300025297	Ga0209758_1035578	Ga0209758_10355783	258
1578	3300025297	Ga0209758_1045552	Ga0209758_10455521	258
1579	3300025298	Ga0209050_1005974	Ga0209050_10059748	258
1580	3300025298	Ga0209050_1027082	Ga0209050_10270822	258
1581	3300025299	Ga0209256_1000509	Ga0209256_100050923	258
1582	3300025299	Ga0209256_1000756	Ga0209256_100075618	258
1583	3300025299	Ga0209256_1001194	Ga0209256_100119416	258
1584	3300025299	Ga0209256_1002059	Ga0209256_100205917	258
1585	3300025299	Ga0209256_1003453	Ga0209256_10034538	258
1586	3300025299	Ga0209256_1003874	Ga0209256_100387411	258
1587	3300025299	Ga0209256_1010990	Ga0209256_10109903	258
1588	3300025299	Ga0209256_1011550	Ga0209256_10115505	258
1589	3300025299	Ga0209256_1016199	Ga0209256_10161993	258
1590	3300025299	Ga0209256_1025178	Ga0209256_10251783	258
1591	3300025302	Ga0207426_1000012	Ga0207426_1000012658	258
1592	3300025302	Ga0207426_1000013	Ga0207426_1000013618	258
1593	3300025302	Ga0207426_1000036	Ga0207426_1000036390	258
1594	3300025302	Ga0207426_1000142	Ga0207426_1000142142	258
1595	3300025302	Ga0207426_1026207	Ga0207426_10262072	258
1596	3300025302	Ga0207426_1030902	Ga0207426_10309022	258
1597	3300025303	Ga0209051_1000170	Ga0209051_100017055	258
1598	3300025303	Ga0209051_1000172	Ga0209051_100017283	258
1599	3300025303	Ga0209051_1000178	Ga0209051_100017877	258
1600	3300025303	Ga0209051_1000704	Ga0209051_100070412	258
1601	3300025303	Ga0209051_1009663	Ga0209051_10096635	258
1602	3300025303	Ga0209051_1012742	Ga0209051_10127422	258
1603	3300025304	Ga0209257_1000015	Ga0209257_1000015504	258
1604	3300025304	Ga0209257_1000108	Ga0209257_1000108206	258
1605	3300025304	Ga0209257_1001648	Ga0209257_100164818	258
1606	3300025304	Ga0209257_1004903	Ga0209257_100490310	258
1607	3300025304	Ga0209257_1008334	Ga0209257_10083344	258
1608	3300025304	Ga0209257_1024843	Ga0209257_10248432	258
1609	3300025304	Ga0209257_1039453	Ga0209257_10394532	258
1610	3300025898	Ga0207692_10087626	Ga0207692_100876262	258
1611	3300025901	Ga0207688_10149192	Ga0207688_101491922	258
1612	3300025904	Ga0207647_10018254	Ga0207647_100182545	258
1613	3300025905	Ga0207685_10088654	Ga0207685_100886542	258
1614	3300025905	Ga0207685_10204504	Ga0207685_102045041	258
1615	3300025906	Ga0207699_10011253	Ga0207699_100112531	258
1616	3300025907	Ga0207645_10034835	Ga0207645_100348351	258
1617	3300025909	Ga0207705_10030223	Ga0207705_100302235	258
1618	3300025911	Ga0207654_10226293	Ga0207654_102262932	258
1619	3300025911	Ga0207654_10228507	Ga0207654_102285072	258
1620	3300025913	Ga0207695_10000006	Ga0207695_10000006215	258
1621	3300025913	Ga0207695_10000427	Ga0207695_1000042748	258
1622	3300025913	Ga0207695_10489800	Ga0207695_104898002	258
1623	3300025914	Ga0207671_10000249	Ga0207671_1000024965	258
1624	3300025914	Ga0207671_10000288	Ga0207671_1000028825	258
1625	3300025914	Ga0207671_10005136	Ga0207671_1000513613	258
1626	3300025914	Ga0207671_10052926	Ga0207671_100529262	258
1627	3300025915	Ga0207693_10009277	Ga0207693_100092775	258
1628	3300025915	Ga0207693_10024590	Ga0207693_100245901	258
1629	3300025915	Ga0207693_10058071	Ga0207693_100580713	258
1630	3300025917	Ga0207660_10159155	Ga0207660_101591552	258
1631	3300025919	Ga0207657_10096071	Ga0207657_100960713	258
1632	3300025919	Ga0207657_10179314	Ga0207657_101793143	258
1633	3300025919	Ga0207657_10325515	Ga0207657_103255152	258
1634	3300025923	Ga0207681_10065702	Ga0207681_100657023	258
1635	3300025923	Ga0207681_10193575	Ga0207681_101935752	258
1636	3300025923	Ga0207681_10210349	Ga0207681_102103492	258
1637	3300025925	Ga0207650_10000424	Ga0207650_1000042424	258
1638	3300025927	Ga0207687_10418781	Ga0207687_104187811	258
1639	3300025928	Ga0207700_10015435	Ga0207700_100154353	258
1640	3300025928	Ga0207700_10394417	Ga0207700_103944172	258
1641	3300025929	Ga0207664_10028091	Ga0207664_100280915	258
1642	3300025929	Ga0207664_10138422	Ga0207664_101384223	258
1643	3300025931	Ga0207644_10081122	Ga0207644_100811222	258
1644	3300025931	Ga0207644_10349329	Ga0207644_103493292	258
1645	3300025933	Ga0207706_10090454	Ga0207706_100904543	258
1646	3300025933	Ga0207706_10100573	Ga0207706_101005732	258
1647	3300025934	Ga0207686_10100088	Ga0207686_101000882	258
1648	3300025935	Ga0207709_10000085	Ga0207709_1000008567	258
1649	3300025937	Ga0207669_10012355	Ga0207669_100123553	258
1650	3300025937	Ga0207669_10168817	Ga0207669_101688172	258
1651	3300025938	Ga0207704_10009681	Ga0207704_100096812	258
1652	3300025939	Ga0207665_10003554	Ga0207665_1000355412	258
1653	3300025940	Ga0207691_10234513	Ga0207691_102345132	258
1654	3300025941	Ga0207711_10214945	Ga0207711_102149451	258
1655	3300025941	Ga0207711_10318885	Ga0207711_103188852	258
1656	3300025941	Ga0207711_10334643	Ga0207711_103346432	258
1657	3300025942	Ga0207689_10256435	Ga0207689_102564352	258
1658	3300025944	Ga0207661_10560734	Ga0207661_105607341	258
1659	3300025949	Ga0207667_10156216	Ga0207667_101562163	258
1660	3300025949	Ga0207667_10776278	Ga0207667_107762782	258
1661	3300025972	Ga0207668_10041514	Ga0207668_100415143	258
1662	3300025972	Ga0207668_10101664	Ga0207668_101016642	258
1663	3300025981	Ga0207640_10083717	Ga0207640_100837172	258
1664	3300025981	Ga0207640_10261016	Ga0207640_102610162	258
1665	3300026023	Ga0207677_10069218	Ga0207677_100692182	258
1666	3300026041	Ga0207639_10001845	Ga0207639_100018456	258
1667	3300026041	Ga0207639_10207710	Ga0207639_102077102	258
1668	3300026067	Ga0207678_10028354	Ga0207678_100283544	258
1669	3300026067	Ga0207678_10055975	Ga0207678_100559752	258
1670	3300026067	Ga0207678_10180904	Ga0207678_101809042	258
1671	3300026075	Ga0207708_10243715	Ga0207708_102437152	258
1672	3300026078	Ga0207702_10105665	Ga0207702_101056652	258
1673	3300026078	Ga0207702_10534455	Ga0207702_105344551	258
1674	3300026089	Ga0207648_10047581	Ga0207648_100475813	258
1675	3300026089	Ga0207648_10329564	Ga0207648_103295642	258
1676	3300026089	Ga0207648_10412913	Ga0207648_104129132	258
1677	3300026095	Ga0207676_10200054	Ga0207676_102000542	258
1678	3300026116	Ga0207674_10049280	Ga0207674_100492802	258
1679	3300026116	Ga0207674_10175085	Ga0207674_101750853	258
1680	3300026116	Ga0207674_10386878	Ga0207674_103868782	258
1681	3300026118	Ga0207675_100026549	Ga0207675_1000265495	258
1682	3300026118	Ga0207675_100180964	Ga0207675_1001809642	258
1683	3300026118	Ga0207675_100350563	Ga0207675_1003505632	258
1684	3300026121	Ga0207683_10270476	Ga0207683_102704762	258
1685	3300026121	Ga0207683_10626316	Ga0207683_106263161	258
1686	3300026142	Ga0207698_10054963	Ga0207698_100549633	258
1687	3300027111	Ga0209281_1000043	Ga0209281_100004340	258
1688	3300027111	Ga0209281_1000138	Ga0209281_1000138115	258
1689	3300027111	Ga0209281_1000591	Ga0209281_100059128	258
1690	3300027296	Ga0209389_1000062	Ga0209389_100006276	258
1691	3300027312	Ga0209371_1000009	Ga0209371_1000009882	258
1692	3300027312	Ga0209371_1007211	Ga0209371_10072113	258
1693	3300027312	Ga0209371_1011290	Ga0209371_10112902	258
1694	3300027361	Ga0209489_100160	Ga0209489_10016076	258
1695	3300027363	Ga0209700_101128	Ga0209700_10112836	258
1696	3300027666	Ga0209282_1000020	Ga0209282_1000020115	258
1697	3300027666	Ga0209282_1001362	Ga0209282_100136215	258
1698	3300027671	Ga0209588_1000381	Ga0209588_10003818	258
1699	3300027866	Ga0209813_10000141	Ga0209813_1000014116	258
1700	3300027866	Ga0209813_10008068	Ga0209813_100080683	258
1701	3300027866	Ga0209813_10027826	Ga0209813_100278262	258
1702	3300027866	Ga0209813_10058163	Ga0209813_100581632	258
1703	3300028379	Ga0268266_10006046	Ga0268266_1000604610	258
1704	3300028379	Ga0268266_10019799	Ga0268266_100197996	258
1705	3300028379	Ga0268266_10037632	Ga0268266_100376323	258
1706	3300028379	Ga0268266_10135791	Ga0268266_101357912	258
1707	3300028379	Ga0268266_10138330	Ga0268266_101383303	258
1708	3300028379	Ga0268266_10145736	Ga0268266_101457362	258
1709	3300028379	Ga0268266_10249760	Ga0268266_102497602	258
1710	3300028380	Ga0268265_10036930	Ga0268265_100369305	258
1711	3300028380	Ga0268265_10438155	Ga0268265_104381552	258
1712	3300028381	Ga0268264_10000020	Ga0268264_10000020221	258
1713	3300028381	Ga0268264_10287523	Ga0268264_102875232	258
1714	3300028577	Ga0265318_10010741	Ga0265318_100107413	258
1715	3300028577	Ga0265318_10046139	Ga0265318_100461392	258
1716	3300028786	Ga0307517_10103413	Ga0307517_101034133	258
1717	3300028794	Ga0307515_10000034	Ga0307515_1000003487	258
1718	3300028794	Ga0307515_10000136	Ga0307515_1000013623	258
1719	3300028794	Ga0307515_10003222	Ga0307515_1000322218	258
1720	3300028794	Ga0307515_10012584	Ga0307515_100125843	258
1721	3300030500	Ga0268256_1000010	Ga0268256_1000010881	258
1722	3300030500	Ga0268256_1001297	Ga0268256_10012972	258
1723	3300030500	Ga0268256_1011141	Ga0268256_10111412	258
1724	3300030521	Ga0307511_10122620	Ga0307511_101226202	258
1725	3300031235	Ga0265330_10050422	Ga0265330_100504222	258
1726	3300031238	Ga0265332_10012314	Ga0265332_100123144	258
1727	3300031241	Ga0265325_10020621	Ga0265325_100206214	258
1728	3300031241	Ga0265325_10105167	Ga0265325_101051672	258
1729	3300031241	Ga0265325_10142308	Ga0265325_101423081	258
1730	3300031247	Ga0265340_10030737	Ga0265340_100307373	258
1731	3300031247	Ga0265340_10065692	Ga0265340_100656923	258
1732	3300031249	Ga0265339_10012260	Ga0265339_100122603	258
1733	3300031249	Ga0265339_10013093	Ga0265339_100130932	258
1734	3300031250	Ga0265331_10036354	Ga0265331_100363543	258
1735	3300031251	Ga0265327_10067577	Ga0265327_100675771	258
1736	3300031344	Ga0265316_10152096	Ga0265316_101520962	258
1737	3300031344	Ga0265316_10311952	Ga0265316_103119522	258
1738	3300031456	Ga0307513_10005749	Ga0307513_1000574914	258
1739	3300031456	Ga0307513_10100173	Ga0307513_101001733	258
1740	3300031507	Ga0307509_10018864	Ga0307509_100188649	258
1741	3300031507	Ga0307509_10298000	Ga0307509_102980001	258
1742	3300031548	Ga0307408_100125500	Ga0307408_1001255002	258
1743	3300031595	Ga0265313_10044495	Ga0265313_100444952	258
1744	3300031616	Ga0307508_10000025	Ga0307508_10000025103	258
1745	3300031616	Ga0307508_10163915	Ga0307508_101639151	258
1746	3300031616	Ga0307508_10285179	Ga0307508_102851792	258
1747	3300031711	Ga0265314_10101684	Ga0265314_101016842	258
1748	3300031711	Ga0265314_10221319	Ga0265314_102213192	258
1749	3300031712	Ga0265342_10024976	Ga0265342_100249764	258
1750	3300031712	Ga0265342_10058609	Ga0265342_100586093	258
1751	3300031712	Ga0265342_10091264	Ga0265342_100912642	258
1752	3300031727	Ga0316576_10011297	Ga0316576_100112973	258
1753	3300031730	Ga0307516_10001162	Ga0307516_1000116228	258
1754	3300031730	Ga0307516_10017995	Ga0307516_100179959	258
1755	3300031731	Ga0307405_10000258	Ga0307405_1000025810	258
1756	3300031731	Ga0307405_10246345	Ga0307405_102463451	258
1757	3300031733	Ga0316577_10269908	Ga0316577_102699081	258
1758	3300031824	Ga0307413_10148077	Ga0307413_101480771	258
1759	3300031852	Ga0307410_10160746	Ga0307410_101607463	258
1760	3300031901	Ga0307406_10000348	Ga0307406_100003482	258
1761	3300031901	Ga0307406_10004585	Ga0307406_100045854	258
1762	3300031903	Ga0307407_10575481	Ga0307407_105754811	258
1763	3300031911	Ga0307412_10000690	Ga0307412_1000069020	258
1764	3300031911	Ga0307412_10043601	Ga0307412_100436013	258
1765	3300031911	Ga0307412_10145249	Ga0307412_101452492	258
1766	3300031911	Ga0307412_10454330	Ga0307412_104543302	258
1767	3300031967	Ga0315914_1000031	Ga0315914_100003128	258
1768	3300031995	Ga0307409_100345111	Ga0307409_1003451112	258
1769	3300031995	Ga0307409_100442770	Ga0307409_1004427703	258
1770	3300031995	Ga0307409_100563512	Ga0307409_1005635122	258
1771	3300032002	Ga0307416_100444347	Ga0307416_1004443472	258
1772	3300032004	Ga0307414_10100724	Ga0307414_101007243	258
1773	3300032004	Ga0307414_10148743	Ga0307414_101487432	258
1774	3300032004	Ga0307414_10613577	Ga0307414_106135771	258
1775	3300032005	Ga0307411_10254080	Ga0307411_102540802	258
1776	3300032133	Ga0316583_10007448	Ga0316583_100074485	258
1777	3300033179	Ga0307507_10208746	Ga0307507_102087462	258
1778	3300033180	Ga0307510_10021408	Ga0307510_100214086	258
1779	3300033430	Ga0315913_1000010	Ga0315913_100001058	258
1780	3300033464	Ga0315915_1000006	Ga0315915_100000611	258
1781	3300035083	Ga0373926_0069915	Ga0373926_0069915_469_1266	258
1782	3300035086	Ga0373934_0002451	Ga0373934_0002451_5190_5978	258
1783	3300035111	Ga0373923_0002937	Ga0373923_0002937_373_1161	258
1784	3300035111	Ga0373923_0153918	Ga0373923_0153918_229_1005	258
1785	3300035113	Ga0373936_0006163	Ga0373936_0006163_1079_1873	258
1786	3300035113	Ga0373936_0198218	Ga0373936_0198218_53_835	258
1787	3300035118	Ga0373954_0016562	Ga0373954_0016562_2127_2921	258
1788	3300035119	Ga0373956_0001024	Ga0373956_0001024_3901_4689	258
1789	3300035119	Ga0373956_0089256	Ga0373956_0089256_560_1354	258
1790	3300035120	Ga0373957_0029216	Ga0373957_0029216_518_1300	258
1791	3300035120	Ga0373957_0033244	Ga0373957_0033244_987_1775	258
1792	3300035170	Ga0373943_0086972	Ga0373943_0086972_781_1578	258
1793	3300035171	Ga0373946_0017582	Ga0373946_0017582_551_1345	258
1794	3300035171	Ga0373946_0018409	Ga0373946_0018409_406_1200	258
1795	3300035172	Ga0373955_0003604	Ga0373955_0003604_4354_5142	258
1796	3300035172	Ga0373955_0110989	Ga0373955_0110989_179_973	258
1797	3300035692	Ga0373935_0003185	Ga0373935_0003185_5661_6458	258
1798	3300035692	Ga0373935_0031178	Ga0373935_0031178_737_1531	258
1799	3300035692	Ga0373935_0260490	Ga0373935_0260490_106_903	258
1800	3300035695	Ga0373927_0000147	Ga0373927_0000147_41474_42250	258
1801	3300035695	Ga0373927_0002909	Ga0373927_0002909_6351_7148	258
1802	3300035695	Ga0373927_0028834	Ga0373927_0028834_449_1243	258
1803	3300035695	Ga0373927_0047377	Ga0373927_0047377_1416_2192	258
1804	3300035724	Ga0373933_0013495	Ga0373933_0013495_1114_1902	258
1805	3300035724	Ga0373933_0026586	Ga0373933_0026586_2151_2927	258
1806	3300035724	Ga0373933_0088172	Ga0373933_0088172_245_1039	258
1807	3300035724	Ga0373933_0113379	Ga0373933_0113379_68_850	258
1808	3300035725	Ga0373947_0189129	Ga0373947_0189129_98_874	258
1809	3300036401	Ga0373937_0002075	Ga0373937_0002075_3892_4674	258
1810	3300036401	Ga0373937_0032959	Ga0373937_0032959_2254_3042	258
1811	3300036401	Ga0373937_0171775	Ga0373937_0171775_755_1552	258
1812	3300036647	Ga0316582_0035425	Ga0316582_0035425_2084_2860	258
1813	3300036712	Ga0316584_0009951	Ga0316584_0009951_919_1725	258
1814	3300037068	Ga0373925_0004474	Ga0373925_0004474_5733_6530	258
1815	3300037068	Ga0373925_0010579	Ga0373925_0010579_1736_2512	258
1816	3300037068	Ga0373925_0115498	Ga0373925_0115498_863_1657	258
1817	3300037312	Ga0395899_0107208	Ga0395899_0107208_171_962	258
1818	3300037418	Ga0395900_0050630	Ga0395900_0050630_76_870	258
1819	3300037418	Ga0395900_0167780	Ga0395900_0167780_1084_1860	258
1820	3300037418	Ga0395900_0194460	Ga0395900_0194460_858_1655	258
1821	3300037418	Ga0395900_0650548	Ga0395900_0650548_56_832	258
1822	3300037418	Ga0395900_0816043	Ga0395900_0816043_33_809	258
1823	3300037466	Ga0395898_0012017	Ga0395898_0012017_5658_6449	258
1824	3300037466	Ga0395898_0143700	Ga0395898_0143700_1406_2194	258
1825	3300037466	Ga0395898_0211482	Ga0395898_0211482_76_870	258
1826	3300037466	Ga0395898_0576544	Ga0395898_0576544_95_910	258
1827	3300037471	Ga0395905_0000710	Ga0395905_0000710_29111_29908	258
1828	3300037471	Ga0395905_0000995	Ga0395905_0000995_29957_30733	258
1829	3300037471	Ga0395905_0005062	Ga0395905_0005062_10616_11419	258
1830	3300037471	Ga0395905_0030688	Ga0395905_0030688_2323_3126	258
1831	3300037471	Ga0395905_0034259	Ga0395905_0034259_2240_3016	258
1832	3300037471	Ga0395905_0148494	Ga0395905_0148494_473_1249	258
1833	3300037471	Ga0395905_0264238	Ga0395905_0264238_208_984	258
1834	3300037853	Ga0436364_0426400	Ga0436364_0426400_867_1655	258
1835	3300037853	Ga0436364_1323171	Ga0436364_1323171_559_1335	258
1836	3300037853	Ga0436364_1416803	Ga0436364_1416803_2932_3708	258
1837	3300037853	Ga0436364_1491459	Ga0436364_1491459_114_911	258
1838	3300038443	Ga0395901_0024350	Ga0395901_0024350_1710_2507	258
1839	3300038443	Ga0395901_0118145	Ga0395901_0118145_1421_2218	258
1840	3300038443	Ga0395901_0555193	Ga0395901_0555193_197_985	258
1841	3300038443	Ga0395901_0798134	Ga0395901_0798134_136_912	258
1842	3300039062	Ga0400483_086271	Ga0400483_086271_1463_2263	258
1843	3300039062	Ga0400483_257403	Ga0400483_257403_927_1727	258
1844	3300039437	Ga0436365_0046378	Ga0436365_0046378_1015_1809	258
1845	3300039437	Ga0436365_0546735	Ga0436365_0546735_87_884	258
1846	3300039437	Ga0436365_0912541	Ga0436365_0912541_962_1756	258
1847	3300039437	Ga0436365_1599958	Ga0436365_1599958_137_931	258
1848	3300039437	Ga0436365_1735852	Ga0436365_1735852_149_949	258
1849	3300039438	Ga0436360_0714471	Ga0436360_0714471_496_1296	258
1850	3300039438	Ga0436360_1314457	Ga0436360_1314457_935_1735	258
1851	3300039447	Ga0436361_0017828	Ga0436361_0017828_1910_2692	258
1852	3300039447	Ga0436361_0915083	Ga0436361_0915083_1011_1811	258
1853	3300039447	Ga0436361_1152524	Ga0436361_1152524_62_844	258
1854	3300039447	Ga0436361_1217182	Ga0436361_1217182_4586_5386	258
1855	3300039450	Ga0436363_0141246	Ga0436363_0141246_1913_2695	258
1856	3300039450	Ga0436363_0479463	Ga0436363_0479463_396_1184	258
1857	3300039450	Ga0436363_0619002	Ga0436363_0619002_450_1226	258
1858	3300039450	Ga0436363_0764206	Ga0436363_0764206_533_1318	258
1859	3300041404	Ga0439436_0015366	Ga0439436_0015366_707_1483	258
1860	3300041405	Ga0439438_033442	Ga0439438_033442_477_1253	258
1861	3300041411	Ga0439466_0073653	Ga0439466_0073653_29_805	258
1862	3300041413	Ga0439465_0010782	Ga0439465_0010782_1952_2728	258
1863	3300041452	Ga0451793_0016878	Ga0451793_0016878_29_826	258
1864	3300041452	Ga0451793_0861834	Ga0451793_0861834_303_1100	258
1865	3300041492	Ga0451835_0126884	Ga0451835_0126884_1107_1883	258
1866	3300041496	Ga0451839_1384225	Ga0451839_1384225_303_1079	258
1867	3300041501	Ga0451845_0183070	Ga0451845_0183070_96_872	258
1868	3300041503	Ga0451847_0114050	Ga0451847_0114050_528_1304	258
1869	3300041511	Ga0451855_0285499	Ga0451855_0285499_19_795	258
1870	3300041512	Ga0451853_2967191	Ga0451853_2967191_375_1151	258
1871	3300042007	Ga0439449_0003781	Ga0439449_0003781_3900_4676	258
1872	3300042007	Ga0439449_0037426	Ga0439449_0037426_850_1626	258
1873	3300042007	Ga0439449_0047503	Ga0439449_0047503_347_1129	258
1874	3300042015	Ga0439462_0010063	Ga0439462_0010063_822_1598	258
1875	3300042876	Ga0451577_0112006	Ga0451577_0112006_1201_2022	258
1876	3300044656	Ga0466969_0020965	Ga0466969_0020965_948_1745	258
1877	3300044658	Ga0466972_0048391	Ga0466972_0048391_1082_1858	258
1878	3300044683	Ga0466965_0143454	Ga0466965_0143454_98_880	258
1879	3300044684	Ga0466966_0002418	Ga0466966_0002418_10088_10885	258
1880	3300044693	Ga0466961_0000324	Ga0466961_0000324_4010_4807	258
1881	3300044735	Ga0466968_0157453	Ga0466968_0157453_102_878	258
1882	3300044765	Ga0466970_0016298	Ga0466970_0016298_2780_3556	258
1883	3300044765	Ga0466970_0063269	Ga0466970_0063269_909_1700	258
1884	3300044765	Ga0466970_0145710	Ga0466970_0145710_383_1183	258
1885	3300044842	Ga0466957_0039262	Ga0466957_0039262_1915_2691	258
1886	3300044901	Ga0466960_0253357	Ga0466960_0253357_32_808	258
1887	3300045049	Ga0466959_0174904	Ga0466959_0174904_408_1208	258
1888	3300045836	Ga0466958_0307527	Ga0466958_0307527_118_915	258
1889	3300046454	Ga0495592_0009908	Ga0495592_0009908_3160_3957	258
1890	3300046454	Ga0495592_0028770	Ga0495592_0028770_1518_2315	258
1891	3300046454	Ga0495592_0033024	Ga0495592_0033024_705_1493	258
1892	3300046455	Ga0495603_0023502	Ga0495603_0023502_189_974	258
1893	3300046455	Ga0495603_0127521	Ga0495603_0127521_312_1109	258
1894	3300046455	Ga0495603_0188872	Ga0495603_0188872_169_963	258
1895	3300046459	Ga0495629_0001327	Ga0495629_0001327_4926_5714	258
1896	3300046459	Ga0495629_0005186	Ga0495629_0005186_2282_3058	258
1897	3300046459	Ga0495629_0008439	Ga0495629_0008439_1897_2694	258
1898	3300046459	Ga0495629_0115165	Ga0495629_0115165_575_1372	258
1899	3300046460	Ga0495638_0005323	Ga0495638_0005323_5930_6706	258
1900	3300046460	Ga0495638_0022077	Ga0495638_0022077_1527_2351	258
1901	3300046460	Ga0495638_0025435	Ga0495638_0025435_2063_2875	258
1902	3300046460	Ga0495638_0096418	Ga0495638_0096418_465_1289	258
1903	3300046460	Ga0495638_0178435	Ga0495638_0178435_74_850	258
1904	3300046461	Ga0495641_0009191	Ga0495641_0009191_3664_4461	258
1905	3300046462	Ga0495651_0012145	Ga0495651_0012145_1565_2362	258
1906	3300046462	Ga0495651_0098362	Ga0495651_0098362_1242_2030	258
1907	3300046462	Ga0495651_0128387	Ga0495651_0128387_473_1249	258
1908	3300046462	Ga0495651_0156809	Ga0495651_0156809_296_1093	258
1909	3300046463	Ga0495653_0007074	Ga0495653_0007074_6706_7494	258
1910	3300046463	Ga0495653_0120490	Ga0495653_0120490_475_1272	258
1911	3300046471	Ga0495650_0072830	Ga0495650_0072830_116_898	258
1912	3300046472	Ga0495580_0009555	Ga0495580_0009555_2081_2878	258
1913	3300046473	Ga0495582_0007766	Ga0495582_0007766_4280_5077	258
1914	3300046475	Ga0495639_0023459	Ga0495639_0023459_502_1299	258
1915	3300046475	Ga0495639_0054037	Ga0495639_0054037_337_1131	258
1916	3300046476	Ga0495662_0001936	Ga0495662_0001936_5875_6672	258
1917	3300046476	Ga0495662_0007671	Ga0495662_0007671_1765_2541	258
1918	3300046476	Ga0495662_0085001	Ga0495662_0085001_201_995	258
1919	3300046477	Ga0495664_0006672	Ga0495664_0006672_1409_2206	258
1920	3300046477	Ga0495664_0009126	Ga0495664_0009126_1574_2371	258
1921	3300046477	Ga0495664_0052402	Ga0495664_0052402_362_1159	258
1922	3300046477	Ga0495664_0165642	Ga0495664_0165642_100_897	258
1923	3300046491	Ga0495584_0005130	Ga0495584_0005130_2036_2824	258
1924	3300046492	Ga0495585_0010208	Ga0495585_0010208_3818_4594	258
1925	3300046492	Ga0495585_0089772	Ga0495585_0089772_759_1535	258
1926	3300046499	Ga0495594_0008915	Ga0495594_0008915_3650_4447	258
1927	3300046501	Ga0495607_0060226	Ga0495607_0060226_812_1588	258
1928	3300046501	Ga0495607_0156803	Ga0495607_0156803_256_1032	258
1929	3300046507	Ga0495606_0001266	Ga0495606_0001266_3008_3784	258
1930	3300046507	Ga0495606_0014254	Ga0495606_0014254_5193_5990	258
1931	3300046507	Ga0495606_0043075	Ga0495606_0043075_2123_2899	258
1932	3300046507	Ga0495606_0074855	Ga0495606_0074855_736_1512	258
1933	3300046507	Ga0495606_0141385	Ga0495606_0141385_158_982	258
1934	3300046507	Ga0495606_0173920	Ga0495606_0173920_188_985	258
1935	3300046511	Ga0495608_0035675	Ga0495608_0035675_1923_2711	258
1936	3300046511	Ga0495608_0138638	Ga0495608_0138638_192_989	258
1937	3300046512	Ga0495610_0003928	Ga0495610_0003928_9707_10483	258
1938	3300046512	Ga0495610_0038817	Ga0495610_0038817_1589_2365	258
1939	3300046512	Ga0495610_0133488	Ga0495610_0133488_232_1008	258
1940	3300046513	Ga0495616_0063713	Ga0495616_0063713_227_1003	258
1941	3300046514	Ga0495618_0147074	Ga0495618_0147074_517_1314	258
1942	3300046515	Ga0495620_0156238	Ga0495620_0156238_54_851	258
1943	3300046516	Ga0495628_0026291	Ga0495628_0026291_1252_2040	258
1944	3300046516	Ga0495628_0031380	Ga0495628_0031380_2162_2959	258
1945	3300046516	Ga0495628_0042439	Ga0495628_0042439_855_1652	258
1946	3300046517	Ga0495630_0004453	Ga0495630_0004453_4391_5188	258
1947	3300046517	Ga0495630_0105915	Ga0495630_0105915_712_1506	258
1948	3300046517	Ga0495630_0147235	Ga0495630_0147235_543_1340	258
1949	3300046517	Ga0495630_0396186	Ga0495630_0396186_154_936	258
1950	3300046518	Ga0495631_0013295	Ga0495631_0013295_2693_3469	258
1951	3300046518	Ga0495631_0053326	Ga0495631_0053326_807_1583	258
1952	3300046519	Ga0495632_0059194	Ga0495632_0059194_46_822	258
1953	3300046519	Ga0495632_0088115	Ga0495632_0088115_261_1052	258
1954	3300046519	Ga0495632_0092138	Ga0495632_0092138_442_1218	258
1955	3300046522	Ga0495643_0009282	Ga0495643_0009282_2848_3624	258
1956	3300046522	Ga0495643_0071106	Ga0495643_0071106_600_1424	258
1957	3300046524	Ga0495648_0008452	Ga0495648_0008452_3354_4151	258
1958	3300046524	Ga0495648_0019531	Ga0495648_0019531_3450_4253	258
1959	3300046524	Ga0495648_0036669	Ga0495648_0036669_1328_2104	258
1960	3300046524	Ga0495648_0152848	Ga0495648_0152848_365_1189	258
1961	3300046526	Ga0495666_0016516	Ga0495666_0016516_1669_2466	258
1962	3300046526	Ga0495666_0045902	Ga0495666_0045902_948_1742	258
1963	3300046529	Ga0495652_0003976	Ga0495652_0003976_10367_11164	258
1964	3300046529	Ga0495652_0038910	Ga0495652_0038910_2245_3042	258
1965	3300046530	Ga0495654_0001076	Ga0495654_0001076_18430_19206	258
1966	3300046530	Ga0495654_0050970	Ga0495654_0050970_940_1716	258
1967	3300046530	Ga0495654_0111414	Ga0495654_0111414_275_1099	258
1968	3300046531	Ga0495665_0024550	Ga0495665_0024550_1618_2415	258
1969	3300046531	Ga0495665_0029157	Ga0495665_0029157_68_862	258
1970	3300046533	Ga0495640_0007922	Ga0495640_0007922_3098_3895	258
1971	3300046533	Ga0495640_0010067	Ga0495640_0010067_6495_7289	258
1972	3300046533	Ga0495640_0011122	Ga0495640_0011122_2689_3477	258
1973	3300046533	Ga0495640_0040211	Ga0495640_0040211_761_1558	258
1974	3300046533	Ga0495640_0220438	Ga0495640_0220438_280_1077	258
1975	3300046536	Ga0495587_0004748	Ga0495587_0004748_2437_3234	258
1976	3300046536	Ga0495587_0059733	Ga0495587_0059733_805_1581	258
1977	3300046536	Ga0495587_0130397	Ga0495587_0130397_298_1095	258
1978	3300046537	Ga0495598_0070471	Ga0495598_0070471_155_991	258
1979	3300046542	Ga0495597_0083463	Ga0495597_0083463_367_1164	258
1980	3300046543	Ga0495645_0001529	Ga0495645_0001529_13063_13851	258
1981	3300046543	Ga0495645_0089484	Ga0495645_0089484_995_1792	258
1982	3300046557	Ga0495622_0013858	Ga0495622_0013858_2101_2925	258
1983	3300046557	Ga0495622_0024050	Ga0495622_0024050_1043_1819	258
1984	3300046557	Ga0495622_0058632	Ga0495622_0058632_824_1621	258
1985	3300046558	Ga0495633_0022355	Ga0495633_0022355_511_1287	258
1986	3300046558	Ga0495633_0085671	Ga0495633_0085671_530_1306	258
1987	3300046559	Ga0495667_0008395	Ga0495667_0008395_3142_3939	258
1988	3300046559	Ga0495667_0011515	Ga0495667_0011515_2585_3382	258
1989	3300046559	Ga0495667_0043164	Ga0495667_0043164_1779_2567	258
1990	3300046616	Ga0495668_0111277	Ga0495668_0111277_217_1014	258
1991	3300046616	Ga0495668_0157528	Ga0495668_0157528_335_1111	258
1992	3300046642	Ga0495634_0002499	Ga0495634_0002499_7013_7810	258
1993	3300046642	Ga0495634_0243599	Ga0495634_0243599_139_915	258
1994	3300046642	Ga0495634_0253159	Ga0495634_0253159_15_809	258
1995	3300046660	Ga0495625_0020617	Ga0495625_0020617_3756_4532	258
1996	3300046660	Ga0495625_0030497	Ga0495625_0030497_562_1338	258
1997	3300046660	Ga0495625_0286839	Ga0495625_0286839_112_936	258
1998	3300046663	Ga0495635_0004879	Ga0495635_0004879_162_959	258
1999	3300046663	Ga0495635_0012056	Ga0495635_0012056_5237_6025	258
2000	3300046663	Ga0495635_0021664	Ga0495635_0021664_1525_2322	258
2001	3300046663	Ga0495635_0033742	Ga0495635_0033742_1646_2440	258
2002	3300046663	Ga0495635_0151048	Ga0495635_0151048_219_995	258
2003	3300046663	Ga0495635_0222110	Ga0495635_0222110_36_812	258
2004	3300046665	Ga0495661_0143424	Ga0495661_0143424_270_1046	258
2005	3300046674	Ga0495588_0002693	Ga0495588_0002693_1020_1796	258
2006	3300046674	Ga0495588_0049690	Ga0495588_0049690_1065_1841	258
2007	3300046675	Ga0495657_0003208	Ga0495657_0003208_3666_4463	258
2008	3300046675	Ga0495657_0112915	Ga0495657_0112915_536_1333	258
2009	3300046675	Ga0495657_0132017	Ga0495657_0132017_499_1287	258
2010	3300046678	Ga0495599_0009089	Ga0495599_0009089_1650_2447	258
2011	3300046678	Ga0495599_0040946	Ga0495599_0040946_55_852	258
2012	3300046679	Ga0495623_0032015	Ga0495623_0032015_879_1676	258
2013	3300046679	Ga0495623_0077871	Ga0495623_0077871_154_942	258
2014	3300046680	Ga0495646_0038625	Ga0495646_0038625_504_1292	258
2015	3300046680	Ga0495646_0049233	Ga0495646_0049233_738_1535	258
2016	3300046680	Ga0495646_0081889	Ga0495646_0081889_689_1483	258
2017	3300046680	Ga0495646_0099812	Ga0495646_0099812_397_1194	258
2018	3300046680	Ga0495646_0118953	Ga0495646_0118953_640_1437	258
2019	3300046683	Ga0495658_0009116	Ga0495658_0009116_3013_3810	258
2020	3300046683	Ga0495658_0009935	Ga0495658_0009935_1981_2775	258
2021	3300046684	Ga0495669_0004055	Ga0495669_0004055_4553_5356	258
2022	3300046689	Ga0495613_0004290	Ga0495613_0004290_2793_3581	258
2023	3300046689	Ga0495613_0030188	Ga0495613_0030188_94_888	258
2024	3300046689	Ga0495613_0044560	Ga0495613_0044560_1869_2666	258
2025	3300046690	Ga0495624_0011028	Ga0495624_0011028_309_1106	258
2026	3300046690	Ga0495624_0085515	Ga0495624_0085515_220_1017	258
2027	3300046690	Ga0495624_0102866	Ga0495624_0102866_470_1246	258
2028	3300046690	Ga0495624_0159925	Ga0495624_0159925_482_1276	258
2029	3300046690	Ga0495624_0245141	Ga0495624_0245141_98_898	258
2030	3300046691	Ga0495670_0047295	Ga0495670_0047295_133_957	258
2031	3300046691	Ga0495670_0077865	Ga0495670_0077865_420_1196	258
2032	3300046692	Ga0495671_0083248	Ga0495671_0083248_669_1445	258
2033	3300046692	Ga0495671_0229599	Ga0495671_0229599_11_787	258
2034	3300046692	Ga0495671_0238919	Ga0495671_0238919_41_817	258
2035	3300046694	Ga0495649_0055578	Ga0495649_0055578_911_1708	258
2036	3300046809	Ga0495600_0015897	Ga0495600_0015897_751_1548	258
2037	3300046809	Ga0495600_0052281	Ga0495600_0052281_614_1411	258
2038	3300046809	Ga0495600_0073022	Ga0495600_0073022_958_1755	258
2039	3300046809	Ga0495600_0091975	Ga0495600_0091975_1078_1854	258
2040	3300046810	Ga0495660_0053995	Ga0495660_0053995_1341_2117	258
2041	3300047315	Ga0495581_0003922	Ga0495581_0003922_2512_3309	258
2042	3300047315	Ga0495581_0067870	Ga0495581_0067870_339_1133	258
2043	3300047315	Ga0495581_0240185	Ga0495581_0240185_168_962	258
2044	3300047317	Ga0495604_0002083	Ga0495604_0002083_4844_5641	258
2045	3300047317	Ga0495604_0012085	Ga0495604_0012085_1258_2034	258
2046	3300047317	Ga0495604_0113916	Ga0495604_0113916_998_1795	258
2047	3300047319	Ga0495674_0010440	Ga0495674_0010440_6377_7174	258
2048	3300047319	Ga0495674_0026570	Ga0495674_0026570_4428_5216	258
2049	3300047319	Ga0495674_0027898	Ga0495674_0027898_849_1646	258
2050	3300047319	Ga0495674_0225585	Ga0495674_0225585_421_1218	258
2051	3300047319	Ga0495674_0258543	Ga0495674_0258543_35_817	258
2052	3300047320	Ga0495672_0073959	Ga0495672_0073959_675_1460	258
2053	3300047320	Ga0495672_0116562	Ga0495672_0116562_489_1265	258
2054	3300047321	Ga0495676_0056387	Ga0495676_0056387_1919_2716	258
2055	3300047321	Ga0495676_0234244	Ga0495676_0234244_233_1027	258
2056	3300047322	Ga0495680_0032208	Ga0495680_0032208_1898_2695	258
2057	3300047322	Ga0495680_0079547	Ga0495680_0079547_35_823	258
2058	3300047322	Ga0495680_0130160	Ga0495680_0130160_493_1290	258
2059	3300047323	Ga0495683_0084622	Ga0495683_0084622_416_1219	258
2060	3300047443	Ga0495687_054832	Ga0495687_054832_709_1506	258
2061	3300047444	Ga0495675_0007148	Ga0495675_0007148_3754_4551	258
2062	3300047444	Ga0495675_0026805	Ga0495675_0026805_963_1751	258
2063	3300047444	Ga0495675_0176306	Ga0495675_0176306_243_1040	258
2064	3300047445	Ga0495677_0071752	Ga0495677_0071752_195_998	258
2065	3300047469	Ga0495673_0078121	Ga0495673_0078121_266_1069	258
2066	3300047470	Ga0495681_0013164	Ga0495681_0013164_762_1538	258
2067	3300047471	Ga0495684_0003716	Ga0495684_0003716_7407_8195	258
2068	3300047471	Ga0495684_0032067	Ga0495684_0032067_1060_1857	258
2069	3300047472	Ga0495686_0006759	Ga0495686_0006759_5049_5825	258
2070	3300047472	Ga0495686_0144506	Ga0495686_0144506_73_873	258
2071	3300047472	Ga0495686_0164594	Ga0495686_0164594_410_1186	258
2072	3300047472	Ga0495686_0211647	Ga0495686_0211647_250_1026	258
2073	3300047673	Ga0495593_0001221	Ga0495593_0001221_4099_4887	258
2074	3300047673	Ga0495593_0001881	Ga0495593_0001881_11395_12192	258
2075	3300047673	Ga0495593_0029270	Ga0495593_0029270_482_1279	258
2076	3300047673	Ga0495593_0045849	Ga0495593_0045849_857_1651	258
2077	3300048088	Ga0495602_0031559	Ga0495602_0031559_740_1537	258
2078	3300048088	Ga0495602_0081589	Ga0495602_0081589_1896_2684	258
2079	3300048088	Ga0495602_0235559	Ga0495602_0235559_129_926	258
2080	3300048091	Ga0495626_0055884	Ga0495626_0055884_855_1679	258
2081	3300048903	Ga0496100_0046217	Ga0496100_0046217_544_1341	258
2082	3300048903	Ga0496100_0089191	Ga0496100_0089191_98_874	258
2083	3300048903	Ga0496100_0144076	Ga0496100_0144076_194_997	258
2084	3300048904	Ga0496101_0189665	Ga0496101_0189665_649_1452	258
2085	3300048905	Ga0496102_0036415	Ga0496102_0036415_3144_3941	258
2086	3300048905	Ga0496102_0107836	Ga0496102_0107836_1641_2417	258
2087	3300048905	Ga0496102_0163250	Ga0496102_0163250_1260_2048	258
2088	3300048905	Ga0496102_0249700	Ga0496102_0249700_441_1244	258
2089	3300048907	Ga0496104_0010401	Ga0496104_0010401_6430_7227	258
2090	3300048907	Ga0496104_0161426	Ga0496104_0161426_73_849	258
2091	3300048907	Ga0496104_0484446	Ga0496104_0484446_118_915	258
2092	3300048908	Ga0496105_0017494	Ga0496105_0017494_892_1689	258
2093	3300048909	Ga0496106_0055923	Ga0496106_0055923_1623_2399	258
2094	3300048909	Ga0496106_0083434	Ga0496106_0083434_1544_2332	258
2095	3300048909	Ga0496106_0579890	Ga0496106_0579890_70_846	258
2096	3300048910	Ga0496107_0126626	Ga0496107_0126626_189_986	258
2097	3300048912	Ga0496109_0472414	Ga0496109_0472414_372_1169	258
2098	3300048913	Ga0496110_0117802	Ga0496110_0117802_1272_2048	258
2099	3300048913	Ga0496110_0205008	Ga0496110_0205008_712_1509	258
2100	3300048914	Ga0496111_0023916	Ga0496111_0023916_3077_3853	258
2101	3300048915	Ga0496112_0116881	Ga0496112_0116881_1340_2137	258
2102	3300048915	Ga0496112_0134592	Ga0496112_0134592_502_1278	258
2103	3300048916	Ga0496113_0138135	Ga0496113_0138135_921_1718	258
2104	3300048916	Ga0496113_0241523	Ga0496113_0241523_615_1391	258
2105	3300048916	Ga0496113_0445929	Ga0496113_0445929_173_949	258
2106	3300048918	Ga0496115_0052515	Ga0496115_0052515_431_1228	258
2107	3300048919	Ga0496116_0000395	Ga0496116_0000395_43169_43945	258
2108	3300048919	Ga0496116_0007150	Ga0496116_0007150_2474_3298	258
2109	3300048919	Ga0496116_0014338	Ga0496116_0014338_2728_3504	258
2110	3300048919	Ga0496116_0147761	Ga0496116_0147761_209_1006	258
2111	3300048920	Ga0496117_0000002	Ga0496117_0000002_2365737_2366513	258
2112	3300048920	Ga0496117_0011279	Ga0496117_0011279_2186_2965	258
2113	3300048920	Ga0496117_0015179	Ga0496117_0015179_643_1419	258
2114	3300048920	Ga0496117_0026801	Ga0496117_0026801_568_1344	258
2115	3300048920	Ga0496117_0035259	Ga0496117_0035259_2918_3694	258
2116	3300048920	Ga0496117_0045985	Ga0496117_0045985_1968_2744	258
2117	3300048920	Ga0496117_0051942	Ga0496117_0051942_905_1729	258
2118	3300048920	Ga0496117_0056732	Ga0496117_0056732_900_1724	258
2119	3300048920	Ga0496117_0112054	Ga0496117_0112054_362_1186	258
2120	3300048921	Ga0496118_0001046	Ga0496118_0001046_40438_41214	258
2121	3300048921	Ga0496118_0013854	Ga0496118_0013854_2918_3694	258
2122	3300048921	Ga0496118_0024196	Ga0496118_0024196_2962_3738	258
2123	3300048921	Ga0496118_0040959	Ga0496118_0040959_2143_2967	258
2124	3300048921	Ga0496118_0058464	Ga0496118_0058464_1929_2753	258
2125	3300048921	Ga0496118_0070872	Ga0496118_0070872_212_1009	258
2126	3300048921	Ga0496118_0095470	Ga0496118_0095470_625_1449	258
2127	3300048921	Ga0496118_0099618	Ga0496118_0099618_524_1321	258
2128	3300048921	Ga0496118_0118899	Ga0496118_0118899_434_1210	258
2129	3300048921	Ga0496118_0124651	Ga0496118_0124651_199_975	258
2130	3300048921	Ga0496118_0232575	Ga0496118_0232575_216_992	258
2131	3300048922	Ga0496119_0001582	Ga0496119_0001582_194_970	258
2132	3300048922	Ga0496119_0029337	Ga0496119_0029337_160_948	258
2133	3300048922	Ga0496119_0044694	Ga0496119_0044694_1922_2719	258
2134	3300048922	Ga0496119_0048490	Ga0496119_0048490_1561_2337	258
2135	3300048922	Ga0496119_0056508	Ga0496119_0056508_11_835	258
2136	3300048922	Ga0496119_0071234	Ga0496119_0071234_1123_1899	258
2137	3300048922	Ga0496119_0102423	Ga0496119_0102423_366_1142	258
2138	3300048922	Ga0496119_0116149	Ga0496119_0116149_586_1362	258
2139	3300048922	Ga0496119_0121880	Ga0496119_0121880_228_1004	258
2140	3300048922	Ga0496119_0257985	Ga0496119_0257985_35_811	258
2141	3300048923	Ga0496120_0000498	Ga0496120_0000498_24195_24971	258
2142	3300048923	Ga0496120_0011542	Ga0496120_0011542_1084_1860	258
2143	3300048923	Ga0496120_0012942	Ga0496120_0012942_1957_2736	258
2144	3300048923	Ga0496120_0013372	Ga0496120_0013372_34_831	258
2145	3300048923	Ga0496120_0015046	Ga0496120_0015046_1139_1951	258
2146	3300048923	Ga0496120_0054792	Ga0496120_0054792_636_1412	258
2147	3300048923	Ga0496120_0072192	Ga0496120_0072192_251_1075	258
2148	3300048923	Ga0496120_0077410	Ga0496120_0077410_947_1744	258
2149	3300048924	Ga0496121_0000001	Ga0496121_0000001_227811_228590	258
2150	3300048924	Ga0496121_0005996	Ga0496121_0005996_4442_5245	258
2151	3300048924	Ga0496121_0020050	Ga0496121_0020050_2454_3230	258
2152	3300048924	Ga0496121_0024199	Ga0496121_0024199_4379_5182	258
2153	3300048924	Ga0496121_0030421	Ga0496121_0030421_4122_4919	258
2154	3300048924	Ga0496121_0031877	Ga0496121_0031877_1086_1889	258
2155	3300048924	Ga0496121_0039433	Ga0496121_0039433_1670_2446	258
2156	3300048924	Ga0496121_0047024	Ga0496121_0047024_1107_1931	258
2157	3300048924	Ga0496121_0051851	Ga0496121_0051851_182_958	258
2158	3300048924	Ga0496121_0058438	Ga0496121_0058438_482_1267	258
2159	3300048924	Ga0496121_0129294	Ga0496121_0129294_474_1250	258
2160	3300048924	Ga0496121_0202569	Ga0496121_0202569_591_1367	258
2161	3300048924	Ga0496121_0229820	Ga0496121_0229820_287_1078	258
2162	3300048924	Ga0496121_0307497	Ga0496121_0307497_144_929	258
2163	3300048924	Ga0496121_0366775	Ga0496121_0366775_58_840	258
2164	3300048925	Ga0496122_0000001	Ga0496122_0000001_1709745_1710521	258
2165	3300048925	Ga0496122_0000018	Ga0496122_0000018_303353_304129	258
2166	3300048925	Ga0496122_0000494	Ga0496122_0000494_30637_31413	258
2167	3300048925	Ga0496122_0001551	Ga0496122_0001551_5368_6144	258
2168	3300048925	Ga0496122_0010126	Ga0496122_0010126_5434_6210	258
2169	3300048925	Ga0496122_0022343	Ga0496122_0022343_2521_3297	258
2170	3300048925	Ga0496122_0044192	Ga0496122_0044192_1897_2697	258
2171	3300048925	Ga0496122_0064012	Ga0496122_0064012_1126_1950	258
2172	3300048925	Ga0496122_0113469	Ga0496122_0113469_327_1115	258
2173	3300048925	Ga0496122_0116244	Ga0496122_0116244_147_947	258
2174	3300048925	Ga0496122_0179498	Ga0496122_0179498_335_1111	258
2175	3300048925	Ga0496122_0264093	Ga0496122_0264093_72_848	258
2176	3300048926	Ga0496123_0000001	Ga0496123_0000001_1713476_1714252	258
2177	3300048926	Ga0496123_0000015	Ga0496123_0000015_303353_304129	258
2178	3300048926	Ga0496123_0000442	Ga0496123_0000442_43128_43904	258
2179	3300048926	Ga0496123_0000831	Ga0496123_0000831_3102_3878	258
2180	3300048926	Ga0496123_0004140	Ga0496123_0004140_7665_8441	258
2181	3300048926	Ga0496123_0006536	Ga0496123_0006536_8949_9773	258
2182	3300048926	Ga0496123_0011290	Ga0496123_0011290_6869_7645	258
2183	3300048926	Ga0496123_0034709	Ga0496123_0034709_473_1249	258
2184	3300048926	Ga0496123_0049116	Ga0496123_0049116_1901_2677	258
2185	3300048926	Ga0496123_0053394	Ga0496123_0053394_646_1434	258
2186	3300048926	Ga0496123_0066461	Ga0496123_0066461_1246_2025	258
2187	3300048926	Ga0496123_0082638	Ga0496123_0082638_129_905	258
2188	3300048926	Ga0496123_0112316	Ga0496123_0112316_221_1021	258
2189	3300048927	Ga0496124_0000178	Ga0496124_0000178_62871_63647	258
2190	3300048927	Ga0496124_0002412	Ga0496124_0002412_18698_19474	258
2191	3300048927	Ga0496124_0003101	Ga0496124_0003101_660_1436	258
2192	3300048927	Ga0496124_0004061	Ga0496124_0004061_13738_14514	258
2193	3300048927	Ga0496124_0008893	Ga0496124_0008893_6224_7000	258
2194	3300048927	Ga0496124_0010624	Ga0496124_0010624_2322_3119	258
2195	3300048927	Ga0496124_0080323	Ga0496124_0080323_468_1292	258
2196	3300048927	Ga0496124_0135069	Ga0496124_0135069_498_1274	258
2197	3300048927	Ga0496124_0170814	Ga0496124_0170814_819_1595	258
2198	3300048927	Ga0496124_0250828	Ga0496124_0250828_420_1196	258
2199	3300048927	Ga0496124_0259410	Ga0496124_0259410_20_796	258
2200	3300048927	Ga0496124_0280041	Ga0496124_0280041_113_889	258
2201	3300048927	Ga0496124_0303502	Ga0496124_0303502_181_957	258
2202	3300048927	Ga0496124_0373695	Ga0496124_0373695_54_833	258
2203	3300048927	Ga0496124_0374313	Ga0496124_0374313_33_809	258
2204	3300048928	Ga0496125_0000001	Ga0496125_0000001_339686_340465	258
2205	3300048928	Ga0496125_0000306	Ga0496125_0000306_55037_55813	258
2206	3300048928	Ga0496125_0000422	Ga0496125_0000422_51274_52050	258
2207	3300048928	Ga0496125_0000446	Ga0496125_0000446_58399_59202	258
2208	3300048928	Ga0496125_0001702	Ga0496125_0001702_23953_24756	258
2209	3300048928	Ga0496125_0003425	Ga0496125_0003425_15950_16774	258
2210	3300048928	Ga0496125_0006203	Ga0496125_0006203_5363_6139	258
2211	3300048928	Ga0496125_0009867	Ga0496125_0009867_2461_3285	258
2212	3300048928	Ga0496125_0097325	Ga0496125_0097325_339_1136	258
2213	3300048928	Ga0496125_0120478	Ga0496125_0120478_154_951	258
2214	3300048928	Ga0496125_0127686	Ga0496125_0127686_550_1326	258
2215	3300048928	Ga0496125_0218919	Ga0496125_0218919_35_823	258
2216	3300048929	Ga0496126_0000212	Ga0496126_0000212_120611_121387	258
2217	3300048929	Ga0496126_0001831	Ga0496126_0001831_19386_20162	258
2218	3300048929	Ga0496126_0011325	Ga0496126_0011325_3987_4784	258
2219	3300048929	Ga0496126_0033777	Ga0496126_0033777_1354_2151	258
2220	3300048929	Ga0496126_0035472	Ga0496126_0035472_2324_3109	258
2221	3300048929	Ga0496126_0036157	Ga0496126_0036157_647_1471	258
2222	3300048929	Ga0496126_0064481	Ga0496126_0064481_2258_3061	258
2223	3300048929	Ga0496126_0071154	Ga0496126_0071154_2112_2888	258
2224	3300048929	Ga0496126_0101569	Ga0496126_0101569_207_986	258
2225	3300048929	Ga0496126_0116808	Ga0496126_0116808_411_1187	258
2226	3300048929	Ga0496126_0125103	Ga0496126_0125103_271_1071	258
2227	3300048929	Ga0496126_0315586	Ga0496126_0315586_145_936	258
2228	3300048929	Ga0496126_0370793	Ga0496126_0370793_112_888	258
2229	3300048929	Ga0496126_0382415	Ga0496126_0382415_17_817	258
2230	3300049460	Ga0495682_0006772	Ga0495682_0006772_470_1267	258
2231	3300049568	Ga0501031_0118919	Ga0501031_0118919_920_1696	258
2232	3300049570	Ga0501033_0000204	Ga0501033_0000204_22229_23005	258
2233	3300049570	Ga0501033_0020873	Ga0501033_0020873_1328_2140	258
2234	3300049570	Ga0501033_0085487	Ga0501033_0085487_1207_1983	258
2235	3300049570	Ga0501033_0158450	Ga0501033_0158450_48_824	258
2236	3300049571	Ga0501034_0020745	Ga0501034_0020745_2469_3281	258
2237	3300049571	Ga0501034_0023398	Ga0501034_0023398_3456_4232	258
2238	3300049571	Ga0501034_0073934	Ga0501034_0073934_1319_2095	258
2239	3300049571	Ga0501034_0157093	Ga0501034_0157093_533_1309	258
2240	3300049571	Ga0501034_0280820	Ga0501034_0280820_788_1564	258
2241	3300049571	Ga0501034_0288844	Ga0501034_0288844_584_1360	258
2242	3300049571	Ga0501034_0375599	Ga0501034_0375599_411_1187	258
2243	3300049574	Ga0501038_0306922	Ga0501038_0306922_64_840	258
2244	3300049575	Ga0501039_0082770	Ga0501039_0082770_651_1463	258
2245	3300049579	Ga0501043_0059261	Ga0501043_0059261_1665_2441	258
2246	3300049579	Ga0501043_0228376	Ga0501043_0228376_222_1034	258
2247	3300049579	Ga0501043_0242195	Ga0501043_0242195_225_1001	258
2248	3300049579	Ga0501043_0332480	Ga0501043_0332480_70_864	258
2249	3300049580	Ga0501046_0037974	Ga0501046_0037974_612_1406	258
2250	3300049580	Ga0501046_0427692	Ga0501046_0427692_70_882	258
2251	3300049581	Ga0501047_0083954	Ga0501047_0083954_149_943	258
2252	3300049581	Ga0501047_0344760	Ga0501047_0344760_406_1182	258
2253	3300049586	Ga0501070_0150305	Ga0501070_0150305_677_1453	258
2254	3300049587	Ga0501071_0342935	Ga0501071_0342935_208_1011	258
2255	3300049590	Ga0501074_0132832	Ga0501074_0132832_834_1628	258
2256	3300049591	Ga0501075_0503938	Ga0501075_0503938_123_911	258
2257	3300049592	Ga0501076_0307203	Ga0501076_0307203_166_954	258
2258	3300049593	Ga0501077_0112045	Ga0501077_0112045_600_1379	258
2259	3300049593	Ga0501077_0198108	Ga0501077_0198108_56_835	258
2260	3300049593	Ga0501077_0347926	Ga0501077_0347926_118_900	258
2261	3300049742	Ga0501080_0003595	Ga0501080_0003595_3018_3812	258
2262	3300049742	Ga0501080_0133008	Ga0501080_0133008_322_1098	258
2263	3300049743	Ga0501081_0500115	Ga0501081_0500115_31_810	258
2264	3300049744	Ga0501083_0009239	Ga0501083_0009239_5596_6372	258
2265	3300049744	Ga0501083_0113429	Ga0501083_0113429_190_969	258
2266	3300049822	Ga0501035_0000181	Ga0501035_0000181_60321_61097	258
2267	3300049822	Ga0501035_0002632	Ga0501035_0002632_6047_6865	258
2268	3300049822	Ga0501035_0026310	Ga0501035_0026310_2293_3069	258
2269	3300049822	Ga0501035_0194728	Ga0501035_0194728_816_1628	258
2270	3300049823	Ga0501044_0027833	Ga0501044_0027833_2374_3168	258
2271	3300049823	Ga0501044_0047516	Ga0501044_0047516_823_1599	258
2272	3300049823	Ga0501044_0111714	Ga0501044_0111714_1443_2261	258
2273	3300049823	Ga0501044_0140360	Ga0501044_0140360_819_1631	258
2274	3300049823	Ga0501044_0296666	Ga0501044_0296666_84_863	258
2275	3300049823	Ga0501044_0395239	Ga0501044_0395239_468_1253	258
2276	3300050489	nmdc:mga03683_28692_c1	nmdc:mga03683_28692_c1_145_921	258
2277	3300050489	nmdc:mga03683_29887_c1	nmdc:mga03683_29887_c1_703_1494	258
2278	3300050489	nmdc:mga03683_50641_c1	nmdc:mga03683_50641_c1_236_1018	258
2279	3300050490	nmdc:mga03n38_157058_c1	nmdc:mga03n38_157058_c1_286_1080	258
2280	3300050490	nmdc:mga03n38_29805_c1	nmdc:mga03n38_29805_c1_54_836	258
2281	3300050490	nmdc:mga03n38_6230_c1	nmdc:mga03n38_6230_c1_3106_3882	258
2282	3300050491	nmdc:mga00v17_26242_c1	nmdc:mga00v17_26242_c1_2192_2968	258
2283	3300050491	nmdc:mga00v17_3730_c1	nmdc:mga00v17_3730_c1_878_1654	258
2284	3300050491	nmdc:mga00v17_38022_c1	nmdc:mga00v17_38022_c1_1838_2617	258
2285	3300050491	nmdc:mga00v17_86817_c1	nmdc:mga00v17_86817_c1_306_1130	258
2286	3300050492	nmdc:mga0yw44_111233_c1	nmdc:mga0yw44_111233_c1_390_1172	258
2287	3300050492	nmdc:mga0yw44_3323_c1	nmdc:mga0yw44_3323_c1_6132_6908	258
2288	3300050492	nmdc:mga0yw44_336127_c1	nmdc:mga0yw44_336127_c1_48_824	258
2289	3300050492	nmdc:mga0yw44_70854_c1	nmdc:mga0yw44_70854_c1_143_925	258
2290	3300050492	nmdc:mga0yw44_7487_c1	nmdc:mga0yw44_7487_c1_4173_4949	258
2291	3300050492	nmdc:mga0yw44_84204_c1	nmdc:mga0yw44_84204_c1_94_870	258
2292	3300050492	nmdc:mga0yw44_9373_c1	nmdc:mga0yw44_9373_c1_1353_2177	258
2293	3300050493	nmdc:mga0k408_131217_c1	nmdc:mga0k408_131217_c1_488_1270	258
2294	3300050493	nmdc:mga0k408_170664_c1	nmdc:mga0k408_170664_c1_267_1043	258
2295	3300050494	nmdc:mga06z11_138_c1	nmdc:mga06z11_138_c1_18783_19577	258
2296	3300050494	nmdc:mga06z11_15467_c1	nmdc:mga06z11_15467_c1_2620_3396	258
2297	3300050494	nmdc:mga06z11_213518_c1	nmdc:mga06z11_213518_c1_127_909	258
2298	3300050494	nmdc:mga06z11_247277_c1	nmdc:mga06z11_247277_c1_160_942	258
2299	3300050495	nmdc:mga04h51_215_c1	nmdc:mga04h51_215_c1_6259_7053	258
2300	3300050496	nmdc:mga07m45_31297_c1	nmdc:mga07m45_31297_c1_796_1593	258
2301	3300050507	nmdc:mga05p37_139417_c1	nmdc:mga05p37_139417_c1_2047_2826	258
2302	3300050507	nmdc:mga05p37_150581_c1	nmdc:mga05p37_150581_c1_325_1104	258
2303	3300050507	nmdc:mga05p37_482685_c1	nmdc:mga05p37_482685_c1_206_988	258
2304	3300050508	nmdc:mga09592_89881_c1	nmdc:mga09592_89881_c1_346_1125	258
2305	3300050509	nmdc:mga0qj67_97487_c1	nmdc:mga0qj67_97487_c1_218_997	258
2306	3300050510	nmdc:mga06r32_167927_c1	nmdc:mga06r32_167927_c1_810_1589	258
2307	3300050510	nmdc:mga06r32_29168_c1	nmdc:mga06r32_29168_c1_4045_4824	258
2308	3300050510	nmdc:mga06r32_563290_c1	nmdc:mga06r32_563290_c1_16_807	258
2309	3300050511	nmdc:mga08y16_68767_c1	nmdc:mga08y16_68767_c1_2053_2856	258
2310	3300050512	nmdc:mga0n895_140271_c1	nmdc:mga0n895_140271_c1_1351_2133	258
2311	3300050512	nmdc:mga0n895_14886_c1	nmdc:mga0n895_14886_c1_6213_6989	258
2312	3300050512	nmdc:mga0n895_17037_c1	nmdc:mga0n895_17037_c1_4324_5103	258
2313	3300050512	nmdc:mga0n895_34517_c1	nmdc:mga0n895_34517_c1_3366_4178	258
2314	3300050512	nmdc:mga0n895_371893_c1	nmdc:mga0n895_371893_c1_301_1080	258
2315	3300050513	nmdc:mga0rr50_14231_c1	nmdc:mga0rr50_14231_c1_2583_3359	258
2316	3300050513	nmdc:mga0rr50_96277_c1	nmdc:mga0rr50_96277_c1_682_1461	258
2317	3300050515	nmdc:mga0a205_206046_c1	nmdc:mga0a205_206046_c1_669_1448	258
2318	3300050515	nmdc:mga0a205_32189_c1	nmdc:mga0a205_32189_c1_2256_3035	258
2319	3300050516	nmdc:mga0sz30_11707_c1	nmdc:mga0sz30_11707_c1_1742_2518	258
2320	3300050516	nmdc:mga0sz30_11773_c1	nmdc:mga0sz30_11773_c1_2160_2936	258
2321	3300050516	nmdc:mga0sz30_1939_c2	nmdc:mga0sz30_1939_c2_2990_3814	258
2322	3300053077	Ga0495601_0225450	Ga0495601_0225450_36_830	258
2323	3300053079	Ga0500610_0068762	Ga0500610_0068762_833_1624	258
2324	3300053079	Ga0500610_0160476	Ga0500610_0160476_96_872	258
2325	3300053080	Ga0500635_0003801	Ga0500635_0003801_1780_2565	258
2326	3300053084	Ga0495595_0003580	Ga0495595_0003580_2969_3757	258
2327	3300053085	Ga0495619_0021971	Ga0495619_0021971_1923_2711	258
2328	3300053085	Ga0495619_0034219	Ga0495619_0034219_403_1179	258
2329	3300053085	Ga0495619_0242569	Ga0495619_0242569_228_1025	258
2330	3300053085	Ga0495619_0279969	Ga0495619_0279969_123_905	258
2331	3300053087	Ga0500643_000111	Ga0500643_000111_75941_76738	258
2332	3300053087	Ga0500643_038213	Ga0500643_038213_492_1316	258
2333	3300053088	Ga0500644_0003969	Ga0500644_0003969_2749_3573	258
2334	3300053092	Ga0500583_0083708	Ga0500583_0083708_359_1171	258
2335	3300053094	Ga0500566_0000737	Ga0500566_0000737_6598_7422	258
2336	3300053094	Ga0500566_0002635	Ga0500566_0002635_5925_6722	258
2337	3300053094	Ga0500566_0082170	Ga0500566_0082170_440_1225	258
2338	3300053096	Ga0500641_0014952	Ga0500641_0014952_1658_2482	258
2339	3300053096	Ga0500641_0045629	Ga0500641_0045629_344_1156	258
2340	3300053098	Ga0500650_0017044	Ga0500650_0017044_1852_2676	258
2341	3300053102	Ga0500554_002199	Ga0500554_002199_2984_3769	258
2342	3300053103	Ga0500555_001805	Ga0500555_001805_797_1609	258
2343	3300053104	Ga0500556_0000003	Ga0500556_0000003_548008_548832	258
2344	3300053104	Ga0500556_0000120	Ga0500556_0000120_44981_45757	258
2345	3300053107	Ga0500560_001158	Ga0500560_001158_1621_2397	258
2346	3300053109	Ga0500569_002182	Ga0500569_002182_1837_2628	258
2347	3300053109	Ga0500569_007518	Ga0500569_007518_1490_2314	258
2348	3300053109	Ga0500569_009642	Ga0500569_009642_438_1214	258
2349	3300053111	Ga0500572_000043	Ga0500572_000043_28767_29567	258
2350	3300053111	Ga0500572_017574	Ga0500572_017574_290_1066	258
2351	3300053116	Ga0500592_002793	Ga0500592_002793_1309_2133	258
2352	3300053119	Ga0500595_031531	Ga0500595_031531_322_1119	258
2353	3300053121	Ga0500607_024986	Ga0500607_024986_1772_2596	258
2354	3300053125	Ga0500618_000459	Ga0500618_000459_14701_15477	258
2355	3300053125	Ga0500618_006208	Ga0500618_006208_2058_2834	258
2356	3300053130	Ga0500642_0000015	Ga0500642_0000015_27454_28278	258
2357	3300053130	Ga0500642_0006832	Ga0500642_0006832_766_1578	258
2358	3300053131	Ga0500652_000004	Ga0500652_000004_69358_70143	258
2359	3300053131	Ga0500652_001789	Ga0500652_001789_4608_5432	258
2360	3300053134	Ga0500658_0008295	Ga0500658_0008295_586_1362	258
2361	3300053134	Ga0500658_0059034	Ga0500658_0059034_61_873	258
2362	3300053136	Ga0500559_0002162	Ga0500559_0002162_7983_8783	258
2363	3300053136	Ga0500559_0018688	Ga0500559_0018688_777_1568	258
2364	3300053136	Ga0500559_0046075	Ga0500559_0046075_184_981	258
2365	3300053139	Ga0500568_0000234	Ga0500568_0000234_42947_43771	258
2366	3300053139	Ga0500568_0020409	Ga0500568_0020409_1249_2034	258
2367	3300053139	Ga0500568_0027627	Ga0500568_0027627_1521_2333	258
2368	3300053139	Ga0500568_0055377	Ga0500568_0055377_226_1029	258
2369	3300053139	Ga0500568_0062652	Ga0500568_0062652_446_1222	258
2370	3300053148	Ga0500590_025852	Ga0500590_025852_1123_1899	258
2371	3300053150	Ga0500603_000845	Ga0500603_000845_4751_5536	258
2372	3300053151	Ga0500604_0001913	Ga0500604_0001913_145_921	258
2373	3300053151	Ga0500604_0080385	Ga0500604_0080385_79_855	258
2374	3300053153	Ga0500616_0000437	Ga0500616_0000437_48620_49396	258
2375	3300053153	Ga0500616_0004031	Ga0500616_0004031_9412_10188	258
2376	3300053153	Ga0500616_0008067	Ga0500616_0008067_4701_5477	258
2377	3300053153	Ga0500616_0036694	Ga0500616_0036694_118_894	258
2378	3300053153	Ga0500616_0051123	Ga0500616_0051123_463_1248	258
2379	3300053153	Ga0500616_0080256	Ga0500616_0080256_587_1390	258
2380	3300053156	Ga0500622_0004832	Ga0500622_0004832_3757_4581	258
2381	3300053156	Ga0500622_0025373	Ga0500622_0025373_1708_2484	258
2382	3300053156	Ga0500622_0030531	Ga0500622_0030531_1666_2478	258
2383	3300053157	Ga0500624_001395	Ga0500624_001395_511_1287	258
2384	3300053158	Ga0500627_0031755	Ga0500627_0031755_628_1440	258
2385	3300053158	Ga0500627_0146109	Ga0500627_0146109_149_925	258
2386	3300053158	Ga0500627_0202969	Ga0500627_0202969_64_840	258
2387	3300053161	Ga0500634_0000008	Ga0500634_0000008_26249_27025	258
2388	3300053161	Ga0500634_0020268	Ga0500634_0020268_511_1287	258
2389	3300053161	Ga0500634_0063823	Ga0500634_0063823_482_1258	258
2390	3300053163	Ga0500639_030649	Ga0500639_030649_1027_1827	258
2391	3300053177	Ga0500636_0000057	Ga0500636_0000057_46836_47627	258
2392	3300053177	Ga0500636_0000158	Ga0500636_0000158_32618_33442	258
2393	3300053177	Ga0500636_0031456	Ga0500636_0031456_46_843	258
2394	3300053177	Ga0500636_0036850	Ga0500636_0036850_270_1073	258
2395	3300053177	Ga0500636_0082016	Ga0500636_0082016_600_1385	258
2396	3300053178	Ga0500637_0003803	Ga0500637_0003803_1221_2006	258
2397	3300053730	Ga0500645_006846	Ga0500645_006846_3193_3969	258
2398	3300053730	Ga0500645_039396	Ga0500645_039396_178_975	258
2399	3300053730	Ga0500645_040644	Ga0500645_040644_305_1132	258
2400	3300053735	Ga0500596_001597	Ga0500596_001597_795_1595	258
2401	3300053737	Ga0500601_000010	Ga0500601_000010_24579_25370	258
2402	3300060353	Ga0501082_0689397	Ga0501082_0689397_80_868	258
2403	3300061719	Ga0466962_0216899	Ga0466962_0216899_114_911	258
2404	iso_pu_bacteria	2508501050	2508734829	258
2405	iso_pu_bacteria	2513237094	2513638465	258
2406	iso_pu_bacteria	2513237098	2513675195	258
2407	iso_pu_bacteria	2513237104	2513714767	258
2408	iso_pu_bacteria	2513237139	2513875574	258
2409	iso_pu_bacteria	2524023205	2524441683	258
2410	iso_pu_bacteria	2524023210	2524468492	258
2411	iso_pu_bacteria	2599185214	2599622108	258
2412	iso_pu_bacteria	2599185226	2599676413	258
2413	iso_pu_bacteria	2599185227	2599680485	258
2414	iso_pu_bacteria	2599185229	2599692501	258
2415	iso_pu_bacteria	2602042107	2603859967	258
2416	iso_pu_bacteria	2617270735	2617347579	258
2417	iso_pu_bacteria	2643221551	2643777939	258
2418	iso_pu_bacteria	2643221555	2643796387	258
2419	iso_pu_bacteria	2643221570	2643866344	258
2420	iso_pu_bacteria	2643221596	2643994332	258
2421	iso_pu_bacteria	2643221609	2644057397	258
2422	iso_pu_bacteria	2643221611	2644072505	258
2423	iso_pu_bacteria	2643221652	2644293165	258
2424	iso_pu_bacteria	2643221662	2644350898	258
2425	iso_pu_bacteria	2687453129	2687578232	258
2426	iso_pu_bacteria	2738543012	2739241667	258
2427	iso_pu_bacteria	2744054633	2745080498	258
2428	iso_pu_bacteria	2751185800	2753359441	258
2429	iso_pu_bacteria	2757320392	2757571185	258
2430	iso_pu_bacteria	2791355196	2793063556	258
2431	iso_pu_bacteria	2802429603	2805921071	258
2432	iso_pu_bacteria	2816332133	2816471029	258
2433	iso_pu_bacteria	2824600985	2824606332	258
2434	iso_pu_bacteria	2824609381	2824612069	258
2435	iso_pu_bacteria	2824653114	2824657091	258
2436	iso_pu_bacteria	2824671348	2824676775	258
2437	iso_pu_bacteria	2824679649	2824683228	258
2438	iso_pu_bacteria	2824687955	2824695425	258
2439	iso_pu_bacteria	2824696289	2824701586	258
2440	iso_pu_bacteria	2824773399	2824777080	258
2441	iso_pu_bacteria	2838122688	2838129170	258
2442	iso_pu_bacteria	2841941048	2841944203	258
2443	iso_pu_bacteria	2841949485	2841954623	258
2444	iso_pu_bacteria	2841966195	2841968984	258
2445	iso_pu_bacteria	2841974524	2841979759	258
2446	iso_pu_bacteria	2841983080	2841989646	258
2447	iso_pu_bacteria	2842733646	2842736509	258
2448	iso_pu_bacteria	2844315083	2844316119	258
2449	iso_pu_bacteria	2847930680	2847931815	258
2450	iso_pu_bacteria	2847939898	2847941499	258
2451	iso_pu_bacteria	2849076700	2849082409	258
2452	iso_pu_bacteria	2857509624	2857516545	258
2453	iso_pu_bacteria	2857524615	2857524959	258
2454	iso_pu_bacteria	2857576091	2857579685	258
2455	iso_pu_bacteria	2874612657	2874615916	258
2456	iso_pu_bacteria	2874628541	2874629441	258
2457	iso_pu_bacteria	2876761206	2876763790	258
2458	iso_pu_bacteria	2879083081	2879091275	258
2459	iso_pu_bacteria	2881364244	2881364837	258
2460	iso_pu_bacteria	2885198086	2885202594	258
2461	iso_pu_bacteria	2885211737	2885216247	258
2462	iso_pu_bacteria	2885366525	2885368255	258
2463	iso_pu_bacteria	2885383462	2885387007	258
2464	iso_pu_bacteria	2888419890	2888427171	258
2465	iso_pu_bacteria	2893066018	2893071188	258
2466	iso_pu_bacteria	2903727486	2903729479	258
2467	iso_pu_bacteria	2903768456	2903771673	258
2468	iso_pu_bacteria	2904449895	2904456011	258
2469	iso_pu_bacteria	2904456579	2904461401	258
2470	iso_pu_bacteria	2904690495	2904693961	258
2471	iso_pu_bacteria	2906602504	2906606689	258
2472	iso_pu_bacteria	2906626472	2906634542	258
2473	iso_pu_bacteria	2917554339	2917558391	258
2474	iso_pu_bacteria	2919073203	2919078847	258
2475	iso_pu_bacteria	2919450847	2919451893	258
2476	iso_pu_bacteria	2919704043	2919707638	258
2477	iso_pu_bacteria	2922386360	2922392890	258
2478	iso_pu_bacteria	2922393267	2922398778	258
2479	iso_pu_bacteria	2928070936	2928074002	258
2480	iso_pu_bacteria	2929520902	2929524332	258
2481	iso_pu_bacteria	2932794094	2932799619	258
2482	iso_pu_bacteria	2932801729	2932805094	258
2483	iso_pu_bacteria	2935684952	2935692500	258
2484	iso_pu_bacteria	2935703347	2935710093	258
2485	iso_pu_bacteria	2935713505	2935721118	258
2486	iso_pu_bacteria	2935722832	2935730889	258
2487	iso_pu_bacteria	2935732158	2935739807	258
2488	iso_pu_bacteria	2935741537	2935748845	258
2489	iso_pu_bacteria	2935750917	2935758715	258
2490	iso_pu_bacteria	2935883170	2935887486	258
2491	iso_pu_bacteria	2935959822	2935966243	258
2492	iso_pu_bacteria	2937843397	2937843427	258
2493	iso_pu_bacteria	2939669807	2939670337	258
2494	iso_pu_bacteria	2940556831	2940564695	258
2495	iso_pu_bacteria	2941531003	2941534863	258
2496	iso_pu_bacteria	2990710928	2990714400	258
2497	iso_pu_bacteria	3005483717	3005490402	258
2498	iso_pu_bacteria	3005587118	3005591105	258
2499	iso_pu_bacteria	3005710791	3005711685	258
2500	iso_pu_bacteria	3005718088	3005718949	258
2501	iso_pu_bacteria	8001845381	8001850016	258
2502	iso_pu_bacteria	8004727605	8004732189	258
2503	iso_pu_bacteria	8006926726	8006930561	258
2504	iso_pu_bacteria	8016583857	8016587182	258
2505	iso_pu_bacteria	8019648815	8019653290	258
2506	iso_pu_bacteria	8056681323	8056685759	258
2507	iso_pu_bacteria	8056967851	8056970572	258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

22

180

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7z17-assembly1.cif.gz_J	e. coli c-p lyase bound to a phnk abc dimer in an open conformation	0.976	4	256
7z17-assembly1.cif.gz_J	e. coli c-p lyase bound to a phnk abc dimer in an open conformation	0.9721	4	256
7z19-assembly1.cif.gz_I	e. coli c-p lyase bound to a single phnk abc domain	0.9648	4	256
7z19-assembly1.cif.gz_I	e. coli c-p lyase bound to a single phnk abc domain	0.961	4	256
8fee-assembly1.cif.gz_H	structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2)	0.9484	7	254

ID	Description	Score	Start	End	Superfamily
af_P16678_3_252_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9825	4	258	3.40.50.300
af_P16678_3_252_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9786	4	258	3.40.50.300
af_P63386_5_251_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9475	4	256	3.40.50.300
af_P14175_33_289_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.943	17	258	3.40.50.300
af_P33360_1_239_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9402	7	254	3.40.50.300

ID	Description	Score	Start	End	GO Terms
AF-A0A4R5QMD1-F1-model_v4	Phosphonate C-P lyase system protein PhnK	0.9921	4	258	GO:0005524 GO:0016829 GO:0016887 GO:0019700
AF-A0A7Y7SWG7-F1-model_v4	deleted	0.9901	2	258
AF-A0A7Y7SWG7-F1-model_v4	deleted	0.9825	2	258
AF-A0A4R5QMD1-F1-model_v4	Phosphonate C-P lyase system protein PhnK	0.9807	4	258	GO:0005524 GO:0016829 GO:0016887 GO:0019700
AF-A0A499V0W1-F1-model_v4	ABC transporter ATP-binding protein	0.9755	5	254	GO:0005524 GO:0016887 GO:0019700

Feature Viewer

pLDDT	pTM	Quality
94.29	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F496868

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00005

ABC_tran

ABC transporter

22

180

0.86

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map